GenomeNet

Database: RefSeq
Entry: NC_012964
LinkDB: NC_012964
Original site: NC_012964 
LOCUS       NC_012964            2394163 bp    DNA     linear   CON 11-OCT-2017
DEFINITION  Komagataella phaffii GS115 chromosome 2, complete sequence.
ACCESSION   NC_012964
VERSION     NC_012964.1
DBLINK      BioProject: PRJNA39439
            BioSample: SAMEA2272385
            Assembly: GCF_000027005.1
KEYWORDS    RefSeq.
SOURCE      Komagataella phaffii GS115
  ORGANISM  Komagataella phaffii GS115
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
REFERENCE   1
  AUTHORS   De Schutter,K., Lin,Y.C., Tiels,P., Van Hecke,A., Glinka,S.,
            Weber-Lehmann,J., Rouze,P., Van de Peer,Y. and Callewaert,N.
  TITLE     Genome sequence of the recombinant protein production host Pichia
            pastoris
  JOURNAL   Nat. Biotechnol. 27 (6), 561-566 (2009)
   PUBMED   19465926
REFERENCE   2  (bases 1 to 2394163)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2394163)
  AUTHORS   Callewaert,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2009) Callewaert N., Department for Molecular
            Biomedical Research, Flanders Institute for Biotechnology (VIB) /
            Gent University, Technologiepark 927, Ghent, 9052, BELGIUM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FN392320.
            Contact: Nico Callewaert
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent Technologiepark
            927, B-9052 Gent, Belgium
            Tel: (32)93313630
            Fax: (32)93313609
            Email: nico.callewaert@dmbr.vib-UGent.be
            ----------- sequencing/assembly
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent -----------
            annotation
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent
            
            Laboratory for Bioinformatics and Evolutionary Genomics VIB
            Department of Plant Systems Biology, UGent
            Web site: http://bioinformatics.psb.ugent.be/
            Bioinformatics Online Genome Annotation System (BOGAS):
            http://bioinformatics.psb.ugent.be/webtools/bogas/ -----------
            * NOTE: finishing of chromosomes in process
            * Final curation of the annotation in progress.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2394163
                     /organism="Komagataella phaffii GS115"
                     /mol_type="genomic DNA"
                     /strain="GS115"
                     /db_xref="taxon:644223"
                     /chromosome="2"
     gene            complement(<266..>913)
                     /locus_tag="PAS_chr2-1_0002"
                     /db_xref="GeneID:8198301"
     mRNA            complement(<266..>913)
                     /locus_tag="PAS_chr2-1_0002"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490836.1"
                     /db_xref="GeneID:8198301"
     CDS             complement(266..913)
                     /locus_tag="PAS_chr2-1_0002"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490881.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0002"
                     /db_xref="EnsemblGenomes-Tr:CAY68601"
                     /db_xref="GeneID:8198301"
                     /db_xref="UniProtKB/TrEMBL:C4QZC7"
                     /translation="MMASPTAGDHPAGDGPASGAQLGGEAGGATGEVSQVFQVRASAS
                     ASPGGTVLEVEVSREDFQGESQVQEDTSQIQVVNGTAHCRECICGRQATGAEQDRAAC
                     WTQQGGSVGVRRGVVDWWRFASTNQRCCGCLVRLVGGWLVEICVHQPALLRYAWWALT
                     GGDLRPPTSVAALAWWALTGGYLRPPTSVAALAWWALTGGYLRPPTSVAALAWWD"
     gene            <2666..>2827
                     /locus_tag="PAS_chr2-1_0003"
                     /db_xref="GeneID:8198122"
     mRNA            <2666..>2827
                     /locus_tag="PAS_chr2-1_0003"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490837.1"
                     /db_xref="GeneID:8198122"
     CDS             2666..2827
                     /locus_tag="PAS_chr2-1_0003"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490882.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0003"
                     /db_xref="EnsemblGenomes-Tr:CAY68602"
                     /db_xref="GeneID:8198122"
                     /db_xref="UniProtKB/TrEMBL:C4QZC8"
                     /translation="MRRNYVCGDVLTLGQVASSKSNFDEMSSYQRLQGLDLMLARRKT
                     KCCILMHWG"
     gene            <4976..>5725
                     /locus_tag="PAS_chr2-1_0004"
                     /db_xref="GeneID:8198123"
     mRNA            <4976..>5725
                     /locus_tag="PAS_chr2-1_0004"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490838.1"
                     /db_xref="GeneID:8198123"
     CDS             4976..5725
                     /locus_tag="PAS_chr2-1_0004"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490883.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0004"
                     /db_xref="EnsemblGenomes-Tr:CAY68603"
                     /db_xref="GeneID:8198123"
                     /db_xref="UniProtKB/TrEMBL:C4QZC9"
                     /translation="MTAMKQKRSRDILKPYHFDPSIDDTMLCSMLPPTTTADPEQLQE
                     PEHEQQQHNNPFNCCQEVKVKMADQQKLYLLPEKRTNNIFNSKSAMFVYCNIPQMSLV
                     QSFLDLNTSLLATDVTLDRNSFSLDSTIDIPFDQSVQDPYSYRSNSPEVAPQSTACFS
                     VNSNLAPVETFTTLLEAAVNSKRQMLQYRQQIKINGLNFSESTFLDHSCILLVRGRSF
                     GGNCSRPPKTPLIPGTRSVCYCPSKTGEQYK"
     gene            <7508..>8287
                     /locus_tag="PAS_chr2-1_0005"
                     /db_xref="GeneID:8198124"
     mRNA            <7508..>8287
                     /locus_tag="PAS_chr2-1_0005"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490839.1"
                     /db_xref="GeneID:8198124"
     CDS             7508..8287
                     /locus_tag="PAS_chr2-1_0005"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490884.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0005"
                     /db_xref="EnsemblGenomes-Tr:CAY68604"
                     /db_xref="GeneID:8198124"
                     /db_xref="UniProtKB/TrEMBL:C4QZD0"
                     /translation="MKIHSLLLWNLFFIPSILGQNFTLKLSALAPVSSNYVGNTTENY
                     EVAIYNPEVGGLPSQSIGVWFKDGKLLRSTLEQRVWDIYFTPPDSEGRVYVYRASDGQ
                     YYGLLRFLGDRTNEVPYLGQRHQLGVVYGSDDRRYASEPTRFALEEDGQLRLTEYAGS
                     TTNNNTISACYAFSVYSTDEQYVIIAGEITSTLFYHCEPIVLSAVSTNLPSMDAKNPK
                     RLFQRSESPSMTSSQNGGASTSRFSRFLGAAAVLLLNMFFI"
     gene            complement(<9189..>10913)
                     /locus_tag="PAS_chr2-1_0006"
                     /db_xref="GeneID:8198125"
     mRNA            complement(<9189..>10913)
                     /locus_tag="PAS_chr2-1_0006"
                     /product="High-affinity glucose transporter of the major
                     facilitator superfamily, expression is induced by low"
                     /transcript_id="XM_002490840.1"
                     /db_xref="GeneID:8198125"
     CDS             complement(9189..10913)
                     /locus_tag="PAS_chr2-1_0006"
                     /codon_start=1
                     /product="High-affinity glucose transporter of the major
                     facilitator superfamily, expression is induced by low"
                     /protein_id="XP_002490885.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0006"
                     /db_xref="EnsemblGenomes-Tr:CAY68605"
                     /db_xref="GeneID:8198125"
                     /db_xref="GOA:C4QZD1"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4QZD1"
                     /translation="MSFFHKFYNAGDAPPQIFNKTLYLAVFIFGVLGCARGYDEGYIG
                     GIEAKAPFQSQFGLDDLTKSETELANLRSNIAAMVQLGSIGGCLLAMYLVDKFGRIRT
                     LQGVCVGWIVGSVIQITSKNVGQLYAGRLIEGLSIGQTVVIGPCYMSEIAPKNIRGLC
                     TCIFAGSVYLGSMLSNFINYGCALHLPTDSPKQWIVPTAIKIVIAGLLAIGSLLCHES
                     PRWLVKQGLINESGTVLSKIRHLPSTHPYILCEVGDIQEQIDIEDEATQSVSKWHVFK
                     ELIMVKSIRYRMLLALSAQVLSQWSFAGSITVYFPELVALAGVRGTDRLLYSSILGVV
                     KLTSAYLGAFFVIDLLGRKKALYIGITIQMLATLYFAIFLQIIPDAIEDDVQLTGSRK
                     HAGLGALAMLYITGVGWTLGWNSIQYLINAEMLPLRVRNIGTATIMAFHFANQYGNTK
                     ALPSMLISLTPAGTFFFGVGVLALGLLWAFFFLPEIAGRSLESMEDLFNLPWYLIGRR
                     GAELCPDNSGIAHVKEAESGELDIKQNDEFIENASDQSVDDTMTSKQKKGKSLCNQEF
                     IPQIPPCA"
     gene            complement(<11580..>12767)
                     /locus_tag="PAS_chr2-1_0007"
                     /db_xref="GeneID:8198126"
     mRNA            complement(join(<11580..11679,12583..>12767))
                     /locus_tag="PAS_chr2-1_0007"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490841.1"
                     /db_xref="GeneID:8198126"
     CDS             complement(join(11580..11679,12583..12767))
                     /locus_tag="PAS_chr2-1_0007"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490886.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0007"
                     /db_xref="EnsemblGenomes-Tr:CAY68606"
                     /db_xref="GeneID:8198126"
                     /db_xref="UniProtKB/TrEMBL:C4QZD2"
                     /translation="MSAMNSDMPSMKKTDMSSVKKSDMSAMNSDMPSMKKSDMSAMNS
                     DMPSIKKSDMSAMNSVTIGDDLKKSESWSAWTLARSAKAESLKLMRKNLK"
     gene            <13442..>13843
                     /locus_tag="PAS_chr2-1_0008"
                     /db_xref="GeneID:8198127"
     mRNA            <13442..>13843
                     /locus_tag="PAS_chr2-1_0008"
                     /product="Putative protein-methionine-R-oxide reductase"
                     /transcript_id="XM_002490842.1"
                     /db_xref="GeneID:8198127"
     CDS             13442..13843
                     /locus_tag="PAS_chr2-1_0008"
                     /codon_start=1
                     /product="Putative protein-methionine-R-oxide reductase"
                     /protein_id="XP_002490887.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0008"
                     /db_xref="EnsemblGenomes-Tr:CAY68607"
                     /db_xref="GeneID:8198127"
                     /db_xref="GOA:C4QZD3"
                     /db_xref="InterPro:IPR002579"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:C4QZD3"
                     /translation="MTNWKAILTPAQYRVLRLGGTETPHTGQYVNFKESGTYLCGGCQ
                     TPLYKSSTKFDSSCGWPAFYEALPGAVTRIEDNSLGMRGIEIRCSQCDGHLGHVFEGE
                     GYDTPTDSRHCVNSISLKFQGEGEDEENTTK"
     gene            complement(<14152..>15947)
                     /locus_tag="PAS_chr2-1_0009"
                     /db_xref="GeneID:8198128"
     mRNA            complement(join(<14152..14390,14621..>15947))
                     /locus_tag="PAS_chr2-1_0009"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490843.1"
                     /db_xref="GeneID:8198128"
     CDS             complement(join(14152..14390,14621..15947))
                     /locus_tag="PAS_chr2-1_0009"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490888.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0009"
                     /db_xref="EnsemblGenomes-Tr:CAY68608"
                     /db_xref="GeneID:8198128"
                     /db_xref="UniProtKB/TrEMBL:C4QZD4"
                     /translation="MLTAGSVQRLQISMFQTQEQEQVDLSSSIHTENIFNSESSGPAY
                     PNIPQISSVHSFIGAKSSLLADAAPNQCLSFVDSAKVTSFDQSFHGSPSYKLNSAKLA
                     VSSSEYLSVESSTEVDSTISLEAQVDRKRQKIQPERHSKTDNLNLFSDFDLLAPAFLT
                     YYLPLFRGCSSGGNNKPPKKRSITGTQYVAASLRLESSTIEDICLPKWNENELKDNRR
                     IIRIERRQQGNEIAASFSIVGSALENPHTKPTLDPDVEVLEVSCLRCLVNYDEIDDKQ
                     TVHGSLLHEVQSEFTEIRKQESTGKRSSYACTSNGTSIECQYYVTSVEVIKIIELLVG
                     SHLIQDRKQRRKERGCIRSNLMPFWSKHLISSTTNTMKRRSVTASNENYIAELAHRIK
                     TYEVRRPRKVNKDLRILEWSKLGPALRRALHSYYVAVPIDKFKNIAKPTNTSLGTIKM
                     AIAGRSEVLETVFIARQSPVEPDACSSIANVRRELCDACTGTQANIVTEKILLTTIAA
                     DAGSTIVVPVCVP"
     gene            <16001..>16264
                     /locus_tag="PAS_chr2-1_0010"
                     /db_xref="GeneID:8198129"
     mRNA            <16001..>16264
                     /locus_tag="PAS_chr2-1_0010"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490844.1"
                     /db_xref="GeneID:8198129"
     CDS             16001..16264
                     /locus_tag="PAS_chr2-1_0010"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490889.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0010"
                     /db_xref="EnsemblGenomes-Tr:CAY68609"
                     /db_xref="GeneID:8198129"
                     /db_xref="UniProtKB/TrEMBL:C4QZD5"
                     /translation="MLDAESCRIRNCIANSWRNWSSVVEVATFAFELIPTRRYILSRL
                     IQLDVLIYYVFSVTQYAFKSQPPCFQHEAEPFAICPPPLSALK"
     gene            complement(<19388..>21388)
                     /locus_tag="PAS_chr2-1_0011"
                     /db_xref="GeneID:8198130"
     mRNA            complement(<19388..>21388)
                     /locus_tag="PAS_chr2-1_0011"
                     /product="ATPase of the ATP-binding cassette (ABC) family
                     involved in 40S and 60S ribosome biogenesis, has sim"
                     /transcript_id="XM_002490845.1"
                     /db_xref="GeneID:8198130"
     CDS             complement(19388..21388)
                     /locus_tag="PAS_chr2-1_0011"
                     /codon_start=1
                     /product="ATPase of the ATP-binding cassette (ABC) family
                     involved in 40S and 60S ribosome biogenesis, has sim"
                     /protein_id="XP_002490890.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0011"
                     /db_xref="EnsemblGenomes-Tr:CAY68610"
                     /db_xref="GeneID:8198130"
                     /db_xref="GOA:C4QZD6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZD6"
                     /translation="MNTETLSRTELIVQGGHNVIIYNEAKKLKAEVILNNAQGVGKHY
                     KDLDVSMDGADLSYVRSLGPESQTLHVDVCLDKHGEPVKLVICKNASPFVNVEKVSQE
                     NLPEKELEKQLLKSSLSPLHGYGIYYRDFVSSSGTIGISVCNLDLSFEKKCLFAGLDF
                     SLSLGDKVTIVGDNGSGKTTFLKLISGIEEYTYSGSVVIEGRIAYLPQHFEDVSGDDL
                     AIVTLLRSLYDPDIDEFLTKPHKPFASEWLQELNTLGGHETFKQANHIGLSTDLLKMP
                     FKFLSGGEKTKVMLCALSILEPDIILLDEPTNCLDWRGIEWLESFLKNFDGGVVMVTH
                     DRSLINAVSNRISELSPHTKKFTHFKGQYKHYVEEEDKRWQRQIEERKHQEKELKKLT
                     LKANQAKGKVKSRIVRSGTDRDKLSYNNKEQRAQKGVNRAFAQLSDKVEQLTDDLVDV
                     IPERRHISFDFEDSPAFSASILNIEVSKVSKSFESPLFENISFTLSKGDRLIIQGPNG
                     SGKSTLMKIIMSLIKPDEGSVTISGNAKIGYLDQEQESLPLDKSPISLLKKDSSINAT
                     DANAITNLRNFGIYTWHDLKNSLRTLSIGCRRKAQLCQLILRGSSILLLDEPSNHIDF
                     PSLEFIEDALLTFPGIIIAATHDRYFTEKVGTRILDLADYKA"
     gene            complement(<22768..>24690)
                     /locus_tag="PAS_chr2-1_0012"
                     /db_xref="GeneID:8198131"
     mRNA            complement(<22768..>24690)
                     /locus_tag="PAS_chr2-1_0012"
                     /product="Ferrioxamine B transporter, member of the ARN
                     family of transporters that specifically recognize sid"
                     /transcript_id="XM_002490846.1"
                     /db_xref="GeneID:8198131"
     CDS             complement(22768..24690)
                     /locus_tag="PAS_chr2-1_0012"
                     /codon_start=1
                     /product="Ferrioxamine B transporter, member of the ARN
                     family of transporters that specifically recognize sid"
                     /protein_id="XP_002490891.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0012"
                     /db_xref="EnsemblGenomes-Tr:CAY68611"
                     /db_xref="GeneID:8198131"
                     /db_xref="GOA:C4QZD7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4QZD7"
                     /translation="MKFNIFNKNRKESPSSSPESQTTDEEAHIPVLPGVARAEMLRHA
                     WSKKSLIVAYAALFFAAFVFQFCGVTVKSYTPYATSSFRQHSMLTTAAVVYKIVCVIT
                     LPFVARIADCFSRVSGFFIALIFLIATYIMFAASKNVGMYLASEIFLGIGKVSYVMME
                     KVFVADTTQILNRGLWTALPTAVASIPTLYISSIVAEKVLDHSTWRWGYGMWAIITPV
                     SLAPLIFIMWRLDRKAQKYGITHNIKASLNLPEGSWYKKLAHLLYVELDIVGGLLMLA
                     GLSLFFLPFTLTGSASILDWDEATTIVLLVLGFVVLGIFVFWVLSKFPQRPFISVSIL
                     KNPSVLMACTLPLFDTINSSTSGAYYSSVLQVSGHFTVGEAARITRASRVCQLVGSVL
                     VGILIKYTRTAKIFMISGISLIVITQGFFCYLSDHNGQFGSELHWTVIQVFEGFGRGF
                     YNIPTIISVQANSDPSQIAPSIAMFTMFSQMGAVIGNSIAASVWNELVIKRLTQYLPE
                     GSKSSATSIFGSIKVALGYKQGTPEREAIDRAYREVLQKQGYISLGFLLPALIIVFFI
                     KGFDPTQRTSVNVDDNGEVVLRTATGKNGEGPQFHTISSNLSSSSSASDLSEEKDGTS
                     AASKEKNSLSTEPERK"
     gene            complement(<25107..>25298)
                     /locus_tag="PAS_chr2-1_0013"
                     /db_xref="GeneID:8198132"
     mRNA            complement(<25107..>25298)
                     /locus_tag="PAS_chr2-1_0013"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490847.1"
                     /db_xref="GeneID:8198132"
     CDS             complement(25107..25298)
                     /locus_tag="PAS_chr2-1_0013"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490892.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0013"
                     /db_xref="EnsemblGenomes-Tr:CAY68612"
                     /db_xref="GeneID:8198132"
                     /db_xref="UniProtKB/TrEMBL:C4QZD8"
                     /translation="MLFHLLLSKNLKIRSDRSSWHSREPLIPLLDCKVTGTGQKYPYM
                     YKTLFKFTEGHMAYSGLSY"
     gene            complement(<28006..>29259)
                     /locus_tag="PAS_chr2-1_0014"
                     /db_xref="GeneID:8198133"
     mRNA            complement(<28006..>29259)
                     /locus_tag="PAS_chr2-1_0014"
                     /product="Fe(II)-dependent sulfonate/alpha-ketoglutarate
                     dioxygenase, involved in sulfonate catabolism for use"
                     /transcript_id="XM_002490848.1"
                     /db_xref="GeneID:8198133"
     CDS             complement(28006..29259)
                     /locus_tag="PAS_chr2-1_0014"
                     /codon_start=1
                     /product="Fe(II)-dependent sulfonate/alpha-ketoglutarate
                     dioxygenase, involved in sulfonate catabolism for use"
                     /protein_id="XP_002490893.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0014"
                     /db_xref="EnsemblGenomes-Tr:CAY68613"
                     /db_xref="GeneID:8198133"
                     /db_xref="GOA:C4QZD9"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:C4QZD9"
                     /translation="MSASIKPSPVEDKGKAVKYEKNIWRFDDAIHFSPSSDIVREDGV
                     LTVSKKAQETSNYPQWLPTWDPKLSFEDEPPFSHVDRGFFADPGLKRLFPEGGAHKIS
                     NITPKLGSKVEGVQLSQLTPDQKDDLALFVAQRGVVVFRDQDLRDKDLGEVKKFGQHF
                     GPLHIHQTSGAPEGYPEFHITFKRAGPPNTFRNKISAPGWHSDVTYELQPAGITFFGL
                     IEGPEAGGDTLFADAIEAYERLSPSFQKFLDGLRLIHSARAQAEDSLKKGSIQRKKFT
                     SETVHPLIRYHPVLNKRSIFAKAFGTKIVGLKQEESDLILNFIQRFIATALDLQLRAS
                     YEPGTVVAWDNRRVFHSAVNDFGEDDPARHCFRITPLAERPVGSKEEYESWSPNGRER
                     TVEEWEDLYKDGIPNLKEIFLGNLD"
     gene            complement(<30119..>30256)
                     /locus_tag="PAS_chr2-1_0015"
                     /db_xref="GeneID:8198134"
     mRNA            complement(<30119..>30256)
                     /locus_tag="PAS_chr2-1_0015"
                     /product="Putative protein of unknown function identified
                     by fungal homology comparisons and RT-PCR"
                     /transcript_id="XM_002490849.1"
                     /db_xref="GeneID:8198134"
     CDS             complement(30119..30256)
                     /locus_tag="PAS_chr2-1_0015"
                     /codon_start=1
                     /product="Putative protein of unknown function identified
                     by fungal homology comparisons and RT-PCR"
                     /protein_id="XP_002490894.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0015"
                     /db_xref="EnsemblGenomes-Tr:CAY68614"
                     /db_xref="GeneID:8198134"
                     /db_xref="UniProtKB/TrEMBL:C4QZE0"
                     /translation="MKVSSPNAKKEIAAPEFRVWSPTTLLGQALSSLTTVDRTGNGAF
                     C"
     gene            <32010..>32696
                     /locus_tag="PAS_chr2-1_0016"
                     /db_xref="GeneID:8198135"
     mRNA            <32010..>32696
                     /locus_tag="PAS_chr2-1_0016"
                     /product="2-deoxyglucose-6-phosphate phosphatase, similar
                     to Dog2p, member of a family of low molecular weight"
                     /transcript_id="XM_002490850.1"
                     /db_xref="GeneID:8198135"
     CDS             32010..32696
                     /locus_tag="PAS_chr2-1_0016"
                     /codon_start=1
                     /product="2-deoxyglucose-6-phosphate phosphatase, similar
                     to Dog2p, member of a family of low molecular weight"
                     /protein_id="XP_002490895.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0016"
                     /db_xref="EnsemblGenomes-Tr:CAY68615"
                     /db_xref="GeneID:8198135"
                     /db_xref="GOA:C4QZE1"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4QZE1"
                     /translation="MVSIPCDLCLFDLDGTLVLSTKAIEKGWESVFSEYNVNYNMEEF
                     LQNNHGVRTGDSFDRWLPQIDNTNSKAGDEFEKRISIEYADLAEPVPGAPQLLNSIPK
                     DHWLVVTSGTPLLANGWFSKVLAKFGVTKPEIFVTGQSVSNGKPHPEPYLKGLALWTE
                     KYGKKPAHPIVFEDAPNGIKAGTASGCTVIGIASSFGKEVLQAAGATYVVQDLSHVKF
                     HDNTLDIDNL"
     gene            complement(<32786..>34195)
                     /locus_tag="PAS_chr2-1_0017"
                     /db_xref="GeneID:8198136"
     mRNA            complement(<32786..>34195)
                     /locus_tag="PAS_chr2-1_0017"
                     /product="Heme-dependent repressor of hypoxic genes"
                     /transcript_id="XM_002490851.1"
                     /db_xref="GeneID:8198136"
     CDS             complement(32786..34195)
                     /locus_tag="PAS_chr2-1_0017"
                     /codon_start=1
                     /product="Heme-dependent repressor of hypoxic genes"
                     /protein_id="XP_002490896.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0017"
                     /db_xref="EnsemblGenomes-Tr:CAY68616"
                     /db_xref="GeneID:8198136"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:C4QZE2"
                     /translation="MNEKDKVSNSLPPLSHLMPMNSMGMKNEITSENGSSVGTTNGMV
                     PTAKHSSSASTPLTSVHNNNDESNNGNIGSHANSFNNANGKASGSPNFHTVSANYPPE
                     EPKYYYSTESQVASQVASQLMAVPQMPGQLYPQGMSTQFVYPQMVPAPPPPPQPPQID
                     QNKLYEKCSCKNSTNRIPRPRNAFILFRQKNHQALLEEGNVIRTNPEVSRELGRRWRN
                     LSPEEKSYWNKSAEEEKRRHAERYPGYKYTPRRSSKKNCPSCKAKQAMKTHSLNVQSY
                     YAQYPSASTAVPVPMSNSQKNMNNHTAQMQQYQQMHIQSSPPMQTQYQQVNTMQHGMI
                     PQYQQIPSTQGHQFIQPQQHPQPQIHPQFDGSQFPQTYMVAMPKGNSNEAALAQQLPV
                     VEQPTLFSNDRTGRSGTLRKLVATPLPGMNGSTNPQSIVSNTVVPDSYHQTQLVASGQ
                     KALPSINNLKNPISYSEVQ"
     gene            complement(<35927..>36112)
                     /locus_tag="PAS_chr2-1_0018"
                     /db_xref="GeneID:8198137"
     mRNA            complement(<35927..>36112)
                     /locus_tag="PAS_chr2-1_0018"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490852.1"
                     /db_xref="GeneID:8198137"
     CDS             complement(35927..36112)
                     /locus_tag="PAS_chr2-1_0018"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490897.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0018"
                     /db_xref="EnsemblGenomes-Tr:CAY68617"
                     /db_xref="GeneID:8198137"
                     /db_xref="UniProtKB/TrEMBL:C4QZE3"
                     /translation="MASRLFKHKALQLTIASRDSSLLAEAILESILKKSTMSAVTFSE
                     FEPDQVSTGVGYLFIFR"
     gene            complement(<37204..>37398)
                     /locus_tag="PAS_chr2-1_0019"
                     /db_xref="GeneID:8198138"
     mRNA            complement(<37204..>37398)
                     /locus_tag="PAS_chr2-1_0019"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490853.1"
                     /db_xref="GeneID:8198138"
     CDS             complement(37204..37398)
                     /locus_tag="PAS_chr2-1_0019"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490898.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0019"
                     /db_xref="EnsemblGenomes-Tr:CAY68618"
                     /db_xref="GeneID:8198138"
                     /db_xref="UniProtKB/TrEMBL:C4QZE4"
                     /translation="MSCCCINNLALEDVVVALKICPVISAFLGRHPHPRNSAFYRLLK
                     EKFKVQVVAQLLGVAHSFEY"
     gene            complement(<37498..>38027)
                     /locus_tag="PAS_chr2-1_0020"
                     /db_xref="GeneID:8198139"
     mRNA            complement(join(<37498..37643,37946..>38027))
                     /locus_tag="PAS_chr2-1_0020"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490854.1"
                     /db_xref="GeneID:8198139"
     CDS             complement(join(37498..37643,37946..38027))
                     /locus_tag="PAS_chr2-1_0020"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490899.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0020"
                     /db_xref="EnsemblGenomes-Tr:CAY68619"
                     /db_xref="GeneID:8198139"
                     /db_xref="UniProtKB/TrEMBL:C4QZE5"
                     /translation="MRAKAGEFWKVKAEACDLSKLIVALQKARSIFASYCWLPNISGI
                     ARSRFVVGRSIHWEYQPKYRKVMSMNVEATI"
     gene            complement(<38470..>39639)
                     /locus_tag="PAS_chr2-1_0021"
                     /db_xref="GeneID:8198140"
     mRNA            complement(join(<38470..39155,39579..>39639))
                     /locus_tag="PAS_chr2-1_0021"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490855.1"
                     /db_xref="GeneID:8198140"
     CDS             complement(join(38470..39155,39579..39639))
                     /locus_tag="PAS_chr2-1_0021"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490900.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0021"
                     /db_xref="EnsemblGenomes-Tr:CAY68620"
                     /db_xref="GeneID:8198140"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:C4QZE6"
                     /translation="MWDDKLGCFFKLNARSSAPSADGQVDYNHSSDKEYVRLRGLADQ
                     AHKRRTELSKQSQEAYQSGDGERAHQLSVKAKEYLAQADQYNRQAAEYVFVENNADSE
                     DHEIDLHGLYVREAEYIVKQRISAAVQRGEKRLSIIVGKGNHSTDGVAKLKPAVEKLC
                     EEAGLHHEVSKKNAGVIEVDLSEPSRIPASWGQQSSEPQYAQSHAIPTGVYNQQQQQS
                     APQQQSASSGSSIDWKLVVRVVKSIIRCFK"
     gene            <40239..>41054
                     /locus_tag="PAS_chr2-1_0022"
                     /db_xref="GeneID:8198141"
     mRNA            join(<40239..40343,40425..>41054)
                     /locus_tag="PAS_chr2-1_0022"
                     /product="60S ribosomal protein L7"
                     /transcript_id="XM_002490856.1"
                     /db_xref="GeneID:8198141"
     CDS             join(40239..40343,40425..41054)
                     /locus_tag="PAS_chr2-1_0022"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="XP_002490901.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0022"
                     /db_xref="EnsemblGenomes-Tr:CAY68621"
                     /db_xref="GeneID:8198141"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:C4QZE7"
                     /translation="MPQKTTSKYLLMIPIFNRLAFGQCCRFVNHLSGLKLDEEKKAII
                     SERTAKYYEEYEEAARVLEKAKSDAAASGSYFVEAEPNLVLVVRIKGINKIAPKPRKV
                     LQLLRLLQINAAVFVRITKATAELLRLVEPYVAYGYPSLETVRELIYKRGYGKLNKQR
                     VPLTDNDIIEKVLGQYGIISIEDLIHEIYTVGPNFKQANNFLYPFRLSNPDGGWGVRR
                     KFFHYIQGGATGNREEHINSLVKKMN"
     gene            complement(<41115..>41558)
                     /locus_tag="PAS_chr2-1_0023"
                     /db_xref="GeneID:8198142"
     mRNA            complement(<41115..>41558)
                     /locus_tag="PAS_chr2-1_0023"
                     /product="Protein of unknown function that may interact
                     with ribosomes, based on co-purification experiments"
                     /transcript_id="XM_002490857.1"
                     /db_xref="GeneID:8198142"
     CDS             complement(41115..41558)
                     /locus_tag="PAS_chr2-1_0023"
                     /codon_start=1
                     /product="Protein of unknown function that may interact
                     with ribosomes, based on co-purification experiments"
                     /protein_id="XP_002490902.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0023"
                     /db_xref="EnsemblGenomes-Tr:CAY68622"
                     /db_xref="GeneID:8198142"
                     /db_xref="InterPro:IPR008476"
                     /db_xref="InterPro:IPR021148"
                     /db_xref="InterPro:IPR023139"
                     /db_xref="UniProtKB/TrEMBL:C4QZE8"
                     /translation="MSLSTFNAEEAENLDDIEKQFAVKAVTQAETYWNLLTKIPGTKL
                     KLTPYDDEIFEALLKDFPEFENPEYASKINEDEMKSLSGKERWRKFMKPFEEKIDDFN
                     FGTLLRTDSSKEYDQEGTIFVVRLQFYAIEIARNKYGLNDWISQK"
     gene            <42106..>42966
                     /locus_tag="PAS_chr2-1_0024"
                     /db_xref="GeneID:8198143"
     mRNA            <42106..>42966
                     /locus_tag="PAS_chr2-1_0024"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002490858.1"
                     /db_xref="GeneID:8198143"
     CDS             42106..42966
                     /locus_tag="PAS_chr2-1_0024"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002490903.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0024"
                     /db_xref="EnsemblGenomes-Tr:CAY68623"
                     /db_xref="GeneID:8198143"
                     /db_xref="GOA:C4QZE9"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="UniProtKB/TrEMBL:C4QZE9"
                     /translation="MLNSLRRMSIKSAGCIIIGDEVLNSKITDTNSRFFAKYCYDLGV
                     DLRKISIISDEEDEIIATVKEFDSKFDFIVTSGGIGPTHDDITYSSIAKAYGLSLKHD
                     QFAYDKCLEKIGDKIKFNTFTQEQIDANLRMFLLPYDPNDSNFVKTYYANDLWVPIVN
                     INNKLNILPGIPRLFQELLTDGITPHVKPFVPKTKFLQYYVAARLPESQVAPLLGRLQ
                     KEVIEKGLSIKIGSYPHVEKRINTVCITGKEEENEVMRQLVATTIEELGGEEISKEEE
                     EGHSHSHIKE"
     gene            complement(<42994..>44400)
                     /locus_tag="PAS_chr2-1_0806"
                     /db_xref="GeneID:8198144"
     mRNA            complement(<42994..>44400)
                     /locus_tag="PAS_chr2-1_0806"
                     /product="hypothetical protein"
                     /transcript_id="XM_002490859.1"
                     /db_xref="GeneID:8198144"
     CDS             complement(42994..44400)
                     /locus_tag="PAS_chr2-1_0806"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002490904.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0806"
                     /db_xref="EnsemblGenomes-Tr:CAY68624"
                     /db_xref="GeneID:8198144"
                     /db_xref="GOA:C4QZF0"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:C4QZF0"
                     /translation="MRPRVIDQTLLRRNLIRSQGISASNINQMYTRWFHHDILLNHNH
                     SHNQTQNQTHTDQLGKEKQPSQGEPDEILPPLKRNKSVFSHVKDFFNPHLPISHLQGP
                     NSGSHSQTHTESSFSSLTHSHSHGHVEADRAMLSKEGKRITWIGLGVNSSMAVGKFLG
                     GIYFHSQALLADAVHAVGDLISDVLTLLTVSFSNQVPNKLYPYGFGKVETLGSMLVSS
                     ILLYAGVSIGWSSLIEIIGPALPHSIVDTLSSLTHSHSHSHAVSAAVTDEQGTQVTEV
                     ADINAAWLALGSVFVKEWLFKATKRVGEKLDSQVLIANAWHHRVDSLTSIVALVTISG
                     GYFLNIYWLDPVGGLLVSMLVIKVGLAGTFQAFKELIDKAVSPTDPRYVNIENSINVS
                     LMKHQPELLIKKLDVLPSGTNVVANVSLGVGPSHSSYENVLTLGQVASLSEKLEADLN
                     TQHANLKKVLVTFENAKK"
     gene            complement(<44617..>49095)
                     /locus_tag="PAS_chr2-1_0025"
                     /db_xref="GeneID:8198082"
     mRNA            complement(<44617..>49095)
                     /locus_tag="PAS_chr2-1_0025"
                     /product="Non-essential protein of unknown function,
                     contains ATP/GTP-binding site motif A"
                     /transcript_id="XM_002490860.1"
                     /db_xref="GeneID:8198082"
     CDS             complement(44617..49095)
                     /locus_tag="PAS_chr2-1_0025"
                     /codon_start=1
                     /product="Non-essential protein of unknown function,
                     contains ATP/GTP-binding site motif A"
                     /protein_id="XP_002490905.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0025"
                     /db_xref="EnsemblGenomes-Tr:CAY68625"
                     /db_xref="GeneID:8198082"
                     /db_xref="GOA:C4QZF1"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013637"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C4QZF1"
                     /translation="MDIENSQTSKVDPGSSPSSFSKQNAAPNADSDDISQTNTSRSSK
                     LHEQEPPLSNGSELGSPPLSSGPTTFYTHSTTAPPKTTRFYKTLADGYRVSDSNSTHH
                     YNPYLYPQHRTRANPPLESINMKGRSTHSSTNPLYPPIPTFTISSQEMENPYKFIESI
                     RAEGEKYGAVRVILENWEHKLNINTELFWFRARRQLLNSHKSEVEARMEFHQSLASFL
                     RENKITISKLPSIDKRSLDLYRLRVCVKLRGGYDTVCQKKLWAQIGRELGYSGKITSS
                     LSSSLKSAYHKVLYGYDLHIAKLEEEQKNVDYKKDKETSPPPVNGSVQNGSSGSRKHE
                     TASTDDPPTKKLKTDESSEDIPIIIGSAIEYKRSRDKLQKLGFPTYFDMMTDNRSGIT
                     FDDEQTLATYDFYNWHKGMNVDDVSAYDSKLSPLYNLRQFFDKNLKFQELLFERFKVA
                     FNPTPNDLEKLYWTVVKDKDSSYEVECSVRIPTSVHESGFNKNEKLQNHVKENTNQNG
                     SPPDTHGLWNLNNFFENQSSVLRYLPQFNSISKPTLSIGMMFGTQNWVAEDHYLYLCD
                     YHHIGDTKVWYFIPPKDHLKYEALLKEHLKNNTPSETQPDFQIYQKDFKNSDFVQCTL
                     ENKIPTSRNHRRFSHKNAAFQPLLKDQDEKVLYSQDFFLTPEFLKEKGVDVYSCYQEP
                     GEFIFKFPKAYSSTVFLGFSTSESVNFAPPSWLSKGLEAEKWLQEQNVYPLFSMFQLL
                     LSIAKECTDPTILKESLDMYKPLLNKVLKERKEVRQHFPKTNEFINKNASSYITDALE
                     NSFPSKIVIIHNNTEISLPLEKALERKDYINALLKQNAVLELHLFEPDESLIQAMGLF
                     ATYNQTPLEWYEKLEDKLTASSQPNISILQELYLEGKKVLAIHNNIPEKAKKGFESLE
                     SFVLDANDWLDQVRGFLKVSDPISESKDLLVDKHQLTSHSLEEFTLLLARIPNLRFEA
                     KEIDELLQYGKLVEEFEIQFRKLLLDQEQKVSISVIDSLVKKGKQFSVNLPSVDCLEK
                     LIRRKKWYLAAENVSVHTSLSDLQHLVQEGEQILDEHDRALKLEPLTKYFKGSQLYNK
                     ELEEFIKLKPIGGYDVDKLKELYDRKDRFSVQSEDLRKFITEKNERKQILDEWLQAVQ
                     PKIDQLKNLRKQKQSAEQKLANNIELSEKEKKLLESYKVTGKQNIFLKEFEFGPKIFE
                     GKEIIEKASGLNVNVAFFKEQVKKTQEWASQVQNVLKINKEQLKHRFKQWRNLYLNMY
                     NLDDGQSELFCFCREADSGVMVECDECKEWFHLKCLKMNDNKPGNNEIFVCPFCDLDQ
                     SRKSTEEFFLAVEKKPKFEQIRQLDTVSESLIFYPEGFGHFKLLMLEVYKFLQIANRE
                     LLLGVEKPRARFLIRKFVSGPFVMEREWEAFGDLIGKRTKEGSKGSVVKQSTLDKSTV
                     AGNAGKVLENGAMPDAGSTENTEEGQGSNGTGSTKIKVESQNDSFESPIKVENEQS"
     gene            <49531..>51141
                     /locus_tag="PAS_chr2-1_0026"
                     /db_xref="GeneID:8198145"
     mRNA            <49531..>51141
                     /locus_tag="PAS_chr2-1_0026"
                     /product="Trimeric heat shock transcription factor,
                     activates multiple genes in response to stresses that
                     incl"
                     /transcript_id="XM_002490861.1"
                     /db_xref="GeneID:8198145"
     CDS             49531..51141
                     /locus_tag="PAS_chr2-1_0026"
                     /codon_start=1
                     /product="Trimeric heat shock transcription factor,
                     activates multiple genes in response to stresses that
                     incl"
                     /protein_id="XP_002490906.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0026"
                     /db_xref="EnsemblGenomes-Tr:CAY68626"
                     /db_xref="GeneID:8198145"
                     /db_xref="GOA:C4QZF2"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C4QZF2"
                     /translation="MSDFPKVEQASPSEGMPQVQTNNAPEIEEIEDIIRDTPNVMDVL
                     GNGSQSWDGTNSNGAAMGSLDTVPANKLVAYNKYDNNIYPDPLQPLSDTALPNSMGYY
                     SMIKAGDKGLKPQSFRKTKKKPTPSGPKTRPAFVMKLWNMVHDPSNQAFIRWLPDGKS
                     FQVTNREDFLKHVLPKYFKHNNFASFVRQLNMYGWHKVQDVGNGSLTANEELWQFENP
                     NFIRDREDLLDQIVRNKSKPGEDDENIDFGLVLNELETIKMNQMAISEDLRRIRQDNE
                     TLWQEHYLARERHKTQAETLEKMMRFLASVYGNNSKLLSEPTNDEFQKSSGAPQRHDT
                     SNISKPTNAASKKLLMLTDHAHKPSTNGSSSTSGAATGDVTPTVLPSHNSSVASQHPF
                     IQEIVNRSNQNLAPINSMPSPGTFFPELNEQLNESASQKVKNHSSMMQNVEDNINQQG
                     ESIKQIHEWINKLAPTSSTTNSKKTDSDAIADDDFDVNDFFLPHTPVDEPGATSIPII
                     EELTPTDSLKRENGAGEGDNSASKRAKK"
     gene            <51223..>52572
                     /locus_tag="PAS_chr2-1_0027"
                     /db_xref="GeneID:8198146"
     mRNA            <51223..>52572
                     /locus_tag="PAS_chr2-1_0027"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002490862.1"
                     /db_xref="GeneID:8198146"
     CDS             51223..52572
                     /locus_tag="PAS_chr2-1_0027"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002490907.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0027"
                     /db_xref="EnsemblGenomes-Tr:CAY68627"
                     /db_xref="GeneID:8198146"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:C4QZF3"
                     /translation="MLLGVRAILPQAPIRILLLLLHPQMTQFSTKTIQWQDDLYHDHH
                     VNKILIQNSNGPCFLIALVNSLILASELTLNGWTNVGSKAIEASHVKAEHLVPLKELL
                     TKNVVQLDELLNEITNLVIQVADSDFDLSPLLESLPRLHTGLNVNPNFLLPRITSKQD
                     GNSKVLDILELFNLELYHGWLIDERTPGYELLSRLGDYDSLQSYILEIKNAIRDSALV
                     DNYEYEDLSLEQLDHLLDKSDDARLKQFLNEYQDIQNFLRSNRTELSETGLSRLMFDS
                     QNTIKRSSFAIFFRNEHFNTVYKNQSDSLFTLLIDEGYSKSKTYVWQTLSSVDGSNDK
                     LLDGNFEFTIEQIQPLSQEPISIDATDFIINEEEIETANDDEALAKKLQKQEDENAAR
                     AIQKKYDKQAKTKTKSKTKSTIKSQPGSSADSNNKRDNSTAAGVKNNTEDKGKCIVM"
     gene            complement(<52576..>54954)
                     /locus_tag="PAS_chr2-1_0028"
                     /db_xref="GeneID:8198147"
     mRNA            complement(<52576..>54954)
                     /locus_tag="PAS_chr2-1_0028"
                     /product="Putative kinase, suppressor of GTPase mutant,
                     similar to bovine rhodopsin kinase"
                     /transcript_id="XM_002490863.1"
                     /db_xref="GeneID:8198147"
     CDS             complement(52576..54954)
                     /locus_tag="PAS_chr2-1_0028"
                     /codon_start=1
                     /product="Putative kinase, suppressor of GTPase mutant,
                     similar to bovine rhodopsin kinase"
                     /protein_id="XP_002490908.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0028"
                     /db_xref="EnsemblGenomes-Tr:CAY68628"
                     /db_xref="GeneID:8198147"
                     /db_xref="GOA:C4QZF4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4QZF4"
                     /translation="MFKVFKASGIEGNHQLSNNPTFINGPWSVYAAKNKSTKKKCSVF
                     IFNKKQFESNLSRSGLLNNRNKQQILNDCFNVLQQYVANLMKFKHPNILNVLEPMEDH
                     KSKCLFVTEYVISDLEAFTKERLDDTPVEEIIVTKGLLQISNAVKFLHENQNLCHLNI
                     QPNTILITENFDWKLSGFSFIQPCDSSKDFFLDTFDQRMPMFTNVSFRFSSPNLILNH
                     KLDYSNDLFSLGLLIHYLFSAKSLLHTDNTFQDYETEIKRLNHLLKSSSALNNPEFRH
                     IPQNHKHLMILLLNQQSTSDNAIELEDSVTIDTVISDQIFQSELIKILNFVDELQAAT
                     VEEKCIFLTTLKAHLHQFPKTLLLNKFVPLLTSTLLSPYLSTSMSKKNQTPKVQLSAE
                     EERLIVLSLENLFLASSQISQLSFSENVFPYLEQVLALNLASANVALAKGIPLVESKL
                     GLPSQSSYKDSYTKFQVSLFHNSMDTSEIEPQEAVLSTLIDFIKYQPYHTISQKFLPM
                     ISEQFAKTTSFKVKNLTIHAFITLITFEPNPLDDFVIVEKILPIVQATSVKNFNNVSI
                     LSNVINLYHVMFVKLSETLTSFGSEKMDLGVIMERVLFELWKLLRYVPDKKEAANLKS
                     ILDQIQAFVFSKAISSLPEEIPKKAQPNQRIQDDTEFGDFDSNVVDSKQRHGLAQQDG
                     LRSSTQNKNLTLENIHSNFVPVTPPTSTILNPKTPLVLRPDRPNPNGTLEIRNTVSNS
                     PIPASTPQIDWSASRNATLEPEAQKLPPGFSAGIIQPNRVKPKPKIDDQRLI"
     gene            complement(<55127..>57685)
                     /locus_tag="PAS_chr2-1_0029"
                     /db_xref="GeneID:8198148"
     mRNA            complement(<55127..>57685)
                     /locus_tag="PAS_chr2-1_0029"
                     /product="Zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type, involved in
                     the"
                     /transcript_id="XM_002490864.1"
                     /db_xref="GeneID:8198148"
     CDS             complement(55127..57685)
                     /locus_tag="PAS_chr2-1_0029"
                     /codon_start=1
                     /product="Zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type, involved in
                     the"
                     /protein_id="XP_002490909.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0029"
                     /db_xref="EnsemblGenomes-Tr:CAY68629"
                     /db_xref="GeneID:8198148"
                     /db_xref="GOA:C4QZF5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C4QZF5"
                     /translation="MPPKREKTFTGCWTCRSRKVKCTLERPECDRCIKGGYHCTGYDI
                     KLRWSQPVQFDKFGSQLSQTNIEPNDDETMRRRNIEPVRYNAKQAYKDYDQLDTDIDG
                     LHSYRLETEKDRDSTVIKGMFGVFRQQKRKREKDVSFSPEKLPFGSPSMFDPLSGFTQ
                     GNEWVSNELIDDALLTASAINGDTHFLDIFRADTLNPLVNTNSSSTPFYGYNADVQKI
                     YPNPSRRDKDLSQYAPDEMFNVLFHRKEEEEPHGVHVGSDGVLIGDSNGSPLVRSSTM
                     SASASQPISGAQQDLPPAKKMKFSIDSIQLDAPDGTSKMPGNIMEARTVPGLPQTLAI
                     EKSGLPTTALQVNPMTRYLLNYYIEDVADMMTVIPLPKNPWKFIYFPRAIMAVGEIGS
                     LGKTSYARSCLLNALLAVSAFNLQSRFPKNSNEMKYYVNLGIQLRQQASVFLKHCLME
                     DVLTQKYKDVLVAVLSMVTIDVVWGTMSDCKTHLNICEKIIEKKMTVKKKLSAKALIL
                     HRIYSSMKLIQDSTNLEIVSKDEIFLNESNYKQFITSSRVDSAESNQGSRIDKLFRKS
                     PSSLLSDSSNHVSSTSSSKGVFHEKINDQGKIRIEYIVHDQNTESPGEIPNERKDSQI
                     PLFIDITKASFKPSKNKLDDHDISSDAIYGLPNSLILLFSEVVHLIRFKVYCDSTSTQ
                     LPLFFKLLADELSTKLSDWKLEWKLTTQEDSEKFISARHEGIYHHVMSFYHGLVIYFY
                     RFIEDINPNYLQEYVEKVLVHLNRIQEIVQSDKDILIIPLFWQGFIAGSEAMTVYLQN
                     GFKKWGTDISKTGIGTYWVARQIMLEVWRRKNFNEKKSNWIDVIRDWDMNVMLT"
     gene            complement(<57904..>59400)
                     /locus_tag="PAS_chr2-1_0030"
                     /db_xref="GeneID:8198149"
     mRNA            complement(<57904..>59400)
                     /locus_tag="PAS_chr2-1_0030"
                     /product="Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /transcript_id="XM_002490865.1"
                     /db_xref="GeneID:8198149"
     CDS             complement(57904..59400)
                     /locus_tag="PAS_chr2-1_0030"
                     /codon_start=1
                     /product="Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /protein_id="XP_002490910.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0030"
                     /db_xref="EnsemblGenomes-Tr:CAY68630"
                     /db_xref="GeneID:8198149"
                     /db_xref="GOA:C4QZF6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZF6"
                     /translation="MGSELKASHGEKIKKEKKEKKEKKVKKDKKVKKEKKEKREKKDK
                     KEKKEKKEKDHNETPQPATEVDQATIDAYLKENEISIDDPHNAEVSPILNFSMLQGIE
                     EKIKNKISQFDKPTTIQAVSWPYLLKGNDVIGVAETGSGKTFAFGVPAISHVLQKNSK
                     GLQVLVISPTRELAVQIYDNLKQLTDLCGLECCCIYGGVSKDDQRRQVKQSQCVIATP
                     GRLLDLMEEGSIDLTGINYLVLDEADRMLEKGFEEAIKSIMANVNTDRQTLMFTATWP
                     KEVRELASHFMKSPVKVTVGDRDELSANKKITQIVEVIDPYDKEKKLLQLLSKYSKND
                     DKILIFALYKKEATRVERTLNYKGYKVSAIHGDLSQQQRTQSLNDFKTGKSSLLLATD
                     VAARGLDIPNVKVVINLTFPLTVEDYVHRIGRTGRAGKTGIAHTLFTEHEKHLSGALQ
                     NILRGANQPVPEELLKFGGHTKRKEHSVYGAFFKDVDMNQKAKKIKFD"
     gene            <59772..>60376
                     /locus_tag="PAS_chr2-1_0031"
                     /db_xref="GeneID:8198150"
     mRNA            join(<59772..60263,60317..>60376)
                     /locus_tag="PAS_chr2-1_0031"
                     /product="Protein of unknown function required for normal
                     levels of resistance to oxidative damage, null mutan"
                     /transcript_id="XM_002490866.1"
                     /db_xref="GeneID:8198150"
     CDS             join(59772..60263,60317..60376)
                     /locus_tag="PAS_chr2-1_0031"
                     /codon_start=1
                     /product="Protein of unknown function required for normal
                     levels of resistance to oxidative damage, null mutan"
                     /protein_id="XP_002490911.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0031"
                     /db_xref="EnsemblGenomes-Tr:CAY68631"
                     /db_xref="GeneID:8198150"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:C4QZF7"
                     /translation="MSKLKDSIKSLKSTTREEPPDYHPFDPPLTGLELNGYKNTTKQR
                     LLHKELAEDLRLHLPARLQVTHNWNLLYSLEQDGISLNTLYKKMRPLPSEINKRYGYL
                     LVIRDSHHNVFGAYVSDYLRPIERKQYYGNGECFLWKAEKDTVPNLVDLGRQEELDVQ
                     YRLKCLHWQWRWEIWSLDRRRPG"
     gene            complement(<60473..>61231)
                     /locus_tag="PAS_chr2-1_0032"
                     /db_xref="GeneID:8198151"
     mRNA            complement(<60473..>61231)
                     /locus_tag="PAS_chr2-1_0032"
                     /product="Putative protein of unknown function with
                     similarity to glutamine amidotransferase proteins"
                     /transcript_id="XM_002490867.1"
                     /db_xref="GeneID:8198151"
     CDS             complement(60473..61231)
                     /locus_tag="PAS_chr2-1_0032"
                     /codon_start=1
                     /product="Putative protein of unknown function with
                     similarity to glutamine amidotransferase proteins"
                     /protein_id="XP_002490912.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0032"
                     /db_xref="EnsemblGenomes-Tr:CAY68632"
                     /db_xref="GeneID:8198151"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C4QZF8"
                     /translation="MTKSTFIAVLNLDQQNPDLLAYGDYGDMGILLMRKAGIVDQELR
                     KYNVIDNMEFPSQDSLQNVAAIYITGSKYDSWRYSEYEWMQKLIAFIQDVYFNHKIPL
                     IGICFGHQIIAIALGGTAKKVGWEIGTEKVQVSLTDGHIQTLTGNSKKVAKDLAEKGS
                     FLVSEYHQDAVTKIPVETINYGSTSNQQIQGLINDRIFTFQGHPEFPTEVEYSLLEKR
                     IDIVGKELYEDALKRKDEDDGFFLGRLIKSFIGI"
     gene            <61726..>62640
                     /locus_tag="PAS_chr2-1_0033"
                     /db_xref="GeneID:8198152"
     mRNA            <61726..>62640
                     /locus_tag="PAS_chr2-1_0033"
                     /product="Nitrogen catabolite repression transcriptional
                     regulator that acts by inhibition of GLN3 transcripti"
                     /transcript_id="XM_002490868.1"
                     /db_xref="GeneID:8198152"
     CDS             61726..62640
                     /locus_tag="PAS_chr2-1_0033"
                     /codon_start=1
                     /product="Nitrogen catabolite repression transcriptional
                     regulator that acts by inhibition of GLN3 transcripti"
                     /protein_id="XP_002490913.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0033"
                     /db_xref="EnsemblGenomes-Tr:CAY68633"
                     /db_xref="GeneID:8198152"
                     /db_xref="GOA:C4QZF9"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017298"
                     /db_xref="UniProtKB/TrEMBL:C4QZF9"
                     /translation="MISNLSAGLRTINLNDEKAEDSRSQHQQQTVIDQSRAESMNSKS
                     QDSGNRITQYFTNLPKEGFTLFSHSSAPNGFKVAIVLSELGYPYKTLFLDFNKGEQRA
                     PEFVSVNPNARVPALIDHNCDNLALWESGAIILYLCQKSLRETGVCDIYSDNPQDQAQ
                     INSWVFFQTSGHAPIIGQALHFRYFHDVNVPSAVERYTDEVRRVYGVLEMALAERREA
                     LIMELDIQNSANYSNGTTPLSQSKYFDHPVWLVGDSISVADLSFVPWNNVVDRIGINL
                     KSEYPEVYKWTKHMMRRPAVVRALRGDT"
     gene            complement(<62702..>63853)
                     /locus_tag="PAS_chr2-1_0034"
                     /db_xref="GeneID:8198153"
     mRNA            complement(<62702..>63853)
                     /locus_tag="PAS_chr2-1_0034"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490869.1"
                     /db_xref="GeneID:8198153"
     CDS             complement(62702..63853)
                     /locus_tag="PAS_chr2-1_0034"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490914.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0034"
                     /db_xref="EnsemblGenomes-Tr:CAY68634"
                     /db_xref="GeneID:8198153"
                     /db_xref="InterPro:IPR029005"
                     /db_xref="UniProtKB/TrEMBL:C4QZG0"
                     /translation="MSVLAIAINVAHGAPVSWAHHFFTTTYTSVGMIPVREPYYPPGG
                     MEIPASMDAVQPHINVPNATAGQQEQTQGPPPLRRHNMVQYQLNTNLKRQLSNFTLLK
                     FLEFCELAGARSKLHDKEYWQKVSEDYFTPEGTISFVLKKDNKSSDTPNGGPDSIPQL
                     RHFEMLTSLIPQFVTGWISPGVESVDIFPLLIKVEILANGSTYIESRKFCLKYTFKDG
                     SHFDITGIARVVYNQQLKIDLFEFQDVETSRAVDLKSLYSTFEKCLKRSTIESGKAER
                     HNDLETESQLNLPFALEEEVLSNKQSSMIKMIADEVLNASGQNTLDMDKKFHSLLQLY
                     DTFSIMSTLVEFSTANGIASPLESLDTFLNLNKHILKESSGPPAKRPRT"
     gene            <63910..>64101
                     /locus_tag="PAS_chr2-1_0035"
                     /db_xref="GeneID:8198154"
     mRNA            <63910..>64101
                     /locus_tag="PAS_chr2-1_0035"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490870.1"
                     /db_xref="GeneID:8198154"
     CDS             63910..64101
                     /locus_tag="PAS_chr2-1_0035"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490915.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0035"
                     /db_xref="EnsemblGenomes-Tr:CAY68635"
                     /db_xref="GeneID:8198154"
                     /db_xref="UniProtKB/TrEMBL:C4QZG1"
                     /translation="MVERSGLYFFSSRLSSIQEVELIPAGGCIVEIKTSLQICSINFP
                     TDYHSHLILEIIDDTLDRI"
     gene            complement(<64168..>64995)
                     /locus_tag="PAS_chr2-1_0036"
                     /db_xref="GeneID:8198155"
     mRNA            complement(<64168..>64995)
                     /locus_tag="PAS_chr2-1_0036"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490871.1"
                     /db_xref="GeneID:8198155"
     CDS             complement(64168..64995)
                     /locus_tag="PAS_chr2-1_0036"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490916.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0036"
                     /db_xref="EnsemblGenomes-Tr:CAY68636"
                     /db_xref="GeneID:8198155"
                     /db_xref="GOA:C4QZG2"
                     /db_xref="InterPro:IPR006880"
                     /db_xref="InterPro:IPR029523"
                     /db_xref="UniProtKB/TrEMBL:C4QZG2"
                     /translation="MSSEDISELSEISDGNISSRSDEELEDEIQENGYTPFEEDDDYG
                     HDEDDDDDDNIHDQDQDDYLDSSTQPETVDSEITSQPRSKQNSLVVKLQPRRAKTRLS
                     YNESDDEFPEDEELDEEEEVEEEDDDDDDNFETPQLGEPTDVSKMTERQRAKFLEQEE
                     PQSFLELPTNKKKKELTEEEILLKREENSRKRKNFNERRLEEEKRDTLNKLLKKRASK
                     VRSKKSLDEFDDDENEVSKRLNRPRRPQLVHPALSRWTCTSKDEQVIIRYGIPGTSK"
     gene            <65610..>66530
                     /locus_tag="PAS_chr2-1_0037"
                     /db_xref="GeneID:8198156"
     mRNA            <65610..>66530
                     /locus_tag="PAS_chr2-1_0037"
                     /product="Nitrilase, member of the nitrilase branch of the
                     nitrilase superfamily"
                     /transcript_id="XM_002490872.1"
                     /db_xref="GeneID:8198156"
     CDS             65610..66530
                     /locus_tag="PAS_chr2-1_0037"
                     /codon_start=1
                     /product="Nitrilase, member of the nitrilase branch of the
                     nitrilase superfamily"
                     /protein_id="XP_002490917.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0037"
                     /db_xref="EnsemblGenomes-Tr:CAY68637"
                     /db_xref="GeneID:8198156"
                     /db_xref="GOA:C4QZG3"
                     /db_xref="InterPro:IPR000132"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:C4QZG3"
                     /translation="MTKQVVAALQVGSSPKGTKETLKKILSYEQEIKEKGVKILVLPE
                     AILGGYPKGSNFGTYLGFRLQEGKEAFKRYFKEAIDLDGEEIRELAQLSNRTGAFITA
                     GVVERAGSTLYCTMVYIDPVKGYVGKHRKLQPTGTERLIWGQGDGSTLTTVETSVGTL
                     GGAICWENFLPLLRQAMYAKGVQVWAAPTVDGRKIWGNCMQTLGYEGRLFVVSAVQFM
                     PPPKEMGYELKDWDENENCINGGSLIVDPYGEVLAGPFTGKEGLLHAEIDLDKIIEAR
                     FDFDPVGHYARGDVFQLTVNERSRDVTFTK"
     gene            <67060..>67641
                     /locus_tag="PAS_chr2-1_0038"
                     /db_xref="GeneID:8198157"
     mRNA            <67060..>67641
                     /locus_tag="PAS_chr2-1_0038"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002490873.1"
                     /db_xref="GeneID:8198157"
     CDS             67060..67641
                     /locus_tag="PAS_chr2-1_0038"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002490918.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0038"
                     /db_xref="EnsemblGenomes-Tr:CAY68638"
                     /db_xref="GeneID:8198157"
                     /db_xref="GOA:C4QZG4"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:C4QZG4"
                     /translation="MSLFLNLVCGLMFFEMGLFSAMTIPFPPKIRKPILNIVSLPFKS
                     IHFQVAYKCILGFILILFIDSVNKVIKVSSDLTSFDSAASSALGNNSVDRTDILLRRF
                     YAQRNMYICGFTLFLTLILSRTYALVDEVMVLKEQRYSKVANSADAADPDEVSKLKAQ
                     LTEKEENIQILKKQAEHLSKDYEELIAKKPKNE"
     gene            complement(<67727..>70477)
                     /locus_tag="PAS_chr2-1_0039"
                     /db_xref="GeneID:8198158"
     mRNA            complement(<67727..>70477)
                     /locus_tag="PAS_chr2-1_0039"
                     /product="Essential 121kDa subunit of the exocyst complex
                     (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p"
                     /transcript_id="XM_002490874.1"
                     /db_xref="GeneID:8198158"
     CDS             complement(67727..70477)
                     /locus_tag="PAS_chr2-1_0039"
                     /codon_start=1
                     /product="Essential 121kDa subunit of the exocyst complex
                     (Sec3p, Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p"
                     /protein_id="XP_002490919.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0039"
                     /db_xref="EnsemblGenomes-Tr:CAY68639"
                     /db_xref="GeneID:8198158"
                     /db_xref="GOA:C4QZG5"
                     /db_xref="InterPro:IPR007191"
                     /db_xref="UniProtKB/TrEMBL:C4QZG5"
                     /translation="MEQPINSVHNGSNSLDNLEHLLKEAEENWQVLMAKDSVSALDIA
                     LPFLDRTSVGMASQYPEFKELERNLFNGLQNVVFENFNAFNDSVAAYQVTREKIGKSQ
                     NIIKEINGTLEQSGKDIMSNKEILKELNNNSQKYEQIIETLDQIEILRKKNVEIEALI
                     DKKAFYKVERLLAESWDICNQYNLNELESLSHIKENLEVQSNNLVELVVEELHSIIYL
                     KNIKRQEETHEELKTYKKIKDFLFKFENNYNFFDMINKEVAFIDNDYEYVYLLLKTLK
                     NLNSLDETLNSLKSRLSTELQFLFNSIQEEIKSSNGKNIQVANLDMTDLDSFGISDIG
                     NSVLQSFFSRIFNRCCHVLEFLLVTYKISEIVSENSNCKLNFQFSDLWDIFSAEISNL
                     MLAYISKSESSDKSQHSNDKHMFQFNSLDFKNTKAETFSIDLQSILQDLFPNYDLKNP
                     ITNSVYIKDDFSVNKTTLIPPNVFNMSVILNNLLQFIHLSLQLVSIVANEKIDPALLC
                     DRFMETAFLPRLQHLLDGIFQSLFKDGTVDTESYHNVFKTFFSKVCDILNTSIIYKSE
                     YVRIILKLLNKMSSLYSECFNKHFGGTGKNTKTVQLVVNSSLRNASKIQDFAAETSIL
                     LSNNFMGQVTTRDFLTDEELTQLIKLLTSIDRMLEWLLPMRRVGSSLNQDHSNDNDEK
                     VDFLKDKWLFLEGSPISTVLLTFSKDSVVEFDSQVDTFYKLMTDIKLILRYDLRLKIG
                     YFVSQMFLTETWLLPYERNRPSLLIESLNKKILQIDHLLTNRDYKTFVFQGVSSFANK
                     LFIKGASDIVALNEHGIGKLYSNIIILQQVLRTLVDDPDEINFSSCINYYEMFKKTDK
                     GIVDQVSRGENRYSYEENAQMIKLYFSEGLSKQMNTGKKMSFGADKRCEESIQALKNL
                     YK"
     gene            complement(<70761..>72305)
                     /locus_tag="PAS_chr2-1_0040"
                     /db_xref="GeneID:8198159"
     mRNA            complement(<70761..>72305)
                     /locus_tag="PAS_chr2-1_0040"
                     /product="Protein with similarity to ATP-binding cassette
                     (ABC) transporter family members"
                     /transcript_id="XM_002490875.1"
                     /db_xref="GeneID:8198159"
     CDS             complement(70761..72305)
                     /locus_tag="PAS_chr2-1_0040"
                     /codon_start=1
                     /product="Protein with similarity to ATP-binding cassette
                     (ABC) transporter family members"
                     /protein_id="XP_002490920.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0040"
                     /db_xref="EnsemblGenomes-Tr:CAY68640"
                     /db_xref="GeneID:8198159"
                     /db_xref="GOA:C4QZG6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZG6"
                     /translation="MNLVELKNVLFQRATGSASKVCSKRLLFKNPINLNLNSDKRWAI
                     IGHTKSSFLEVLSGKHLAIPIEGRKYPILANELASNSIELLQFSNNNYGKSATGTGNG
                     GFTHLGARYEFFKDLEIDIRVDQFISDYSYNASHKVDSDKIANLIKTFKLDGLEDKYI
                     NGLSNGQFRRARLAKSIYKAPKILLIDDPFLGLDPNATDLVSNVLSQDHESAILLGLR
                     IQDPIPSWIDNVVLVNQDGVVKHGPKDELAPELEANLDEFKKSQVKELENIKKKELAF
                     IERQTANTDNSEIISMRNVNVAHKGKKILTNLNWNVRCGEKWHIRGPNGSGKTTILSL
                     LTLDHPQSWNKSISVYGAPRRIGSTNYFDTNKYIGFTSPELHALFPKKLTVFKAVSTG
                     FVTGSYLPPNNLTADQINRINNLLEYFQLGELKDTSFDELSISHQKVVLFIRAVINNP
                     RILILDESLSAMDENDVLRCKDFVSSYNQGCVLVVGHVDEEVPKCDKYLQLIDAPKGE
                     YKIGYV"
     gene            <72637..>74013
                     /locus_tag="PAS_chr2-1_0041"
                     /db_xref="GeneID:8198160"
     mRNA            <72637..>74013
                     /locus_tag="PAS_chr2-1_0041"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490876.1"
                     /db_xref="GeneID:8198160"
     CDS             72637..74013
                     /locus_tag="PAS_chr2-1_0041"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490921.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0041"
                     /db_xref="EnsemblGenomes-Tr:CAY68641"
                     /db_xref="GeneID:8198160"
                     /db_xref="UniProtKB/TrEMBL:C4QZG7"
                     /translation="MSLNCGDSDSEVDSFPSSESEFNVLGTNLLVSRRQNNSKTTECS
                     SLSPDFSNKHAAGQSTPKSEIFVDEGSSLILLDNDHLTDRVIEILDSSIMDLEDDNGS
                     PLDRSSSQEENNQVELSLDEIITSSQFTQEGTNAKEEEPKSYLQQLLERATPQELRRV
                     NKVTRTQEEMLSKVKIEISNSFLEHIKRKATFEFDSVQIEELDSKHKEIRWKYELDCL
                     YYPEQEIVVPLPQGKIEIVNESTILLSYTAEEMATNLLNESLISLINEYPADSFFIIL
                     VEGWDTYLRSIKTKHNRDFVKEIRMRLDQEELHQKRLKSTPRPSKPNPVDPDKLWEKV
                     LCMELEFKVNIFPVHNVVDSLEWIKSFTSTLASRTFNKKHRNTGFERVGTVRSGSNGA
                     DCYFQALQQLKYMTPITAKKLMNEYPSINRLYDHISRHNHLEGCSKSIREALIKLFTC
                     DNPNELIN"
     gene            complement(<74120..>74983)
                     /locus_tag="PAS_chr2-1_0042"
                     /db_xref="GeneID:8198161"
     mRNA            complement(<74120..>74983)
                     /locus_tag="PAS_chr2-1_0042"
                     /product="Hsp70 (Ssa1p) nucleotide exchange factor,
                     cytosolic homolog of Sil1p, which is the nucleotide
                     exchan"
                     /transcript_id="XM_002490877.1"
                     /db_xref="GeneID:8198161"
     CDS             complement(74120..74983)
                     /locus_tag="PAS_chr2-1_0042"
                     /codon_start=1
                     /product="Hsp70 (Ssa1p) nucleotide exchange factor,
                     cytosolic homolog of Sil1p, which is the nucleotide
                     exchan"
                     /protein_id="XP_002490922.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0042"
                     /db_xref="EnsemblGenomes-Tr:CAY68642"
                     /db_xref="GeneID:8198161"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013918"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QZG8"
                     /translation="MEKLLKWSISANSQDEESKKRAGQPDPELLAQLFGGPDEPTLMN
                     ESMKVINNPETDLENKEVAFDNFEMLIENMDNANNIENMHLWPPLLQNLDSEYISLRR
                     FACSCIGTAVQNNPKCQEHFLKHSDGIKKLIAISSNSEEDDSVKLKALYALSNVLRHN
                     KPAYEEFSNQGGWNEISPLLTSLDNSNEKIKLRTLSLLSSIITNGLSEEVIEHLHNNK
                     VVISMLKVLKAEGHITSIDKVLSLLTTLVQNKFRFSDEEINLIRQSLTTIAELEDSLN
                     NDDLNTIKQVL"
     gene            <75124..>76250
                     /locus_tag="PAS_chr2-1_0043"
                     /db_xref="GeneID:8198162"
     mRNA            join(<75124..75178,75319..>76250)
                     /locus_tag="PAS_chr2-1_0043"
                     /product="Subunit of TFIIH complex, involved in
                     transcription initiation, similar to 34 kDa subunit of
                     human T"
                     /transcript_id="XM_002490878.1"
                     /db_xref="GeneID:8198162"
     CDS             join(75124..75178,75319..76250)
                     /locus_tag="PAS_chr2-1_0043"
                     /codon_start=1
                     /product="Subunit of TFIIH complex, involved in
                     transcription initiation, similar to 34 kDa subunit of
                     human T"
                     /protein_id="XP_002490923.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0043"
                     /db_xref="EnsemblGenomes-Tr:CAY68643"
                     /db_xref="GeneID:8198162"
                     /db_xref="GOA:C4QZG9"
                     /db_xref="InterPro:IPR004600"
                     /db_xref="UniProtKB/TrEMBL:C4QZG9"
                     /translation="MDAIADRAFQEKQHNVSQDETPSLLAVVIDTNPLEWTKLKGVIC
                     LKELCKSVLVLLNAHLSLNSGNRVAVLTSSSLNSGPKFLYPDPNDKTYEKRESLLSSD
                     IHRQFKFVDQKIIQELQILLDNEPLNPENQELKGSIAGAMSMALSYINRLTNIEPEST
                     GNTLRAKMLVISISDDSTQQYVPFMNCIFSAQKMKVSIDVCKMGPDSSFLQQASDVTN
                     GVYMLIKNVHGLIQYLTTALFIDPSLRPIMVLPTNSDLDFRASCFVTNKVIDIGYVCS
                     VCLCIFSIIPRNNVCPTCQSKFDDAVVKKLRQKPIVIPLQKKKKLEDGVQRT"
     gene            complement(<76262..>76690)
                     /locus_tag="PAS_chr2-1_0044"
                     /db_xref="GeneID:8198163"
     mRNA            complement(<76262..>76690)
                     /locus_tag="PAS_chr2-1_0044"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490879.1"
                     /db_xref="GeneID:8198163"
     CDS             complement(76262..76690)
                     /locus_tag="PAS_chr2-1_0044"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490924.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0044"
                     /db_xref="EnsemblGenomes-Tr:CAY68644"
                     /db_xref="GeneID:8198163"
                     /db_xref="GOA:C4QZH0"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4QZH0"
                     /translation="MKRTLDDFSDASNEQKSTRISNQALFRCTLGACKADFTDHSSLN
                     HHILQYHTFICQSCKKNFPNERFLYLHIQEHHNPFNSIKEERGEKIYQCFLETCDKIC
                     SSPQTRRLHMIDKHQYPKEFLYSVIKNGMSKGQTSLLKSR"
     gene            <76765..>77550
                     /locus_tag="PAS_chr2-1_0045"
                     /db_xref="GeneID:8198164"
     mRNA            <76765..>77550
                     /locus_tag="PAS_chr2-1_0045"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490880.1"
                     /db_xref="GeneID:8198164"
     CDS             76765..77550
                     /locus_tag="PAS_chr2-1_0045"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490925.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0045"
                     /db_xref="EnsemblGenomes-Tr:CAY68645"
                     /db_xref="GeneID:8198164"
                     /db_xref="UniProtKB/TrEMBL:C4QZH1"
                     /translation="MKRQNQPYELLTLKKQKAEQPESSIEHTHGPVDLQFGQRKAFPV
                     DLDIDPSRLPQNEGSLPQDVMTYLAMVRMEAEGNARYNIDEDENFYLHETVKTKENIA
                     LDPVDNEHQVHITWHHDYTEYFKARQEKLSILGKEIEGDEKFIEPSSAQLWKKYVFET
                     TPDDRLIVAIPFDVKFKMIIYFTRWLNKTLNANLIKWIEITLESLPELLEGTEISLLR
                     NLAKKAIKLRGNDLDSTSLSVMDEIISIVGDVYHQRDLLEGYL"
     gene            <77696..>78083
                     /locus_tag="PAS_chr2-1_0046"
                     /db_xref="GeneID:8198165"
     mRNA            join(<77696..77733,77795..>78083)
                     /locus_tag="PAS_chr2-1_0046"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490881.1"
                     /db_xref="GeneID:8198165"
     CDS             join(77696..77733,77795..78083)
                     /locus_tag="PAS_chr2-1_0046"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490926.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0046"
                     /db_xref="EnsemblGenomes-Tr:CAY68646"
                     /db_xref="GeneID:8198165"
                     /db_xref="InterPro:IPR005351"
                     /db_xref="UniProtKB/TrEMBL:C4QZH2"
                     /translation="MSEDPRRPDEVVKYVHVPAQTRNTAANVVGSTLPMAAMFLRNKV
                     VSWSALFIALQAYLNEPRFKPQNKDGPSQPGLMTVGFALLAVLTSYTDVLFPTPGVGK
                     KIVPSV"
     gene            complement(<78280..>78732)
                     /locus_tag="PAS_chr2-1_0047"
                     /db_xref="GeneID:8198166"
     mRNA            complement(<78280..>78732)
                     /locus_tag="PAS_chr2-1_0047"
                     /product="Cytosine deaminase, zinc metalloenzyme that
                     catalyzes the hydrolytic deamination of cytosine to urac"
                     /transcript_id="XM_002490882.1"
                     /db_xref="GeneID:8198166"
     CDS             complement(78280..78732)
                     /locus_tag="PAS_chr2-1_0047"
                     /codon_start=1
                     /product="Cytosine deaminase, zinc metalloenzyme that
                     catalyzes the hydrolytic deamination of cytosine to urac"
                     /protein_id="XP_002490927.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0047"
                     /db_xref="EnsemblGenomes-Tr:CAY68647"
                     /db_xref="GeneID:8198166"
                     /db_xref="GOA:C4QZH3"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C4QZH3"
                     /translation="MTFSDEDGIKLALKEAQKGYEDGGIPIGAALVSEDGTVLGVGHN
                     LRIQKGSSVFHAEMSALENAGRLPGKTYKNCTMYTTLSPCHMCSGACLMYGIKRVVLG
                     ENETFQGAEELLRSKGVEVVNAKNDECKELISKFIKERPADWSEDIGE"
     gene            <79295..>81538
                     /locus_tag="PAS_chr2-1_0048"
                     /db_xref="GeneID:8198167"
     mRNA            <79295..>81538
                     /locus_tag="PAS_chr2-1_0048"
                     /product="Ferric reductase and cupric reductase, reduces
                     siderophore-bound iron and oxidized copper prior to u"
                     /transcript_id="XM_002490883.1"
                     /db_xref="GeneID:8198167"
     CDS             79295..81538
                     /locus_tag="PAS_chr2-1_0048"
                     /codon_start=1
                     /product="Ferric reductase and cupric reductase, reduces
                     siderophore-bound iron and oxidized copper prior to u"
                     /protein_id="XP_002490928.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0048"
                     /db_xref="EnsemblGenomes-Tr:CAY68648"
                     /db_xref="GeneID:8198167"
                     /db_xref="GOA:C4QZH4"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:C4QZH4"
                     /translation="MLITSLLVLILFNVLATAKIFAKPSSLMFSCLTASQEFQYDFVP
                     PPDVIPFWYIACNYEPALGSIVFCMDSNADSICPFSNSLEVLALGCQTQGDRTLTQTY
                     LMESGKNATKYMKNPASDPDFNFTQLTTPIMFNMSEVVNKKDAYYNFFDNLDDSTKFG
                     DFTIIYWGVLLILIGLFNHISAHNYLKSISLNSRLNQWKALVVLPTLSSYHLNPARFR
                     GIAFFEALLPLRQETFVLIAYILLCVYYTTSNYKVIANSPLFGSPYRQYLRFISDRTG
                     IFAFTQLPLLILFGGRNNILMTISGLPFNTFIIFHKWISRVMMLCAVVHAHQFVIYLE
                     ATGTFRRSLGELYFQFGELALLCCLLIMVQSVFYFRKRCYELFLVLHIFLAFIFLVGC
                     YFHVSKIGYSEWILATLGLWILDRVWRFVNIYRYGVQTAQLTVFHPHSTDSNREDPTV
                     KVSIPKPATWKSYPGCFVYLYFLDPHLKFWESHPFTIYDSTDQFGDPTPMINIYIKPK
                     CGTTKAIYDQIMSRDITGVKVLVEGPYGHRAHTENYDQLLLFVGGNGIPGPFSHAARS
                     VSALPYKDVESFKKVELVWSIKTLSALNWFYDELIQLKDTNVSVTVYVTRGDLSLADD
                     DNSSTSSNNNIEPEILTETSHLLKDDTNNKSKKREVSSIITIAEKFHNLSKFVTFIRG
                     RPNFEKKLDQVINECSQASKITTIGLVACGPSLMCDNIRNLVAHRLSRNDTGKFRIDL
                     LEELQVW"
     gene            <81862..>83619
                     /locus_tag="PAS_chr2-1_0049"
                     /db_xref="GeneID:8198168"
     mRNA            <81862..>83619
                     /locus_tag="PAS_chr2-1_0049"
                     /product="Aminophospholipid translocase (flippase) that
                     maintains membrane lipid asymmetry in post-Golgi secre"
                     /transcript_id="XM_002490884.1"
                     /db_xref="GeneID:8198168"
     CDS             81862..83619
                     /locus_tag="PAS_chr2-1_0049"
                     /codon_start=1
                     /product="Aminophospholipid translocase (flippase) that
                     maintains membrane lipid asymmetry in post-Golgi secre"
                     /protein_id="XP_002490929.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0049"
                     /db_xref="EnsemblGenomes-Tr:CAY68649"
                     /db_xref="GeneID:8198168"
                     /db_xref="GOA:C4QZH5"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C4QZH5"
                     /translation="MGFKQFCKDNFVAVSPKKLKKSDLHNVEISVEDDPFKKSAVIED
                     KKLDVESSVTESSESFRPHRNLKNRHIQLIGIGGTIGTAIFVSISGALFKGGPLSLFL
                     GFTIWCIPILAVTASTAEMVSYLPITSPFIRMAGICCDDALEFVSGLNFWILTGSLIP
                     YEIVGVNTIIHYWSDSYSPAITICIQIVLYFLINLFSVGIYGETEFWLSVWKVCLAVG
                     LMFFTLVTMSGGNPLNDAYGYRNWNSPSPMMEYISVGALGRFQGFIACLSQACFTISG
                     PDYVSSVAGESANPRKTLPTAFKQVFYRLTFIFIIGVLCIGTVCSPRDPHLIAALEEG
                     RPGSGSSPYVIAMDNLKIKVLPHVVNGALALSAFSSGNSYTYCSSRVLYGLAYTGKAP
                     KIFAYCTKSGIPLYSVLMSLCWAFLSFLEMNTQSQIVLVWIINLVTSSQLLNYTITML
                     TYTRFYAALKHKGIERKSLPFYAWFQPYTAIFGGFCTFSMIFISQYLLFYPSREYWAI
                     STFLFAFLSLFVIIALFIAYKLVFRTKWKSVDEIDWELELQEVERDQAYFDELAYYDN
                     NAKKPWYDKLIAILVGNNK"
     gene            <83824..>88701
                     /locus_tag="PAS_chr2-1_0807"
                     /db_xref="GeneID:8198169"
     mRNA            <83824..>88701
                     /locus_tag="PAS_chr2-1_0807"
                     /product="hypothetical protein"
                     /transcript_id="XM_002490885.1"
                     /db_xref="GeneID:8198169"
     CDS             83824..88701
                     /locus_tag="PAS_chr2-1_0807"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002490930.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0807"
                     /db_xref="EnsemblGenomes-Tr:CAY68650"
                     /db_xref="GeneID:8198169"
                     /db_xref="GOA:C4QZH6"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C4QZH6"
                     /translation="MERQSRGDGDTNDPPRITDPSVTKPRKRGLSLRSQLLNKKLLNN
                     PATNNSVPDIELSEVDASHEGSDSQAVKTEPKERFAEESYHDLVLEDREPTSGDQSSR
                     KTSFLKNLHNKLLGVKNVSNSKGQRRVPLQIGGEAPNYAYLQNKQGKSLLKDPKTNKA
                     FCDNNIKSSRYTLATFVPRQLYAQFSKVANCYFLCISIMQMIPSWSTTGTYTTIIPLM
                     VFVSISIAREGYDDWKRHRQDKDENHKKVMVVASQSPGLYSNTTLRSANSLSELNTDI
                     GDTEPYQAQVLGRSRGSTISESNNVFDGIEERFSGKRFHLSKSYWKDVRVGQVIVLKR
                     DDWVPADIILLSSTGDSGEVFIETMALDGETNLKAKVPHPELYKRCNTNTGLEAVQAD
                     VSTENPNLDLYNFEGSLKFKGESISYPLGPDNIVYRGSIIRNTDYCLGLVIFTGEETK
                     IRMNAIKNPRTKAPKLQRAINMIVFFMIFVVASLSAFLTMAQRIWYEKTKDQYIYLYE
                     EDVGVAATLMGYIVMLNTLIPLSLYVTMEIIKAMQLVLLQSDIDMYDRKSNTPAEART
                     ATILEELGQVSYIFSDKTGTLTDNLMLFRKFTVAGTAWVHDIDLVNQQNEQGDEPEET
                     DSPNLEVNGNKETLEPRTSISHRGGQATYTGRPSLASISSNHNPKQSETTTTISLEAS
                     TSSSPTKSFSDPSSTGSLKSTVELIRYLQRYPSSFFSKQVKFMLLSLALCHSCLPRRA
                     DPGASDDDDEDNINYQASSPDELALVIAARDMGYIVFDRKLKMLTLKVYPNSFDGEPV
                     LENYEILDTVEFTSSRKRMSVIVKFPDGRICMLTKGADNVMLERFRDKELVERKIKEL
                     KKQTSERKNQEADIVLQHKNEDASANVRTSISSIGSSLAERVSLQIGRTSLHVNPDPH
                     NSIDGRIMNEEPDEEEEYVKNITKSSRKSIHLQQAKKYDISSEPTADSPIEDYVTSEK
                     LVFNEEFVLERTLQHIEEFSVEGLRTLMYCYRWLDKDVYERWSQQYADAKSSLTDRKY
                     NIEKVGEILEFDFELVGATAIEDKLQEGVPEAIEKLRKAGIKLWMLTGDKKETAINIG
                     YSCKLIKDYSSVVILSSDEGIQNLSTKMAASELEIKEGNVAHCVVVVDGATFTDIEND
                     LTLMTLFIELGVKADSVICCRASPSQKATMVSVIRKYNMKKVTLAIGDGANDIAMIQQ
                     ADIGIGITGKEGLQAARTSDYSIAQFRFLLKLLLVHGRYNYIRTCKFVLCTFYKEILF
                     YLTQAIYQRYTLFTGSSLYESWSLSMFNTLFTSLPVLCIGMLEKDLKPSTLLAVPALY
                     KIGRNYEAFNLVTFIYWMLLGTSQSLLISFANYLGWGGSSSQDNTTYPLGVASFTALV
                     FVVNLKCQVLEMHNITKFSLIGTLVSCLGWFLWLILLTGLYQSKDSKIFFVKSGLFHT
                     FGTDITWWCNLLVLILIGPLLDIILTVIKKDLIPSDTDIFQNIEKIPMFRKTFEIKAF
                     PYMFQGWTWPHESVILEEKKLSVSPFKRNYYNFKSILKKGSTGPTMTTRKRNGTLPSI
                     YELPPGSPSVVRKVTSKDGYESEILPSGKVIQVKHGVSRLKKVTRMFKLDNVDEETDY
                     DTEAIIDRRIKETET"
     gene            <88960..>92829
                     /locus_tag="PAS_chr2-1_0050"
                     /db_xref="GeneID:8198083"
     mRNA            <88960..>92829
                     /locus_tag="PAS_chr2-1_0050"
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter required for the export of a-factor, catalyze"
                     /transcript_id="XM_002490886.1"
                     /db_xref="GeneID:8198083"
     CDS             88960..92829
                     /locus_tag="PAS_chr2-1_0050"
                     /codon_start=1
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter required for the export of a-factor, catalyze"
                     /protein_id="XP_002490931.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0050"
                     /db_xref="EnsemblGenomes-Tr:CAY68651"
                     /db_xref="GeneID:8198083"
                     /db_xref="GOA:C4QZH7"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZH7"
                     /translation="MRLFKRKKDPEKEHLDEKDAQFKNPDDQLNEKFDQLDPATREVL
                     EGQLKGVSFKASLADLYGLLRGWEYLIAFIAYVCSIIAGAALPLMTLVVGDMAQQFTN
                     YFTGVLGRSEFEDKIRDNSLYFVYLGIGLTVFQYLATFLHIVISEIIASRVRQKFVWS
                     ILHQNVAFLDSMGSGEITESITSDTRLIQEGVSEKIGMTVECLATVVSALVVAFAKYW
                     KLALVLLSVMVGLIMSATPTTLMLIKMYMKSLESYGKASSIAEETFSAIRTATAFGAH
                     EFQLSRYNIFILESRGYGFKKALWLSLMIGSVWFIVFNTYALAFWQGSRFMVSDNSGI
                     GKILTACMAMLFGAMTIGNVTTHMKDVSVGIGAASKLLAVINREPYLDSSSEDGSKLE
                     RVDGSISFRNVTTRYPSRPDITVLSDFTLDVKPGNTVALVGESGSGKSTVIGLLERFY
                     EYLDGDILLDGVSVKDLNIKWLRQQIALVQQEPVLFAASIYENICYGLVGTKYEDAPE
                     EVKRDLVEKACKDANAWEFITQMSHGLDTEVGERGLSLSGGQKQRIAIARAVISQPKI
                     LLLDEATSALDTKSEGIVQDALNRLSESRTTLVIAHRLSTIQNADLIVVMSNGRIIER
                     GTHQELIKLRGRYYQLVQVQNINTKINSTQVTKSIAASTISDSENDKPNDSESLIYEP
                     SPEIASDLPPQKKPSVGQLFLMLLKISKGEYHLIIPAMFCALIAGMGFPGLSLLMGHI
                     VEAFQVSGPDEYPHMRSQINKLTGYLFMIGVIEFINYIFLISSLVMASEYLIYKMRYR
                     CFKQYLRQDMAFYDQPQNKVGSLVTMLAKDPQEIEGLSGGTAAQITVSVIIVVVGIII
                     SLITNWRLGLVCTSTVPLLLGCGFFRVYLIIMFEERSLKSYQGSASYACEQVSALRTV
                     ISLTREKGIYDKYSKSIKAQVRRSTQSVAKTAIMHGLIQGMVPWIFALGFWYGSKLMI
                     EGRCTNREFFTVLIAILFGAQSAGQIFSYAPGMGKAKQAAANVKKVLDTFPNVIDIES
                     EEGAIVDPSEVKGGIEFRNVTFRYPTRMEVPVLQDLNLTIKPGQYIGLVGASGCGKST
                     TVGLIERFYDPLSGEVLLDGVDIRNLHLRTYRQALALVQQEPVLFGGSIRDNILLGSI
                     DEVSDDEVIEACREANIYDFVSSLPEGLDTLCGNRGAMLSGGQKQRIAIARALIRNPR
                     VLLLDEATSALDSESEKAVQEAIDRASKGRTTITIAHRLSTIQNCDVIHVFEGGKIIE
                     SGKHDELLALGGKYYDLVQLQGLESQN"
     gene            <93286..>94329
                     /locus_tag="PAS_chr2-1_0051"
                     /db_xref="GeneID:8198170"
     mRNA            <93286..>94329
                     /locus_tag="PAS_chr2-1_0051"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490887.1"
                     /db_xref="GeneID:8198170"
     CDS             93286..94329
                     /locus_tag="PAS_chr2-1_0051"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490932.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0051"
                     /db_xref="EnsemblGenomes-Tr:CAY68652"
                     /db_xref="GeneID:8198170"
                     /db_xref="GOA:C4QZH8"
                     /db_xref="InterPro:IPR007828"
                     /db_xref="UniProtKB/TrEMBL:C4QZH8"
                     /translation="MSVQKSTKVFNNNTKDFKKHTQLRNGKLLEQTDDHIQNVNRRKR
                     DLKLSQILNCTDSDSEVTKNFDGKDSKEESPWYDNSSSDFLKSVDTKAYRQYDLACER
                     VKDFYKEQHENQTVAYNLQARINFKTKKRDVMTVWDALVKLNVLLDESDPDTELSQID
                     HAIQTAEAIRRDCKPRWFQLVGLIHDLGKLLYFYDSKGQWDVVGDTFPVGCRFSKRII
                     FFEFFKNNPDNDNPLYNKKYGIYSPHCGLEDVMLSWGHDEYIYHIAKGQSKLPPEGLA
                     MLRYHSFYPWHQDGGYRYLMNENDAQMLQAVKAFNPYDLYSKTDITYDIEELKPYYLE
                     LIDEFFPQKLVKF"
     gene            complement(<94422..>95816)
                     /locus_tag="PAS_chr2-1_0052"
                     /db_xref="GeneID:8198171"
     mRNA            complement(<94422..>95816)
                     /locus_tag="PAS_chr2-1_0052"
                     /product="Cell wall protein with similarity to glucanases"
                     /transcript_id="XM_002490888.1"
                     /db_xref="GeneID:8198171"
     CDS             complement(94422..95816)
                     /locus_tag="PAS_chr2-1_0052"
                     /codon_start=1
                     /product="Cell wall protein with similarity to glucanases"
                     /protein_id="XP_002490933.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0052"
                     /db_xref="EnsemblGenomes-Tr:CAY68653"
                     /db_xref="GeneID:8198171"
                     /db_xref="GOA:C4QZH9"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C4QZH9"
                     /translation="MLSTILNIFILLLFIQASLQAPIPVVTKYVTEGIAVVTETNVRV
                     VTKTIPIVQVLISDGATYTHTLTTVSTAEENGNFQPITTTSIVNKEVVVPTSVTPNTQ
                     QTRPTQVDTTQNNADTPAAPTPSPTTSSNNGVFTTYSTTRSVVTSVVVVGPDGSPIEN
                     TGQTANPTTTAPTTSTTAARTTSSTSTTPTASSTPGGNHPRSIVYSPYSDSSQCKDAT
                     TIETDLEFIASKGISAVRIYGNDCNYLTVVLPKCASLGLKVNQGFWIGPSGVDSIDDA
                     VQEFIQAVNGNNGFNWDLFELITVGNEAISAGYVSASSLISKIKEVSSILSSAGYTGP
                     ITTAEPPNVYEDYGDLCSTDVMSIVGVNAHSYFNTLFAASDSGSFVKSQIEVVQKACS
                     RSDITIIETGYPSQGATNGKNVPSKENQKTAIFSIFEVVGTDVTILSTYDDLWKDPGP
                     YGIEQFFGAIDLFS"
     gene            <96002..>96340
                     /locus_tag="PAS_chr2-1_0053"
                     /db_xref="GeneID:8198172"
     mRNA            join(<96002..96125,96228..>96340)
                     /locus_tag="PAS_chr2-1_0053"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490889.1"
                     /db_xref="GeneID:8198172"
     CDS             join(96002..96125,96228..96340)
                     /locus_tag="PAS_chr2-1_0053"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490934.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0053"
                     /db_xref="EnsemblGenomes-Tr:CAY68654"
                     /db_xref="GeneID:8198172"
                     /db_xref="UniProtKB/TrEMBL:C4QZI0"
                     /translation="MAGIKVGSGTSRNGKYQKQSKIQCIESEDIVLYQPFQTTLYAIS
                     KNGWDEILHRHDHWMQDHEVNFVRGNWFRFWEKM"
     gene            <96665..>98233
                     /locus_tag="PAS_chr2-1_0054"
                     /db_xref="GeneID:8198173"
     mRNA            <96665..>98233
                     /locus_tag="PAS_chr2-1_0054"
                     /product="Putative hexose transporter, expressed at low
                     levels and expression is repressed by glucose"
                     /transcript_id="XM_002490890.1"
                     /db_xref="GeneID:8198173"
     CDS             96665..98233
                     /locus_tag="PAS_chr2-1_0054"
                     /codon_start=1
                     /product="Putative hexose transporter, expressed at low
                     levels and expression is repressed by glucose"
                     /protein_id="XP_002490935.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0054"
                     /db_xref="EnsemblGenomes-Tr:CAY68655"
                     /db_xref="GeneID:8198173"
                     /db_xref="GOA:C4QZI1"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4QZI1"
                     /translation="MTEESLESTRMSTLGKDKHHKTTPSIVYCLGLALAGIVFGFDIG
                     SIGMINFQTYRDQFGDIVYPSGEKRINEVVLGLIVSGFSLGAALGGLLLPRFADNYGK
                     KPLILFSMFLYFLGSLTVFWAWVWWQVFLGRILNGAGVGCCGVVSVMLISELSPPDLK
                     GPLVSSFQVFTTVGILFGALVIYLCKNERSRWQYRIGLVIQMNLANIVAIVTAFVPES
                     PVYLIKSRQYNKALRSIGRIKGLSPTDHRVETELNDLRERTQLESLNIALSDPNSTSI
                     LKGEPRILFRTVIGTILMIFQQLTGINYFFFFGVAIFENAGVEDPFLTPVILGAVNLV
                     FSFLSLWLVSQYPRRWLLISGSFVMMILIFMFSTCGVFFLDSSNGAVVGSIMILLTCF
                     FIGAFACTWGPLSFVVLSELFPIRVRSKSMSIASAMNWTTTFALSLLSPLIIRYIGFW
                     YGYVFAAFLFLSAFFVFYYIPETKYDTIEQIDHYYETMTTFNEFSIGFPTKTFKKRNK
                     SITVKQPEIQLHDV"
     gene            <98740..>100866
                     /locus_tag="PAS_chr2-1_0055"
                     /db_xref="GeneID:8198174"
     mRNA            <98740..>100866
                     /locus_tag="PAS_chr2-1_0055"
                     /product="Plasma membrane transporter for both urea and
                     polyamines, expression is highly sensitive to nitrogen"
                     /transcript_id="XM_002490891.1"
                     /db_xref="GeneID:8198174"
     CDS             98740..100866
                     /locus_tag="PAS_chr2-1_0055"
                     /codon_start=1
                     /product="Plasma membrane transporter for both urea and
                     polyamines, expression is highly sensitive to nitrogen"
                     /protein_id="XP_002490936.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0055"
                     /db_xref="EnsemblGenomes-Tr:CAY68656"
                     /db_xref="GeneID:8198174"
                     /db_xref="GOA:C4QZI2"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR019900"
                     /db_xref="UniProtKB/TrEMBL:C4QZI2"
                     /translation="MAGGIETPLPQGAGYAVVLGLGFFFSFLMIGITYGLQRYKKEIM
                     TSEEFNTGGRSIGTGLIASAVVSSWTWAATLLTSSTMAYNFGVSGSFFYAAGACVQIV
                     LFSYLAIKAKQRAPECHTYLEIVKARYGTLTHCVFMFFAIATNVLVTAMLLTGTSAVI
                     SDLTGMHTVAVCFLMPISVVAYTIVGGLKSTILSDYSHNGALLIIILVFAFTTYAGSD
                     KIGSPTRLWEMVNARSALNPVEGNAGGNYFTMSSRGGGIFFVINIAGNFGTVFLDNGY
                     WNKAIAASPAAAMPGYVLAGFHWFSIPFLCATTMGLACLALEDLNDPLTPQQVSAGLV
                     LPTAATQLLGKGGAVASLLLVFMAATSALSSELISVSSIFTYDIFKGYLRPRASGKTL
                     LVTSHLSVMAFAMIMSAFSTGLWYAEISMGYLYELMGILISAAVVPASCTLLWKDQNK
                     VAATLSPPLGCALAITGWLVYSKVNFGEVTVDTTFEDMSMLTGNCVALLSPLLFVPLF
                     SFIFGFQNFDWRVLKSINRVDEDEEIIEKTEPNVHIDAETGMYPIKSQITNAAEEIAL
                     KTGDERLTAEEAQLKRSSRIAGFACLVSASSFLILWPMPMYGSRYIFSSQFFTGWVTV
                     GIIWVFSTIGLVLLLPIWEGRHTLYTTFRGIYWDLSGNSHKLKEWQESHPEELHVVQS
                     QISAQVQRHNRIQVIDDLVETDSDRK"
     gene            <101035..>102195
                     /locus_tag="PAS_chr2-1_0056"
                     /db_xref="GeneID:8198175"
     mRNA            <101035..>102195
                     /locus_tag="PAS_chr2-1_0056"
                     /product="Palmitoyltransferase that acts on the SNAREs
                     Snc1p, Syn8p, Tlg1p and likely on all SNAREs"
                     /transcript_id="XM_002490892.1"
                     /db_xref="GeneID:8198175"
     CDS             101035..102195
                     /locus_tag="PAS_chr2-1_0056"
                     /codon_start=1
                     /product="Palmitoyltransferase that acts on the SNAREs
                     Snc1p, Syn8p, Tlg1p and likely on all SNAREs"
                     /protein_id="XP_002490937.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0056"
                     /db_xref="EnsemblGenomes-Tr:CAY68657"
                     /db_xref="GeneID:8198175"
                     /db_xref="GOA:C4QZI3"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:C4QZI3"
                     /translation="MVQFIPILVLIFLLFCFILIVLFGDLPSYRGTLIPRIRQTLILI
                     LSCSGNGLVAADRRFLGGVVTKLVSSPIIRKTLGWLIPSMYFVIMWNCLKLFFNKVYP
                     TLYSQLEFILVIVPSLIVNFSSFLLATFISPGVPTHTDLDKLLAQFPYNGLIFHSFYD
                     YKFSNPEYYNKKVTCSTCHLTKIPRSKHCSHCGQCFLLLDHHCIWLNNCVGYNNYKWF
                     LIFLVDMDWVFLYGGYLNYKFLKNQIADEVPWSSYLREIWVLRKVSFDNEVAQILLLL
                     CTVLFPVVFGFTIEHFRNIYLGVTTNETAKWKFIQALIEEGILYQYSDKNTQCTYLIK
                     SRLHFLRLDNEESFKDIDFMIGRLSKIESIHDIDNIYDKGFLQNFKERMRIQ"
     gene            complement(<102265..>106845)
                     /locus_tag="PAS_chr2-1_0057"
                     /db_xref="GeneID:8198176"
     mRNA            complement(<102265..>106845)
                     /locus_tag="PAS_chr2-1_0057"
                     /product="Aminophospholipid translocase (flippase) that
                     localizes primarily to the plasma membrane"
                     /transcript_id="XM_002490893.1"
                     /db_xref="GeneID:8198176"
     CDS             complement(102265..106845)
                     /locus_tag="PAS_chr2-1_0057"
                     /codon_start=1
                     /product="Aminophospholipid translocase (flippase) that
                     localizes primarily to the plasma membrane"
                     /protein_id="XP_002490938.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0057"
                     /db_xref="EnsemblGenomes-Tr:CAY68658"
                     /db_xref="GeneID:8198176"
                     /db_xref="GOA:C4QZI4"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR026871"
                     /db_xref="UniProtKB/TrEMBL:C4QZI4"
                     /translation="MVGKSSKGVTSPQKSARFDENMSNGESELGRADSILKSPNPMHL
                     SSFHLPRINERVQFDQENDSIEKDKEEEEGKMKRMRWGTTRHASGRPKRSKSIWRRNT
                     TRRREKEEPQESNPTNVANDHRGEQRKIFHNLPLDPDMLAENGDPRNTYPRNKIRTTK
                     YTPLSFIPKNIAFQFRNIANVYFLTMIILGAFDIFGVPNPALSAVPLIVIVIITAIKD
                     AIEDSRRTGLDMEINNQITHLLHGIPNPNVLSSNVSLWRKFKKANTKLLFIVLRSVKK
                     LFKKSEIKLPEAANNRVSLETMRSSIGEDPFNSELKPLKFSRDYWKDVKVGDIIRIKN
                     NDSIPADVCILATSDEDGACYVETKDLDGETNLKVKNSLKCTSSVVRRPHDLDKLQFH
                     IDSEGPHHNLYSYQGNFVLHDGYSSSSEPITINNLLLRGCSLRNTKWAIGIVIFTGVD
                     TKIMINAGITPTKKSKISRDLNYSVLLNFLLLFILCLVSGLVNGIYYTNDNTSRTYFE
                     FGTIGGTPAVNGIISFFVAVILYQSLVPISLYVSIEIIKTAQAFFIYSDVKMYYPQLD
                     YPCTPKSWNISDDLGQIEYIFSDKTGTLTQNVMEFKKCTINGVSYGRAYTEAYAGIRK
                     RQGVDVEEESSREKKEIEADRLEMFESLQKISKNPTLSLEDLTFVSKLFVDDLKKEDS
                     VQKHCNENFMLALGLCHTVVTEENPKTGKVEFKAQSPDEAALVSTASDMGFTFVDKTK
                     KGMILNVQGEERQYQILSTLEFNSTRKRMSAIIKIPPTSPDAKPKALLICKGADSVIY
                     ERLSKTRNNTKMVDRTAIHLEQFATEGLRTLCIAQRELEWEEYEEWAIRHDEAAASIT
                     DREERLEECADSIERELVLLGGTAIEDRLQDGVPDAIELLGQAGIKLWVLTGDKVETA
                     INIGFSCNLLGSYMDLLIIKTHGEDVHEVLGKDYSDTDEKQVVQRLISKYLEENFDMQ
                     GSMEELMQARKEHNPPSPRFGLIIDGDALKIALQDDCKRQFLLLCKQCKAVLCCRVSP
                     AQKAAVVKLVKDSLNVMTLAIGDGSNDVAMIQAAHVGVGIAGEEGRAAAMSSDYAFGQ
                     FRYLARLVLVHGRWSYKRLAEMIPSFFYKNVIFTLALFWYGIYNNFDGSYLFEFTYLM
                     FYNLAFTSLPVIFMGIFDQDVSDVVSLLVPQLYSTGILRSEWTQSKFWWYMGDGFYQS
                     VICFFFPYLMYYKNGFVTMNGLQLDHRYLIGTVVATISILACNIYILFHINRWDWLTM
                     LSILFSIVVLYAWTGIWSSSLSSGEYYKAAASMYGTLSFWVCSFVGLVICLIPRFTYD
                     FFQKLYFPKDIDVIRECVDRGDFSQYPDDYDPTDPNRKKISQYSRDMLAEQQPTYKEE
                     LYKPTMAVNHEYRDSINGVAGKRGSFMKSIFHKNKNKNDANIARYNAYGQSASSLQTE
                     EIEMEFTSDDQDKGAALRMKNSRQSFESRRRGSLNPERRASLNNTRLQMIRNGELDEN
                     PDTSPSAIQGIRTSMDLPELTAAETLVSLTSK"
     gene            complement(<107358..>107813)
                     /locus_tag="PAS_chr2-1_0058"
                     /db_xref="GeneID:8198177"
     mRNA            complement(<107358..>107813)
                     /locus_tag="PAS_chr2-1_0058"
                     /product="Ubiquitin-conjugating enzyme involved in the
                     error-free DNA postreplication repair pathway"
                     /transcript_id="XM_002490894.1"
                     /db_xref="GeneID:8198177"
     CDS             complement(107358..107813)
                     /locus_tag="PAS_chr2-1_0058"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme involved in the
                     error-free DNA postreplication repair pathway"
                     /protein_id="XP_002490939.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0058"
                     /db_xref="EnsemblGenomes-Tr:CAY68659"
                     /db_xref="GeneID:8198177"
                     /db_xref="GOA:C4QZI5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C4QZI5"
                     /translation="MSQLPKRIIKESQRLISDPVPGITAVPHEDNLRYFQVTIQGPKE
                     SPYQDGLFKLELYLPDDYPMVAPKVRFLTKIYHPNIDRLGRICLDVLKKNWSPALQIR
                     TILLSIQALLSAPNPDDPLSNEVAEHWKRDEQDAIATAKEYTKLYATEQ"
     gene            <108193..>108432
                     /locus_tag="PAS_chr2-1_0059"
                     /db_xref="GeneID:8198178"
     mRNA            <108193..>108432
                     /locus_tag="PAS_chr2-1_0059"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490895.1"
                     /db_xref="GeneID:8198178"
     CDS             108193..108432
                     /locus_tag="PAS_chr2-1_0059"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490940.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0059"
                     /db_xref="EnsemblGenomes-Tr:CAY68660"
                     /db_xref="GeneID:8198178"
                     /db_xref="UniProtKB/TrEMBL:C4QZI6"
                     /translation="MVKPKGPSTTQRTVVLLLGTGFGLYWGMKYLNENYKLVSYKPPK
                     DDKPVKFSLKYRDVQPLEKRKPIEAEIVEATSEKN"
     gene            <108797..>109495
                     /locus_tag="PAS_chr2-1_0060"
                     /db_xref="GeneID:8198179"
     mRNA            <108797..>109495
                     /locus_tag="PAS_chr2-1_0060"
                     /product="Hydroperoxide and superoxide-radical responsive
                     glutathione-dependent oxidoreductase"
                     /transcript_id="XM_002490896.1"
                     /db_xref="GeneID:8198179"
     CDS             108797..109495
                     /locus_tag="PAS_chr2-1_0060"
                     /codon_start=1
                     /product="Hydroperoxide and superoxide-radical responsive
                     glutathione-dependent oxidoreductase"
                     /protein_id="XP_002490941.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0060"
                     /db_xref="EnsemblGenomes-Tr:CAY68661"
                     /db_xref="GeneID:8198179"
                     /db_xref="GOA:C4QZI7"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:C4QZI7"
                     /translation="MSVIEITSKEHFTQVTDVPKDKLLALYFHTQWAPPCIQMNTVYQ
                     TLSQQHPEVSFISINADNHSELSEMFDVSAVPFFALIRDNTILKEMSGADPKEFVTSL
                     NELTNGKSTGEDSQRNEQHNSTAPGDETEEQLNLRLSKLTSAAPVMLFMKGTPASPQC
                     GFSRQVVAILREHQVRFGFFDILKDDSVRQGLKKFSDWPTFPQLYINGEFQGGLDIIK
                     ENLQEDPKFFENTI"
     gene            complement(<109581..>110858)
                     /locus_tag="PAS_chr2-1_0061"
                     /db_xref="GeneID:8198180"
     mRNA            complement(<109581..>110858)
                     /locus_tag="PAS_chr2-1_0061"
                     /product="Checkpoint protein, involved in the activation
                     of the DNA damage and meiotic pachytene checkpoints"
                     /transcript_id="XM_002490897.1"
                     /db_xref="GeneID:8198180"
     CDS             complement(109581..110858)
                     /locus_tag="PAS_chr2-1_0061"
                     /codon_start=1
                     /product="Checkpoint protein, involved in the activation
                     of the DNA damage and meiotic pachytene checkpoints"
                     /protein_id="XP_002490942.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0061"
                     /db_xref="EnsemblGenomes-Tr:CAY68662"
                     /db_xref="GeneID:8198180"
                     /db_xref="GOA:C4QZI8"
                     /db_xref="InterPro:IPR004582"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZI8"
                     /translation="MQIDLTRVSKRPRLSKRPKSDSSPWIEKYAPRKIESIAVNPQKI
                     KQVQSALSQCLQGLIKIIFLVGPTGTGKSTVARAVSRLLLNEVFGKNEGLDRVLDYES
                     GKGSEHFAKFLQECLILTHTKTAKSIIVDDLPNLSNDVTREKTSSALLRWLDYRGLTP
                     PLIICVSENSQGEEANQYVEKMFDKQVLNHSKVVRINFNKVTQKILEKVLKNILRNEG
                     AQCKDLQSFSSMGDISSAINGMEQNVKHGFSDVKDDDIGLFDAIGKVLYGSRNSRMRE
                     LIADQYKYIWSRFNLCLLENYTNVKWFHSRMDNKKWEALESIVDCLSHSDLLKDVYLP
                     VFKLRYEMDKLEKLGNVDSGAKHKINYFSKLPKKEITVKFDQYKYYEDLLAKRRKNYN
                     SASLSKGTTDESEIESIEDSEMTTDDELDNMEL"
     gene            <111011..>112648
                     /locus_tag="PAS_chr2-1_0062"
                     /db_xref="GeneID:8198181"
     mRNA            <111011..>112648
                     /locus_tag="PAS_chr2-1_0062"
                     /product="JmjC domain-containing histone demethylase which
                     can specifically demethylate H3K36 tri-and dimethy"
                     /transcript_id="XM_002490898.1"
                     /db_xref="GeneID:8198181"
     CDS             111011..112648
                     /locus_tag="PAS_chr2-1_0062"
                     /codon_start=1
                     /product="JmjC domain-containing histone demethylase which
                     can specifically demethylate H3K36 tri-and dimethy"
                     /protein_id="XP_002490943.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0062"
                     /db_xref="EnsemblGenomes-Tr:CAY68663"
                     /db_xref="GeneID:8198181"
                     /db_xref="GOA:C4QZI9"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="UniProtKB/TrEMBL:C4QZI9"
                     /translation="MTRAIKPDHYEQGIPVFKPSTDQFEDFYAFNKAVHPYGMQSGII
                     KVIPPSDWIDSLHDSPDYLTQEDLLNVKLKNPIEQQVSLMSNKSCFSIDNVEKHRTYT
                     LPQWKKLHDQLKYSLPRPRGAKSDTFNSKDGPIPKEKEGEFTAKIDTSIYEPDYIEFL
                     ESQYWKSLKFSAPLYAADSLGSLFPKNLKTWNVSSLPNLLDYLPEKIPGVNDSYLYAG
                     LWKATFSWHLEDQDLHSINYIHFGAPKKWYSIPQDQHREFYQLMSNTYPDDAKHCPEF
                     LRHKTFLVDPKYIRSNGITVNEIVHREKEFIITYPYGYHSGFNLGYNLAESVNFAIEE
                     WLPIGLRAKKCECIDDSVGIDVRKLMESVSKCILCPTLMQKNIFQESFDKLLILGTNS
                     KAHRICGKLIPGLEVDGDLITKYFSMIDNTKLSICNYCGEGGYCVSCSFQDCTNCYHV
                     LCSLNSNVSIDRCKIYCELHKGEAVTTFDSLEIGDIISFDSKYGEIVSLDKEKETTTM
                     ATFPEAQHKLIHRYQFDSIKAPSRKRERDNNDSELVF"
     gene            complement(<112637..>113545)
                     /locus_tag="PAS_chr2-1_0063"
                     /db_xref="GeneID:8198182"
     mRNA            complement(<112637..>113545)
                     /locus_tag="PAS_chr2-1_0063"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490899.1"
                     /db_xref="GeneID:8198182"
     CDS             complement(112637..113545)
                     /locus_tag="PAS_chr2-1_0063"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490944.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0063"
                     /db_xref="EnsemblGenomes-Tr:CAY68664"
                     /db_xref="GeneID:8198182"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ0"
                     /translation="MSDLSNLTFDFLLYEVTPVVISLSTLIPFLIIHGLILCDFIGES
                     NDKAERLFSLIINSYPSLTLYVLEILNLAFPLMIFVKSRLFNLDISASLNNYTKHIPA
                     KYIQITVVAIQVWRILQVLFAPSQILFKGQSDNNFVPVVIFLVFIYNIRTSAVQSDEA
                     VESKLEEYGYQEQENSMISLQKYCLAVAITFNERLLSLNSLISFVQLATGNLSSNIEI
                     LYFQYRDISPIISSHPLFNSLFEGLFHIYQLGMLSSILLATCTIETNSYLSMKKFKHT
                     FWIVVSLILIIEKDFLFIALMDKLED"
     gene            <114025..>114345
                     /locus_tag="PAS_chr2-1_0064"
                     /db_xref="GeneID:8198183"
     mRNA            <114025..>114345
                     /locus_tag="PAS_chr2-1_0064"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490900.1"
                     /db_xref="GeneID:8198183"
     CDS             114025..114345
                     /locus_tag="PAS_chr2-1_0064"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490945.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0064"
                     /db_xref="EnsemblGenomes-Tr:CAY68665"
                     /db_xref="GeneID:8198183"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ1"
                     /translation="MGSLSPESDVEFPSLFSVDTSSSTHCSITEYAAEKRPTFTIPIC
                     VSFPYYEQKNMLSVKVNRRRDTIEISWRLKKWRQRYIDGSYNSPSDLANEQPEISNHT
                     TEQC"
     gene            <115122..>118688
                     /locus_tag="PAS_chr2-1_0065"
                     /db_xref="GeneID:8198461"
     mRNA            <115122..>118688
                     /locus_tag="PAS_chr2-1_0065"
                     /product="Chitin synthase III, catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin"
                     /transcript_id="XM_002490901.1"
                     /db_xref="GeneID:8198461"
     CDS             115122..118688
                     /locus_tag="PAS_chr2-1_0065"
                     /codon_start=1
                     /product="Chitin synthase III, catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin"
                     /protein_id="XP_002490946.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0065"
                     /db_xref="EnsemblGenomes-Tr:CAY68666"
                     /db_xref="GeneID:8198461"
                     /db_xref="GOA:C4QZJ2"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ2"
                     /translation="MKNSFSSDNYQEFDVESGDLNRKRSLVRHDRARNDPHNPHYHYA
                     NVVAQESDHIKVQSFDTGLDPTRWDSLSRSASARGRSIPLDDLNSKGQIMHDFEDDST
                     QVDPRGTEIQGLNDEQSLHRNNTIRSNKLASKVIKSKSSSKYEFWPIYCTIITFWAPS
                     PLLRLFGFKTKERQFAWREKMGLISIILYIGTFVAYLTFGFSRTVCSNTRTRIENNSV
                     STGYLIINGRAYDLTASSHPAAAGIDAGTNILYPPINAGGKDASFLFQNVNGNCKGLI
                     TPKEDSEIPFDGDEVAWYMPCKLFAQDGSSSPNFTASEYYNGWGCHTSTTARDAFYSL
                     DVTGDVYFTWNDIRNSSRNLVVFSGDVLDLDLISWIDSDNLNYPELFDRLRTDEQMRG
                     HDISILLSSSSERKAARCLVETIKVGVIDSETIGCIASDIVLYVSLIFILSVVISKFL
                     CACYFKWVISRRQGATTSSTKEMNERERDIEDWADDINKQAPVASVQPFQRFDYRNQS
                     KGNRVSKLFNRASRYSMATQLDGFDYVNSVGTLASSAKYPMTTMTLQTTKMLRASKDR
                     RSHVRNRSSVMLNTNASRQSLLLGSDYHNPFDANDGFYIQSLSADLIHPDVAPQPPVE
                     YQPYGYPLAHVITLITCYSEDEDGLRTTIESIATTDYPNSHKLILVICDGMIKGAGND
                     KTTPEIALDLMTDFVTPPDDVQPFSYVSVAQGSKRHNMAKVYAGFYNYKDSNLPPEKQ
                     QRVPVVTIVKCGTPAETGAAKPGNRGKRDSQIILMSFLQKVMFDERMTQLENEMLKSI
                     FSITGLMTEMYEIVLMVDADTKVYPDSLTHMVAEMVKDPTVMGLCGETKIANKRQSWV
                     TAIQVFEYYISHHQAKAFESCFGSVTCLPGCFCMYRIKTPKGRDGYWVPILANPDIVE
                     RYSDNVLDTLHKKNLLLLGEDRYLSSLMLQTFPKRKQIFVPKAACKTIVPERFKVLLS
                     QRRRWINSTVHNLFELFLVNDLCGTFCFSMQFVIGIELVGTLVLPAAICFTVYVIIFA
                     IVSHPTPILSLVLLGIIFGLPGLLIVVTVSSWSYILWLLVYLVALPIWNFVLPSYAYW
                     KFDDFSWGETRVTSHEIKDAHGEIEGLFDGSHIIQKRWREFERDRRRSNSPNLNHRGS
                     ELPVPSAAWDPANINHDFEKDSDVYVNAQEEAESSSSQNYLK"
     gene            complement(<118734..>123380)
                     /locus_tag="PAS_chr2-1_0066"
                     /db_xref="GeneID:8198462"
     mRNA            complement(<118734..>123380)
                     /locus_tag="PAS_chr2-1_0066"
                     /product="Peripheral membrane protein with a role in
                     endocytosis and vacuole integrity, interacts with Arl1p a"
                     /transcript_id="XM_002490902.1"
                     /db_xref="GeneID:8198462"
     CDS             complement(118734..123380)
                     /locus_tag="PAS_chr2-1_0066"
                     /codon_start=1
                     /product="Peripheral membrane protein with a role in
                     endocytosis and vacuole integrity, interacts with Arl1p a"
                     /protein_id="XP_002490947.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0066"
                     /db_xref="EnsemblGenomes-Tr:CAY68667"
                     /db_xref="GeneID:8198462"
                     /db_xref="GOA:C4QZJ3"
                     /db_xref="InterPro:IPR026829"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ3"
                     /translation="MTLAYLVQELGTLSHDSKRKYPELKEAADASIDMIRSFKQRVPI
                     QELVKFESFVDPFLLSIQTRSLKLVNTGLACLQKLIIESAIADTKLESLVNSLLVCSQ
                     FKSDDVHLKILQLLSLLLQSYPIRLKNELLSKFLFVCSNLYTQSKSPAIINTASATYL
                     QLLTGVFDKIKIEDSKISPDDPVYTVSLDDNKTIEVRQCAYDSQRILLDLINLIQHQK
                     PIFLKTNSISEEFGLELLETILKDNSELFNEHLELEYLLRIKISPLILDYLTSSDEFP
                     IMVRVARIIQLMLLQHFTTLKNESKPILSTLTFQLTKDSNSPFWKKVLSLEIYLSIVK
                     DFTLVQQIHKTYDSQLDSNEKTVFKSFFDVCFEIVVLNKSLLNTGDTILPKFISREYQ
                     KPADFAGLTVAKSSSKVLFIDYLDKLEPPQTSSTYMLYLILQTLTSMCDSLSKAVIGL
                     DKNSSSYIEIKDLVSNNWVLWKDMATVFLYSSLCETLFNGLTKSLQKLTLTVSFLDLK
                     DARKKLLFLICKSITNLTGSSGFRSKSLGESIVGTISTTIQTLSQQPVSNVSTSIQPY
                     SRSFNSRMAVLFRMLINLVISLGNLLDGSEWILIFKTIQWLDYFLNGASSDKLLPQDK
                     PSADLISSQEILSIQDSIVKLEDSVSGYNSTTLSLIIESFVTLTTELLLEEGGSKVPF
                     EENDDLTLRTSSYNKLFFVGKLTNILQNNTIQLLATANGVWDYTLEFYKSIIQQRTLD
                     DQTRFLITDSFDSVVKKIAADGFTNDEIRNTEHVVLNSLNKIDTSLSNLPTSKELLIV
                     NCETDIRLRVLKTLSTVLNRYGSNFAESWSLVYTLLDAPFQLIEKTVLEDPILLKDPQ
                     LRINVGQLLESNFETVKLLLDEFLTSLPKKQLKPLIDILCKFFYQTLDLNISLNSLSY
                     FWLISDSLKNSFNATKDSSYVGENLDLVLNDKEDLTTLINSPSTDPALIDHLIWICLI
                     ISLNKAASDPRAQVRNGAISTCFSIIDSHGSLLGCWKLIYRLVIEKEFYTIDYSDSLD
                     SDHLESITLILRGLCSLYSSQFLSFDSSDSKNTKSLLLFWEGLFGYFEKLLKLNWLDL
                     EYQIFKQFQELSKQGLEHEIPTELKELFYSFWSTYQILYQVNPLAQDTLVVYFESFDS
                     IYKMVSPIQDVQKMERILAILNTAIRYPILPSTRSSDSIKSTKLQETVLNILGYMEFD
                     DYHYKSMLIQQLANISMLPLAPKSAIEQKFIKKVQDSGFQVPTYIHFSHKAIIVLENK
                     LADLSPAKVLDLGSFTERLFEQLLTIVQERSVGLEETEQELWMIASRILVDLSQKLLQ
                     SYDSSLEYLSMLFIRLTDTILSYYGKNSLYERFDIVQYDKLYACLIPPLTEMPKSVQV
                     EFAHSIWKNSFLYEFDDTETALIGLDELKDIPAQQSLCSRLLSFPFDTIANTTSPIQT
                     HPRKNLSLRCLNDLIDLCSDPQFQKVVTPFFISRTAIALHRVIVCKSLLDRRPLPRLQ
                     HLEIETIINGISSLVQKNGDRNIQDQIHELKPLFLRYVPFTDERDLQKVLSLSE"
     gene            <123721..>124896
                     /locus_tag="PAS_chr2-1_0067"
                     /db_xref="GeneID:8198463"
     mRNA            <123721..>124896
                     /locus_tag="PAS_chr2-1_0067"
                     /product="Pseudouridine synthase, catalyzes only the
                     formation of pseudouridine-55 (Psi55), a highly conserved"
                     /transcript_id="XM_002490903.1"
                     /db_xref="GeneID:8198463"
     CDS             123721..124896
                     /locus_tag="PAS_chr2-1_0067"
                     /codon_start=1
                     /product="Pseudouridine synthase, catalyzes only the
                     formation of pseudouridine-55 (Psi55), a highly conserved"
                     /protein_id="XP_002490948.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0067"
                     /db_xref="EnsemblGenomes-Tr:CAY68668"
                     /db_xref="GeneID:8198463"
                     /db_xref="GOA:C4QZJ4"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR014780"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ4"
                     /translation="MNGIFAVEKPYGVSSNKFLQQINNIFTNSSIFGADLAELRKRKL
                     AGYGKNSARGLKKASKAKVKMGHGGTLDPLASGVLVIGVGQGTKRLQEYLGGSTKLYE
                     TEALLGAATTTGDSEGDVICKTEVNHITKDMCLQTAKKFVGELIQTPPLFSALKMNGK
                     PLYEYAREGKPLPMEIKPRTVQVYSLEVEESDLLSTDHDYKLKESIIDEDGTPLESKL
                     SENPLLQNDKLHFSKEFIESASQEGLRTDVDPPHLIKDISVQISKAPLLHFVAQVSSG
                     TYIRSLVSDFGKALSSSAYMVKLIRRKQGEWDLSSNCFTLADFQENEQVWGPVLKKVF
                     EHGDEINVLEEMQRSKEKFVQNEHQEQSEETSEEVPKENLEARSEETTNKTDETFTA"
     gene            complement(<124961..>126730)
                     /locus_tag="PAS_chr2-1_0068"
                     /db_xref="GeneID:8198464"
     mRNA            complement(<124961..>126730)
                     /locus_tag="PAS_chr2-1_0068"
                     /product="N-glycosylated integral membrane protein of the
                     ER membrane and plasma membrane, functions as a stre"
                     /transcript_id="XM_002490904.1"
                     /db_xref="GeneID:8198464"
     CDS             complement(124961..126730)
                     /locus_tag="PAS_chr2-1_0068"
                     /codon_start=1
                     /product="N-glycosylated integral membrane protein of the
                     ER membrane and plasma membrane, functions as a stre"
                     /protein_id="XP_002490949.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0068"
                     /db_xref="EnsemblGenomes-Tr:CAY68669"
                     /db_xref="GeneID:8198464"
                     /db_xref="InterPro:IPR024338"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ5"
                     /translation="MFCFIYGILLWSLVVQALSSNMWPHCYDLLTTVDGKFLRHTYYH
                     PEVTLQECLNLECDELNDSQDRKQCLELEELDIEPLDFLERDIEYTSQIDQDALVHRS
                     FRFTSVDLSIGDDSQLNDWKPVRKYISQNETHYYEFPINNTNPGVSSSFDALIFITGN
                     ICSLPDTDLDENGLSLYYTFNQSVFSIETIDQMTKLDFRLGYVQALASNPTSAPFSTL
                     YVAMQPNDVGTNTVSGQWTYELGISQNGLVFQWDDRAWAHLLDADGESALLMTGALDT
                     DLYSNISDIDPGLTDSYSLHLFDYTYKSTFQNLNRSWCAIKSGPELSSISINTSFVQK
                     NESIREQFYVQNLNSSSQYIAYLTQNSGTQNSDSGGTVFHQFEFETMLEDTCTLIYDL
                     EFCNNVDYAVPMSMQFFDGLISATELGALYDDYAKEHYENFTKSLQIVQCDTDASSRY
                     SPLRTCQDCANSYQNWLCSVLIPRCTTRNNTSGYKYRTTSDGRNSFINEEIQPPNPYY
                     EILPCVDSCNAIVRDCPGSFGFVCPTTNETIRESYYWDEGEDYVSCNALGFIVQSSGA
                     RLSVKRNLEVVIALWIIIIYKLL"
     gene            <127073..>128071
                     /locus_tag="PAS_chr2-1_0069"
                     /db_xref="GeneID:8198465"
     mRNA            <127073..>128071
                     /locus_tag="PAS_chr2-1_0069"
                     /product="Subunit of heteropentameric Replication factor C
                     (RF-C), which is a DNA binding protein and ATPase t"
                     /transcript_id="XM_002490905.1"
                     /db_xref="GeneID:8198465"
     CDS             127073..128071
                     /locus_tag="PAS_chr2-1_0069"
                     /codon_start=1
                     /product="Subunit of heteropentameric Replication factor C
                     (RF-C), which is a DNA binding protein and ATPase t"
                     /protein_id="XP_002490950.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0069"
                     /db_xref="EnsemblGenomes-Tr:CAY68670"
                     /db_xref="GeneID:8198465"
                     /db_xref="GOA:C4QZJ6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ6"
                     /translation="MSIRAGQDNTNLPWVEKYRPSSLDYVYGQHDTVDTVRKFVQDGR
                     LPHLLFYGPPGTGKTSTIMALAKEIYGKNYRNMVLELNASDDRGISVVRDQIVNFAST
                     RQIFSNGFKLIILDEADAMTNVAQNALRRVIEKFTKNTRFCVLANYAHKLNPALLSRC
                     TRFRFQPISQEAIQLRINDVIKQEGINIDDDALQSLLKLSKGDMRKALNVLQACFTGL
                     DSPSQAITSPMIYECVGAPDPQDIEHVLDTIIQENWEAAFTIMNRLKLEKGYALIDLV
                     NGFVDILGGYQLEKMCRLTILKGLADIEYAISRGGNDAIQNTAVIGVIKKGFETQT"
     gene            <128169..>128714
                     /locus_tag="PAS_chr2-1_0070"
                     /db_xref="GeneID:8198466"
     mRNA            <128169..>128714
                     /locus_tag="PAS_chr2-1_0070"
                     /product="Phosphatase that is highly specific for
                     ADP-ribose 1''-phosphate, a tRNA splicing metabolite"
                     /transcript_id="XM_002490906.1"
                     /db_xref="GeneID:8198466"
     CDS             128169..128714
                     /locus_tag="PAS_chr2-1_0070"
                     /codon_start=1
                     /product="Phosphatase that is highly specific for
                     ADP-ribose 1''-phosphate, a tRNA splicing metabolite"
                     /protein_id="XP_002490951.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0070"
                     /db_xref="EnsemblGenomes-Tr:CAY68671"
                     /db_xref="GeneID:8198466"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ7"
                     /translation="MVKYINGDVFAILNQKSNLPVILAHSCNCFGSWGGGIAFALKQK
                     FPSSYTLYSDYCSRFQDNPQELLGKCLLLPISKTDPGYTSVVGDKFLIACLFTGASGG
                     KAEILKYTDVSLSHLGKIIQSKKSEISIPRVDEILQSINTDDVPIYLPKINSGIFGVP
                     WPNTEKILENHNDLKFVVYSI"
     gene            complement(<128737..>130011)
                     /locus_tag="PAS_chr2-1_0071"
                     /db_xref="GeneID:8198467"
     mRNA            complement(<128737..>130011)
                     /locus_tag="PAS_chr2-1_0071"
                     /product="Putative protein kinase, possible substrate of
                     cAMP-dependent protein kinase (PKA)"
                     /transcript_id="XM_002490907.1"
                     /db_xref="GeneID:8198467"
     CDS             complement(128737..130011)
                     /locus_tag="PAS_chr2-1_0071"
                     /codon_start=1
                     /product="Putative protein kinase, possible substrate of
                     cAMP-dependent protein kinase (PKA)"
                     /protein_id="XP_002490952.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0071"
                     /db_xref="EnsemblGenomes-Tr:CAY68672"
                     /db_xref="GeneID:8198467"
                     /db_xref="GOA:C4QZJ8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ8"
                     /translation="MVFYLDETVVESDSDNDDGHADLVEHLGANLSSAHPPTRRRKSS
                     VYSKISVHNEDTGNGQISITEYTKGEQETNASISDFEPITVLGQGAYGTVKLVKNKHT
                     SKLYAQKELKKASLVINEKHVERTMEERNILSKISEHPNIVKLFYAFHDHDKLYLMME
                     YVPGGELFQHLNEEKFLGEDIASFYAAQMALAINYLHTMGIVYRDLKPENCLLDSQGF
                     LVLTDFGLSKQSLDTGASSIEHDGSFKSIIGTPEYMAPEVLKGDPYSFSCDWWSLGAV
                     IFDMMIGKPPFTGANSKIIMDKIVNKTLKFPYYLTPTAKELLQKLLNKSPAKRDVDTT
                     FNKFQKHSFFRNIDWDALLKRDLTKISPPIVPIITNLELAENFSRDFTDLKLSDDVST
                     DLNLIPTTKTKDAFQGFSYVASNSYMNRYLGC"
     gene            <130900..>132387
                     /locus_tag="PAS_chr2-1_0072"
                     /db_xref="GeneID:8198468"
     mRNA            <130900..>132387
                     /locus_tag="PAS_chr2-1_0072"
                     /product="Delta(9) fatty acid desaturase"
                     /transcript_id="XM_002490908.1"
                     /db_xref="GeneID:8198468"
     CDS             130900..132387
                     /locus_tag="PAS_chr2-1_0072"
                     /codon_start=1
                     /product="Delta(9) fatty acid desaturase"
                     /protein_id="XP_002490953.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0072"
                     /db_xref="EnsemblGenomes-Tr:CAY68673"
                     /db_xref="GeneID:8198468"
                     /db_xref="GOA:C4QZJ9"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR001522"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C4QZJ9"
                     /translation="MEQPQAMEKVESVDVTEANAVAAGTNKLTKRIVAAGLGGKLMGT
                     KSMVDVTADQLAKDSINELLARDKALKEKYEKQKHISEQPWTKDNWHQHINWLNMILV
                     CGLPLFGAIATYYKPPTKETVILGVVLYILGGLSITAGYHRLWSHRAYSARTPLKVLF
                     ALFGAGAVEGSIKWWSHSHRVHHRYTDTHRDPYDARKGFWYSHMGWMLTKPNPRYKAR
                     ADISDLADDWIVRFQHRHYLLIMTFMALILPTIIAKYFWDDAWGGFIYGGIFKVFVIQ
                     QATFCVNSLAHWIGVQPFDDRRTPRDHFLTAIVTFGEGYHNFHHEFPSDYRNALKWYQ
                     YDPTKIVIYLSSKVGLSYNLKTFSDNAIKQGLVQQQQKKLDSMRAHLNWGTPLQDLPV
                     WDKSEFFEKSKDKKGLVIISGIVHNVENFIGEHPGGEKLVKGALGKDATTAFNGGVYA
                     HSNAAHNLLATMRVAVIRDGNANANTFSLQNEFLDKKAAAAAASN"
     gene            complement(<132422..>133921)
                     /locus_tag="PAS_chr2-1_0073"
                     /db_xref="GeneID:8198469"
     mRNA            complement(<132422..>133921)
                     /locus_tag="PAS_chr2-1_0073"
                     /product="Component of the RIM101 pathway, has a role in
                     cell wall construction and alkaline pH response"
                     /transcript_id="XM_002490909.1"
                     /db_xref="GeneID:8198469"
     CDS             complement(132422..133921)
                     /locus_tag="PAS_chr2-1_0073"
                     /codon_start=1
                     /product="Component of the RIM101 pathway, has a role in
                     cell wall construction and alkaline pH response"
                     /protein_id="XP_002490954.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0073"
                     /db_xref="EnsemblGenomes-Tr:CAY68674"
                     /db_xref="GeneID:8198469"
                     /db_xref="InterPro:IPR014844"
                     /db_xref="UniProtKB/TrEMBL:C4QZK0"
                     /translation="MTISKRNIIWRYRVPSEHTYPTCEGVQLGEGIIMCTDPAIMAYS
                     SSIKYHARCYDGHPVYSAMNNRLQDEFGISTLPIIDEDWQLFASQSTPTTSPLESSIY
                     PLIYTLSASAVIIGYLTIIVFTKNYLHSQRPTKLLRLSILLGAVAIMMYFVASIVELN
                     RQHRYEGVSNADLLISYLNSRIYINVVLFFAFFALLLAQVQIITRLFPRRKEKRYIFI
                     VGTICTVLIQIIWALSAFLSSNYYYDSEDESKLAMIPAFMYLLRISLAVVFSSLVCVY
                     AFSKSQYLFDREMFLLTAFTAIAINITVAFFIADVSEIWVSELSEVFNVTSYVICNVT
                     TWEWINRISYLEKMVQRASVLGRPYYEDDVLESTNRRSISGTGDHVEFSKKLDISIDN
                     SPSLSSSVVGSHIEKPKKARFVKLSSFKHNIRNKFSTTRDHIRSTGLRKKKGSSTVAS
                     SNNPQSNEVFVHQVQRVEVTEPSELDSDEEYDDTFTTETVITDNNHNNT"
     gene            <134416..>135756
                     /locus_tag="PAS_chr2-1_0074"
                     /db_xref="GeneID:8198470"
     mRNA            <134416..>135756
                     /locus_tag="PAS_chr2-1_0074"
                     /product="GTPase-activating protein for Sec4p and several
                     other Rab GTPases, regulates exocytosis via its acti"
                     /transcript_id="XM_002490910.1"
                     /db_xref="GeneID:8198470"
     CDS             134416..135756
                     /locus_tag="PAS_chr2-1_0074"
                     /codon_start=1
                     /product="GTPase-activating protein for Sec4p and several
                     other Rab GTPases, regulates exocytosis via its acti"
                     /protein_id="XP_002490955.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0074"
                     /db_xref="EnsemblGenomes-Tr:CAY68675"
                     /db_xref="GeneID:8198470"
                     /db_xref="GOA:C4QZK1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C4QZK1"
                     /translation="MSDRPVSASNAESLFQLYRDKSPEKPGIESKRKTVDLNGRDRYG
                     FKISASFVDQEKYNTWWDQYSRYLIRRKLKWVKLMNKNGFEADEDSMPTKFPTRSEEL
                     KRYVRKGIPAEWRGNAWFYFCKGPERLSKNKGLYDNLCAKMDTLDEVNLEAIEKDLHR
                     TFPDNIHFNDYSGEESLMIGSLRRVLRCYALYNPEIGYCQSLNFIAGQLLIFMDEEKT
                     FWMLVIIHEKLLVDVHTMNLEGVSVHQGVLLLCFRQYLPLTWSVMREHDTINDDFLVN
                     IPSLGICTTSWFMSLFIGILPVETVLRIWDCLFYEDSKSIFRISLGIFKLMEPQFVKT
                     PEDELYHLIQSFPRTILNPNDLLDVCYRKLNSISHLKQQEIQLCKQYVINYRAKYKNL
                     KHEDNNLLSNQERLKLLQEGIQEFGKPRVLKGLRWNSRLNKQIRKLRVESEHDI"
     gene            complement(<135753..>136400)
                     /locus_tag="PAS_chr2-1_0075"
                     /db_xref="GeneID:8198471"
     mRNA            complement(<135753..>136400)
                     /locus_tag="PAS_chr2-1_0075"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490911.1"
                     /db_xref="GeneID:8198471"
     CDS             complement(135753..136400)
                     /locus_tag="PAS_chr2-1_0075"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490956.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0075"
                     /db_xref="EnsemblGenomes-Tr:CAY68676"
                     /db_xref="GeneID:8198471"
                     /db_xref="InterPro:IPR019383"
                     /db_xref="UniProtKB/TrEMBL:C4QZK2"
                     /translation="MTLFFYNYHEFSIYDYKKIGESTVRSHDKPLIITHFDNPYISLL
                     SAGKGTRIVRVPRVHDVPGDSYIRFSTVLPGEEPAAIRADEQTDKEHTLETQPFTIDG
                     IYEEHGYGLTSHSPLSNIFTDEEFQKVVTEINRLLKAKRNWWMEKLSILAFGILSFYT
                     QTSVDDYVIQKNREWEEKNIDARIVPPSWNGYLSLDFEVLDPMLFAIGSESKNER"
     gene            <136541..>137110
                     /locus_tag="PAS_chr2-1_0076"
                     /db_xref="GeneID:8198472"
     mRNA            <136541..>137110
                     /locus_tag="PAS_chr2-1_0076"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490912.1"
                     /db_xref="GeneID:8198472"
     CDS             136541..137110
                     /locus_tag="PAS_chr2-1_0076"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490957.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0076"
                     /db_xref="EnsemblGenomes-Tr:CAY68677"
                     /db_xref="GeneID:8198472"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4QZK3"
                     /translation="MSVNEIVFAQKYLDLINITSPKVLSDNYSVPISSVKSPGDLSFR
                     KLKVKAVPPPRGEVQVQVNLRSIKPPKFSVDYSLSGKATIYSLKQKLVEDGQVADKST
                     IKLMNKSKIAGDEASLEDLAKDNKVSLVVMVSKETALNVQEDAEPQSELPSRVITSQS
                     WTKIHQLLRDDLGEPEASKVLDRWKTSSS"
     gene            <137155..>138129
                     /locus_tag="PAS_chr2-1_0077"
                     /db_xref="GeneID:8198473"
     mRNA            <137155..>138129
                     /locus_tag="PAS_chr2-1_0077"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490913.1"
                     /db_xref="GeneID:8198473"
     CDS             137155..138129
                     /locus_tag="PAS_chr2-1_0077"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490958.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0077"
                     /db_xref="EnsemblGenomes-Tr:CAY68678"
                     /db_xref="GeneID:8198473"
                     /db_xref="GOA:C4QZK4"
                     /db_xref="InterPro:IPR000246"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C4QZK4"
                     /translation="MDFALIHLGAGKHNEKNKDHYRNLCFRALKRKKTKTKAGSPNPY
                     NYVKERQSFEELLSVLDSIANVLESSPLTNTGRGASVNCEGNILCDASIILQESKILH
                     SSCCEITSPFPISVIIDNFKEQLNPRHDHILSPLATVYHKSSCRPSLITPSNQDISDT
                     IGISLLNNSISLTASSSGGNLFKPVGRIGPAGIIGSAIYSDFNDCYRVSIMCTGSGED
                     IISMDLARSVCNYLLANMTEDAFASELMSNHIEKCASKYYLRSEYGLYVGVVGWILDA
                     HSRDLRVIYAHSTESLVFAYFDSHLKFYYSTNNKVGKLLHGEFKCSSP"
     gene            <138721..>140799
                     /locus_tag="PAS_chr2-1_0078"
                     /db_xref="GeneID:8198474"
     mRNA            <138721..>140799
                     /locus_tag="PAS_chr2-1_0078"
                     /product="Plasma membrane G protein coupled receptor
                     (GPCR) that interacts with the heterotrimeric G protein a"
                     /transcript_id="XM_002490914.1"
                     /db_xref="GeneID:8198474"
     CDS             138721..140799
                     /locus_tag="PAS_chr2-1_0078"
                     /codon_start=1
                     /product="Plasma membrane G protein coupled receptor
                     (GPCR) that interacts with the heterotrimeric G protein a"
                     /protein_id="XP_002490959.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0078"
                     /db_xref="EnsemblGenomes-Tr:CAY68679"
                     /db_xref="GeneID:8198474"
                     /db_xref="GOA:C4QZK5"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR022596"
                     /db_xref="InterPro:IPR023041"
                     /db_xref="UniProtKB/TrEMBL:C4QZK5"
                     /translation="MSTETARITDFSDESARIIRILAISSSSTSIAFGLVSFYLFGAI
                     DYSKRVFRHQLIIFLILFDFLKAIFLLIFPARTLDNPESADNRTFCNAIGFFTAVSIE
                     GADIAILAFAVHTALLIFRPNKKVRNGNNLEGGLFRYRYPVYLVSFLTPILLASLAFI
                     NGSGYVPISSWSYLPVHPIWYRLVLSWVPRYIILISIITIYCSIYFYILSQYNSVGGT
                     AKIMWKESLWYKLSNIVLMLFFPDISLSSRSHGQNAEAAPDSKNIDNVSVDDNTEFGN
                     WNRLFSIKEEDNSMSSNIQRPFEKVKIPSSSSMSPRNTAAYEEKEKDQIIHDLRERIQ
                     LETQETINKETVELFQIRRLQILKQMKVIFIYPIAYIFLWLFPFILQCVEFNYSREGG
                     PVLWLNYVAAFMQPFNCTVDSLVFFFRETPWNLTSSSVDHLYEHKYSDFRRSVSFLPM
                     YGLPDQYLRGTPPVAPSNADQNNSISPFTNYLMNKPRSLRPSVSSNIDPSQTEEIAGA
                     DDDMSFTEALQFLRGEPPAEKPVPNSADLSASPKARKLSKVSWRSSRRGSATDSHYSA
                     KRNRSDPSSDEQPSSNLNSSNKSPDDPSDSPPFSLPHTGALEPQLTHIPETSASSPKH
                     SPKQSRQSSASNRKDVPFLGFFKSSKSEPQSSEASQVDNHSHQSHSQSHNGSEEDLTF
                     LEFLSQGPKN"
     gene            complement(<140981..>142621)
                     /locus_tag="PAS_chr2-1_0079"
                     /db_xref="GeneID:8198475"
     mRNA            complement(<140981..>142621)
                     /locus_tag="PAS_chr2-1_0079"
                     /product="Subunit of the cytosolic chaperonin Cct ring
                     complex, related to Tcp1p, required for the assembly of"
                     /transcript_id="XM_002490915.1"
                     /db_xref="GeneID:8198475"
     CDS             complement(140981..142621)
                     /locus_tag="PAS_chr2-1_0079"
                     /codon_start=1
                     /product="Subunit of the cytosolic chaperonin Cct ring
                     complex, related to Tcp1p, required for the assembly of"
                     /protein_id="XP_002490960.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0079"
                     /db_xref="EnsemblGenomes-Tr:CAY68680"
                     /db_xref="GeneID:8198475"
                     /db_xref="GOA:C4QZK6"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012720"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C4QZK6"
                     /translation="MNGQVPTIVVLKEGTDTSQGRGQIITNINACIAIQESLKPTLGP
                     LGSDVLIVGADGKTTISNDGATILKLLDVIHPAAKILVDISRSQDAEVGDGTTSVTLL
                     AGEILKECKGFIEEGISTTVICKGLRKASQLAVKNIKELQVEVSSKGGANRELLENCA
                     KTAMSSKLIHNNDEFFTKMVVDAVLTLDQEYLDEKLIGIKRIPGGSMEDSLFVNGVAF
                     KKTFSYAGFEQQPKQFTNPKILNLNVELELKAEKDNAEVRIEQVKDYQNIVDAEWKII
                     TQKLEAIEASGANIVLSKLPIGDLATQYFADRNIFCAGRVASGDLDRVIQAVGGSIQT
                     TTSDILPEHLGTCASFEEVQIGGERYNIFKGCPEAKTCTLLLRGGAEQVIAEVERSLH
                     DAIMIVRRAVKNTAIVAGGGAIEMELSKILREYSRTIPGKQQLIIGAFAKALEVIPRQ
                     LCDNGGFDGTDLLNKLRAAHAKGEVWYGVDFRNGGINDNLKSFVWEPSMMKINAIQSA
                     TEAAMLILSVDETIKNEERASAGAAAAAQGARGRNIPQ"
     gene            complement(<142809..>144665)
                     /locus_tag="PAS_chr2-1_0080"
                     /db_xref="GeneID:8198476"
     mRNA            complement(<142809..>144665)
                     /locus_tag="PAS_chr2-1_0080"
                     /product="Peripheral protein of the cytosolic face of the
                     mitochondrial outer membrane, required for mitochond"
                     /transcript_id="XM_002490916.1"
                     /db_xref="GeneID:8198476"
     CDS             complement(142809..144665)
                     /locus_tag="PAS_chr2-1_0080"
                     /codon_start=1
                     /product="Peripheral protein of the cytosolic face of the
                     mitochondrial outer membrane, required for mitochond"
                     /protein_id="XP_002490961.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0080"
                     /db_xref="EnsemblGenomes-Tr:CAY68681"
                     /db_xref="GeneID:8198476"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4QZK7"
                     /translation="MESDNISKAVATASALYSSGSLNKDVFLKNNSYRKTINETLSNK
                     NTSMILKYSSAIPLLSRRRHSLDKKQRNRKPKLYAELSDELVRDIPDERLETDHGGPT
                     SVFSLFQGFNATLPEVNEEIERIKKGSSKLLEGGFVDKESRELDDPNRDPLPAGITES
                     KIKHSQNPHHLKQFKAEIDYKLDLLEIRKGLTANEIQEIDIKLEKLHKMRASVFNKIA
                     LYERDEIALENYLDEIESRLSLIKDIDPDLNETDESSEEDEDAEDVEPDPKSENLMMN
                     QSVYGRLTDEHHKKSRKIKPTLQQYYEPGSNIAEFHGHEDTITTFGFDLPFGTMVSAS
                     LDNTVRVWDLSRSKCIGLLEGHNAAVKCLQIEDSTVVTGSLDASIKMWDLNRLHNEEQ
                     DPLIHSFDSHVDEITALHFNNNTLISGSNDKTIRQWDMTTGHCLQTIDVLWASSMMNA
                     SSGSYTTSSPVVAAEQSSFIGSLQCYDAALATGTADGLVRLWDLRSGEVIRQLSGHTG
                     PVTCLQFDDKHLITGSSDRSIRIWDLRTGNIVDAFVYDTGITSLQFDSRRIISTNGDS
                     VVKVYDRIEEKHWDCGPRVSDPSSEVNIIFARYQEGYMVEGRTDGAFGVWAI"
     gene            complement(<144960..>145517)
                     /locus_tag="PAS_chr2-1_0081"
                     /db_xref="GeneID:8198477"
     mRNA            complement(<144960..>145517)
                     /locus_tag="PAS_chr2-1_0081"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490917.1"
                     /db_xref="GeneID:8198477"
     CDS             complement(144960..145517)
                     /locus_tag="PAS_chr2-1_0081"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490962.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0081"
                     /db_xref="EnsemblGenomes-Tr:CAY68682"
                     /db_xref="GeneID:8198477"
                     /db_xref="GOA:C4QZK8"
                     /db_xref="InterPro:IPR013966"
                     /db_xref="UniProtKB/TrEMBL:C4QZK8"
                     /translation="MSLDLHLRNIQKNAKSLRTLYFKPPGIFTNAIINKPEITRLIRD
                     SDPLERSLYTIEDGEPHRIDGINNYAETPSDEKTIIKIPDYSTQDTPSTLIQLNDETE
                     ISELLERASDLVTRYPLEDMAAKLEASTLKYEQLQQSIAEYELLEQQQAEDLQGHDIN
                     EDQLEEIAKEETRIRELKLILEQND"
     gene            <145849..>149526
                     /locus_tag="PAS_chr2-1_0082"
                     /db_xref="GeneID:8198478"
     mRNA            <145849..>149526
                     /locus_tag="PAS_chr2-1_0082"
                     /product="Subunit of the multiprotein cohesin complex,
                     essential protein involved in chromosome segregation an"
                     /transcript_id="XM_002490918.1"
                     /db_xref="GeneID:8198478"
     CDS             145849..149526
                     /locus_tag="PAS_chr2-1_0082"
                     /codon_start=1
                     /product="Subunit of the multiprotein cohesin complex,
                     essential protein involved in chromosome segregation an"
                     /protein_id="XP_002490963.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0082"
                     /db_xref="EnsemblGenomes-Tr:CAY68683"
                     /db_xref="GeneID:8198478"
                     /db_xref="GOA:C4QZK9"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:C4QZK9"
                     /translation="MGRLIGLNLYNFKSYRGLNRIGFGSANFTSIMGTNGSGKSNLMD
                     AISFVLGLQSNSLRSTNAKDLIYRGRVAGTDNDDDDDDMDNSDKENYSGDGSRNAYVS
                     AIYETSEGEQVQFKRVINSNGSTEYRINEKLVTMSEYSDLLKDENILIKAKNFLVFQG
                     EVEKIAAQSAKELTNIIEIISGSNEYKEEYDYLKEQLDEAHNVTVATFGRRRALKNDF
                     KQYKEQTIEVQRYEDKTRERDQLEITAKMCSMFHNDNNISKLQEQLQAVNQQIGDLSA
                     RLEKEESTFEALKTAYSEKALNASNDKHKLSKRIEALKDQKLTIIPLDTEKQGIRRQL
                     ANLEVRLNEMNADSDKQKSVIKTITKSLNFAQKELKELDEKYVSESITLPEESLKEYN
                     KLRQTFLVKGNLLEAELNEKSQKIDMLTQEFQDLQDKLDAETSKLDNLESLKTSKEKS
                     LHSKTSLLNDQLEFLQTKQASLSSFKSIRQTHLKQVQEVNLKLRDVLSQLDELNASQR
                     ESQRERALSDINVSLKRVYGAMVKGSVHSLLKPTHKRYQAAISAALGKDWDSIIVENA
                     SAAQQCIHYLKENRSGTATFIPINSVKVSPVSPHLRNIHPEARPLIDVIEYNSSLHNA
                     MAYVCSNTLVCDTLDLAKHLKFDQRVNCKVVALNGAVINKSGLMTGGVNPNDVPRWDK
                     AKALGLTKRKDELLFELEELDKKKPNEFDERALIDEISAIELELPLLRRNRTEAERAI
                     RDVELEIEYQKQKVAEVQTLLEHSELGQLRQSYGEVQSKVTHLQLEIYADFCKRNGLE
                     SIQQYENSERHREFTRQKTKLLQQISSLENKLEYEKEKYQNTQNTRQDIEREEDKLKE
                     SLEDVSRRHAQSVERLDREDAELEVEKEALEMEFEKLGKELETTKQKGDEVADLRGQY
                     EDLQTHKLHYDEELEKENMKKIQVLKDCKMKSIDIPLLYGDMETLELEDDNEASNSSN
                     ILADQFVIDYDGNLDEKYKSGDLDTHLQDLSVQMELLSEEINNLTPNTKSLERLAEAE
                     KALKSCERQFNGAREDEKEILSQFDTVKEKRFRLFDEAFQHISKSIDNIYKELTKSKV
                     SPLGGSAYLTLSQEDEPYLGGINFHSMPPTKRFREMNLLSGGEKSIAALALLFAIHSY
                     KPSPFFVLDEVDAALDNANVNRLANYIVKNASPTFQFIVISLKNSLFEKADALVGIYR
                     EQRLNSSKAVTLDLRNFSDKE"
     gene            complement(<149547..>151085)
                     /locus_tag="PAS_chr2-1_0083"
                     /db_xref="GeneID:8198479"
     mRNA            complement(<149547..>151085)
                     /locus_tag="PAS_chr2-1_0083"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490919.1"
                     /db_xref="GeneID:8198479"
     CDS             complement(149547..151085)
                     /locus_tag="PAS_chr2-1_0083"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490964.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0083"
                     /db_xref="EnsemblGenomes-Tr:CAY68684"
                     /db_xref="GeneID:8198479"
                     /db_xref="GOA:C4QZL0"
                     /db_xref="InterPro:IPR018791"
                     /db_xref="UniProtKB/TrEMBL:C4QZL0"
                     /translation="MSYLPPPQRRLRHVVCVSVRNILPKGGHPRPVSTKSSTNLRELS
                     STSKNAGTLRNVLYDTFISFHECFQYDKPFYITEISHGTINPVFQDVHFAGTSLSRKI
                     TFSMMVWVRESKSKNDWVLFKRINLKLSFLNYLGPTLEKAEKAVKDVRNILLLNLVDG
                     WYYYPLESNLIAMATDGIQSDKLKTVKSKPSFLKSRELKSCSFDQIIKLSNVKFSIID
                     TIGFKHRLSIQIDHLISSTFRTDSAQQIEAIKHRLAYQYAPRVEMLSRENTSLQNVIS
                     KLRTNCDRLRSLIKNKNTDTEILAKVLHSLRESHGSLLVRVEEVQEYVSIQKSRLIKD
                     LSSIFSITQTNGKHHEHCMFGLIFPHAKISSSNFQFLRSQELEINALLGYVVQLVHLL
                     ATYLRCPLRYPIQAFGSNSYISDPISRLKGSRVFPLWIKDGTVYRFQYAIMLLTKNVK
                     QLMDHEKIKSIEAYHLLGNLQILFVCLTNTADSELNFKPKLDLEQLKIHLHSQNTQSL
                     IEAE"
     gene            <151366..>152019
                     /locus_tag="PAS_chr2-1_0084"
                     /db_xref="GeneID:8198480"
     mRNA            <151366..>152019
                     /locus_tag="PAS_chr2-1_0084"
                     /product="Protein possibly involved in a post-Golgi
                     secretory pathway"
                     /transcript_id="XM_002490920.1"
                     /db_xref="GeneID:8198480"
     CDS             151366..152019
                     /locus_tag="PAS_chr2-1_0084"
                     /codon_start=1
                     /product="Protein possibly involved in a post-Golgi
                     secretory pathway"
                     /protein_id="XP_002490965.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0084"
                     /db_xref="EnsemblGenomes-Tr:CAY68685"
                     /db_xref="GeneID:8198480"
                     /db_xref="InterPro:IPR021713"
                     /db_xref="UniProtKB/TrEMBL:C4QZL1"
                     /translation="MGSFIFSLAHFCETHGPTVVLNTQHIATEQHEKLISSNYDQQAC
                     ESCKLQLPGGSSTLTSIDNEVTYVSTQYPTSQAKYSILRQVAIKCLSVESTSELSPVM
                     FGDPILGFTLACIFKISDNTARGGERRYSVMIVAEDESELIHYWNIIATNFKEWIHCI
                     KQKREQVLSRQAEQGNNEQFFRRTQLSNKNMVQLLEDPQFFVKMHVWASGVLKQLVN"
     gene            complement(<152016..>153131)
                     /locus_tag="PAS_chr2-1_0085"
                     /db_xref="GeneID:8198481"
     mRNA            complement(<152016..>153131)
                     /locus_tag="PAS_chr2-1_0085"
                     /product="Putative glycoprotease proposed to be in
                     transcription as a component of the EKC protein complex
                     wit"
                     /transcript_id="XM_002490921.1"
                     /db_xref="GeneID:8198481"
     CDS             complement(152016..153131)
                     /locus_tag="PAS_chr2-1_0085"
                     /codon_start=1
                     /product="Putative glycoprotease proposed to be in
                     transcription as a component of the EKC protein complex
                     wit"
                     /protein_id="XP_002490966.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0085"
                     /db_xref="EnsemblGenomes-Tr:CAY68686"
                     /db_xref="GeneID:8198481"
                     /db_xref="GOA:C4QZL2"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:C4QZL2"
                     /translation="MTTYLDTRLKPGKDHYLAIGLEGSANKLGVGIIRHPKGELSDSN
                     KAVILSNVRDTYITPPGEGFLPRDTARHHRNWVVRVIKNALKDAQVAPSDLDAICFTQ
                     GPGMGAPLQSVAVAARMISQLWHLPLVGVNHCIGHIEMGREITNAHNPVVLYVSGGNT
                     QIIAYSRQKYRIFGETLDIAIGNCLDRFARTLKISNNPSPGYNIEQLAKKGKNLVELP
                     YTVKGMDLSMSGILEFIDNLAKDLFANKKNKLLVTSDGSKITVEDLCFSLQECLFAML
                     VEITERAMAHVNSNQVLIVGGVGCNERLQQMMEIMVKDRNGSIYATDERFCIDNGIMI
                     AHAGLLQYRMGDVTDIKDTVCTQKFRTDEVWVKWRLD"
     gene            complement(<153341..>153817)
                     /locus_tag="PAS_chr2-1_0086"
                     /db_xref="GeneID:8198482"
     mRNA            complement(<153341..>153817)
                     /locus_tag="PAS_chr2-1_0086"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_002490922.1"
                     /db_xref="GeneID:8198482"
     CDS             complement(153341..153817)
                     /locus_tag="PAS_chr2-1_0086"
                     /codon_start=1
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_002490967.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0086"
                     /db_xref="EnsemblGenomes-Tr:CAY68687"
                     /db_xref="GeneID:8198482"
                     /db_xref="GOA:C4QZL3"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="UniProtKB/TrEMBL:C4QZL3"
                     /translation="MKIEVDSFSGSKIYPGRGTLFIRGDSKIFRFQNSKSASLFHQRK
                     NPRRIAWTVLFRRHHKKGITEETSKKRTKKAVKTQRAIVGASLDLIKERRSLKPEQKK
                     AIKEAAAKKEEEAKAKREAHKAKRQAEKAKAIANGGFIISKQSAKGSFQKVQATSR"
     gene            <154085..>154469
                     /locus_tag="PAS_chr2-1_0087"
                     /db_xref="GeneID:8198483"
     mRNA            join(<154085..154087,154149..>154469)
                     /locus_tag="PAS_chr2-1_0087"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_002490923.1"
                     /db_xref="GeneID:8198483"
     CDS             join(154085..154087,154149..154469)
                     /locus_tag="PAS_chr2-1_0087"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_002490968.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0087"
                     /db_xref="EnsemblGenomes-Tr:CAY68688"
                     /db_xref="GeneID:8198483"
                     /db_xref="GOA:C4QZL4"
                     /db_xref="InterPro:IPR000231"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR022991"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C4QZL4"
                     /translation="MAPKVKNSDTINQKLALTIKSGKYTLGFKSTVKAIRQGKAKLII
                     ISSNTPVLRKSELEYYAMLSKTNIYYFQGGNNELGTACGKLFRVGTLAILDAGDSDLL
                     SVVGN"
     gene            <155095..>156714
                     /locus_tag="PAS_chr2-1_0088"
                     /db_xref="GeneID:8198484"
     mRNA            <155095..>156714
                     /locus_tag="PAS_chr2-1_0088"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490924.1"
                     /db_xref="GeneID:8198484"
     CDS             155095..156714
                     /locus_tag="PAS_chr2-1_0088"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490969.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0088"
                     /db_xref="EnsemblGenomes-Tr:CAY68689"
                     /db_xref="GeneID:8198484"
                     /db_xref="GOA:C4QZL5"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:C4QZL5"
                     /translation="MTLSSQASNAIIYVTYGLTLIFCVGLAWYHNDKSKFLSSNQTKT
                     GIPLALNFIASAMGCGILTTYTQVANLAGIHGLMTYTIVGALPIFFFSFWGPLIRRKC
                     PEGFVLTEWTFQRFGSVTGYYLSLATILTMFLFMVAELSAIKFAVEALTGLDGLPVVI
                     VECIVTTIYTSIGGFQVSFSTDNYQACVVLVLAVIGVIGFALNVNIDPELKRETESYL
                     LGANKLGWQLLYILFIAIATCDCFISGFWLRTFAAKTNKDLMIGTGIASIVAMTICTL
                     VGLPGIFGVWTGDVVIGSPEGYLSFFIMVSTMGNWMIGLILIFSIVLSTCTFDSLQSG
                     LTSTIVNDFGRGRMPLWAARVITILVMVPSIVVAVKVADDVLKIYFIADLISSSVIPS
                     LFIGLSTRFYFWSGWEVVGGGFAGLFFVWVFGTVYYGDAAEGGKLLLIWNGIYDSEDW
                     GPFGAFVVAPGVSLVGGLIICGVRLAVLKVYSNIKGTPFTALDRPEKLGFGGVAIGDS
                     SDIEEVYEETLNESQSKKSTDYVKEEDNFRA"
     gene            complement(<156825..>159830)
                     /locus_tag="PAS_chr2-1_0089"
                     /db_xref="GeneID:8198485"
     mRNA            complement(<156825..>159830)
                     /locus_tag="PAS_chr2-1_0089"
                     /product="Component of the mitochondrial
                     alpha-ketoglutarate dehydrogenase complex, which catalyzes
                     a key step"
                     /transcript_id="XM_002490925.1"
                     /db_xref="GeneID:8198485"
     CDS             complement(156825..159830)
                     /locus_tag="PAS_chr2-1_0089"
                     /codon_start=1
                     /product="Component of the mitochondrial
                     alpha-ketoglutarate dehydrogenase complex, which catalyzes
                     a key step"
                     /protein_id="XP_002490970.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0089"
                     /db_xref="EnsemblGenomes-Tr:CAY68690"
                     /db_xref="GeneID:8198485"
                     /db_xref="GOA:C4QZL6"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C4QZL6"
                     /translation="MLKSFKGISSRSSILRNAPRRLIQTRLLATDSFLQSNNANYIDE
                     MYEQWSKDPSSVHSSWNAYFKNLDQGVPPSRAFQAPPTLIPQPAGGIPNLVPVGNASG
                     NSNVLTHLKAQLLVRAYQVRGHQKAKIDPLGISFGDDKSKPVPKELTQEFYGFTEADL
                     DTEITLGPGILPKFAEAGHPTMKLRDIIKACEKIYCSSYGVEYVHIPSREKCDWLRER
                     IEIPTPYKYSVDEKRQILDRLIWSCSFENFLSSKFPNDKRFGVEGAESVIPGMKALID
                     TAVENGVEDVVIGMAHRGRLNMLSNVVRKPNESIFSEFTGSKDFDEGSGDVKYHLGMN
                     YVRPTTSGKKVHLSLVANPSHLEAEDPVVLGRTRAIQHYKGDVGEFNKAMGILVHGDA
                     AFAGQGIVYETMGFAALPAYSTGGTIHIIINNQIGFTTDPRFARSTPYPSDIAKSINA
                     PILHVNADDVESVIFNFQLAAEWRQTFHSDVILDVVGYRKYGHNETDQPSFTQPLMYQ
                     KIAEKKQVLDIYVDKLIKEGSFTLDDINEHKQWVWNTLEEAFTKSVEYKPTSREWLTT
                     PWEGFKSPKELASEVLPHLPTSVERGVVERIGDTISSWPEGFEVHRNLKRILKNRKDS
                     IQKGEGIDWSTGEALAFGSLVIEGYHVRISGQDVERGTFSQRHAVLHDQNSEKVYIPL
                     KHLSKVQSDFGISNSSLSEYGCMGFEYGYSLTSPDALVMWEAQFGDFANTAQVIIDQF
                     LAAGESKWKQRSGVVLSLPHGYDGQGSEHSSARLERYLQLCNEDPRVYPSPEKLERQH
                     QDCNMQVAYPTTPANLFHLLRRQMHRQFRKPLILLFSKKLLRHPLARSNIEDFIGESS
                     FQWIIEDSELGKTINDKEGIKRLVLCSGQVHSSLHKKRADIGDKETAVLKIEQLHPFP
                     FEQLKNAIDSYPSLDEIVWCQEEPLNMGSYAFSAPRIVTVLEQTEKYKDYNLRYAGRN
                     PAAAVAVGTKSMHVAQEEAFLDDVFQIQN"
     gene            <160918..>162453
                     /locus_tag="PAS_chr2-1_0090"
                     /db_xref="GeneID:8198486"
     mRNA            <160918..>162453
                     /locus_tag="PAS_chr2-1_0090"
                     /product="tRNA methyltransferase, localizes to both the
                     nucleus and mitochondrion to produce the modified base"
                     /transcript_id="XM_002490926.1"
                     /db_xref="GeneID:8198486"
     CDS             160918..162453
                     /locus_tag="PAS_chr2-1_0090"
                     /codon_start=1
                     /product="tRNA methyltransferase, localizes to both the
                     nucleus and mitochondrion to produce the modified base"
                     /protein_id="XP_002490971.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0090"
                     /db_xref="EnsemblGenomes-Tr:CAY68691"
                     /db_xref="GeneID:8198486"
                     /db_xref="GOA:C4QZL7"
                     /db_xref="InterPro:IPR002905"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4QZL7"
                     /translation="MLKRLLQSLKNILKPIKSQVMTDLDAYNKIKEGKAEILFPKEDK
                     VFYNPIQQFNRDLSICGIRAWSELYQSAGKKRNNEGEVKPFINILEALSASGLRALRY
                     GHEIPLVKKVVANDFSPAAVESIKLNIEHNQLNGIVKANEGDAILFMSQFRDKPEFHV
                     IDLDPYGTATPFIDSAVQAVKNDGLLLVTCTDLGVLAGSSYPEKCFALYGGTNIPGDA
                     THESALRLVLSMIASTAAKYKKTIEPMLSLSIDFYVRLFIRVKTSPIKVKEHASTTMI
                     NYHCSGCGTTYDQPLGKKTQDEKTGRYKFTMARGPPVGEKCTFCHKTMHLAGPMWAGQ
                     LHNKTFIDKSLQISKSLDKDVYGTTDRIEGMLTLAKQELETPFYFKPGSLSSVIKCPA
                     PPINELVSALGNLGYMASLTHAMPSAIKTNAPWEAIWYIMKTWLNHRKEESGKNLSET
                     SPGYAIIHNDQIGKDIELKEYEELYKKNDLYHEIKSLRNFKIVRFQQNPTKFWGPKAK
                     PTN"
     gene            complement(<162816..>163547)
                     /locus_tag="PAS_chr2-1_0091"
                     /db_xref="GeneID:8198487"
     mRNA            complement(<162816..>163547)
                     /locus_tag="PAS_chr2-1_0091"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490927.1"
                     /db_xref="GeneID:8198487"
     CDS             complement(162816..163547)
                     /locus_tag="PAS_chr2-1_0091"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490972.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0091"
                     /db_xref="EnsemblGenomes-Tr:CAY68692"
                     /db_xref="GeneID:8198487"
                     /db_xref="UniProtKB/TrEMBL:C4QZL8"
                     /translation="MSKESTLSLINDQLSYLNDITSTLTNCSYGKNVPNELSKAHLDR
                     IFNKAEYDDEFENIDGFKLIQLGCKIARLMEGPVEEFFDQLERLPNNDLRSYSPNGFD
                     SDYKLDLVVGLVNSLLKLLTSDIFINYTPGQTYYQIISTSTNITKSRSADIHEMKATL
                     KVCRYNKSLIVKKLIEQIAKVFKFLKTYVLSVKLTQYDDINSQLMNLKILCNGSITNK
                     VLKILTHLSETLVSENVLKINQLLE"
     gene            <164552..>165376
                     /locus_tag="PAS_chr2-1_0092"
                     /db_xref="GeneID:8198488"
     mRNA            <164552..>165376
                     /locus_tag="PAS_chr2-1_0092"
                     /product="Pho85 cyclin of the Pcl1,2-like subfamily,
                     involved in entry into the mitotic cell cycle and regulat"
                     /transcript_id="XM_002490928.1"
                     /db_xref="GeneID:8198488"
     CDS             164552..165376
                     /locus_tag="PAS_chr2-1_0092"
                     /codon_start=1
                     /product="Pho85 cyclin of the Pcl1,2-like subfamily,
                     involved in entry into the mitotic cell cycle and regulat"
                     /protein_id="XP_002490973.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0092"
                     /db_xref="EnsemblGenomes-Tr:CAY68693"
                     /db_xref="GeneID:8198488"
                     /db_xref="GOA:C4QZL9"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:C4QZL9"
                     /translation="MSDAQCLKIFLQSPVTEEMIHHLVVQTLQVLPCDESTNTKLPSL
                     MSFITKLVRYTNVYTGTLMSTLVYLQRLRSKLPQDAKGLPCTRHRIFLACLILSAKYH
                     NDSSPKNKHWTRYTDGLFSSQDVNLMERQLLTLLNWDLKIDSKELCYSVRRFLEPIRL
                     DIQRSSKLRFRKERRETSLSSLSSMASSASNASINSIHSVGSLYPSSLGRSNSSSSIE
                     TNSSLDTTELTANYCQKPIMIPVHTAKMESSLHQTALKEQQELDTLMRQYCRGTAF"
     gene            <165774..>167102
                     /locus_tag="PAS_chr2-1_0093"
                     /db_xref="GeneID:8198489"
     mRNA            <165774..>167102
                     /locus_tag="PAS_chr2-1_0093"
                     /product="GDP-mannose pyrophosphorylase
                     (mannose-1-phosphate guanyltransferase), synthesizes
                     GDP-mannose from"
                     /transcript_id="XM_002490929.1"
                     /db_xref="GeneID:8198489"
     CDS             165774..167102
                     /locus_tag="PAS_chr2-1_0093"
                     /codon_start=1
                     /product="GDP-mannose pyrophosphorylase
                     (mannose-1-phosphate guanyltransferase), synthesizes
                     GDP-mannose from"
                     /protein_id="XP_002490974.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0093"
                     /db_xref="EnsemblGenomes-Tr:CAY68694"
                     /db_xref="GeneID:8198489"
                     /db_xref="GOA:C4QZM0"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4QZM0"
                     /translation="MSTKAIVLVGGDTRGTRFRPLSLDTPKILFPIAGKPLLGHILDS
                     LILLPSLTEIILIGFYDKAVFEGFISDYNAKFQLEERNIEIKYLKEFKALGTAGGLYH
                     YRKEILKGGPDEFFVVHGDVITGFPFTEIFKFYQSLKSAKKNVEAILFGVKINNYEYF
                     KVLNNSTDRHSFGTIVSADTKVVHYVEKPEQKISNIINGGIYLFDNKLFKRLSNAKIT
                     KINIANDISHPELVDEDVISLEQDVLQKLPDDGTTYVYEYKGFWKQIKTPADALIGNE
                     LFLENLFQKRLVPDKAIKLTAESGAENGITIVPPVYISPSAKIAENTRIGPYVAIGNN
                     VSVETGSRISNSIILRDSTIGAHSVILNSILSNNCTIGSWARIEGTGLDSKKIAESIE
                     SQANIIGIKGTGNITILGSNTEVAEDSYILNSYILPNKSIKFDVRYEIIM"
     gene            <167266..>170787
                     /locus_tag="PAS_chr2-1_0094"
                     /db_xref="GeneID:8198490"
     mRNA            <167266..>170787
                     /locus_tag="PAS_chr2-1_0094"
                     /product="Protein required for mismatch repair in mitosis
                     and meiosis, forms a complex with Msh2p to repair bo"
                     /transcript_id="XM_002490930.1"
                     /db_xref="GeneID:8198490"
     CDS             167266..170787
                     /locus_tag="PAS_chr2-1_0094"
                     /codon_start=1
                     /product="Protein required for mismatch repair in mitosis
                     and meiosis, forms a complex with Msh2p to repair bo"
                     /protein_id="XP_002490975.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0094"
                     /db_xref="EnsemblGenomes-Tr:CAY68695"
                     /db_xref="GeneID:8198490"
                     /db_xref="GOA:C4QZM1"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR015536"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR017261"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZM1"
                     /translation="MAKKKVVAPDNQPSVFSFFKKKPSVNSAEPKKEQKLPTPSSSPQ
                     KADLSSGTSDKENHPTTPTKNEHKTQLPSASSSVVRANKLEDDEEEGVVSGRKRRRVA
                     IDSEDEEDAFDEEESVDNDDDEDYNEDDLHNISDEDFVISTQEMMQLEKELEGEEEPN
                     NSEGEEEEEVHQVKPLKKSKQSTSQKLNQFGWTPSSSSQNDAKGKTANSQVKRSNLIN
                     PLKPKASKKLDEERYHWLEDVRDAEGRAQGDPEYDPRTLFIPSSAWSSFTPFEKQYWE
                     IKSKMYDCVVFFKKGKFYELYENDADIAHNEFDLKLAGGGRANMRLAGVPEMSFDYWA
                     NAFINAGYKVAKVDQKESMLAKEIREKGKTITKEEKVIKRELQCVLTGGTLTDESMLT
                     DEMATYCLSLKEVDNGLDGRTFGVCFVDTATGKMRLTEFEDSVECTRLETLLAQVRPK
                     EVLVAKNQISPLTARILRFNSPSSCIWNKLKPDTEFLNHEVTFEELTRGKYFEASDLD
                     DLSNYPPLLVEYHEKHHVAFSAFGALLWYLKSLKLDESIISMGNISPYDPYQHATSMT
                     MDGVTLQNLEIFANTFDGSNKGTLFKVLNRATTPFGKRLFKDWVVHPLLLKKSIDERL
                     DSVELLLNDGELKHIFINTLSRLPDLERLLSRIHSGSLKIQDFTKVIEGFERISKLVR
                     TLRSSFGENFESIGGSLGKILSQLPQELEIQVSKWATSFDRVAATSQGLLIPEPGVEE
                     EFDQSKLKIENLKDKLNQFLRQYRRELKCQEMEFRDSGKEIYLIEVPKKVISKVPKDW
                     QQMGSTSKVTRYWSPEVKLVVRELMEATELHKILMDTLQLKVYRKFDENYSLWSETIR
                     CIGSIDCLISLANASESLGSPSCRPEIVDKDEAFIDFEELRHPCFIPGGASGSRDFIP
                     NDVKLGNGFANIALLTGANAAGKSTVLRMTCIATIMAQIGCFVPASKATLVPVDKIMT
                     RLGANDNIMQGKSTFYVELSETKRILQNATPRSLLVLDELGRGGSSSDGFAIAEACLH
                     HIATHIQSIGFFATHYGTLGASFIGHPQVMPLRMAILVDESSKTITFLYKLEKGASNG
                     SFGMHVATMCGIPKEIVDNVEIAAKNLKHNSMITQVSKAGVSLGLQSDISWLTAGKDI
                     GAGITKYDEKIRKKGLEYILQMIEGIK"
     gene            complement(<170844..>172191)
                     /locus_tag="PAS_chr2-1_0808"
                     /db_xref="GeneID:8198491"
     mRNA            complement(join(<170844..172119,172181..>172191))
                     /locus_tag="PAS_chr2-1_0808"
                     /product="hypothetical protein"
                     /transcript_id="XM_002490931.1"
                     /db_xref="GeneID:8198491"
     CDS             complement(join(170844..172119,172181..172191))
                     /locus_tag="PAS_chr2-1_0808"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002490976.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0808"
                     /db_xref="EnsemblGenomes-Tr:CAY68696"
                     /db_xref="GeneID:8198491"
                     /db_xref="UniProtKB/TrEMBL:C4QZM2"
                     /translation="MKARPTLPDSTDSSTSTGLVSYSKRSWRIKKYRNDDSEEQSNMI
                     QSMAQSTETKAPRRPKPKTGRSTEFLFVETSPQKLSGQSASSSSNTPKRATRMSRLFK
                     YKKKDESLSENSVSSSTSPVKDPFLQEIMANDLAPLCMRVDKSGRAILAATEPSSPAI
                     TPGVTSVSAGPPSASEDYFSRPLENKAKRSKTPIRSNSTISSHSLVYPLASVEDIPPS
                     SASPVLNPRNRHHRSCSSLSLSSKIKYNSPLKFNRKRHQHSISITGNDAQIESPYFQS
                     DDNLFFDSERSHPLTHSDVYDSSSMTSNGIVSSMASSKFALGPPLGASPKNEESITPV
                     SFIENELKLDSFLDFPHYSQSSNDITPKVSEYQSAQHLQAQCASTDSSNTITNLVQQT
                     DAVLESDLQFFHKQEHFYDYVDDDYPLYNFVTEAEH"
     gene            complement(<173188..>177351)
                     /locus_tag="PAS_chr2-1_0095"
                     /db_xref="GeneID:8198084"
     mRNA            complement(<173188..>177351)
                     /locus_tag="PAS_chr2-1_0095"
                     /product="Nucleosome remodeling factor that functions in
                     regulation of transcription elongation"
                     /transcript_id="XM_002490932.1"
                     /db_xref="GeneID:8198084"
     CDS             complement(173188..177351)
                     /locus_tag="PAS_chr2-1_0095"
                     /codon_start=1
                     /product="Nucleosome remodeling factor that functions in
                     regulation of transcription elongation"
                     /protein_id="XP_002490977.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0095"
                     /db_xref="EnsemblGenomes-Tr:CAY68697"
                     /db_xref="GeneID:8198084"
                     /db_xref="GOA:C4QZM3"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR023779"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR025260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZM3"
                     /translation="MSRDLPDEVFENPELYGLRRSRRPHTAPITTSGEDDDQSNDKLE
                     FDESFDESASEESDIEFGVAKKRKVTPKAVSKEKRSAKTNGNLVEAAEVRFSTRNNKT
                     VNYALEDDEDEFLESDNGQDEDSYAYDGYYDQEVEENNTASIDQVLDHRLKGLDELTS
                     DADEQAVKLETEKEERARLNSSGDPYVDFEFKIKWTGISHLHNTWESYSDLNGFKGIK
                     KVDNYIKQFIIYDQEVRNDTFTTREDIEALDLDRERRREELAEYTHVERIVDSDRIIE
                     DGDSKLQYLCKWKRLNYDECTWEDANTIVKLSPDKVTHFQQRANSKTLPSLSASYGNN
                     RPKFEKLEVQPVYIKNGELRDFQLTGLNWMAFLWSRNENGILADEMGLGKTVQTVSFL
                     SWLIFARRQYGPHLVVVPLSTVPAWQETFEKWAPSVNTIYYMGNTNSRKMIRDYEFFL
                     PGKSKKPKFNVLLTTYEYILKDRAELGQFKWQFLAVDEAHRLKNAESSLYESLFDFKI
                     ANRLLITGTPLQNNIKELAALVNFLMPGKFTIEQEIDFETASEEQETYIKDLQSKIHP
                     FILRRLKKDVEKSLHSKTERILRVELSDLQTHYYKNILTKNYAALNAGPKEAQISLLN
                     VMAELKKTSNHPYLFDGAEEQVLANLGSSSRENIFRGLIMSSGKMVLLDKLLTRLKKD
                     GHRVLIFSQMVRMLDILGDYLTFKGYSFQRLDGTVPSARRRVAIDHFNADGSQDFVFL
                     LSTRAGGLGINLMTADTVIIFDSDWNPQADLQAMARAHRIGQKNHVMVYRFVSKDTVE
                     EEVLERARKKMILEYAIISLGISDPGQTKKKSNEPSSGELSEILKFGAGNMFKASDNQ
                     KKLEDLNLDDVLNHAEDHVTTPDLGESNLGGEEFLKQFEVTDYKADVDWDDIIPEDEL
                     KKLKEEEKKRQDEEYLKEQIEMFSKRKAALKAMENSAEGTDVESTDGGSRRRRATETQ
                     GLIEKDYRTIYRALLRYGDLNDRWTELIGEGILPNKKVELMQDVYNGLVHQAQDLLKA
                     EDDRRSKENSVPDSANNDGPRKKERKAVLFEYHGVKNVNAEMVVSRPGDLKLLSLKMP
                     SDPLQFKFQRPPKVINGWSCEWTERDDAMLLVGIFKFGYGSWIQIRDDPLLGLQSKIF
                     LETAPSTLSKEEKEKFNKRTPGAVHLTRRVDYLLGFLKEEGEESKEEKKHTKRVSKSS
                     TPESRPKSKSLEIKKKKEPRRVLKKESKKEIKKDSKKENKDGKKDSKKEIKKEMKKEI
                     KKEIKKEVKKEVKKENVKERSHADKTSSDDDHLPPHEESICRSQLSKVQSSLSRLKQG
                     ENGLPRKEWAALLKKKLITIGDEIDKEAQGNSIKLKHLWVYATQYWPAKVPSKKIRNM
                     YTKLKGSST"
     gene            <178705..>180525
                     /locus_tag="PAS_chr2-1_0096"
                     /db_xref="GeneID:8198492"
     mRNA            <178705..>180525
                     /locus_tag="PAS_chr2-1_0096"
                     /product="Essential iron-sulfur protein required for
                     ribosome biogenesis and translation initiation"
                     /transcript_id="XM_002490933.1"
                     /db_xref="GeneID:8198492"
     CDS             178705..180525
                     /locus_tag="PAS_chr2-1_0096"
                     /codon_start=1
                     /product="Essential iron-sulfur protein required for
                     ribosome biogenesis and translation initiation"
                     /protein_id="XP_002490978.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0096"
                     /db_xref="EnsemblGenomes-Tr:CAY68698"
                     /db_xref="GeneID:8198492"
                     /db_xref="GOA:C4QZM4"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZM4"
                     /translation="MSEKNTRIAIVSDDRCKPKKCRQECRKSCPVVKTGKLCIEVEAY
                     SKIAFISETLCIGCGICVKKCPFGAINIINLPTNLEKEVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDAPPDWEEILKYFRGSELQNYFTKVL
                     EDNIKAIIKPQYVDNLPRAIKGPVNKVGELLKAKLERKEEGKHIIQVLELKHVLNREV
                     AKLSGGELQRFAIGMTCVQDANVYMFDEPSSYLDVKQRLNAAQIIRSLLHATCYVIVV
                     EHDLSVLDYLSDFVCILYGVPSVYGVVTLPASVREGINIFLDGHIPTENLRFRTESLK
                     FKLTDASDSVLIEQSRAFEYPKMVKTQGDFKLTVNAGDFSDSEIIVMMGENGTGKTTL
                     CKLLAGAIEGDEGTKVPKLNVSMKPQKIAPKFTGTVRQLFLKKIRSSFLHPQFNTDVM
                     KPLKVDDVIDQEVQHLSGGELQRVAIVLALGKEADIYLIDEPSAYLDSEQRIICSKVI
                     RRFILHSKKTAFIVEHDFIMATYLADKVMVFEGQPSKNAVANRPETLLTGCNRFLKNL
                     NVTFRRDPNSFRPRINKLDSQMDREQKLSGNYFFLENTEL"
     gene            <181250..>183130
                     /locus_tag="PAS_chr2-1_0097"
                     /db_xref="GeneID:8198493"
     mRNA            <181250..>183130
                     /locus_tag="PAS_chr2-1_0097"
                     /product="Poly(A) binding protein, part of the 3'-end
                     RNA-processing complex, mediates interactions between th"
                     /transcript_id="XM_002490934.1"
                     /db_xref="GeneID:8198493"
     CDS             181250..183130
                     /locus_tag="PAS_chr2-1_0097"
                     /codon_start=1
                     /product="Poly(A) binding protein, part of the 3'-end
                     RNA-processing complex, mediates interactions between th"
                     /protein_id="XP_002490979.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0097"
                     /db_xref="EnsemblGenomes-Tr:CAY68699"
                     /db_xref="GeneID:8198493"
                     /db_xref="GOA:C4QZM5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002004"
                     /db_xref="InterPro:IPR006515"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QZM5"
                     /translation="MSVDTKEVQESLDQLNISESPATAVTEETPATSTEAAEESNESS
                     TQASETLASLYVGELDPTVTESDLYEFFSPIGSVNSIRVCRDAVTKRSLGYGYVNFHS
                     QAAGERALEELNYAEIKGVRCRLMWSQRDPSLRRSGSGNIFIKNLDPAIENKTLHDTF
                     SSFGKVLSCKVATDENGNSKGFGFVHYESDEAAQAAIENINGMLLNGREIYVGPHLAK
                     KDRESRFQEMIKNYTNVFVKNFDTESTEDELRELFESYGPITSIHLQVDSEGHNKGFG
                     FVNFAEHDDAVKAVEALNDKEYKGKPLYVGRAQKKNERVHELTKKYEADRLEKLQKYQ
                     SVNLFIKNLDESIDDARLEEEFKPFGTITSAKVMLDENGKSRGFGFVCLSTPEEATKA
                     ISEMNQRMVANKPLYVALAQPKAIRRSQLAQQIQARNQMRMQQQAGPGIPNQFVQPIF
                     YGQQPGMLPPGARVPPMGNQIPQFAGMPRPGPFPQGQFPRMAPNGQPMPVYGQPVFNG
                     NGPQQRGYYPNNRQNKNRNQKEEGNSLAAILPQLPLEQQKRVLGEELYPKVVATNKTQ
                     DPEAAGKITGMILDLDNQEILQLLEDEELFNTHFNEALQAYEEYKSKTVEQQQQADAQ
                     AN"
     gene            complement(<183385..>183726)
                     /locus_tag="PAS_chr2-1_0098"
                     /db_xref="GeneID:8198494"
     mRNA            complement(<183385..>183726)
                     /locus_tag="PAS_chr2-1_0098"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490935.1"
                     /db_xref="GeneID:8198494"
     CDS             complement(183385..183726)
                     /locus_tag="PAS_chr2-1_0098"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490980.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0098"
                     /db_xref="EnsemblGenomes-Tr:CAY68700"
                     /db_xref="GeneID:8198494"
                     /db_xref="UniProtKB/TrEMBL:C4QZM6"
                     /translation="MLFQDGSLFEQVLILQLLAAHVNSLIVTTIDSVLSNCPFYISLA
                     SSKPQTKVKSFKYRIPALKAEPLVYQFPLILSISSRLYGNGHRKNWYVQKQLGYREHL
                     ALRLNMQINPN"
     gene            <183904..>184891
                     /locus_tag="PAS_chr2-1_0099"
                     /db_xref="GeneID:8198495"
     mRNA            join(<183904..183934,183990..>184891)
                     /locus_tag="PAS_chr2-1_0099"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490936.1"
                     /db_xref="GeneID:8198495"
     CDS             join(183904..183934,183990..184891)
                     /locus_tag="PAS_chr2-1_0099"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490981.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0099"
                     /db_xref="EnsemblGenomes-Tr:CAY68701"
                     /db_xref="GeneID:8198495"
                     /db_xref="GOA:C4QZM7"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="UniProtKB/TrEMBL:C4QZM7"
                     /translation="MPPKEDVMKQLIYVTLTSNSTTLYTYDNAPLINKLQVNCTELIS
                     QELGLINSMSDFKDESGSIIINNRKPVLVNGEYVNLVMYYVKGSLSNSDLITVVAVVS
                     DHVLKEFVLQTLWKILVEFRKFREVSVGEEQTQKGPENGKVAKVGNVAYSPSQSSPSS
                     PISLHTSLNFSASGQDSSSVLSFKKIMTSIIKKEESKYLHYGATYDATFDEIEQVRNI
                     MNKNIERTINRGERINLLVSKTSKLTNSSNSFRRRTVALKRKMWWSNVKFIILVGILV
                     VVMLYFLIGIECGMPWYQNCLHPSKPEQPHQSSI"
     gene            complement(<184895..>185686)
                     /locus_tag="PAS_chr2-1_0100"
                     /db_xref="GeneID:8198496"
     mRNA            complement(join(<184895..185536,185588..>185686))
                     /locus_tag="PAS_chr2-1_0100"
                     /product="Shared subunit of DNA polymerase (II) epsilon
                     and of ISW2/yCHRAC chromatin accessibility complex"
                     /transcript_id="XM_002490937.1"
                     /db_xref="GeneID:8198496"
     CDS             complement(join(184895..185536,185588..185686))
                     /locus_tag="PAS_chr2-1_0100"
                     /codon_start=1
                     /product="Shared subunit of DNA polymerase (II) epsilon
                     and of ISW2/yCHRAC chromatin accessibility complex"
                     /protein_id="XP_002490982.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0100"
                     /db_xref="EnsemblGenomes-Tr:CAY68702"
                     /db_xref="GeneID:8198496"
                     /db_xref="GOA:C4QZM8"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4QZM8"
                     /translation="MPAKGWKKTSDGSFTPKGPAAKQDKESENISIENLLFPKATIGK
                     LAKSVLQGDENESNMILSKDGLTAVQRSAVVFVSYLYHHAREVSKDQNRKTVNVQDIL
                     KALENTEFSALIPTVQEELISFNQRKEAKKLKNEKDKDQEVEEEGDDEKYEANKKLKI
                     VEGAVDASSVHASQEPTAEEVADDDEATEDATEEASEEVYNLVESSDEEVPEAPDVID
                     TIDRDPLNGVEEHSETNAEGSLHEEDEQ"
     gene            <185845..>186891
                     /locus_tag="PAS_chr2-1_0101"
                     /db_xref="GeneID:8198497"
     mRNA            <185845..>186891
                     /locus_tag="PAS_chr2-1_0101"
                     /product="Exopolyphosphatase, hydrolyzes inorganic
                     polyphosphate (poly P) into Pi residues"
                     /transcript_id="XM_002490938.1"
                     /db_xref="GeneID:8198497"
     CDS             185845..186891
                     /locus_tag="PAS_chr2-1_0101"
                     /codon_start=1
                     /product="Exopolyphosphatase, hydrolyzes inorganic
                     polyphosphate (poly P) into Pi residues"
                     /protein_id="XP_002490983.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0101"
                     /db_xref="EnsemblGenomes-Tr:CAY68703"
                     /db_xref="GeneID:8198497"
                     /db_xref="GOA:C4QZM9"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="UniProtKB/TrEMBL:C4QZM9"
                     /translation="MSKISKFLDLIKRQALNEVVLVCGNQSADLDSIASSISYAYFHY
                     QKYRFTKGLVIPLLNIPEKDLALRKDAEFVLTQNGIKRSQLWFTDDLSKFDQFKLIMV
                     DHNVPQGEVAKSRLTHVVGIIDHHQDEQKYLDSAPRVIEECGSCSSLVLNYWYDLIGE
                     DVGECATLLASAIMIDTTNFTQRVKSHDEKALETIKMLGIYNVSAFTTNFEKIQESKS
                     DLEGLSMNDILRKDYKQFVFDGNTVGVSSIVKPFSWLDKHFDIDKETKSFGEEHKLDL
                     LVLMTAYTTNDQFKREISFHDVLKDLSERCIKGMKDKLDLNRISGNRFTQNNIKASRK
                     QVVPYLEQTLTNTD"
     gene            complement(<187101..>188309)
                     /locus_tag="PAS_chr2-1_0102"
                     /db_xref="GeneID:8198498"
     mRNA            complement(<187101..>188309)
                     /locus_tag="PAS_chr2-1_0102"
                     /product="B-type cyclin involved in cell cycle
                     progression"
                     /transcript_id="XM_002490939.1"
                     /db_xref="GeneID:8198498"
     CDS             complement(187101..188309)
                     /locus_tag="PAS_chr2-1_0102"
                     /codon_start=1
                     /product="B-type cyclin involved in cell cycle
                     progression"
                     /protein_id="XP_002490984.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0102"
                     /db_xref="EnsemblGenomes-Tr:CAY68704"
                     /db_xref="GeneID:8198498"
                     /db_xref="GOA:C4QZN0"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:C4QZN0"
                     /translation="MSNVQPNENVYSIRHTRSKTQELKRNVLTDVSNNSKVPHHGLHK
                     KDQVGTQHARKEDTEDKMDITIVETASSVANVFPENIQKENILSGPADRNRNTKSSLK
                     RSATITDVPQVTNKKAKVDYSWDDLDADDSDDPLMVSEYVGEIFEYLHRLEKETLPDP
                     NYLQWQKSFKPKMRSILVDWLVEVQLKFRLLPETLYLSINIMDRFLSKEPVQINKLQL
                     LATGCIFISAKYEEVYSPSIKYYAQDSGFSEEEILDAEKFILEILDFNINYPGAMNFL
                     RRISKADDYDVQSRTIGKYLLEITIIDHKFLGVLPSLCAAASMYVARKMLGRYEWNGN
                     LIHYSGGYTEAHLKETCEMLIDYLVSPIIHEEFFKKYASKKFMKVSILARQWAKKVTT
                     EGRSIMDPIL"
     gene            <189096..>190502
                     /locus_tag="PAS_chr2-1_0103"
                     /db_xref="GeneID:8198499"
     mRNA            <189096..>190502
                     /locus_tag="PAS_chr2-1_0103"
                     /product="One of three repressible acid phosphatases, a
                     glycoprotein that is transported to the cell surface"
                     /transcript_id="XM_002490940.1"
                     /db_xref="GeneID:8198499"
     CDS             189096..190502
                     /locus_tag="PAS_chr2-1_0103"
                     /codon_start=1
                     /product="One of three repressible acid phosphatases, a
                     glycoprotein that is transported to the cell surface"
                     /protein_id="XP_002490985.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0103"
                     /db_xref="EnsemblGenomes-Tr:CAY68705"
                     /db_xref="GeneID:8198499"
                     /db_xref="GOA:C4QZN1"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR016274"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C4QZN1"
                     /translation="MFSPILSLEIILALATLQSVFAVELQHVLGVNDRPYPQRTDDQY
                     NILRHLGGLGPYIGYNGWGIAAESEIESCTIDQAHLLMRHGERYPSTNVGKQLEALYQ
                     KLLDADVEVPTGPLSFFQDYDYFVSDAAWYEQETTKGFYSGLNTAFDFGTTLRERYDH
                     LINTSEEGKKLSVWAGSQERVVDTAKYFAQGFMKSNYTDMVEVVALEEEKSQGLNSLT
                     ARISCPNYNSHIYKDGDFPNDIAEREADRLNTLSPGFNITADDIPTIALYCGFELNVR
                     GESSFCDVLSREALLYTAYLRDLGWYYNVGNGNPLGKTIGYVYANATRQLLENTEADP
                     RDYPLYFSFSHDTDLLQVFTSLGLFNVTDLPLDQIQFQTSFKSTEIVPMGARLLTERL
                     LCTVEGEEKYYVRTILNDAVFPLSDCSSGPGFSCPLNDYVSRLEALNEDSDFAENCGV
                     PKNASYPLELSFFWDDLS"
     gene            complement(<190625..>191148)
                     /locus_tag="PAS_chr2-1_0104"
                     /db_xref="GeneID:8198500"
     mRNA            complement(join(<190625..190924,190978..>191148))
                     /locus_tag="PAS_chr2-1_0104"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490941.1"
                     /db_xref="GeneID:8198500"
     CDS             complement(join(190625..190924,190978..191148))
                     /locus_tag="PAS_chr2-1_0104"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490986.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0104"
                     /db_xref="EnsemblGenomes-Tr:CAY68706"
                     /db_xref="GeneID:8198500"
                     /db_xref="InterPro:IPR013714"
                     /db_xref="UniProtKB/TrEMBL:C4QZN2"
                     /translation="METEQNYNSLFKAANLFVAGATVSKIRSRTVIQGKLLTLVLLQI
                     FAGALQLLNGLNAFLLSLFIIAFGGVIAALEIKPELVPKVTPYLSFLLSFLGRGGFYI
                     FLGVLISGGSIFRGLIGFLLVIVGVGFVSLEFVGSIEPPPSMREVVSFEEEDII"
     gene            complement(<191513..>192286)
                     /locus_tag="PAS_chr2-1_0809"
                     /db_xref="GeneID:8198501"
     mRNA            complement(<191513..>192286)
                     /locus_tag="PAS_chr2-1_0809"
                     /product="hypothetical protein"
                     /transcript_id="XM_002490942.1"
                     /db_xref="GeneID:8198501"
     CDS             complement(191513..192286)
                     /locus_tag="PAS_chr2-1_0809"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002490987.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0809"
                     /db_xref="EnsemblGenomes-Tr:CAY68707"
                     /db_xref="GeneID:8198501"
                     /db_xref="GOA:C4QZN3"
                     /db_xref="InterPro:IPR000308"
                     /db_xref="InterPro:IPR023409"
                     /db_xref="InterPro:IPR023410"
                     /db_xref="UniProtKB/TrEMBL:C4QZN3"
                     /translation="MSREDSVYLAKLAEQAERYEEMVENMKTVASSGLELSVEERNLL
                     SVAYKNVIGARRASWRIVSSIEQKEEAKGNQSQVSLIREYRSKIETELANICEDILSV
                     LSEHLIPSARTGESKVFYFKMKGDYHRYLAEFAVGDKRKEAANLSLEAYKSASDVAVT
                     ELPPTHPIRLGLALNFSVFYYEILNSPDRACHLAKQAFDDAIAELETLSEESYKDSTL
                     IMQLLRDNLTLWTSDMSETGQEESSNSQDKTEAAPKDEE"
     gene            complement(<192872..>194509)
                     /locus_tag="PAS_chr2-1_0105"
                     /db_xref="GeneID:8198085"
     mRNA            complement(<192872..>194509)
                     /locus_tag="PAS_chr2-1_0105"
                     /product="Shuttling pre-60S factor"
                     /transcript_id="XM_002490943.1"
                     /db_xref="GeneID:8198085"
     CDS             complement(192872..194509)
                     /locus_tag="PAS_chr2-1_0105"
                     /codon_start=1
                     /product="Shuttling pre-60S factor"
                     /protein_id="XP_002490988.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0105"
                     /db_xref="EnsemblGenomes-Tr:CAY68708"
                     /db_xref="GeneID:8198085"
                     /db_xref="GOA:C4QZN4"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="UniProtKB/TrEMBL:C4QZN4"
                     /translation="MELQVAPRDADILLKDKNILNNEVLEKYTSAGKIAQSCLTYLVK
                     LINEGYHTQVGTVYSINELCALGDSYLINTINGLTETKSVIREKGIAQPVCIEANDVV
                     SGYSPELDETANVYLQPGDIATITLGCHLDGYTANVSHTVVIFPPGQSPTGPLLTGKA
                     DAVCAAHIATETITTLLAATTTPEKIPAAFGNKIIGSTIRSVVDSIAQSFNCRVLPGS
                     RVRRVRRFLAGQAEGLVAEKEYKGVVWSESDQEKAFLESVNSSQDLTVVHKLSPLVRN
                     LSTVPTDEFQVLPGEAYIVDIRMASLEGINEVGYVTLQSVDQIVGKNKEKSSITSKPS
                     IFLRDVIMVRHLKLKASRTLLDTIDKKLSVFPFKLAHTASSYPINISNDGTAEPVETQ
                     LSNILNEMKRGRLGMSEITNRRLCVTKPIQTARFIPLKVVLEASNATGLDGYDAANPT
                     LPGLETPLPRLGISSLKLKSLLKKSIPIDVARECSTILLPEQQPPIRLTGGSTSRPSY
                     VHSNYELDGPYKQAIYELVKLTEDSKFGLNIQECPPF"
     gene            complement(<194627..>195670)
                     /locus_tag="PAS_chr2-1_0106"
                     /db_xref="GeneID:8198502"
     mRNA            complement(<194627..>195670)
                     /locus_tag="PAS_chr2-1_0106"
                     /product="Protein necessary for structural stability of
                     L-A double-stranded RNA-containing particles"
                     /transcript_id="XM_002490944.1"
                     /db_xref="GeneID:8198502"
     CDS             complement(194627..195670)
                     /locus_tag="PAS_chr2-1_0106"
                     /codon_start=1
                     /product="Protein necessary for structural stability of
                     L-A double-stranded RNA-containing particles"
                     /protein_id="XP_002490989.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0106"
                     /db_xref="EnsemblGenomes-Tr:CAY68709"
                     /db_xref="GeneID:8198502"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C4QZN5"
                     /translation="MENREYEANDKSHVMFTSLGMFIVDEVHLLNGSVRKDVMGGGGL
                     YATVGARIVCDNPRTIGGFADFGGDMVDDDHEVKRVISSWNTLMKQRVDRRRLTTRGL
                     VNYTMSSTEQMSFSYLTPKKRIGVADLDEEEELLYSKSFHLLSDGPKLIEIVQGIVDK
                     RNCAEKPLIVWEPFGVYCVSARLEETIKALEHVDIFTPNAAEAACLLGRSEPETREEM
                     DFVANSFVKYLKKPNSAIVLRCGKLGSLTITGDKSYHKWFPAYHDPKFSDFKVVDTTG
                     GGNSFAGAVAFMFASTGNWTLSNIAANVASSFVIEQLGVPVYDPVEDTWNGVATSARQ
                     KEYIRRYEDVALN"
     gene            <195830..>197170
                     /locus_tag="PAS_chr2-1_0107"
                     /db_xref="GeneID:8198503"
     mRNA            <195830..>197170
                     /locus_tag="PAS_chr2-1_0107"
                     /product="Gamma-aminobutyrate (GABA) transaminase
                     (4-aminobutyrate aminotransferase) involved in the
                     4-aminobu"
                     /transcript_id="XM_002490945.1"
                     /db_xref="GeneID:8198503"
     CDS             195830..197170
                     /locus_tag="PAS_chr2-1_0107"
                     /codon_start=1
                     /product="Gamma-aminobutyrate (GABA) transaminase
                     (4-aminobutyrate aminotransferase) involved in the
                     4-aminobu"
                     /protein_id="XP_002490990.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0107"
                     /db_xref="EnsemblGenomes-Tr:CAY68710"
                     /db_xref="GeneID:8198503"
                     /db_xref="GOA:C4QZN6"
                     /db_xref="InterPro:IPR004631"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4QZN6"
                     /translation="MSKNEQELSQLGSVFDTRAAYFVCNYFASHDNYLVDLDGNEYLD
                     VYAQISSIALGYNHPELIKVAKSDEMAVALVNRPALGCFPSSDYRTILEEGILAAAPP
                     SLDKVWTSLSGSDANETAFKAAFMYHALQKRGKGTPFTEEEMKSCMENLPPGCPDYVI
                     LSFEHGFHGRLFGSLSTTRSKAIHKLDIPAFQWPKTPFPRLKYPLEEFEKENSQEEER
                     CLELFSSVIDQWKGRIVAFIVEPIQSEGGDNHASPYFFQRLREISLEKNVLMIVDEVQ
                     TGVASTGKFWAHEHWNLTTPPDFVTFSKKFQAAGFYFQNPEFVPNQPFRQFNTWCGDP
                     SKAIIARTIFKQIQKDNLVSKIREVGDYLYEKLETVFKSTPVTNLRGKGRGTFIAWDF
                     DSAQERNEFLLKMKQHGINIGGCGDSSVRLRTTLIFEKKHADILCDAILKVLNV"
     gene            complement(<197175..>199376)
                     /locus_tag="PAS_chr2-1_0108"
                     /db_xref="GeneID:8198504"
     mRNA            complement(<197175..>199376)
                     /locus_tag="PAS_chr2-1_0108"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490946.1"
                     /db_xref="GeneID:8198504"
     CDS             complement(197175..199376)
                     /locus_tag="PAS_chr2-1_0108"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002490991.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0108"
                     /db_xref="EnsemblGenomes-Tr:CAY68711"
                     /db_xref="GeneID:8198504"
                     /db_xref="UniProtKB/TrEMBL:C4QZN7"
                     /translation="MDNYHRMIHIYSQLLDVEPQQDTAESYFRDFLTTPFLFTALNST
                     LNNIDVRAKAKPAHLEILKNLIQHALEILKEQLDTRTQENEVTDWPLVNNVLNILRVI
                     LKNVLTRKLSSNSSKKQLDNNQILVGIFGNVDVVESSARELIYFTDHFLSIVPNDKDS
                     CHAVIYSTRESSLELLDSLLVGFHDTMVLDLLFEKDTFFVGLLSILQDAGHSDADDTF
                     DSVVVMKVFRCLAILFSNKEVNHNIYKGLLNTHIISQNEKEINLIDKWLFQWFILATK
                     CYEEFSPDLLFQEEKRTSLFHLMTFNRFNFNSNTNTHYSQLLTDQLIPKFWDRQLERY
                     KDSCESNMENFNHSPLLPVPELLPVMVFFTALIAEDDFYCQLFATRRSDVDFLEVFLS
                     FNSYVMTFQHYSPTHKLVTRMSLQILHKLLISCSSKLVPYTINQRKIKPSYQRRPLIN
                     PVGVFDLHEAKLDGEQLVSDPQFITNKCSIYYILDDVQRYSRYNLTQKLELDNYKLVN
                     NIVLKSLQILSDNDLLNYSYKNSGAEGRYNWVDFWDTQFQVVQFISKLVSKHKMDVSN
                     KQLGSIVEEILIIVEFVLNDWGKQQLFLGPHQLIEDTTSILLQLIYRILEHNSDLFYL
                     IKTFELDISLLNYRNILDVFELFSREFKINFEEEASATTSETSFAEVISKIKVFINTQ
                     PKGDKQSKILQINKDLFKFETTFEYLDDPNFRNNGTTLALKELLKPKKMTQ"
     gene            complement(<199543..>201117)
                     /locus_tag="PAS_chr2-1_0109"
                     /db_xref="GeneID:8198505"
     mRNA            complement(<199543..>201117)
                     /locus_tag="PAS_chr2-1_0109"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002490947.1"
                     /db_xref="GeneID:8198505"
     CDS             complement(199543..201117)
                     /locus_tag="PAS_chr2-1_0109"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002490992.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0109"
                     /db_xref="EnsemblGenomes-Tr:CAY68712"
                     /db_xref="GeneID:8198505"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4QZN8"
                     /translation="MSYSATLDSESAISIYRAPKATFVKRLVQIGCAMFWCLLAAGPI
                     FGFAALKPVLIDQGIYHEKCKAEELTFGKLDEMLQSTISSKEKDLCPAQDLSLNFMFT
                     LAAVVTNAAALLVGHVLDTYGPRVTGITGAVLLALASLLLRDGDKLPFDGYRYGYSLL
                     ALGGPFVFISCFQLANSFPRNSGLVLALLTGAFDTSSALFLFYRLIYQNDIIKNLTLH
                     RFFSFYLVVPAFILICQLTIMPKDSYKTSNTLAKITVEGIDETGIPITIDEASQLLPR
                     ETISRRNSIRTIYEEEAENKLVKQTGIFGALHGKTVKQQIFTPWFYLMALFTSVQMLR
                     INFFVATIRAQEQYFFDSKTAAVINQFFDVALPAGGIISIPFIGFFLDNFKTVTVIQL
                     LLGISLLIGILGVIANEACALLGIVLLVVYRPFYYTAVSDFCAKVFGFDTFGTVYGTI
                     ICLSGFCNLIQKYLDTLMHDTFQMNPIPVNILLVSITALFGGLLVFFIIGQEKEIKKA
                     QLILEAENADVVDMPN"
     gene            complement(<201383..>202243)
                     /locus_tag="PAS_chr2-1_0810"
                     /db_xref="GeneID:8198506"
     mRNA            complement(<201383..>202243)
                     /locus_tag="PAS_chr2-1_0810"
                     /product="hypothetical protein"
                     /transcript_id="XM_002490948.1"
                     /db_xref="GeneID:8198506"
     CDS             complement(201383..202243)
                     /locus_tag="PAS_chr2-1_0810"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002490993.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0810"
                     /db_xref="EnsemblGenomes-Tr:CAY68713"
                     /db_xref="GeneID:8198506"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4QZN9"
                     /translation="MNGRVLCLHGFAQNGPNFSAKASGIRKALKKFDIETVFLNAPLQ
                     LKGADLPFDSASLGADSADSAEAPDFKGWWYTVDDFDIEPAFEAVRECCKEKGPFTGV
                     LGFSQGAGLAAILANKFSEIVPGHPGLKFGIFYSGFKVNNQKYWKYYEPKISIPTLHI
                     FGELDTVVSEERSQRLIDECCVPETTLTLKHPGGHYVPNIKDLINKEVSWVLNALDLD
                     PEEIKANKNNKGKAQSVTGEKSKRQLKREQKAKQKESGTSTPSKETEEDKTARELGEL
                     NDEFDKIGKI"
     gene            <202765..>204114
                     /locus_tag="PAS_chr2-1_0110"
                     /db_xref="GeneID:8198086"
     mRNA            <202765..>204114
                     /locus_tag="PAS_chr2-1_0110"
                     /product="Fructose-2,6-bisphosphatase, required for
                     glucose metabolism"
                     /transcript_id="XM_002490949.1"
                     /db_xref="GeneID:8198086"
     CDS             202765..204114
                     /locus_tag="PAS_chr2-1_0110"
                     /codon_start=1
                     /product="Fructose-2,6-bisphosphatase, required for
                     glucose metabolism"
                     /protein_id="XP_002490994.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0110"
                     /db_xref="EnsemblGenomes-Tr:CAY68714"
                     /db_xref="GeneID:8198086"
                     /db_xref="GOA:C4QZP0"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C4QZP0"
                     /translation="MAVYSVVDNLRVCVVMVGLPARGKSLIAQKLVRYLSWLSINTKC
                     FSVGNYRRKESVHPSADFFDPENEMGFLIRRQATDLAIKDMLEWFDNGDGVVGILDAS
                     NITNERRRQVLQIMRENQIEPIFLESYCDDQELIRKNVKDIQETSPDYKSIQEDYAIK
                     DVLERISIYEKSYESIDVERDSDLTFVKLINVNTEIIINKIESYLESRIAFFVMNLHI
                     KPRYIWLSRHGESQYNLEGKIGGDADLSERGWKYAKKLPSLVEKYIPNHEKLTVWTST
                     LKRTQQTGSYLPYPKKTWKALDELDAGVCDGMTYEEIAEKYPDDFKARDEDKFEYRYR
                     GGESYRDVILRLEPIIMEMENLENVLIITHQAVLRCIYAYFMNVPQQQSPWMSIPLHT
                     LIRLEPRAYETLVTRIKADIPAVSTYKEKGTSKLGESTKNDHSMAGALISSSSSKDV"
     gene            <204478..>205149
                     /locus_tag="PAS_chr2-1_0111"
                     /db_xref="GeneID:8198507"
     mRNA            <204478..>205149
                     /locus_tag="PAS_chr2-1_0111"
                     /product="Mitochondrial adenylate kinase, catalyzes the
                     reversible synthesis of GTP and AMP from GDP and ADP"
                     /transcript_id="XM_002490950.1"
                     /db_xref="GeneID:8198507"
     CDS             204478..205149
                     /locus_tag="PAS_chr2-1_0111"
                     /codon_start=1
                     /product="Mitochondrial adenylate kinase, catalyzes the
                     reversible synthesis of GTP and AMP from GDP and ADP"
                     /protein_id="XP_002490995.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0111"
                     /db_xref="EnsemblGenomes-Tr:CAY68715"
                     /db_xref="GeneID:8198507"
                     /db_xref="GOA:C4QZP1"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028586"
                     /db_xref="UniProtKB/TrEMBL:C4QZP1"
                     /translation="MIKNLRLLLLGAPGSGKGTQTSRLLEKIQITPVSSGDLLRTEIS
                     KKSSLGLLASKIIQKGGLVPDHLMIALIYREFQARNWLGQDCSWLLDGFPRTQNQAVA
                     LDDKLTVAPINCVIELDVPEKVILERIENRYIHIPSGRIYNQQYNPPKVPGKDDITGE
                     PLSKRPDDNAEVFKRRLDNYHKEIDPLKEYFKNKGILHSIRGETSDIIFPQLYEYITS
                     EFTSK"
     gene            <205915..>206490
                     /locus_tag="PAS_chr2-1_0112"
                     /db_xref="GeneID:8198508"
     mRNA            <205915..>206490
                     /locus_tag="PAS_chr2-1_0112"
                     /product="Small rho-like GTPase, essential for
                     establishment and maintenance of cell polarity"
                     /transcript_id="XM_002490951.1"
                     /db_xref="GeneID:8198508"
     CDS             205915..206490
                     /locus_tag="PAS_chr2-1_0112"
                     /codon_start=1
                     /product="Small rho-like GTPase, essential for
                     establishment and maintenance of cell polarity"
                     /protein_id="XP_002490996.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0112"
                     /db_xref="EnsemblGenomes-Tr:CAY68716"
                     /db_xref="GeneID:8198508"
                     /db_xref="GOA:C4QZP2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZP2"
                     /translation="MQTIKCVVVGDGAVGKTCLLMSYTTNKFPPDYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPNSDVFLICFSVCSPPSFENVKEKWFPEVL
                     NHCPGVPCLIVGTQIDLRDDKATLRKLQKQNTKPITPEQGEKLAKELHAVKYVECSAL
                     TQRGLKNVFDEAIVAALEPPVYKKSKKCLIL"
     gene            <206976..>208646
                     /locus_tag="PAS_chr2-1_0113"
                     /db_xref="GeneID:8198509"
     mRNA            <206976..>208646
                     /locus_tag="PAS_chr2-1_0113"
                     /product="Alpha subunit of chaperonin-containing
                     T-complex, which mediates protein folding in the cytosol"
                     /transcript_id="XM_002490952.1"
                     /db_xref="GeneID:8198509"
     CDS             206976..208646
                     /locus_tag="PAS_chr2-1_0113"
                     /codon_start=1
                     /product="Alpha subunit of chaperonin-containing
                     T-complex, which mediates protein folding in the cytosol"
                     /protein_id="XP_002490997.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0113"
                     /db_xref="EnsemblGenomes-Tr:CAY68717"
                     /db_xref="GeneID:8198509"
                     /db_xref="GOA:C4QZP3"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C4QZP3"
                     /translation="MFDSTRSDTLFLGAQKVSGDDVRQQNVLATQAVANVVKSSLGPV
                     GLDKMLVDDIGDVVVTNDGATILNLLDVKHPAGQILVDLAQQQDREVGDGTTSVVIIA
                     SELLKRANELVKNKIHPTTIITGYRLALKETIRYINEVLSQSIDSFSKEILINIASTS
                     MSSKIIGSDSAFFSEMVVDAMLAVKTTNNKGETKYPIKAVNILKSHGKSSTESMLING
                     YALNCTVASQAMVKYVKDAKIACIDINLQKARMAMGVQINIDDPDQLEEIRKREYGII
                     MERIDKIIEAGANVVLTTKGIDDLCLKKFVESGVMAVRRCKKEDLRRISRATGATFIS
                     SMSDLEGEETFDSSYLGNASEVVQERISDDECILVKGTKTHSAASIILRGPNEYTLDE
                     MERSIHDSLSVVKRTLESGNVVPGGGAVETALNIYLENFATTVGSREQLAIAEFANAL
                     LVIPKTLAVNAAKDSSDLVPKLRSYHAASQQALPTELKKKNYKNYGLDLIKGKVTDQV
                     LHGVLEPTVSKVKSLKSALEACVAILRIDTMITVDPEPAKEDPHGHDH"
     gene            <208795..>210153
                     /locus_tag="PAS_chr2-1_0114"
                     /db_xref="GeneID:8198510"
     mRNA            <208795..>210153
                     /locus_tag="PAS_chr2-1_0114"
                     /product="Sterol regulatory element binding protein,
                     induces transcription of sterol transport and biosyntheti"
                     /transcript_id="XM_002490953.1"
                     /db_xref="GeneID:8198510"
     CDS             208795..210153
                     /locus_tag="PAS_chr2-1_0114"
                     /codon_start=1
                     /product="Sterol regulatory element binding protein,
                     induces transcription of sterol transport and biosyntheti"
                     /protein_id="XP_002490998.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0114"
                     /db_xref="EnsemblGenomes-Tr:CAY68718"
                     /db_xref="GeneID:8198510"
                     /db_xref="GOA:C4QZP4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C4QZP4"
                     /translation="MANLKIPGSEQLTTNKVLKSSKGKRKYHNKSRKGCTTCKKRRVK
                     CDENKPICNKCEHLGLDCIYMSPPPKRLSSSTSDGSPAITVPLSSGPPLGATSNSPSN
                     QYTGNLNMLDLRLMYHYITKVWHTITAAGISDAKIWCEDIPMLAFNYPFLMHSILAFS
                     ATHLSRTEKGLDQCVTCHRGDALRLLREAVLEISPANTDALVASALILIMDSLANASL
                     PTSTSPKSLPASAWIFHVKGAATILTAVWPLNESSRFHKFISVDLSDLGDVDLMGDNA
                     NANHPHDVKYSQLLCFDEELTDLFPVTYTSPYLITLAYLNKLHNERYKSDFILRVFAF
                     PALLDKTFLTLLINGDISAMRIMRSYYTLLRNFTDEMKDKVWFLEGVSKVLPVDVDEY
                     SGGGGMHMMMDFLGGPSTLNDNDTNDIADNIAQSGLLDTDNLPSSITDNLDIMHSSIY
                     DE"
     gene            complement(<210225..>211856)
                     /locus_tag="PAS_chr2-1_0115"
                     /db_xref="GeneID:8198511"
     mRNA            complement(<210225..>211856)
                     /locus_tag="PAS_chr2-1_0115"
                     /product="Mitochondrial cytochrome-c peroxidase"
                     /transcript_id="XM_002490954.1"
                     /db_xref="GeneID:8198511"
     CDS             complement(210225..211856)
                     /locus_tag="PAS_chr2-1_0115"
                     /codon_start=1
                     /product="Mitochondrial cytochrome-c peroxidase"
                     /protein_id="XP_002490999.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0115"
                     /db_xref="EnsemblGenomes-Tr:CAY68719"
                     /db_xref="GeneID:8198511"
                     /db_xref="GOA:C4QZP5"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="InterPro:IPR002207"
                     /db_xref="InterPro:IPR010255"
                     /db_xref="UniProtKB/TrEMBL:C4QZP5"
                     /translation="MDLINSLIAPFRNFYQRLAIRLAPLGRVLLYPYVLFLAHLQSVH
                     FVVYVQAKNLELYYRREAQRFTSGSRRSTTFKDKSQELDQWKLDFGTSRPIAEEVKPL
                     FRASVNPRDVMLKAWGRTDYYYDRYVVHTPFCIIVRLSGERNRYIYSPRPGTKLPFVL
                     SELPEPDQYHFSPEATRSFNLNKAEVPKPVEKPLVKLFEREVIPEVVAKPDTPAIDKS
                     PIVLDADTGTKFSSSHTPLTGQLTVSKTGSPRNRRIKLVVNKKPKAPFIGSFYDYEHV
                     RHEIINCFDRPELDYGSLAPNIVRLAWHVSATYDQRTGTGGSNGCTIRFPPELTDPGN
                     TGLHPAMSALNLIQAKFPWISYADLYTFAGAIAIEYLGGPKIDWKPGRVDCTDQSLVP
                     PNGRLPLGSLGADHIRDVFINALGFDDRAAVCLIGGGHALGRTHAKYSGWDGKWTENP
                     LQFSNQFFLELLTHEWDECTVPETGMKQFCYEKKRLMMLNTDMALLRDPSFAKWVKIY
                     GEDEKLFFDEFSQDFAKLLELGVDRDSDGIARKKF"
     gene            complement(<212008..>213444)
                     /locus_tag="PAS_chr2-1_0116"
                     /db_xref="GeneID:8198512"
     mRNA            complement(<212008..>213444)
                     /locus_tag="PAS_chr2-1_0116"
                     /product="Actin-associated protein, subunit of a complex
                     (Rvs161p-Rvs167p)"
                     /transcript_id="XM_002490955.1"
                     /db_xref="GeneID:8198512"
     CDS             complement(212008..213444)
                     /locus_tag="PAS_chr2-1_0116"
                     /codon_start=1
                     /product="Actin-associated protein, subunit of a complex
                     (Rvs161p-Rvs167p)"
                     /protein_id="XP_002491000.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0116"
                     /db_xref="EnsemblGenomes-Tr:CAY68720"
                     /db_xref="GeneID:8198512"
                     /db_xref="GOA:C4QZP6"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:C4QZP6"
                     /translation="MSFKGFRKGLVRGPQSIRQKLNMGQITEDPVYVDAERRFKELED
                     ETKRLSDESKRYFTAVNGMLNHQIGFSKAIEEIYKPISGRVSDPSTLVVEGSPEGIEA
                     STQYREVVAELQTTLKPDLELIETRIVAPAQQLLDVIKSIRKMATKRNHKQLDLDRAQ
                     NSLHKIQEKKEKTVKDEEKMYKAEADVAIAQQEYDYYNDMMKNELPVLFKLEAEFIKP
                     LFVSFYYMQLNIFYTLFQRMEELKIPYFDLSADIIEQFTYKRGNVQEQADAIGITHFK
                     LGNAKAKLEATKRRYAAAGGPAGAAGVAGAAAGSTAAGTEQLPQYGQTPEYGQTAAGA
                     PAYGQPSAATPAYGQAPAYGQAPAYGQAPAYGQAPAYGQSNSPYPPEKVGYGQPQGYQ
                     APVTAASAASPIPSAVPSTPTAPTTAPGVETCTALYDYSAQAAGDLSFSAGQVIEVVQ
                     KTDANGWWTGRLNGVQGVFPGNYVELNK"
     gene            <214127..>215635
                     /locus_tag="PAS_chr2-1_0117"
                     /db_xref="GeneID:8198513"
     mRNA            <214127..>215635
                     /locus_tag="PAS_chr2-1_0117"
                     /product="GTPase activating protein (GAP) for Rho1p,
                     involved in signaling to the actin cytoskeleton, null mut"
                     /transcript_id="XM_002490956.1"
                     /db_xref="GeneID:8198513"
     CDS             214127..215635
                     /locus_tag="PAS_chr2-1_0117"
                     /codon_start=1
                     /product="GTPase activating protein (GAP) for Rho1p,
                     involved in signaling to the actin cytoskeleton, null mut"
                     /protein_id="XP_002491001.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0117"
                     /db_xref="EnsemblGenomes-Tr:CAY68721"
                     /db_xref="GeneID:8198513"
                     /db_xref="GOA:C4QZP7"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C4QZP7"
                     /translation="MEDNPSAKKSLANWWKSFQRSAQSNKVPQDDERPRIRFRSRSST
                     AIKTNSDYKQHIDDFFTKRKERDNYLTKGGVGDNLVFNVTLESSLEITSAKVALCTDI
                     NTSVTYGRIPTLVVCCGLFLKQQGLDKPGIFRMPGAARRVRELQVLFSSPPTYGAKFD
                     WNGYTVHDAASILRRYLTSLSEPLIPLDLYEAFRSPILNRPLIVKYFKKKEQRRIERD
                     KIMKQKEGDEPRATRNAQNNQDNDDETPENMDAPLGTEDVEDHFVDASEEIVPDGQQK
                     QKRKKHKQKLIKEIHGALAEYVDLFSQLSLPSRQLIYYLVDLLQMVSTHSSTNLMSVR
                     NLASIFQPSLLFHPKHDLEPEQYILSQAVVEFWIEYSDRILRASTLLESQTTKKQKPP
                     PIARSSLPPVTQPEAKRNSLSSFLNLSYSGRRKHSKSMSSAVSPPDVISNLKHSNLSG
                     ASLEHTTSFSSDYTHPGQAPSSVSDNPPSSVSNNPQSASLQTKPPNIMISSE"
     gene            <215905..>217332
                     /locus_tag="PAS_chr2-1_0118"
                     /db_xref="GeneID:8198514"
     mRNA            <215905..>217332
                     /locus_tag="PAS_chr2-1_0118"
                     /product="GTPase activating protein (GAP) for Rho1p,
                     involved in signaling to the actin cytoskeleton, null mut"
                     /transcript_id="XM_002490957.1"
                     /db_xref="GeneID:8198514"
     CDS             215905..217332
                     /locus_tag="PAS_chr2-1_0118"
                     /codon_start=1
                     /product="GTPase activating protein (GAP) for Rho1p,
                     involved in signaling to the actin cytoskeleton, null mut"
                     /protein_id="XP_002491002.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0118"
                     /db_xref="EnsemblGenomes-Tr:CAY68722"
                     /db_xref="GeneID:8198514"
                     /db_xref="GOA:C4QZP8"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C4QZP8"
                     /translation="METSTSPPRNSISSWWSNFKQRHSSNESLSIYTSNETPSKQGGT
                     TNTSPKRPQMRPKSRSSNYIPYRLSLHRNSKELDLSDEAKLKQHRNSFLNSRQQDFFE
                     DSQVFAVPLKQSLEIASAKINCGSSDYGLIPVVIAQCGIYIKKNGLDVEGIFRVAGSS
                     RRVKELQFVFSTAPLYGRKIDWESYGTTVHDAASLMRRYLNFLPEPLVSLALYEQFRD
                     PIRSRPRILNYLKNKSEKKDKEKSPEQEGEKDQQDREQTGVQAQSEQESKQQAKDIDE
                     QNEEYKAKEAKKAANEKKLKKSILAALKEYALLFNYLPKESRHLILYILDLLSLCTQH
                     RDKNLMTAKNLAAVFQPSILTHPDHDMSPEEYALSHAVLEIWIEFSYILIARLNDSPQ
                     EIIRLTDTKGTKRDTIPSVTTSTDSTFLAPPPGQHRRQHSRSLSSVVPVNDRIYQNKQ
                     KPQLLDDQLQETTPEPQNDKESDDV"
     gene            complement(<217388..>219207)
                     /locus_tag="PAS_chr2-1_0119"
                     /db_xref="GeneID:8198515"
     mRNA            complement(join(<217388..218424,218703..>219207))
                     /locus_tag="PAS_chr2-1_0119"
                     /product="Nuclear protein that acts as a heterodimer with
                     Aos1p to activate Smt3p (SUMO) before its conjugatio"
                     /transcript_id="XM_002490958.1"
                     /db_xref="GeneID:8198515"
     CDS             complement(join(217388..218424,218703..219207))
                     /locus_tag="PAS_chr2-1_0119"
                     /codon_start=1
                     /product="Nuclear protein that acts as a heterodimer with
                     Aos1p to activate Smt3p (SUMO) before its conjugatio"
                     /protein_id="XP_002491003.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0119"
                     /db_xref="EnsemblGenomes-Tr:CAY68723"
                     /db_xref="GeneID:8198515"
                     /db_xref="GOA:C4QZP9"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4QZP9"
                     /translation="MRWISNFPPPSKTFTERTMARDIQLIRILGEETYNKISNSKVLL
                     VGAGGIGCELLKDLLLMGYGEIHVADLDTIDLSNLNRQFLFRQKDIKKSKANTAVAAV
                     ALFKGNTRLEPHHGNIMDVSQFPLSWFRQFDIIFNALDNLEARVYVNRMALFINKPLI
                     ESGTTGLKDSAEEFIDSVVEKIFVEDIVRLAKIDTLWKTRQKPIPLNYELYSKKLKEL
                     PTSIISDDQKIWTTEENLFVLIDSLKRLQARYKSEGVLDFDKDDKDTLDFVVAAANLR
                     SFIFGIETKSEFEIKQIAGNIIPAVATTNAIFAGFSSLQSLNVFSDDPVGNSRLIYDS
                     EYINKFVTQCPPLPGNSNCKACGIQRGIITVPSLDIQLGEIHKQLLKKFGYSDDVSIV
                     VGNNRLIYDYDFEDNLISSLKDLTIGSGSIFFVSDSDDDLQDIELYLEVAPQETDITL
                     TDITIKKKPLKKKESKEEVTIQDDQMEEIFDEDEILLIDEPAEKRPLEIEQEETYSKR
                     KKSTI"
     gene            <219568..>220668
                     /locus_tag="PAS_chr2-1_0120"
                     /db_xref="GeneID:8198516"
     mRNA            <219568..>220668
                     /locus_tag="PAS_chr2-1_0120"
                     /product="Subunit of mitochondrial NAD(+)-dependent
                     isocitrate dehydrogenase, which catalyzes the oxidation
                     of"
                     /transcript_id="XM_002490959.1"
                     /db_xref="GeneID:8198516"
     CDS             219568..220668
                     /locus_tag="PAS_chr2-1_0120"
                     /codon_start=1
                     /product="Subunit of mitochondrial NAD(+)-dependent
                     isocitrate dehydrogenase, which catalyzes the oxidation
                     of"
                     /protein_id="XP_002491004.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0120"
                     /db_xref="EnsemblGenomes-Tr:CAY68724"
                     /db_xref="GeneID:8198516"
                     /db_xref="GOA:C4QZQ0"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ0"
                     /translation="MFRQYSRAIRSTPFTRSYATNVAQFLGQKNSNGKYTVSFIEGDG
                     IGVEISDAVKQIYSAADVPIEWESCDVTPLFINGKTTLPQQAVDSINKNLVALKGPLA
                     TPVGKGHQSLNLTLRRTFNLFANVRPCKSIQGYKTPYENVDTVLIRENTEGEYSGIEH
                     TIVPGVVQSIKLITKVASERCIRYAFEYARSVGRKEVLVVHKASIMKLSDGLFVKTAE
                     ELASEYPEIKLSFELLDNTSLKLCTDPSDYKSLVMVMPNLYGDIMSDLSSGLIGGLGL
                     TPSGNMGDKVSIFEAVHGSAPDIAGKNLANPTALLLSSCMMLRHMSLNSYADKIENSV
                     LKTIASGPEHRTKDLKGTSSTSNFTEQVIKNL"
     gene            <220873..>221508
                     /locus_tag="PAS_chr2-1_0121"
                     /db_xref="GeneID:8198517"
     mRNA            <220873..>221508
                     /locus_tag="PAS_chr2-1_0121"
                     /product="Phosphoribosyl-glycinamide transformylase,
                     catalyzes a step in the 'de novo' purine nucleotide biosy"
                     /transcript_id="XM_002490960.1"
                     /db_xref="GeneID:8198517"
     CDS             220873..221508
                     /locus_tag="PAS_chr2-1_0121"
                     /codon_start=1
                     /product="Phosphoribosyl-glycinamide transformylase,
                     catalyzes a step in the 'de novo' purine nucleotide biosy"
                     /protein_id="XP_002491005.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0121"
                     /db_xref="EnsemblGenomes-Tr:CAY68725"
                     /db_xref="GeneID:8198517"
                     /db_xref="GOA:C4QZQ1"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR004607"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ1"
                     /translation="MTPKILVLISGNGSNLQALINAKEQGQLKAEISLVISSSSKAFG
                     IERARKHNIPVRVHELKSYYQGIPKEEKAKRAEKRNDFDQDLVKIILSEKPDLVVCAG
                     WMLILGEKFLQPLQEKNISIINLHPSLPGAFEGINAIERSYNAGQNGEITKGGIMIHR
                     VILEVDRGQPLIVREIDVIKGETLESWEARIHSLEHQAIVDGTNKALDELK"
     gene            complement(<221574..>222371)
                     /locus_tag="PAS_chr2-1_0122"
                     /db_xref="GeneID:8198518"
     mRNA            complement(<221574..>222371)
                     /locus_tag="PAS_chr2-1_0122"
                     /product="Endopeptidase with trypsin-like activity that
                     cleaves after basic residues"
                     /transcript_id="XM_002490961.1"
                     /db_xref="GeneID:8198518"
     CDS             complement(221574..222371)
                     /locus_tag="PAS_chr2-1_0122"
                     /codon_start=1
                     /product="Endopeptidase with trypsin-like activity that
                     cleaves after basic residues"
                     /protein_id="XP_002491006.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0122"
                     /db_xref="EnsemblGenomes-Tr:CAY68726"
                     /db_xref="GeneID:8198518"
                     /db_xref="GOA:C4QZQ2"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR024689"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ2"
                     /translation="MAGLSFDNHQRNQFLSAKGFGSPKATSTGTTIVGVKFEGGVVIA
                     ADTRATSGPIVADKNCEKLHRLSPTIWCAGAGTAADTEMVTQLIGSNLELHAMSTERK
                     PRVVTALTMLKQHLFKYQGHIGAYLIVGGVDPTGAHLFSIHAHGSTDIGFYQSLGSGS
                     LAAMAVLESNWKEGLTKEEAMKLCTEAIEAGIWNDLGSGSNVDLCVMEVGKDAQLYRN
                     YLKPNVREAKVKSYKFARGTTAVLKESIYNLVDIEETVVPMEVDTEA"
     gene            complement(<222543..>225605)
                     /locus_tag="PAS_chr2-1_0123"
                     /db_xref="GeneID:8198519"
     mRNA            complement(<222543..>225605)
                     /locus_tag="PAS_chr2-1_0123"
                     /product="Mitochondrial isoleucyl-tRNA synthetase, null
                     mutant is deficient in respiratory growth"
                     /transcript_id="XM_002490962.1"
                     /db_xref="GeneID:8198519"
     CDS             complement(222543..225605)
                     /locus_tag="PAS_chr2-1_0123"
                     /codon_start=1
                     /product="Mitochondrial isoleucyl-tRNA synthetase, null
                     mutant is deficient in respiratory growth"
                     /protein_id="XP_002491007.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0123"
                     /db_xref="EnsemblGenomes-Tr:CAY68727"
                     /db_xref="GeneID:8198519"
                     /db_xref="GOA:C4QZQ3"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR023585"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ3"
                     /translation="MLRRRALFTVEGRRYFSSCLSRCYSVSSDSGSDVSHKYSSTLRL
                     PKTSFPNRSSSELISSKLLPQCTDDVYYGNLNNTDRELFILHDGPPYANGELHIGHAL
                     NKVLKDIINRFNLIDGKRVFYKPGWDCHGLPIELKALEALRKEQNTRVKILKSQLKKT
                     TNEEERDNIEHEIKQVKRSKLTPSDIRTLARSFALATSEAQSKSFQELGVMGDFKNPY
                     KTLDPSYVINQLYIFKQMMDNGLIRRQEKPVYWSCENATALAEGELEYNDSHNSTAIY
                     LKFPVDTTDLKELSSLGNKVNLLIWTTTPWTIVANKAVSVNSKLDYTILKHQSEYLIV
                     ALDLASQVMSSKEGIEDTKIHLSGAQLLKTTYINSLTGGVKQPILDGDHVTNVAGTGL
                     VHTAPGHGNDDYWVCLKNDIAPYSPVDSFGRYTPDVPESCKDLIGLHVLKEGAPKVVE
                     KLTNLGAIFSIQKNYIHSYPYDWRSKKPIIIRSTPQWFINIDQIKERTLKTLQDVKFY
                     PDKGFKRLETFIQRRQEWCISRQRSWGVPIPVIYEKDTGKEILNDEVIGAITKYIEGA
                     GVDSWFDKNCDMSNFLPESMKADSEKYVRGNDTMDVWFDSGTSWHLIEDFLKHNGQDI
                     NSRNYLADVYLEGSDQHRGWFQSSLLTKMAICKDKEKTISPYRKIITHGFTLDEKGNK
                     MSKSLGNTLKPQDVINGVKSKNIPALGVDGIRLWVAQSDYFTDVAIGPTILKHVAENL
                     KKIRFTIKFILGNLEGFSMDKSVPYQDLQLLDQYALSKLYSLQQICKESYSEFNFSKV
                     VRNLNHHMNVELSSVYFDLVKDRVYADAPDSASRRSVQTVLVAILQSYISILSPITPI
                     IAQEAWNHAPRYVTNDTKSPFSKGWHELPQSYRRADLELEFSQLFELNSTIKLLMDQG
                     SRVDKSIRNTLETAVYLNCEEGTPVWDLLQKHQSYLSDYFLTSQVFINQELPDFSVSY
                     HYEDKIRLDCGTIDVHVVQSSLHKCPRCWKYEVRPDHELCHRCDKVVN"
     gene            complement(<225734..>229303)
                     /locus_tag="PAS_chr2-1_0811"
                     /db_xref="GeneID:8198520"
     mRNA            complement(<225734..>229303)
                     /locus_tag="PAS_chr2-1_0811"
                     /product="hypothetical protein"
                     /transcript_id="XM_002490963.1"
                     /db_xref="GeneID:8198520"
     CDS             complement(225734..229303)
                     /locus_tag="PAS_chr2-1_0811"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491008.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0811"
                     /db_xref="EnsemblGenomes-Tr:CAY68728"
                     /db_xref="GeneID:8198520"
                     /db_xref="InterPro:IPR013935"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ4"
                     /translation="MTDPNSYIVPARVNIRLVPLGISLSTFEKYTKLLKEIFEIRLLD
                     VTPDRGTFNPQGFPYGRILFNYTTCRCDPDSLFLYDLEPFRKVFILVGVTDEKYIKDQ
                     ALEDSLRLLKVQNPDVITHNLVVFGDEAKEDEQLNNLENVFFQKFRSLETIMCDISSN
                     FLQSLSNYAASYKHVTLRSPGSIASGNITRITSSAVVTNIIEKQKKRFSVSFDQGFDR
                     KLRVKARQQKLLGNLYLLSGRLNDSLKEFCESIYGLKSCNDYLWLASSLEGMGVCCLL
                     LSMIGSSFTLPNHVLSILNTITKDSLLLNLVSSPSASPRSSLQSMTNINANTTTNTAN
                     SNKEFGQERILELLTSVHDKVISYYKLSIPSADDYVPQIVYCETVLRYTKLCTMVHLN
                     GKMDKNTFPFLVNGKKAPIENFQPIVSESLDSISTFDRLSIVANLQELSDVEFEKLTL
                     VQKCLIYSSLVSIYGDLQYHRKKAFYLKLLLNTIHPSLGKLDVPVDTLSKYRELFEYL
                     LTVYNIEQSSSWLLLQKSILLVILSFSTKLDDRQLLSRVSYLLLNRFHEALSTKEQEH
                     IFKTHLSNTSEDQEFFNDHLLQNLGYPDNGNNYKISPSKDKTLVVQGESFVYNPYLKE
                     KSNSPQRFIIMKDEISQVSLTLYNPYAFELDIANIELTTVTRDIKLKILKVDFLKNEE
                     NSHFTAITLKPKASLNVLVIFIPLDIGTLEIDGFQANVCSCKQTKFKVVQGTENHAAA
                     NSTRSLIFDVMHPQPVLSLTSVSLHNSSLMLLEGEETQFEANLKNYSSIPIGYLQYVI
                     TDSTYEPLLQILSNRKLPVNEIYEIEYHLFEKKALKILNEEVLGEIESNKSVRLQVGI
                     LGKRGMKSANINLQYCHKKGANMLRNLDIPINVTVFPSIELDAYDFYPLLGSSQSGLL
                     NEQTGYLSKFLSRIVSEGKKISDYCILSLDLRNSWNEPLKVEFSLATDVDCNFSIKET
                     IPSFKTRKLLLPLKRFKISAEKLAEPIPNFREKQFIVDKISPGERKNMLQLFWYRYNL
                     LQMIQGRWKNEPETRIGSVDTRGLRLSTKMVNTLSVGEVDIDINLFQDSKEIEGDLVR
                     PVNVHECYNVVVNIHNNSSSALKGILRHVPYCMQTKKSIDQKVLFNGTLQYAITDPIS
                     TGASRSFTMGAIFVEKGFYEWGVILDNDDNQYLETEPLKVIAR"
     gene            complement(<229592..>232197)
                     /locus_tag="PAS_chr2-1_0812"
                     /db_xref="GeneID:8198087"
     mRNA            complement(join(<229592..232116,232194..>232197))
                     /locus_tag="PAS_chr2-1_0812"
                     /product="hypothetical protein"
                     /transcript_id="XM_002490964.1"
                     /db_xref="GeneID:8198087"
     CDS             complement(join(229592..232116,232194..232197))
                     /locus_tag="PAS_chr2-1_0812"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491009.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0812"
                     /db_xref="EnsemblGenomes-Tr:CAY68729"
                     /db_xref="GeneID:8198087"
                     /db_xref="GOA:C4QZQ5"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ5"
                     /translation="MVNFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQRAG
                     IISAAKAGEARFTDTRKDEQERGITIKSTAISLYSEMGDDDVKEIKQKTEGNSFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDCVEGVCVQTETVLRQALGERIKPVVVINKV
                     DRALLELQVTKEDLYQSFARTVESVNVVIATYTDKTIGDNQVYPEQGTVAFGSGLHGW
                     AFTVRQFATRYSKKFGVDRIKMMERLWGDSYFNPKTKKWTNKDKDAAGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPVLLEKLEINLKREEKELEGKALLKVVMRKFLPAADAL
                     LEMIVLHLPSPVTAQAYRAETLYEGPSDDQFCIGIRECDPKAELMVYISKMVPTSDKG
                     RFYAFGRVFSGTVKSGQKVRIQGPNYVPGKKEDLFIKAVQRTVLMMGRTVEPIDDVPA
                     GNILGIVGIDQFLLKSGTLTTNEAAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLTYISESGEHIVAGTGELHLEICLQDLQDDHAGVPLKISPPVVTYRET
                     VTNESSMTALSKSQNKHNRIYLKAQPIDEELSLAIEEGKVHPRDDFKARARIMADEYG
                     WDVTDARKIWCFGPDGTGANLVVDQSKAVQYLHEIKDSVVAGFQLATKEGPILGENMR
                     SVRVNILDVTLHADAIHRGGGQVIPTMKRVTYAAFLLAEPAIQEPIFLVEIQCPENAI
                     GGIYSVLNKKRGQVISEEQRPGTPLFTVKAYLPVNESFGFTGELRQATAGQAFPQMVF
                     DHWANMNGNPLDPASKVGEIVLAARKRQGMKENVPGYEEYYDKL"
     gene            complement(<232523..>235630)
                     /locus_tag="PAS_chr2-1_0124"
                     /db_xref="GeneID:8198088"
     mRNA            complement(<232523..>235630)
                     /locus_tag="PAS_chr2-1_0124"
                     /product="Elongation factor 2 (EF-2), also encoded by
                     EFT1"
                     /transcript_id="XM_002490965.1"
                     /db_xref="GeneID:8198088"
     CDS             complement(232523..235630)
                     /locus_tag="PAS_chr2-1_0124"
                     /codon_start=1
                     /product="Elongation factor 2 (EF-2), also encoded by
                     EFT1"
                     /protein_id="XP_002491010.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0124"
                     /db_xref="EnsemblGenomes-Tr:CAY68730"
                     /db_xref="GeneID:8198088"
                     /db_xref="GOA:C4QZQ6"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002219"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011072"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ6"
                     /translation="MSDTSNDEVIKDILKKIERERNIAQGASNIRKKTNNAEIIQNCN
                     TSIREAQQNIEYLEQTLSKLQLEQHNRAARGSNQGELTQQKVLKTSPPTFTFLDLLKY
                     DCPSLGHRIHYMLQLLEFKLQVEKQYREANEKISRLYQVDGDRRSIAAAEGGKVESDM
                     KIHLMKMALKNYHDVHVNIDEVARDTEVMNTFRKKPLSGTLSITINSIRDILHVSSIF
                     SKKLETLVSIRIDDVEKARTKPTKNQRVNDSFQIHVEKGNELSLIVYDKVGDTLTPVA
                     MIWFLLSDIVEEIRKKKVDRELNATGWMSASNLAGRPEQQQPQQLGSHPFDNQQGNLQ
                     SLQTHTSHSNGDTDPAQLSASAWFVLAPAGQILLTMGFNKTNDAGQKKEFMGGLGRHG
                     AIRQRKEEVLEQHGHKFVPRQFYNIMMCAMCGDFLPYSGYQCEDCRFLCHKKCYQKVI
                     TKCISKSSIDVDPEETKLNHRIPHKFEPFSNHGTKWCCHCGYILPWSRKNVYKCSECG
                     VVCHAQCTHLVPDFCGMSMEMASKILSTIKETTATRQQRQAMSMSSKSSGKSDTHISQ
                     KQLPPVPSAAQRLSQSDEAPKTKPIRRPPPPPPPVSNEQRVLPQREEPQVEPERTPNQ
                     AIAEAGYALEKQISSTSSSKETDHHHQHHHYHPQQQPQQQVKTVKTAVASDVSPTKVA
                     VKKQEAARRSSERHHGRHRQKYGLDDFRFIAVLGKGNFGKVMLAESIHTGQLCAIKVL
                     KKDFIIKNDEVASTKSEKRVFIIANRGKHPFLLNLHQCFQTENRIYFVMEYVSGGDLM
                     WHAQQRTFSPSRAKFYAAEVLLALQYFHENGVVYRDLKLDNILLTADGHIKLADYGLC
                     KEEMWYGSTTATFCGTPEFMAPEILKEQKYDKAVDWWAFGVLLYQMMLGKSPFKGEDE
                     DEVFNSILTDEPRYPIQMDRESVDILQQLLTKDPYKRLGASEEDAEEIKRHPYFHGIN
                     WDDIMQCKVPPPLIPTIKDRHDVSNFDVEFTTEAPKLTPVNSVLSLSMQEQFRGFTYV
                     NDDHT"
     gene            complement(<236012..>239695)
                     /locus_tag="PAS_chr2-1_0125"
                     /db_xref="GeneID:8198521"
     mRNA            complement(<236012..>239695)
                     /locus_tag="PAS_chr2-1_0125"
                     /product="RNA polymerase II second largest subunit B150,
                     part of central core"
                     /transcript_id="XM_002490966.1"
                     /db_xref="GeneID:8198521"
     CDS             complement(236012..239695)
                     /locus_tag="PAS_chr2-1_0125"
                     /codon_start=1
                     /product="RNA polymerase II second largest subunit B150,
                     part of central core"
                     /protein_id="XP_002491011.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0125"
                     /db_xref="EnsemblGenomes-Tr:CAY68731"
                     /db_xref="GeneID:8198521"
                     /db_xref="GOA:C4QZQ7"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ7"
                     /translation="MSYDPYSIDDTITTEDCWTVISAFFEEKGLVSQQLDSFDEFMET
                     SIQDLVWEEPRLILDQPAQHTNEKDNINKRYEIRFGKIYLSRPTMTEADGTTHAMFPQ
                     EARLRNLTYSSPVYLDMEKSMFTSIDDEGNPNATLDWQQVHEPIKDGVEEGNKVHIGK
                     VPIMLRSKFCSLRTLDEVDLYKMKECPYDMGGYFVINGSEKVLIAQERSAANIVQVFK
                     KAAPSPISHVAEIRSALEKGSRLISTMQIKLYGREDKGTGRTIKATLPYVKQDIPIVI
                     VFRALGVVPDGEILQHICYDENDWQMLEMLKPCIEEGFVIQDKEVALDFIGRRGSAAL
                     GIRREKRIQYAKDILQKELLPHITQEEGFETRKTFFLGYMVNRLLLCALERKDQDDRD
                     HFGKKRLDLAGPLLANLFRILFRKLTREIYRYMQRCIETDRDFNLNLAVKSTTITSGL
                     KYSLATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLH
                     NTHWGLVCPAETPEGQACGLVKNLSLLSGISIGSPSEPIINFLEEWGMEPLEDYDPAQ
                     HTKSTRIFVNGVWTGIHRDPSMLVSTMRDLRRSGAISPEVSIIRDIREREFKIFTDVG
                     RVYRPLFIVEDDESKDNKGELRITKEHIRKIQQGYDDDAMNDDSEEQEQDVYGWSSLV
                     TSGVIEYVDGEEEETIMIAMTPEDLQTRSLEQKEIDLNDTAKRIKPEMSTSSHHTFTH
                     CEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYY
                     PQKPLAKTQAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFF
                     RSYMDQEKRFGISIVEEFEKPTRATTLRLKHGTYEKLDEDGLIAPGVRVSGDDIIIGK
                     TTPIPPDTEELGQRTKYHTKRDASTPLRSTENGIVDQVLLTTNQEGLKFVKVRMRTTK
                     VPQIGDKFASRHGQKGTIGVTYRHEDMPFSAEGIVPDLIINPHAIPSRMTVAHLIECL
                     LSKVGSIRGYEGDATPFTDLTVDAVSNLLRDNGYQSRGFEVMYNGHTGKKLMAQVFFG
                     PTYYQRLRHMVDDKIHARARGPVQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAGF
                     LKERLMEASDAFRVHVCGICGLMSVIANLKKNQFECRSCKNKTNIYQLHIPYAAKLLF
                     QELMAMNIAPRLYTERSGVSMRS"
     gene            <240254..>240898
                     /locus_tag="PAS_chr2-1_0126"
                     /db_xref="GeneID:8198522"
     mRNA            <240254..>240898
                     /locus_tag="PAS_chr2-1_0126"
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /transcript_id="XM_002490967.1"
                     /db_xref="GeneID:8198522"
     CDS             240254..240898
                     /locus_tag="PAS_chr2-1_0126"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL41"
                     /protein_id="XP_002491012.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0126"
                     /db_xref="EnsemblGenomes-Tr:CAY68732"
                     /db_xref="GeneID:8198522"
                     /db_xref="GOA:C4QZQ8"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR013025"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ8"
                     /translation="MSAPRGLATVSPLSRKWYDLSQKAIEQGKPHFRLGQKKIYFPSA
                     RVILLRPNAKHTPYQAKFVVPKSFNKLDLRDYLYHIYGLRAFNITTQLLHGKFTRSLP
                     MPFRARRRSPQIKKMTIDMQDPFVWPEPQNSYLQDELDLSEESKQYFQDRTSPGADKN
                     KRSLAFGGIIDPEPAAENFVPKKLSRQMKNKKQKALEQEKRQSQEELIRQYISL"
     gene            complement(<241114..>241869)
                     /locus_tag="PAS_chr2-1_0127"
                     /db_xref="GeneID:8198523"
     mRNA            complement(<241114..>241869)
                     /locus_tag="PAS_chr2-1_0127"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490968.1"
                     /db_xref="GeneID:8198523"
     CDS             complement(241114..241869)
                     /locus_tag="PAS_chr2-1_0127"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491013.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0127"
                     /db_xref="EnsemblGenomes-Tr:CAY68733"
                     /db_xref="GeneID:8198523"
                     /db_xref="InterPro:IPR004345"
                     /db_xref="UniProtKB/TrEMBL:C4QZQ9"
                     /translation="MLGLLLGLIGWVISVGFPLVKSYQSIVTSSKESTVNWLIYWIIY
                     SINLYITSCGPFQLIFGYVPFFSVVNLYFHCWLVLPLIDVSKYNTLKENEVLSSLLQN
                     HMVNGGDKRVNGALLLWFLYLDPMLESGLQNLDLNSDNIWNQLQSLLVRLAQRYTPGA
                     PSPAAAVPEKQANQASKFSPLLEFGKLAMLSESLLKYPLSLIDGEKTSTASSTVSSVA
                     EFDIVNRDELEGENSPNNNSPKQDNWFWKTKSE"
     gene            complement(<242072..>242320)
                     /locus_tag="PAS_chr2-1_0128"
                     /db_xref="GeneID:8198524"
     mRNA            complement(<242072..>242320)
                     /locus_tag="PAS_chr2-1_0128"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490969.1"
                     /db_xref="GeneID:8198524"
     CDS             complement(242072..242320)
                     /locus_tag="PAS_chr2-1_0128"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491014.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0128"
                     /db_xref="EnsemblGenomes-Tr:CAY68734"
                     /db_xref="GeneID:8198524"
                     /db_xref="UniProtKB/TrEMBL:C4QZR0"
                     /translation="MKLGKNYDPAVFPLILVPCFNRNDGPHAEKSSPDVRLVSGWLKS
                     TPHIYVHQGKTSNPRSYRFRGVYTDCSGSTEIITVQKH"
     gene            <243124..>244884
                     /locus_tag="PAS_chr2-1_0129"
                     /db_xref="GeneID:8198525"
     mRNA            <243124..>244884
                     /locus_tag="PAS_chr2-1_0129"
                     /product="Proline permease, required for high-affinity
                     transport of proline"
                     /transcript_id="XM_002490970.1"
                     /db_xref="GeneID:8198525"
     CDS             243124..244884
                     /locus_tag="PAS_chr2-1_0129"
                     /codon_start=1
                     /product="Proline permease, required for high-affinity
                     transport of proline"
                     /protein_id="XP_002491015.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0129"
                     /db_xref="EnsemblGenomes-Tr:CAY68735"
                     /db_xref="GeneID:8198525"
                     /db_xref="GOA:C4QZR1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C4QZR1"
                     /translation="MPFQNIKNKMFDKKTSTTVSVHEEEALESGNSSINNSGVQQLSY
                     DGTDYKPSEAPEVDEDDINNVHRGMKSRHILLIGIGGCIGTGLFVGTGANLAKTGPAP
                     LLMSYLLMSFAIWSVMNNLSEMATYLPLKGVSISGFVSRYADDSLGFACGYNLFYTFA
                     IMVATEVTAVGLIIEYWNDDIHIAIFMTVFLAAIVILNFLPNKYFGEMEFWFALIKVL
                     CILGLIVTGIVIFFGGAPSRDRIGFRYWKNPGAFAERITPGAGGRFLDVWTALILSGF
                     SFILGPELIITAAAEAKRPRYNIPKVANSFIWRIMFFYIAGSLVVGCTVPYNHPRLLS
                     GGSNASASPYVIAIQSAGIKVLPDIINACILTSAWSAGNAYMFSGSRMLLQLAKVGQA
                     PQIFNRVNKYGVPWTCMILVSAISCLAYLNVSAGSAKVFTWLSNLCTISGFISWLCSS
                     VAFLRWRKAMILQGRWDSRPYKTALQPYATYYALFLLGMVVLTNGYDVFIKGRWDTAT
                     FIAAYVTIPPFVILWLGHKFFFNKHKRLLRPVSEIDLVTGLQAVEAEAEKDFFEIEQE
                     RATSTAFNNPFLRAFHYILY"
     gene            complement(<245149..>246549)
                     /locus_tag="PAS_chr2-1_0130"
                     /db_xref="GeneID:8198526"
     mRNA            complement(<245149..>246549)
                     /locus_tag="PAS_chr2-1_0130"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490971.1"
                     /db_xref="GeneID:8198526"
     CDS             complement(245149..246549)
                     /locus_tag="PAS_chr2-1_0130"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491016.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0130"
                     /db_xref="EnsemblGenomes-Tr:CAY68736"
                     /db_xref="GeneID:8198526"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4QZR2"
                     /translation="MDPPKKKKKASSLKGDFFAFQDDTFGFPKKKRKTSKTKRTKDQE
                     GSSESKTDANLNLLSPKKNSNRRSTRKSETTEHTPAGPQIVDIDEKSDATDKNNDTDN
                     ECVTPPPIIEHEMPLFDYDLTKEVSTTPIPVEAEPDVPKIIDPYKSVKCLVSITNQMH
                     YFENSTVDLMVKCGTSFGKIMDTALKQLNSDLDSFKKYQPTLVLNNEHEIKRHLKVSS
                     LITSNLLSPQASDNDVLKLSLTLMSSQQYELMNLQREMRLQTLSTKNDLQNIEKITPI
                     EDDLNDDSEYFTIGLQCAQDDISKVIMVCSNTPLKRVQEYYLLVMGYPRALSTNLSYQ
                     EMPISRYSTIEESEIRKNTILHIDYEEKDLQALREQTEDHEESLLIDDIVKDEKKTDR
                     QFFIHMKSNDGKEPIKLSVSKNTPISFIKDYYLTTQGLPSSTKVQLLFDDESLNMSSK
                     VGDTELDEDFLIDVVI"
     gene            <246793..>247311
                     /locus_tag="PAS_chr2-1_0131"
                     /db_xref="GeneID:8198527"
     mRNA            <246793..>247311
                     /locus_tag="PAS_chr2-1_0131"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490972.1"
                     /db_xref="GeneID:8198527"
     CDS             246793..247311
                     /locus_tag="PAS_chr2-1_0131"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491017.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0131"
                     /db_xref="EnsemblGenomes-Tr:CAY68737"
                     /db_xref="GeneID:8198527"
                     /db_xref="UniProtKB/TrEMBL:C4QZR3"
                     /translation="MNKLMDNLVPVWKQYLYTWQSLRNIPFRKKWFIGYDLSGNTYWE
                     FIVERNSKNYRRKMVPYQRKDFMHDYYESVPPQWQQWLRFVKQHPPTLTELIADRQRQ
                     EAIKELAKNADRRWQLETQKQEDYDNWKLNKELNRMNVRQTPGGRPPPFSGKSTHSND
                     DPISSANVKSNR"
     gene            complement(<247387..>250269)
                     /locus_tag="PAS_chr2-1_0132"
                     /db_xref="GeneID:8198528"
     mRNA            complement(<247387..>250269)
                     /locus_tag="PAS_chr2-1_0132"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490973.1"
                     /db_xref="GeneID:8198528"
     CDS             complement(247387..250269)
                     /locus_tag="PAS_chr2-1_0132"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491018.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0132"
                     /db_xref="EnsemblGenomes-Tr:CAY68738"
                     /db_xref="GeneID:8198528"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4QZR4"
                     /translation="MDTKIQHIFGCSSKKTSQFAVCQSKNLIGYVTSGGVVVSEVDLK
                     ENAVKSQRFFCANNKKSKSSRQTLESNDSNANAYLNLAINSGLLDDDTHVESDSLEYY
                     TRDGLSISHASDSASFTPTNTNVSKLTHKVRVISCIDISSDGKLLAVGEEGYQPRVLV
                     YSLEPNSTNSPLFCISDHRFGINLVKFSPKNDKLCSLGISNDGFLNCWKLRPTSSSNK
                     VLFLGSNKCLSTINGLIWKGNDIVVTFGLRHIRLWNCSFNDSIELCKEIFEKAPPTSP
                     TKPHVQLIKGKNVILKDFINSNFLSCSWFNEDELLVLTDRSEIACFNLYDDPIQLQKL
                     DVHLAETTNQIYLGDSLYYNSGELIKSMELESIKIAEDLTIQPTPYSPRKTQVRDGLI
                     SLLKFGDFFACLNDKDEIYLIHKDGTLACVIADAMFKCSVDFKSIGKKGLNLSSSGEL
                     VQFDFDSHNFKSITLLRFQQPGTDSLEHEFSCFEYSCKNREIFFGDKFGLVYFFNDGN
                     LVKSIKAHESSVNQMVYAKLGADAHLLVTVGRDRMIQLFFKQGSPWELFQTLSIHRGN
                     LSQAIIHNERLYVCSHDRTISVHELKFKDQLSVNLLKVISLKSTPLYMEIVDNELYVS
                     TNDRSVMIFNLHSFEVFKTLKLHSALNNDSLLIEKFFVAQQDDTKLLVTCSSTDKSIS
                     IFTLSGDLLNSHWAHGDAVVSMTRLQDSLHFCTISGNGCCFFWSLSFGPLKVAVKNEK
                     MDSSLLESPTTKVARRIVNSPRSPPKSPQPKTLVSMAGSPSVKTDNTLHRLSPTKRLY
                     PNGRVPLGSSSILNSQTVVKNISPTKSSNVFADKGRDKEQHINTSPQKTRPKSLILTT
                     PKNRTRGRLVKPSISEAAEKLISQLKEFQAEFETVEPLTQSTITALRLELERTLSFVN
                     DDGDTEHTSNDDTSERDVQADNSSLLESFSNQLVALVEKKLQINGA"
     gene            complement(<250525..>251403)
                     /locus_tag="PAS_chr2-1_0133"
                     /db_xref="GeneID:8198608"
     mRNA            complement(join(<250525..250893,250962..251103,
                     251180..>251403))
                     /locus_tag="PAS_chr2-1_0133"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490974.1"
                     /db_xref="GeneID:8198608"
     CDS             complement(join(250525..250893,250962..251103,
                     251180..251403))
                     /locus_tag="PAS_chr2-1_0133"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491019.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0133"
                     /db_xref="EnsemblGenomes-Tr:CAY68739"
                     /db_xref="GeneID:8198608"
                     /db_xref="InterPro:IPR025340"
                     /db_xref="UniProtKB/TrEMBL:C4QZR5"
                     /translation="MPYGYDWPDELYGYWCNSGYESEPDTDEIARAEEFYDEREDYID
                     KSLFPLEFEPPACVTEKKVDLADFGSLNLLNKINEDIIATVFYYHDSENIGDSKISFR
                     NAAVSPNVTVVDGDRVMARRTLIFPNVYQHRVEPFELADKTKPGHRKILCFLLVDPNN
                     QQTVATDKVPAQQQNLSGDKITSSVDRTSYIIPTENLDLTDSAFQYTISSDEAKKVRE
                     KLMKGRTPEEEDERGGSTAYTSFFIP"
     gene            complement(<251553..>251921)
                     /locus_tag="PAS_chr2-1_0134"
                     /db_xref="GeneID:8198529"
     mRNA            complement(<251553..>251921)
                     /locus_tag="PAS_chr2-1_0134"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490975.1"
                     /db_xref="GeneID:8198529"
     CDS             complement(251553..251921)
                     /locus_tag="PAS_chr2-1_0134"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491020.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0134"
                     /db_xref="EnsemblGenomes-Tr:CAY68740"
                     /db_xref="GeneID:8198529"
                     /db_xref="InterPro:IPR025340"
                     /db_xref="UniProtKB/TrEMBL:C4QZR6"
                     /translation="MGPNENVLLLDRALDEDFTESLKKLVYEKLEDVPEDSKDWRPGS
                     DNQVLDLVHPSLYPLQYGKTKVMTGNLFEVSKMIVPKDIPTYTNCLGKDYLSEIYQWL
                     PSIFHVSKKDGGTMWTYNLY"
     gene            complement(<252727..>255516)
                     /locus_tag="PAS_chr2-1_0813"
                     /db_xref="GeneID:8198450"
     mRNA            complement(<252727..>255516)
                     /locus_tag="PAS_chr2-1_0813"
                     /product="Cu(+2)-transporting P-type ATPase, required for
                     export of copper from the cytosol into an extracytos"
                     /transcript_id="XM_002490976.1"
                     /db_xref="GeneID:8198450"
     CDS             complement(252727..255516)
                     /locus_tag="PAS_chr2-1_0813"
                     /codon_start=1
                     /product="Cu(+2)-transporting P-type ATPase, required for
                     export of copper from the cytosol into an extracytos"
                     /protein_id="XP_002491021.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0813"
                     /db_xref="EnsemblGenomes-Tr:CAY68741"
                     /db_xref="GeneID:8198450"
                     /db_xref="GOA:C4QZR7"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:C4QZR7"
                     /translation="MFQTKVTITGMTCSACVNSITQNLQSLDSVEEVSVSLMTETGTI
                     VHGDGISPKDIIEVIEDSGFDCELISSDPVLSEPEKASYQNETTVKLQVIGMTCTNCS
                     DTVESMVSQLDGVLSAHVALVTEECVVRYLPRQVGIRKIVETIENCGFDVLLLNNTLV
                     DKESQLNILAKVKEIQYWRLTFVQNLIFGVPVFFLGHIFPMITHKNVKLFNGLTLTDF
                     IQLVLASYIQLWLARKFYTNAYNSLRHGTGNMDLLICLSTTIAYGYSIITLLHAILGA
                     NHTQPSVLFDTSAMLFIFISFGKFLENKAKSHSSTALSKLLALSPTSCLLIENFSSEK
                     DIESTSLVTKEIVPELLQLNDMVLIHPGSRIPCDGTVVYGKSDVDESLLTGESLPVLK
                     EEGAKVICGSVNNSGVLYVKVDKLSSDTELQQIVDLVKDAQMSKAPVQRFADSVSSIF
                     VPTILSLSVLTFIVWFMVVKCRSFSSVPTFFKDGDHISIERVFKVAISVIVVACPCAL
                     GLAAPTAIMVGTGVGATNGILIKGGEVLENASSIECVLFDKTGTITTGLMQLSRYSLN
                     PTVSNISESDLWHIIGRLESNSEHPVAKALSKISMEKSVESKPEITVSNVDIQVGAGI
                     KADVTINGEVLKVSIGNEKICSTIQSNEEICGTHIYVLINEVLQGYVELSDMVKSDSA
                     QVVSYLMSQGISVALVTGDNQATAEKVASKVGIFKSNVFANVSPSEKAGIVQEIRSEF
                     GFKIAFVGDGINDAPALVDADIGIAIASGTDVAIEAADIVLLSNDSNSISGLISALSI
                     SRATFKKIKMNFFWAFIYNAFMLPIAMGVFLVPFGLYLHPMVASAAMAFSSVSVVLNS
                     LLLKLWKKPDISSFKFSAPNTSNDLDINTDLETGSLIKRFQKSTPSKKYFNLLDKLKF
                     WSSPTRKESYELLAQ"
     gene            <256230..>257894
                     /locus_tag="PAS_chr2-1_0135"
                     /db_xref="GeneID:8198089"
     mRNA            <256230..>257894
                     /locus_tag="PAS_chr2-1_0135"
                     /product="Helix-hairpin-helix protein, involved in DNA
                     repair and replication fork stability"
                     /transcript_id="XM_002490977.1"
                     /db_xref="GeneID:8198089"
     CDS             256230..257894
                     /locus_tag="PAS_chr2-1_0135"
                     /codon_start=1
                     /product="Helix-hairpin-helix protein, involved in DNA
                     repair and replication fork stability"
                     /protein_id="XP_002491022.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0135"
                     /db_xref="EnsemblGenomes-Tr:CAY68742"
                     /db_xref="GeneID:8198089"
                     /db_xref="GOA:C4QZR8"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:C4QZR8"
                     /translation="MCMPEDQGRGEPSRTMDLPSDLKHLFLKWLEDDCIVQIQLGSKR
                     ALQLTRAMENLKRTDEAIDNVNKLKTVRYIGPKITEFLNKKLLKYCNDNGYRVPDWCK
                     TAETTTSSRKPATQKVAKPSTSTGLTGALPGGRSKGRRKYVPAKNSSAYAILISLLVN
                     DSAQTGVQKSTVIAVASKYCERSFTTNPATGQFYSAWNSIKTLMNHELVVESTTKRPA
                     LYYLTDEGKLLATTLVQEMPEHQRPQIDGNDEDYDARQSTPAAYFASCGYQEWSDFTI
                     KMIIDNREIRSQTERDFFQNKMSDANVPIEIRPLPVGDVLWVARSEAGEEVVLDTIVE
                     RKRLDDLVASIQDGRFLEQKSRLKETKLKNIIYITEEFTSTNLGQMAGAVQTSLSMIM
                     TNFQFRLHRTKDADATCKFLSILHRSVCNRFQNKPIICINAMKLDDNSLPAFQDSLMK
                     FRKEMDKDGCYIYINYSIFHSIFGKSSLVSLKETYIKMLMTTKGVSLDKAIQIQRHYP
                     TPQSLIKAFRESKDPKLLSQHFKQEIITHKKVTAILSEKIFQTWGI"
     gene            <258071..>259696
                     /locus_tag="PAS_chr2-1_0136"
                     /db_xref="GeneID:8198451"
     mRNA            <258071..>259696
                     /locus_tag="PAS_chr2-1_0136"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002490978.1"
                     /db_xref="GeneID:8198451"
     CDS             258071..259696
                     /locus_tag="PAS_chr2-1_0136"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002491023.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0136"
                     /db_xref="EnsemblGenomes-Tr:CAY68743"
                     /db_xref="GeneID:8198451"
                     /db_xref="GOA:C4QZR9"
                     /db_xref="InterPro:IPR007603"
                     /db_xref="UniProtKB/TrEMBL:C4QZR9"
                     /translation="MSEKYSRPAQPPPTYNQPGGGQSPFNEPYYPQQGVNSSDYHQQQ
                     RPDYDPESQFPPEKIVGSGKPDNAETFDDSFKVKNKLNDWPFTILFIATLAGFVVVAG
                     IVLSAWASNYSTSGSGIYDSGASFTLNTNTVVLFAFVIVISLVLAVLMLCFARIAPKR
                     FIQVGIVLNVVLGLASSIYYLAVGYYSAGVVFLVFTLISAYCYWSMRGRIPFSATVLT
                     IVIDVMKRNPSTLMTSLIGIIVSGAFAALFSATVVATYMKWTPSDENGNCSFNEGSTS
                     CSRSKVIGILVFVFFAGYYITEVIGNVIHVTISGVYGSWYYLSRSDQGMPRFPALGAF
                     KRAMTWSFGSICFGSLIVALLQLLKTIIQILKNDAMQNGEGWQTIILCCADCILGLIE
                     WAVRYFNHYAYSFVALYGESYMKSARATWDLFRAKGLDALVNDCLIGAGLSFFALFVS
                     YLSALFSYLYLRYTAPGYNSDGSFYAPVIAFTFVIALQIVNIASSVIRSGTATFFVCL
                     ARDPEVFQISYPDEFSRIFADYPQVMNKVAARQ"
     gene            complement(<259820..>262673)
                     /locus_tag="PAS_chr2-1_0137"
                     /db_xref="GeneID:8198452"
     mRNA            complement(join(<259820..260768,260875..>262673))
                     /locus_tag="PAS_chr2-1_0137"
                     /product="Nuclear import receptor, mediates the nuclear
                     localization of proteins involved in mRNA-nucleus expo"
                     /transcript_id="XM_002490979.1"
                     /db_xref="GeneID:8198452"
     CDS             complement(join(259820..260768,260875..262673))
                     /locus_tag="PAS_chr2-1_0137"
                     /codon_start=1
                     /product="Nuclear import receptor, mediates the nuclear
                     localization of proteins involved in mRNA-nucleus expo"
                     /protein_id="XP_002491024.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0137"
                     /db_xref="EnsemblGenomes-Tr:CAY68744"
                     /db_xref="GeneID:8198452"
                     /db_xref="GOA:C4QZS0"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4QZS0"
                     /translation="MTMTLDKLNQALTSMYGSTDESTQHAADKFLLEFQKSPEAWTIV
                     FQVLNNDNDPPMTTIKMFCAQTLRSKINYDLFQLPKENWQGLKDSLLQLIVKYDSKAK
                     AIETQLCVSLANLALQYVEWSNAMDEIISVLSSGSMASLLEFLKVLPEELSDVNKTPL
                     TDEEFSLRTTQLITDNVERVLLILKKFSDVKDSNGGRENSMVLDCLNSWIKEVSVDQL
                     LKVRSLSDMIYQSIHNDETFDTAVECLCTILRETTDVEDLTIVQTLYQQLLSLKDVIQ
                     ESWDDPEKMEGLTRIFVEAGEAWHVLIPKLCEDFKPLVEILLQLTSYEDDLDTVKYTF
                     FFWHQLRQIIIIDKYAEARILFTPIYTQLIHVMIKHLSYPIVEPNTTDSSLLFSTKQQ
                     EDKFKDFRYEMGDVLKDCCAVIGASNALSIPLNQIQSNVNSNQPWQSIEAPIFSLRAM
                     AEQVRSTENKLMPQVMQLLIKLPENPKIRYAVTLVLGRYTEWTSKHPEYLEGQLSYIT
                     DGFQSNNNQITIAASHALMFFCQDCSSLLIGYLEQLFNFYNNVYSAGTLDIKSLYEVA
                     DGIAHILQEEGDPEKLMQLTAMFWKPTIEKLSSLPSNPIAKLVIEQGWPIVTKLLNKF
                     GKSTPITERALKFLNKSMSSLSTYLEPIIPQMAELLVSGFQTYREGAYLWVSGIFIRE
                     YGDEHVSAQIKENVWKFSLQQAASFIQFLEQNQSEITNYPDLVEDYFRMMADILMFFP
                     IHLIQSELLQPVYNSAIMALSTFSQFEPLIATLHFLIDLYSWGFETPPVSLLETDVPP
                     EIRRIILSFIESTGGPLTKVLLNGLVYRFPVDCNHDASDLWTKIIRLVTINGQNGDLV
                     LQWLNEALSSLPEGTVNEKERSKLLTTVQAAINSKDFRRVRASIRDFINWYSRKNFER
                     S"
     gene            <262820..>263159
                     /locus_tag="PAS_chr2-1_0138"
                     /db_xref="GeneID:8198453"
     mRNA            join(<262820..262846,262920..>263159)
                     /locus_tag="PAS_chr2-1_0138"
                     /product="Core Sm protein Sm E"
                     /transcript_id="XM_002490980.1"
                     /db_xref="GeneID:8198453"
     CDS             join(262820..262846,262920..263159)
                     /locus_tag="PAS_chr2-1_0138"
                     /codon_start=1
                     /product="Core Sm protein Sm E"
                     /protein_id="XP_002491025.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0138"
                     /db_xref="EnsemblGenomes-Tr:CAY68745"
                     /db_xref="GeneID:8198453"
                     /db_xref="GOA:C4QZS1"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027078"
                     /db_xref="UniProtKB/TrEMBL:C4QZS1"
                     /translation="MSSSRTQKVMVPPINLMFKFLQQQSTVQIWLYEQNNTRINGIIK
                     GFDEFMNVVVDEAIEINLKTQKQRKLGRLLLKGDNITLISTLSN"
     gene            complement(<263321..>264184)
                     /locus_tag="PAS_chr2-1_0139"
                     /db_xref="GeneID:8198454"
     mRNA            complement(<263321..>264184)
                     /locus_tag="PAS_chr2-1_0139"
                     /product="Mitochondrial ribosomal protein of the small
                     subunit"
                     /transcript_id="XM_002490981.1"
                     /db_xref="GeneID:8198454"
     CDS             complement(263321..264184)
                     /locus_tag="PAS_chr2-1_0139"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the small
                     subunit"
                     /protein_id="XP_002491026.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0139"
                     /db_xref="EnsemblGenomes-Tr:CAY68746"
                     /db_xref="GeneID:8198454"
                     /db_xref="GOA:C4QZS2"
                     /db_xref="UniProtKB/TrEMBL:C4QZS2"
                     /translation="MGKNVIKHGGKSGILPPAREIFKQPIKPITIKKNPNTGYAPNIP
                     HPRGSTREAIVPKVVTIEEKISKTAPEPKKIYSSEELSKLSADQQWKIKNSKLRRDYL
                     KESYYQEEKNLEHKEKIQHLKESKAKEEAAAASHYEVSEAFRLTLPSMEQFLEGPIVR
                     QRTKEEKRLLKLKREHNRLQRELAIKEQKASDLLRLCSSAKNFIVTEEELERRVEELY
                     RTGPKAYFNGSNMNSFEDQQALDIEKTVQEKLFGTVNEGPGISTIEDILSGETEKLKN
                     AVEDKVKQNDK"
     gene            complement(<264385..>266421)
                     /locus_tag="PAS_chr2-1_0140"
                     /db_xref="GeneID:8198455"
     mRNA            complement(<264385..>266421)
                     /locus_tag="PAS_chr2-1_0140"
                     /product="ATPase involved in protein import into the ER,
                     also acts as a chaperone to mediate protein folding i"
                     /transcript_id="XM_002490982.1"
                     /db_xref="GeneID:8198455"
     CDS             complement(264385..266421)
                     /locus_tag="PAS_chr2-1_0140"
                     /codon_start=1
                     /product="ATPase involved in protein import into the ER,
                     also acts as a chaperone to mediate protein folding i"
                     /protein_id="XP_002491027.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0140"
                     /db_xref="EnsemblGenomes-Tr:CAY68747"
                     /db_xref="GeneID:8198455"
                     /db_xref="GOA:C4QZS3"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C4QZS3"
                     /translation="MLSLKPSWLTLAALMYAMLLVVVPFAKPVRADDVESYGTVIGID
                     LGTTYSCVGVMKSGRVEILANDQGNRITPSYVSFTEDERLVGDAAKNLAASNPKNTIF
                     DIKRLIGMKYDAPEVQRDLKRLPYTVKSKNGQPVVSVEYKGEEKSFTPEEISAMVLGK
                     MKLIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGLIAGLTVLRIVNEPTAAALAYG
                     LDKTGEERQIIVYDLGGGTFDVSLLSIEGGAFEVLATAGDTHLGGEDFDYRVVRHFVK
                     IFKKKHNIDISNNDKALGKLKREVEKAKRTLSSQMTTRIEIDSFVDGIDFSEQLSRAK
                     FEEINIELFKKTLKPVEQVLKDAGVKKSEIDDIVLVGGSTRIPKVQQLLEDYFDGKKA
                     SKGINPDEAVAYGAAVQAGVLSGEEGVDDIVLLDVNPLTLGIETTGGVMTTLINRNTA
                     IPTKKSQIFSTAADNQPTVLIQVYEGERALAKDNNLLGKFELTGIPPAPRGTPQVEVT
                     FVLDANGILKVSATDKGTGKSESITINNDRGRLSKEEVDRMVEEAEKYAAEDAALREK
                     IEARNALENYAHSLRNQVTDDSETGLGSKLDEDDKETLTDAIKDTLEFLEDNFDTATK
                     EELDEQREKLSKIAYPITSKLYGAPEGGTPPGGQGFDDDDGDFDYDYDYDHDEL"
     gene            complement(<266745..>268784)
                     /locus_tag="PAS_chr2-1_0141"
                     /db_xref="GeneID:8198456"
     mRNA            complement(<266745..>268784)
                     /locus_tag="PAS_chr2-1_0141"
                     /product="Member of the ChAPs family (Chs5p-Arf1p-binding
                     proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms th"
                     /transcript_id="XM_002490983.1"
                     /db_xref="GeneID:8198456"
     CDS             complement(266745..268784)
                     /locus_tag="PAS_chr2-1_0141"
                     /codon_start=1
                     /product="Member of the ChAPs family (Chs5p-Arf1p-binding
                     proteins: Bch1p, Bch2p, Bud7p, Chs6p), that forms th"
                     /protein_id="XP_002491028.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0141"
                     /db_xref="EnsemblGenomes-Tr:CAY68748"
                     /db_xref="GeneID:8198456"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:C4QZS4"
                     /translation="MSYVTQGSIPEVLEKYANQSLEERTNCLPAIQDLGPPDLVQLVK
                     LNHHSHKEISTFFYITGTNVTSSSSVAAVLNSFAMIISESPQLWFGKHKPWRVIQATF
                     CSYNVFSKTDAVVTVHIPGSAESHMVSSTGEKIKETEQLWLETFISSMIRSIITADDD
                     DAEFASIVELRKVNPLLNDESVTLFLEGFEALFWDGQKTGCHANLQLPTLLENYLVDT
                     FFKVLQLTRRFDQGVEIVNRLIEQDESCRVLLAKVYMLSNQEIKAMDIICQGIKINPR
                     DAALLTLQAEICMGKSRHDLAIHAATRAVESSPSEFKCWATLAKIYINVGNFEEALLT
                     LNSCPMVTHKDRYHLKRVFNPLKQDLHLPLPVDVTIDEVTTLNPADVTQEHKTVDASL
                     LNLPAASLKSTFAEAYGLLTEIVHKIGWEELLRYRAKVFVMEHEYKKEKSHSATSSTT
                     LANDATIKAINCGNGQQNGNAVNDDDFRAKRLCERWLDNLFMLLYEDLRVYTMYRAEH
                     MHLTAQQMEFKKTTLEWELIGMVSWRLKHFKEASEAFKYALGLRFSVKACKKLIEFYL
                     NERSRMNQPETSIALNNLNQSTLSIQEILKYRSFLDINLISNLVKLGVWNHRWYAEFS
                     PKLIESLAVVVENGGLIKVENEVKATYFDSQDGVYDLMNEVFKFMKHYDYPGTDN"
     gene            complement(<269079..>269540)
                     /locus_tag="PAS_chr2-1_0142"
                     /db_xref="GeneID:8198457"
     mRNA            complement(<269079..>269540)
                     /locus_tag="PAS_chr2-1_0142"
                     /product="Subunit (17 kDa) of TFIID and SAGA complexes,
                     involved in RNA polymerase II transcription initiation"
                     /transcript_id="XM_002490984.1"
                     /db_xref="GeneID:8198457"
     CDS             complement(269079..269540)
                     /locus_tag="PAS_chr2-1_0142"
                     /codon_start=1
                     /product="Subunit (17 kDa) of TFIID and SAGA complexes,
                     involved in RNA polymerase II transcription initiation"
                     /protein_id="XP_002491029.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0142"
                     /db_xref="EnsemblGenomes-Tr:CAY68749"
                     /db_xref="GeneID:8198457"
                     /db_xref="GOA:C4QZS5"
                     /db_xref="InterPro:IPR003162"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4QZS5"
                     /translation="MTNEQAAIPRDVRLLHLIFATQNIYSYQDHVPLQLMDFAYRYTT
                     GTLQDATIYSDHAHASGSHISNAGNAGTNAQLTTEDIRLAIAARTNYQFKPVPPKELL
                     LELAAERNKKPLPAVIPTWGIRLPPEKYCLTGKDWVLEDEEEAVSYKKRKT"
     gene            <269892..>270434
                     /locus_tag="PAS_chr2-1_0143"
                     /db_xref="GeneID:8198458"
     mRNA            <269892..>270434
                     /locus_tag="PAS_chr2-1_0143"
                     /product="Conserved protein of the mitochondrial matrix,
                     performs a scaffolding function during assembly of ir"
                     /transcript_id="XM_002490985.1"
                     /db_xref="GeneID:8198458"
     CDS             269892..270434
                     /locus_tag="PAS_chr2-1_0143"
                     /codon_start=1
                     /product="Conserved protein of the mitochondrial matrix,
                     performs a scaffolding function during assembly of ir"
                     /protein_id="XP_002491030.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0143"
                     /db_xref="EnsemblGenomes-Tr:CAY68750"
                     /db_xref="GeneID:8198458"
                     /db_xref="GOA:C4QZS6"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="UniProtKB/TrEMBL:C4QZS6"
                     /translation="MFRSVLRANTNIAKTAFQKPATAPLLRQALQQTRAYHPKVIDHY
                     QNPRNVGSLNKNLPNVGTGLVGAPACGDVMRLQIQVNDETGIIEDVKFKTFGCGSAIA
                     SSSYVTELVRGKTLEEAGKIKNSVIAKELSLPPVKLHCSMLAEDAIKSAIKDYTSKRR
                     VTLGPEADAKVNLESSVSAH"
     gene            complement(<270685..>271332)
                     /locus_tag="PAS_chr2-1_0144"
                     /db_xref="GeneID:8198459"
     mRNA            complement(<270685..>271332)
                     /locus_tag="PAS_chr2-1_0144"
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /transcript_id="XM_002490986.1"
                     /db_xref="GeneID:8198459"
     CDS             complement(270685..271332)
                     /locus_tag="PAS_chr2-1_0144"
                     /codon_start=1
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /protein_id="XP_002491031.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0144"
                     /db_xref="EnsemblGenomes-Tr:CAY68751"
                     /db_xref="GeneID:8198459"
                     /db_xref="GOA:C4QZS7"
                     /db_xref="InterPro:IPR007018"
                     /db_xref="UniProtKB/TrEMBL:C4QZS7"
                     /translation="MNNTPLDELQWKSPEWIQTFGLRTDNVLEYFSQSPFFDRSSNNQ
                     VLKMQSQFNEQFQIQLQQNPHFLQQELKKMKGVEFIVAYTQEPNFWVIRKQFRKSPNE
                     ADALNDYYIIGANVYMAPVLNDVISSRLLSTTLALRKAMNTLHQMPKFSPTEGHYYHQ
                     DTDPYLGDKSRPGTIINTPNIGTTVSNTNLNTPSDKEAADRNTNSSTLISLLNML"
     gene            <271459..>271860
                     /locus_tag="PAS_chr2-1_0145"
                     /db_xref="GeneID:8198460"
     mRNA            <271459..>271860
                     /locus_tag="PAS_chr2-1_0145"
                     /product="Protein of unknown function, required for
                     survival upon exposure to K1 killer toxin"
                     /transcript_id="XM_002490987.1"
                     /db_xref="GeneID:8198460"
     CDS             271459..271860
                     /locus_tag="PAS_chr2-1_0145"
                     /codon_start=1
                     /product="Protein of unknown function, required for
                     survival upon exposure to K1 killer toxin"
                     /protein_id="XP_002491032.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0145"
                     /db_xref="EnsemblGenomes-Tr:CAY68752"
                     /db_xref="GeneID:8198460"
                     /db_xref="InterPro:IPR019083"
                     /db_xref="UniProtKB/TrEMBL:C4QZS8"
                     /translation="MFRAIRSYSQVVKYNNKVIPAPSKSVPDVNTFLTKIGRNAEEHI
                     EIFENDWSKFWNAKSSDMKEWGIEPQTRKYVLAWKERFRQGQEPYHIAKGVKKNGGER
                     NAKLHNALKRFEKLKAERELREKYMSEHKNF"
     gene            complement(<271895..>272395)
                     /locus_tag="PAS_chr2-1_0146"
                     /db_xref="GeneID:8198530"
     mRNA            complement(<271895..>272395)
                     /locus_tag="PAS_chr2-1_0146"
                     /product="Dinucleoside triphosphate hydrolase"
                     /transcript_id="XM_002490988.1"
                     /db_xref="GeneID:8198530"
     CDS             complement(271895..272395)
                     /locus_tag="PAS_chr2-1_0146"
                     /codon_start=1
                     /product="Dinucleoside triphosphate hydrolase"
                     /protein_id="XP_002491033.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0146"
                     /db_xref="EnsemblGenomes-Tr:CAY68753"
                     /db_xref="GeneID:8198530"
                     /db_xref="GOA:C4QZS9"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:C4QZS9"
                     /translation="MSKVLFSNFNVTSQVFYRSKYSYALVNLKPIVNGHVLVVPLRVV
                     SRLKELTKEESIDYMETVQLVHQFIEKYYNADGLNIAIQDGNAAGQSVPHLHTHLIPR
                     YYPDGYGDGIYAKLEDNEQKLENNYRKFKVLSDEDRKPRTLEEMTAEAENLAKELETF
                     KGNLTS"
     gene            <272450..>272668
                     /locus_tag="PAS_chr2-1_0147"
                     /db_xref="GeneID:8198531"
     mRNA            <272450..>272668
                     /locus_tag="PAS_chr2-1_0147"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490989.1"
                     /db_xref="GeneID:8198531"
     CDS             272450..272668
                     /locus_tag="PAS_chr2-1_0147"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491034.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0147"
                     /db_xref="EnsemblGenomes-Tr:CAY68754"
                     /db_xref="GeneID:8198531"
                     /db_xref="UniProtKB/TrEMBL:C4QZT0"
                     /translation="MIRDLVMSHRYLSVIFQGKCWQVTPDGKRDEVRRWGHTNHSSVE
                     LLLNTKCSNVFFPEQSHLGLPSFKDGIP"
     gene            complement(<272839..>273009)
                     /locus_tag="PAS_chr2-1_0148"
                     /db_xref="GeneID:8198532"
     mRNA            complement(<272839..>273009)
                     /locus_tag="PAS_chr2-1_0148"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490990.1"
                     /db_xref="GeneID:8198532"
     CDS             complement(272839..273009)
                     /locus_tag="PAS_chr2-1_0148"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491035.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0148"
                     /db_xref="EnsemblGenomes-Tr:CAY68755"
                     /db_xref="GeneID:8198532"
                     /db_xref="UniProtKB/TrEMBL:C4QZT1"
                     /translation="MGKTGKAYIIRELSVNVHNSDEPFVQLGQLPLGKSFSTGYIAGG
                     ICDYRSFTCQTS"
     gene            <273138..>275783
                     /locus_tag="PAS_chr2-1_0149"
                     /db_xref="GeneID:8198533"
     mRNA            <273138..>275783
                     /locus_tag="PAS_chr2-1_0149"
                     /product="Protein involved in DNA replication"
                     /transcript_id="XM_002490991.1"
                     /db_xref="GeneID:8198533"
     CDS             273138..275783
                     /locus_tag="PAS_chr2-1_0149"
                     /codon_start=1
                     /product="Protein involved in DNA replication"
                     /protein_id="XP_002491036.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0149"
                     /db_xref="EnsemblGenomes-Tr:CAY68756"
                     /db_xref="GeneID:8198533"
                     /db_xref="GOA:C4QZT2"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C4QZT2"
                     /translation="MDETTILGDTPLDAVYSDRVRRFQDFLTSPDLGNMDNIKKMLTL
                     GQRRLAVSLDEIRETDKDFWLGLLNTPADYLPACQDGVREAIKSIYTPIDYPDIEITS
                     DTDFYVSFKGSFGDHQLTPRTIGSHFLSKMVSVEGIVTRASLIRPKIIKSVHYCDATG
                     RFHQREYSDQTTSFNPITTSALYPTEDPEGNPLTTEYGFSKYRDHQTITIQELPELAP
                     AGQLPRSLDVIMDDDLVDLVKPGDRLQAVGVYRSLGGVGSNSSSFRTVILCNSVYPLH
                     ARSTSVKSVERLTNSDIRNINKLSKKKNIFDLMAQSLAPSIYGHAYIKKAVLLMLLGG
                     YEKNLSNGAHLRGDINLLMVGDPSTAKSQMLRFVLNTAPLAIATTGRGSSGVGLTAAV
                     TTDKETGERRLEAGAMVLADRGIVCIDEFDKMSDIDRVAIHEVMEQQTITIAKAGIHT
                     SLNARCSVIAAANPVYGQYDTNRSPQQNIALPDSLLSRFDLLFIVTDDISDEKDKAVS
                     EHVLRMHRFIPQGYSEGEPIRERRNVTLAVGDSSNQDEDDSDDRNKVYEKFSPLLHSG
                     AAEMAEGSTSSSKKTPKVLNITFLKKYIQYAKQRIEPQLTTECTKKVVEIYATLRNDH
                     IVKNSPITARTLETIIRLATAHAKVRLSQTVEIKDVQVAEEMLRFSLLGETPATKHKS
                     SPQKSPKKKRKTTSPSKKKFQDDETELYSVSESEPEYAEDKDDGNEDADVADYQPRAT
                     TARTRSLQERLQSAYDEEGEDEDMEEELVDVEQIREGLSQQTLREPSNEEDILQETNT
                     NMDQPATISASRFSKFKSLLSMLRSHYESTSEDGSAPVADLVTRVNQELSQEEQFDEQ
                     EAYLALEQMQEKNFIQISEEKVYFI"
     gene            <275961..>276500
                     /locus_tag="PAS_chr2-1_0150"
                     /db_xref="GeneID:8198534"
     mRNA            <275961..>276500
                     /locus_tag="PAS_chr2-1_0150"
                     /product="Flavin-linked sulfhydryl oxidase of the
                     mitochondrial intermembrane space (IMS), oxidizes Mia40p
                     as"
                     /transcript_id="XM_002490992.1"
                     /db_xref="GeneID:8198534"
     CDS             275961..276500
                     /locus_tag="PAS_chr2-1_0150"
                     /codon_start=1
                     /product="Flavin-linked sulfhydryl oxidase of the
                     mitochondrial intermembrane space (IMS), oxidizes Mia40p
                     as"
                     /protein_id="XP_002491037.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0150"
                     /db_xref="EnsemblGenomes-Tr:CAY68757"
                     /db_xref="GeneID:8198534"
                     /db_xref="GOA:C4QZT3"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:C4QZT3"
                     /translation="MTKDPQEEPSDDKPLFGSTGRKIIYDKDGKPCRSCNTLLDFKMA
                     GGSLMGALSTKKPSLAKDSVPETYKQEPPDVEQLGKSTWTFLHSVAATYPESPSPSQQ
                     DDMRQFMNIFGKIYPCWFCAKDFQKWSSKNEPKVKTQEEFGRWLCDAHNEVNAKLGKP
                     KFDCNLWKQRWKDGWDEGK"
     gene            complement(<276571..>278661)
                     /locus_tag="PAS_chr2-1_0151"
                     /db_xref="GeneID:8198535"
     mRNA            complement(<276571..>278661)
                     /locus_tag="PAS_chr2-1_0151"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490993.1"
                     /db_xref="GeneID:8198535"
     CDS             complement(276571..278661)
                     /locus_tag="PAS_chr2-1_0151"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491038.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0151"
                     /db_xref="EnsemblGenomes-Tr:CAY68758"
                     /db_xref="GeneID:8198535"
                     /db_xref="GOA:C4QZT4"
                     /db_xref="InterPro:IPR003124"
                     /db_xref="InterPro:IPR028293"
                     /db_xref="UniProtKB/TrEMBL:C4QZT4"
                     /translation="MAGPPAPPPPPPPPGGPMNSSSPAAPPPARDALLGDIRKGAKLR
                     KAQTIDKSKPILDKKSGGFAGGTSSPAPSIPSGGPTVPTVPTGAPQLGDILAGGMPKL
                     RHVSRGNNHQTPAQPPSPTVPKQRPGRVSSNKTVPTIPGGVPPLPSAAPPILPTATAP
                     PAPSAPPPLPNSSVPAVPTPTAPRRPSTSSRNKSRVPSDAPPAAPPLPSSRAPPAPPA
                     PPTSQPSPATPAAPSVPGGLPFLADIQKNRSDKHVIDTSPETAQESSRGQAAKVSSSS
                     APPLPSIAAPTAPAAPKLPNTVPPSHTPLNAPPLPNSGAPPVPPLPSSSAPPAPPLPS
                     SGPPPAPKLPNSGAPSIPALSKSNAPPAPSAPPAPSAPPAPPAPPAPPAPPVPPAPPA
                     PPAPPTQSFGGSSSKTQSTPTPRTTPPVSGGLPFLAEIQKKRNDVHVVDGESGYSTMS
                     NTPEPSSFSPKVPHVPQVNAPIIPKQSAPKIPSLPNSTAPQIPHSTAPQVPSIPTPSI
                     PTAPEIPSQAAPTLPPPIVKPAEIPTPVRTQKPPVRIPEPPSQSSLPPPPTPPSAPPT
                     AAPELPNSPPPMRNASGSVSRKAPPPPPSQSKPRIHSDSQSSANLKVDEQQHVGASLR
                     AIDVSAYTIDTSAIHKASNGQSQNSSRIEIDDSRFSFSNKDSLPKPRKFEGKEKLYPS
                     GRGSSVPLNLAAFV"
     gene            complement(<278789..>279775)
                     /locus_tag="PAS_chr2-1_0152"
                     /db_xref="GeneID:8198536"
     mRNA            complement(<278789..>279775)
                     /locus_tag="PAS_chr2-1_0152"
                     /product="Protein that acts together with Ula1p to
                     activate Rub1p before its conjugation to proteins
                     (neddylat"
                     /transcript_id="XM_002490994.1"
                     /db_xref="GeneID:8198536"
     CDS             complement(278789..279775)
                     /locus_tag="PAS_chr2-1_0152"
                     /codon_start=1
                     /product="Protein that acts together with Ula1p to
                     activate Rub1p before its conjugation to proteins
                     (neddylat"
                     /protein_id="XP_002491039.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0152"
                     /db_xref="EnsemblGenomes-Tr:CAY68759"
                     /db_xref="GeneID:8198536"
                     /db_xref="GOA:C4QZT5"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023318"
                     /db_xref="UniProtKB/TrEMBL:C4QZT5"
                     /translation="MSINSIKPFTEKKGPFTDDVYEPNTEETFNAIRSSKILVIGAGG
                     LGCEILKNLSLSGFQDIHVIDMDTIDLTNLNRQFLFRNKDIGKSKAKVASQFVMNRIP
                     NVQITPHFCRIQDKDDLFYRQFQLVICGLDSTEARRWINHKLVTLLDPNDFSSLIPMI
                     DGGTEGFRGQSRLILPTLSSCFECSLDMIPTNVTYPVCTIANTPRLPEHCIEWAHQLE
                     WPKKFGDKPFDADDPSQVDWMYKTSLERAKHFDIEGVTLSLTLGVVKNIIPAISSTNA
                     IIAASCCNEALKLISNVNPILDNYMMYSGDESVFTYTFKHERKPSCPVCGGS"
     gene            complement(<279913..>281136)
                     /locus_tag="PAS_chr2-1_0153"
                     /db_xref="GeneID:8198537"
     mRNA            complement(<279913..>281136)
                     /locus_tag="PAS_chr2-1_0153"
                     /product="Protein that stimulates strand exchange by
                     facilitating Rad51p binding to single-stranded DNA"
                     /transcript_id="XM_002490995.1"
                     /db_xref="GeneID:8198537"
     CDS             complement(279913..281136)
                     /locus_tag="PAS_chr2-1_0153"
                     /codon_start=1
                     /product="Protein that stimulates strand exchange by
                     facilitating Rad51p binding to single-stranded DNA"
                     /protein_id="XP_002491040.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0153"
                     /db_xref="EnsemblGenomes-Tr:CAY68760"
                     /db_xref="GeneID:8198537"
                     /db_xref="GOA:C4QZT6"
                     /db_xref="InterPro:IPR004585"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="UniProtKB/TrEMBL:C4QZT6"
                     /translation="MSFDDAELKRISKELDKQLGPEFICTRPGQGGMKVSYLSGTTAI
                     SLANHIFGFNGWHSEVKSTTVDFVDTQHGKISMGLSSVIRVTLKDGSFHEDIGYGSVE
                     NAKSKAIAFEKCRKEAITDGLKRVLRCFGNALGNCLYDKEYLRKISNVKTQAITFNEG
                     DLMRHNQLEARTLKQEAKLLEINQKKAKNSSKSRINVPPKHFGDNEDDDSHLFSDEIN
                     IDSEDFMNEIDDYEMDLLMQKNSQREIENVNDDEIENKGDAVDAVTKSNIENQFIAPN
                     SPQIMDNMVLTPDKIPAKVEFVSAKVAEKVQNNSPLNVEEKFNPSFQSPSLRRTVDPT
                     KSMPIRRTMVQTSVLSQSKQGPKRMIGIPPDTAKRHKLGSQNQNTANDKPEEKQLSRF
                     NSTKAPGKENSPASN"
     gene            <281363..>283225
                     /locus_tag="PAS_chr2-1_0154"
                     /db_xref="GeneID:8198538"
     mRNA            <281363..>283225
                     /locus_tag="PAS_chr2-1_0154"
                     /product="Nuclear envelope protein with multiple putative
                     transmembrane domains"
                     /transcript_id="XM_002490996.1"
                     /db_xref="GeneID:8198538"
     CDS             281363..283225
                     /locus_tag="PAS_chr2-1_0154"
                     /codon_start=1
                     /product="Nuclear envelope protein with multiple putative
                     transmembrane domains"
                     /protein_id="XP_002491041.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0154"
                     /db_xref="EnsemblGenomes-Tr:CAY68761"
                     /db_xref="GeneID:8198538"
                     /db_xref="GOA:C4QZT7"
                     /db_xref="InterPro:IPR019049"
                     /db_xref="UniProtKB/TrEMBL:C4QZT7"
                     /translation="MTIEDAKPKLIYYKTIFEQVQRKRLSFVNRIVVLLTFFSSLFIG
                     IFAGSSLWFWPLKWLLLGVSLILVRHCKESTQTLENPGFKTFFRQILGQIFCADFVSH
                     LLAYGISGFTYWVILFSQKSDDLTYYIITPTRTVLPYINDQFVYFWFFFGTLVLWQSI
                     QQAVFLRNKLNFQIGVYRIEPRSEFNLINFTTVLSGSLTSSVLVSLSTPILYVLSRSS
                     VYNVLLYPFYWVLGLNHNRPHLNIGFGLFCSLFYHSLLLTLQWEFVNLVYDIYVRIGC
                     IDKDKALSLQSADPVNTLLSGLKDVNHPFVQFTAFQELAYIATSSKPEDRKLFYSVHS
                     KNSYVWNTILEECTSYINENIKHIERRMVEFDDITKFLQPRPAEISGGLRRSELAVPP
                     TIFGNSKHQASSEGTPEYDSANEIFATPTSPGKLSSQFYSLAHDYNNIDNIHLVVQPI
                     QKVLLGYYQLLIQSSIGVPFRKTLSREAASRVKNPVLLGNIIIAFSTFLLHSQTEDKV
                     GVVKGSLAQALEILAKLISATGNFTDHPPLPPTMLETEQPKTHIIAIIHDLSMKQFFE
                     LAVKFNHVLNDLILSPTVFKLAKWSIDTAIEEQKKQETLQKKQTLKATGVSILH"
     gene            complement(<283299..>285140)
                     /locus_tag="PAS_chr2-1_0156"
                     /db_xref="GeneID:8198539"
     mRNA            complement(<283299..>285140)
                     /locus_tag="PAS_chr2-1_0156"
                     /product="Endosomal Na+/H+ exchanger, required for
                     intracellular sequestration of Na+"
                     /transcript_id="XM_002490997.1"
                     /db_xref="GeneID:8198539"
     CDS             complement(283299..285140)
                     /locus_tag="PAS_chr2-1_0156"
                     /codon_start=1
                     /product="Endosomal Na+/H+ exchanger, required for
                     intracellular sequestration of Na+"
                     /protein_id="XP_002491042.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0156"
                     /db_xref="EnsemblGenomes-Tr:CAY68762"
                     /db_xref="GeneID:8198539"
                     /db_xref="GOA:C4QZT8"
                     /db_xref="InterPro:IPR004709"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR018422"
                     /db_xref="UniProtKB/TrEMBL:C4QZT8"
                     /translation="MIRLLALFFARQILANEITDPTDENPVLVGPEAPEEETNPLTEE
                     IFSSWALFIVLLLVVSALWSSYYLQQRRVKSIHETVLSIFYGMFVGLILRVTPGHYIQ
                     DAVKFNSGYFFNFLLPPIILNSGYELHQANFFRNIGSILTFAIPGTFISAIVLGVILF
                     IWTKLGLDGIDVSLVDALSVGATLSATDPVTILSIFNSYKVDPKLYTIIFGESLLNDA
                     ICIVMFETCQKFHGQAVSVSSVLKGIGLFLMTFTVSLLIGVVVGVFIALVLKHSLIRR
                     YPQIETCLVLLFAYESYFFSNGCHMSGIVSLLFCGITMKHYAYFNMSRRTQIATKYIF
                     QLLAQLSENFIFIYLGLSLFTEVELVFRPMLIIVTTISICISRWCAVFPLSRLINWTT
                     RAKHKGGSSAINYTQDEIPPNYQMMIFWAGLRGAVGVALAMGLQGEAKSSLLATVLVV
                     VVLTVILFGGTTAGMLETLNIRVGVIDEQESDDEFDIEAPKPMQLNQIIPGATTPVYS
                     IYSDAAGSRSRTGSQQSFYNNEDEDAADAPPDMNDDEMTSDLDDIPPMANQAQSSKIN
                     LQSMSFNNLLSMDDHAKWFTHFDEQVLKPVLLDNLTENNNSKDKIED"
     gene            <285505..>286110
                     /locus_tag="PAS_chr2-1_0157"
                     /db_xref="GeneID:8198540"
     mRNA            <285505..>286110
                     /locus_tag="PAS_chr2-1_0157"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002490998.1"
                     /db_xref="GeneID:8198540"
     CDS             285505..286110
                     /locus_tag="PAS_chr2-1_0157"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491043.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0157"
                     /db_xref="EnsemblGenomes-Tr:CAY68763"
                     /db_xref="GeneID:8198540"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C4QZT9"
                     /translation="MPDEVDLLQKEENELTREKEIGRILSTFKLDSYAILDLKPGCSP
                     EDIRKTFRKKSLLIHPDKTPNKRAPDAFDTLKKAHANLVDDSIREQLDSSYAEARRLL
                     IRERKWNIDDARLNSSSFLVDWREKIKELLLEEELLKRLEKKRKMEEEGQVQQKKEEQ
                     LKETEGKRLQQQKWEDTRESRVQNWRSFVKKKRKKSKDVLA"
     gene            complement(<286140..>287756)
                     /locus_tag="PAS_chr2-1_0158"
                     /db_xref="GeneID:8198541"
     mRNA            complement(<286140..>287756)
                     /locus_tag="PAS_chr2-1_0158"
                     /product="Anthranilate synthase, catalyzes the initial
                     step of tryptophan biosynthesis, forms multifunctional"
                     /transcript_id="XM_002490999.1"
                     /db_xref="GeneID:8198541"
     CDS             complement(286140..287756)
                     /locus_tag="PAS_chr2-1_0158"
                     /codon_start=1
                     /product="Anthranilate synthase, catalyzes the initial
                     step of tryptophan biosynthesis, forms multifunctional"
                     /protein_id="XP_002491044.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0158"
                     /db_xref="EnsemblGenomes-Tr:CAY68764"
                     /db_xref="GeneID:8198541"
                     /db_xref="GOA:C4QZU0"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:C4QZU0"
                     /translation="MSVSDSHLATDYFGTQLTKQIHPSAESFLDIVKNDRQSHSPETV
                     PNLYPIYKFIQSDFLTPHLAYIKLTNSSETPSPSFLLESAKNGDTVDRYTFMGHSPRK
                     IIKTGPLEGAEVDPLVLLEKELKGTRQAQLPGIPRLSGGAIGYISYDCIKYFEPKTER
                     KLKDVLQLPEAALMLFDTIVAFDNVYQRFQVIGNVSLSVDDSDEAILEKYYKTREEVE
                     KISKVVFDNKTVPYYEQKDIIQGQTFTSNIGQEGYENHVRKLKEHILKGDIFQAVPSQ
                     RVARPTSLHPFNIYRHLRTVNPSPYMFYIDYLDFQVVGASPELLVKSDNNNKIITHPI
                     AGTLPRGKTIEEDDNYAKQLKSSLKDRAEHVMLVDLARNDINRVCEPTSTTVDRLLTV
                     ERFSHVMHLVSEVSGTLRPNKTRFDAFRSIFPAGTVSGAPKVRAMQLIGELEGEKRGV
                     YAGAVGHWSYDGKSMDTCIALRTMVVKDGVAYLQAGGGIVYDSDPYDEYIETMNKMRS
                     NNNTILEAEKIWTDRLARDENQSESEENDQ"
     gene            complement(<287909..>288983)
                     /locus_tag="PAS_chr2-1_0159"
                     /db_xref="GeneID:8198542"
     mRNA            complement(join(<287909..288466,288537..>288983))
                     /locus_tag="PAS_chr2-1_0159"
                     /product="UBX (ubiquitin regulatory X) domain-containing
                     protein that regulates Glc7p phosphatase activity and"
                     /transcript_id="XM_002491000.1"
                     /db_xref="GeneID:8198542"
     CDS             complement(join(287909..288466,288537..288983))
                     /locus_tag="PAS_chr2-1_0159"
                     /codon_start=1
                     /product="UBX (ubiquitin regulatory X) domain-containing
                     protein that regulates Glc7p phosphatase activity and"
                     /protein_id="XP_002491045.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0159"
                     /db_xref="EnsemblGenomes-Tr:CAY68765"
                     /db_xref="GeneID:8198542"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4QZU1"
                     /translation="MVDSETINKFIEVTGASAFQAIQYLEETDDFEAAVNDYYSSQLE
                     NEKGKGKSERPVNQTKASAGPKIRTFNDLNSNSNGDNNLFTGGEKSGLQVENPDKRGD
                     PFGLVNDLLKKAEETGQQPDTRPHEEAPARQFVGTGHKLGSTDSPSEDGFQVGDGDLY
                     RYDDPANARYLADLNAGRAPLALLDVEIGQEVDVTVHKKIEKNFTPPKKARVGFQGKG
                     QRLGSPVPGDIKLSQSPEVQQETQEEAEEEKQKEEAEQLGTGDSPVQIRLANGQRIVH
                     RFNSTDSVAQLYAFVNEHSPSAREFVLSLAFPVKPIENNEDTLKDAGLINAVVVQRWK
                     "
     gene            complement(<289344..>291650)
                     /locus_tag="PAS_chr2-1_0160"
                     /db_xref="GeneID:8198543"
     mRNA            complement(<289344..>291650)
                     /locus_tag="PAS_chr2-1_0160"
                     /product="Cobalamin-independent methionine synthase,
                     involved in amino acid biosynthesis"
                     /transcript_id="XM_002491001.1"
                     /db_xref="GeneID:8198543"
     CDS             complement(289344..291650)
                     /locus_tag="PAS_chr2-1_0160"
                     /codon_start=1
                     /product="Cobalamin-independent methionine synthase,
                     involved in amino acid biosynthesis"
                     /protein_id="XP_002491046.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0160"
                     /db_xref="EnsemblGenomes-Tr:CAY68766"
                     /db_xref="GeneID:8198543"
                     /db_xref="GOA:C4QZU2"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:C4QZU2"
                     /translation="MVQSSVLGFPRIGAFRELKKTTEAYWSGKVGKDELFKVGKEIRE
                     NNWKLQKAAGVDVIASNDFSYYDQVLDLSLLFNAIPERYTKYELDPIDTLFAMGRGLQ
                     RKATDSEKAVDVTALEMVKWFDSNYHYVRPTFSHSTEFKLNGQKPVDEYLEAKKLGIE
                     TRPVVVGPVSYLFLGKADKDSLDLEPISLLEKILPVYAELLAKLSAAGATSVQIDEPI
                     LVLDLPEKVQAAFKTAYEYLANAKNIPKLVVASYFGDVRPNLASIKGLPVHGFHFDFV
                     RAPEQFDEVVAALTAEQVLSVGIIDGRNIWKADFSEAVAFVEKAIAALGKDRVIVATS
                     SSLLHTPVDLTNEKKLDSEIKNWFSFATQKLDEVVVVAKAVSGEDVKEALSVNAAAIK
                     SRKDSAITNDADVQKKVDSINEKLSSRAAAFPERLAAQKGKFNLPLFPTTTIGSFPQT
                     KDIRINRNKFTKGEITAEQYDTFIKSEIEKVVRFQEEIGLDVLVHGEPERNDMVQYFG
                     EQLKGFAFTTNGWVQSYGSRYVRPPVVVGDVSRPHAMSVKESVYAQSITKKPMKGMLT
                     GPITVLRWSFPRNDVSQKVQALQLGLALRDEVNDLEAASVEVIQVDEPAIREGLPLRS
                     GQERSDYLKYAAESFRIATSGVKNTTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKD
                     DPNYIQEFSNYPNHIGLGLFDIHSPRIPSKEEFIARIGEILKVYPADKFWVNPDCGLK
                     TRGWEEVRASLTNMVEAAKTYREKYAQN"
     gene            <292075..>292746
                     /locus_tag="PAS_chr2-1_0161"
                     /db_xref="GeneID:8198544"
     mRNA            <292075..>292746
                     /locus_tag="PAS_chr2-1_0161"
                     /product="v-SNARE protein involved in Golgi transport,
                     homolog of the mammalian protein GOS-28/GS28"
                     /transcript_id="XM_002491002.1"
                     /db_xref="GeneID:8198544"
     CDS             292075..292746
                     /locus_tag="PAS_chr2-1_0161"
                     /codon_start=1
                     /product="v-SNARE protein involved in Golgi transport,
                     homolog of the mammalian protein GOS-28/GS28"
                     /protein_id="XP_002491047.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0161"
                     /db_xref="EnsemblGenomes-Tr:CAY68767"
                     /db_xref="GeneID:8198544"
                     /db_xref="GOA:C4QZU3"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="UniProtKB/TrEMBL:C4QZU3"
                     /translation="MSNYSQTRSQALQLENKTESLLSQYASFGQSSSSSATGEELSLE
                     KALKDILERRQELVNALSRIADSDDTLAASKLQQLHRHKEILNDHKRDFGRIQESIQQ
                     ERNKLNLLFSVRSDIQEHKKRSHTSNVDSLNEEEYMRQERNRVDNVNSFADRLLSQAY
                     ETRDEFSRQRHILNNAASRISESVSQMPGINVIVSKINTRRKRDSLIIAGLITMCIIL
                     LWLSL"
     gene            <293135..>296476
                     /locus_tag="PAS_chr2-1_0162"
                     /db_xref="GeneID:8198545"
     mRNA            <293135..>296476
                     /locus_tag="PAS_chr2-1_0162"
                     /product="Histidine kinase osmosensor that regulates a MAP
                     kinase cascade"
                     /transcript_id="XM_002491003.1"
                     /db_xref="GeneID:8198545"
     CDS             293135..296476
                     /locus_tag="PAS_chr2-1_0162"
                     /codon_start=1
                     /product="Histidine kinase osmosensor that regulates a MAP
                     kinase cascade"
                     /protein_id="XP_002491048.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0162"
                     /db_xref="EnsemblGenomes-Tr:CAY68768"
                     /db_xref="GeneID:8198545"
                     /db_xref="GOA:C4QZU4"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:C4QZU4"
                     /translation="MTELLELLKDPVRFHQDSESIRLKALAHITEQNTSIARLETQLE
                     SAKSANKAFQQALGEIGTVVISVAMGDLSKKVQVHPVESDPEILKVKITINTMMDQLQ
                     TFANEVTKVATEVASGELGGQAKNEGTVGVWRSLTDNVNIMALNLTNQVREIADVTRA
                     VATGDLSRKINVHAQGEILQLQMTINTMVDQLRTFAFEVTRVARETGVEGRLGGQARI
                     NNVEGIWKELTDNVNAMALNLTNQVRNIANVTTAVAKGDLSKKVTADCKGEILDLKLT
                     INQMVDRLQTFALEVTTLATEVGTDGILGGQANVRDVEGAWKAVTENVNIMAANLTNQ
                     VRSIATVTTAVAHGDLSQKIAVEAQGEILQLKNTINKMVDSLQVFASEVTRVAKDVGI
                     DGKLGVQAQVSDVDGLWKEITTNVNTMAANLTSQVRAFAQITAAATDGDFTRFITVEA
                     SGEMDALKTKINQMVLNLRESIQRNTAAREAAELANSAKSEFLANMSHEIRTPMNGII
                     GMTQLTLETELTQYQREMLSIVHNLANSLLTIIDDILDISKIEANRMTVEQIAFSLRG
                     TVFGALKTLAVKAIEKQLDLIYQVDNSFPDNLIGDSFRLRQVILNLAGNAIKFTTHGK
                     VTLTVKKAARIVSNNDEKLLLEFCVSDTGIGIEEDKLGLIFDTFCQADGSTTRKFGGT
                     GLGLSISKQLIHLMGGEIWVTSGYGAGSNFFFTIAVSPAKIELSRQIEALAPFAQHQI
                     LFISTEHDEETRNQIKEHIALLQLEPVVISSIDDAQYKDFVPYDIIIIDSIEIGMELR
                     HLPEIKNIPLVLLNPSVPSLNMRVCLDLGITSYGNTPCSVIDLASILMPALESRASPS
                     NSDGSQSYNILLAEDNLINQKLAVRILEKHGHKVEVVENGLEAFNAVKKNRYDVVLMD
                     VQMPIMGGFEATANIRDWERKSNPVDVLGFRTPIIALTAHAMLGDRERCLKAQMDEYL
                     SKPLKPTVLLQTISKCIHNINQLKELSKKNVSSRNTTFSEDFDINAVMSPNSTGGQLY
                     SVNNRVNEIHGNFLDGRSNFAHIPLENRETVSTTTTLGATVAKAKKPSRNQPVVKPPS
                     ISAIYDASSIDELTGSSLIAESSPE"
     gene            complement(<296563..>299844)
                     /locus_tag="PAS_chr2-1_0163"
                     /db_xref="GeneID:8198546"
     mRNA            complement(<296563..>299844)
                     /locus_tag="PAS_chr2-1_0163"
                     /product="Catalytic subunit of DNA polymerase delta"
                     /transcript_id="XM_002491004.1"
                     /db_xref="GeneID:8198546"
     CDS             complement(296563..299844)
                     /locus_tag="PAS_chr2-1_0163"
                     /codon_start=1
                     /product="Catalytic subunit of DNA polymerase delta"
                     /protein_id="XP_002491049.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0163"
                     /db_xref="EnsemblGenomes-Tr:CAY68769"
                     /db_xref="GeneID:8198546"
                     /db_xref="GOA:C4QZU5"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:C4QZU5"
                     /translation="MPEQLSQESEAKRVKLEDYHETAHSIPVANRDINGYQLPGHQSN
                     SFHTKMTSSQVDNEPSTFIKELEDMDNEATSKSEEIQIQNWSRPELPKFDPKKDDIIF
                     QQLDAEEISHVNGHSSARFFGVTDAGNTVLCNVTGFDHYFYVGMPKALKESDLPGFTN
                     YLKDEYVGVNTIEISFKESIWGYNNNTKLPFLKIIMSNSRLISRVRTGFENGSIQYND
                     AFPPNGSITFDNIQYLLRMMVDTKVSGMCWIKLQASKYTLVPPSQQVSTCQLELSVDY
                     RDLVSLPIEGEFSKIAPLRILSFDIECAGRKGIFPEPEHDPVIQIANVVSRTGESTPF
                     VRNVFTVNSCAPIVGSQIFSFEKEEELLRKWRDFIIKVDPDVIIGYNIANFDFPYLIN
                     RAATLKVQDFPFFSRVKTSKQEIKDSTFSSKAYGTRENKVVNIDGRMQLDLLQFIQRE
                     YKLRSYTLNSVSSHFLGEQKEDVQHSIITDLQNGDAETRRRLAVYCLKDAYLPLRLAE
                     KLMCLVNYTEMARVTGVPFSFLLSRGQQIKVISQLFRKCLELDIVIPNMKSDSVNEEY
                     EGATVIDPVRGYYDVPVATLDFASLYPSIMMAHNLCYTTLLNKPTIDRLGLVKDKDYI
                     LTPNGDFFVKEDLRKGILPTILQELLAARKKAKYDLKTETDPFKKQVLNGRQLALKIS
                     ANSVYGFTGATIGKLPCLAISSSVTAFGREMIEATKQAVQERYTIKNGYDHDAQVIYG
                     DTDSVMVKFGENDLRKCMKLGEEAAAFVSTIFKNPIKLEFEKVYFPYLLINKKRYAGL
                     YWTNPDKYDKMDTKGIETVRRDNCRLVQNVITKVLEYMLELRDVEGAENFVKQTIADL
                     LQDRVDLSQLVITKALSRQDYAGKQAHVELAERMRKRDAGSAPTLGDRVAYVIIKTSS
                     TKNYEKSEDPLYVLEHSLPIDTNYYLENQLAKPLTRIFEPILGERRAKALLSGSHTRT
                     VFVAAPKTGGLMRFAKKTNTCKNCKSPLTKSNCKSPNGNAALCNNCMDKAGSLYGEAL
                     SLMNSLETKFSKLWTECQRCQGSLHQEVLCSNNDCPIFYMRTKAKKDIIHQAEELERW
                     NDMVW"
     gene            <300074..>303043
                     /locus_tag="PAS_chr2-1_0164"
                     /db_xref="GeneID:8198547"
     mRNA            <300074..>303043
                     /locus_tag="PAS_chr2-1_0164"
                     /product="Ubiquitin-conjugating enzyme (E4), elongates
                     polyubiquitin chains on substrate proteins"
                     /transcript_id="XM_002491005.1"
                     /db_xref="GeneID:8198547"
     CDS             300074..303043
                     /locus_tag="PAS_chr2-1_0164"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme (E4), elongates
                     polyubiquitin chains on substrate proteins"
                     /protein_id="XP_002491050.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0164"
                     /db_xref="EnsemblGenomes-Tr:CAY68770"
                     /db_xref="GeneID:8198547"
                     /db_xref="GOA:C4QZU6"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:C4QZU6"
                     /translation="MFNFDGSTKRRNVNLSGRRNNLESREQLLHRAELERNRRKEAKL
                     QDKSVRIIQSYIRTFLLRSHISLEFEKIWLHCGSDVTALNMFAFFCPNLVLKRDEAWL
                     QVQLDHVSKLLLSSHGSISFLLRNALVEVLFKTSKQGRSPLPMLKLVNSLSHEFAIEW
                     IQRKDLMEKLVDRLGENEELDLQVLKFTFNFRHNDMETFAMAFINIVQKANLNDEAKQ
                     LIREQFSRPSSFYLQLPNSLFFLYLLSVITIWKKYGGVENLDIFLAQELSSAVEKMQE
                     LKFCFENELSQDLSLNRDADLDGRKKLIITTGSKEALLYLYSPDYQTKISNLPNVSTE
                     FLSNFYYSLLVPIDTGSPQNEEILNSLLISVVVNGLPHGILHYWLQQIVSSDIFRMED
                     GNWELNKPILTGCSVELWQTLHIFLDVYFYVLNMSSDSVIFDQDRGRLPRDEFLKVVS
                     FLKGLCITLVLKDKELKPSLPSSTRVMYDKTLVVALKLLHQIYLRNLRLSFVSEEYWL
                     CDLSLSIEQIVPVLYERDISISNNADFDLDPDTSEHLNLESDFSQLYGLNSTRYMKLP
                     SSVLAALKVLKFLPFMFSFTTRATILHQLIRQSQEIRDTYGGMNRIQGTISRDNIIED
                     GFALLSKLTGEQLKNYLGIQFTNQFGAEAGIDGGGLTKEFLTETVKKGFATTNESGVE
                     DLMLFKHSPRNEIYPNPALYLKRTKGVDVHKDLEMIRYLGSIVGKCLYEKILVDLPFS
                     PFFLTRWSVNQPYKTMFDDLKYYDEDLFRNLNKLLSLNSDQVDALELNFTLTERFYYN
                     GAFKTTTIMLLPNGANIPVTTANRLQYVFAVSNFKLYTSLRLQTDYFLQGLFKVIPSQ
                     WLEVFNPMELQILVSGRDRGIDISDLRKNTVFSEYTENDQTIIDLFDILEHDFSNEER
                     SKFIRFVTSSSKAPLLGFSQLNPKFGVRNIGPFSDRLPSAFTCFNQLKLPDYGNRKVL
                     KEKLLYAISSESGFDLS"
     gene            <303127..>305095
                     /locus_tag="PAS_chr2-1_0165"
                     /db_xref="GeneID:8198548"
     mRNA            join(<303127..303144,303212..>305095)
                     /locus_tag="PAS_chr2-1_0165"
                     /product="Protein required for mismatch repair in mitosis
                     and meiosis as well as crossing over during meiosis"
                     /transcript_id="XM_002491006.1"
                     /db_xref="GeneID:8198548"
     CDS             join(303127..303144,303212..305095)
                     /locus_tag="PAS_chr2-1_0165"
                     /codon_start=1
                     /product="Protein required for mismatch repair in mitosis
                     and meiosis as well as crossing over during meiosis"
                     /protein_id="XP_002491051.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0165"
                     /db_xref="EnsemblGenomes-Tr:CAY68771"
                     /db_xref="GeneID:8198548"
                     /db_xref="GOA:C4QZU7"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C4QZU7"
                     /translation="MTSRIKALDIDVVNKIAAGEIIVAPENALKELLENAIDAKSTSI
                     DIIIQDGGLKLLQMTDNGVGIYKEDLPILCERFTTSKLSTFEDLNSIGTYGFRGEALA
                     SISHISRLTVTTKTKDSACAYRAIYQEGRMVGEPKPVAGKDGTQILIEDLFYNVPSRL
                     RSLKGGNEQLSKILDVVARYAINTDGVAFSVKKAGDTLNLLAVRANNSTKDKVRTVFG
                     SAVASELLPIAVEKSEEIGLLSCEGQITNTSYYSKKSVSPIFFINGRLVSCDPLKRMI
                     TQLYSSFLPKGHKPFVYLRIDIKRENLDVNVHPTKREVRFLFEDEIFQVIFQSIQAKL
                     GSLDHSRKFVTTQSVLKHQYAPQEEITKKPQTLLRTDDLQSKITAFINTTNTESFGTI
                     VKDRVTVKLSSILELRQQLENKVSEDLTNMFAKHTYVGLVDPNRRLCCIQYDVKLFLV
                     DYASISYELIYQIGLSDFNNFGTLYLESEKPITIRELLEIVYESIDTSVPPIDDVLEA
                     LFEMKDMLLEYFSIELQGTEKDPILRSLPIVIKGYTPSIGKLPLFWYRLGTKVDWSSE
                     KECLDGILRQIALLYVPEVSEAEGIEKILEDLIFPTIKSRLLAVDSLSKSVVEIANLP
                     GLYKVFERC"
     gene            complement(<305194..>306237)
                     /locus_tag="PAS_chr2-1_0166"
                     /db_xref="GeneID:8198549"
     mRNA            complement(<305194..>306237)
                     /locus_tag="PAS_chr2-1_0166"
                     /product="Predicted transporter of the mitochondrial inner
                     membrane"
                     /transcript_id="XM_002491007.1"
                     /db_xref="GeneID:8198549"
     CDS             complement(305194..306237)
                     /locus_tag="PAS_chr2-1_0166"
                     /codon_start=1
                     /product="Predicted transporter of the mitochondrial inner
                     membrane"
                     /protein_id="XP_002491052.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0166"
                     /db_xref="EnsemblGenomes-Tr:CAY68772"
                     /db_xref="GeneID:8198549"
                     /db_xref="GOA:C4QZU8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4QZU8"
                     /translation="MEKYNTASLPLGFENDHYIKPHTILQEEEGPSNESSPLWHCIVA
                     GGIGGMVGDSTMHSLDTVKTRQQGAPTVAVYKNMTSAYATIFRQEGFRRGLYGGYGAA
                     MLGSFPSTAVFFGTYESVKRLMIGRWNCNETATHLVAGFLGDFFSSVFYVPSEVLKTR
                     LQLQGRYNNPYFHSGYNYKSTAHAITSIIKSEGWQTLFFGYKATLVRDLPFSALQFAF
                     YEKFRSWALRVSSANHHDLSVLWELATGAAAGGLAGTLTTPLDVIKTRIQTQNAASTV
                     SSSSSGKPIILSSPSILSSLLMVYKHEGALGLFSGVGPRFIWTSVQSSIMLLLYQVSL
                     RTLDDMLEGTALD"
     gene            <306431..>307552
                     /locus_tag="PAS_chr2-1_0167"
                     /db_xref="GeneID:8198550"
     mRNA            <306431..>307552
                     /locus_tag="PAS_chr2-1_0167"
                     /product="Putative metalloprotease, similar to
                     O-sialoglycoprotein metallopeptidase from P. haemolytica"
                     /transcript_id="XM_002491008.1"
                     /db_xref="GeneID:8198550"
     CDS             306431..307552
                     /locus_tag="PAS_chr2-1_0167"
                     /codon_start=1
                     /product="Putative metalloprotease, similar to
                     O-sialoglycoprotein metallopeptidase from P. haemolytica"
                     /protein_id="XP_002491053.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0167"
                     /db_xref="EnsemblGenomes-Tr:CAY68773"
                     /db_xref="GeneID:8198550"
                     /db_xref="GOA:C4QZU9"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:C4QZU9"
                     /translation="MLRRLRCGIRTYKVLAIESSCDDSCVSLIDRSAGAKPIVLDHVK
                     STLNSVKAGGVIPTSAHLHHQKSIAGLVKQVLQKHNISGVNCPELVCVTRGPGMPGSL
                     SIGVDTAKGLSVAWGSQFLGVHHMLGHLLIPRLESNGEEPQFPFLSLLASGGHTMLVL
                     SRSLLDHEILVNTIDIAAGDALDKCAREIGIRGNMIGKELELFLNKNPQLSLKDIPWE
                     MPQPLKNKPKRVDTLGFSFTPFISGVKLSLERYHNNEVKDELMPAMGFRIQEAIFDHI
                     IDRVLVAYKVRPELNQIKTFVGSGGVVANQRLRVKLQAALKSHGVENFHFPPPALCTD
                     NAIMIGWAGIELYENGVTSELDVTPLRKWSVEGLEKSGF"
     gene            complement(<307549..>308694)
                     /locus_tag="PAS_chr2-1_0814"
                     /db_xref="GeneID:8198551"
     mRNA            complement(<307549..>308694)
                     /locus_tag="PAS_chr2-1_0814"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491009.1"
                     /db_xref="GeneID:8198551"
     CDS             complement(307549..308694)
                     /locus_tag="PAS_chr2-1_0814"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491054.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0814"
                     /db_xref="EnsemblGenomes-Tr:CAY68774"
                     /db_xref="GeneID:8198551"
                     /db_xref="GOA:C4QZV0"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="UniProtKB/TrEMBL:C4QZV0"
                     /translation="MAETTENSEGPKGASPVADEDSDLGSDSSSKTSADSDSDSGTSS
                     DSSSGEESDDDDIGESEKDLLHKEMQSLQEHYNRLEDALKREKVQTIRDADLGKSIHH
                     LEEVHELFETAKGHNMVSFLPKDALIFKSISQQSSDTARNLKLGTSRKGLNPTMFNAK
                     LTEYLSYEQNQPTNPDMDDITEDIANTQFANYNWAKLGALSYLASRRSYTSNFLLGAL
                     SLEKKKVRTHTQRTVDEVNETVTANRVTLNDIQKGDTDSSVKMMKQHFHVFAEKSKMK
                     KVNLFEYFIDPGSYARTIENMLYTSFMLNYGKIILVHGEDGIPYIQVADKDTIQKDSE
                     LYQKVKDNDESHSQFIVRLEMDVWEALIKKYNITKPYVDPQLLSHED"
     gene            complement(<308966..>311476)
                     /locus_tag="PAS_chr2-1_0168"
                     /db_xref="GeneID:8198090"
     mRNA            complement(<308966..>311476)
                     /locus_tag="PAS_chr2-1_0168"
                     /product="Protein that is processed in the mitochondrion
                     to yield acetylglutamate kinase and N-acetyl-gamma-gl"
                     /transcript_id="XM_002491010.1"
                     /db_xref="GeneID:8198090"
     CDS             complement(308966..311476)
                     /locus_tag="PAS_chr2-1_0168"
                     /codon_start=1
                     /product="Protein that is processed in the mitochondrion
                     to yield acetylglutamate kinase and N-acetyl-gamma-gl"
                     /protein_id="XP_002491055.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0168"
                     /db_xref="EnsemblGenomes-Tr:CAY68775"
                     /db_xref="GeneID:8198090"
                     /db_xref="GOA:C4QZV1"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011241"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023013"
                     /db_xref="UniProtKB/TrEMBL:C4QZV1"
                     /translation="MFQTRFRSLPKLFGVYRRNNYSTRSTVIQLLNNIGSKREVEQYL
                     KYFTSVSQQQFAVIKVGGAIITQKLPELASCLAFLYHVGLYPIVLHGTGPQINELLEN
                     EGVEPQYEDGIRITDEKTMSVVRKCFLEQNLKLVTALEKMGVRARPVTAGVFSADYLN
                     KDKYKLVGNISSVNKAPIEASIQAGALPILTSLAETASGQILNVNADVAAGELARVFE
                     PLKIVYLNEKGGIINGITGEKISIINLDEEYEDLLKESWVKYGTKLKIKEIRDLLMHL
                     PRSSSVAIINVDDLQKELFTDSGAGTLIRRGYKLIIRESLDEFQQPDLLRTALNRDSD
                     ISSGKTSVASFLRELEGVSFKAYGDEPLEVLAIVKENKSGVPKLDKFLASKNGWLNNV
                     TDNIFNAIKKGNPSLQWVVREDDPNTAWFFSKSQGSFSKNGQILFWYGVESPEDVDSL
                     IQNFSKNVSYIQSTDSSNSKAASETRAYHTMRKASSQQIRSFATTCNSNPNPPIREGS
                     NKKKAKIALIGARGYTGQNLITMIDNHPYLEIAHVSSRELQGQKLQGYDKANIVYENL
                     QVEDINRLERNGEIDVWVMALPNGVCKPFVDAIEHADGPKTSKIIDLSADYRFDTTGE
                     WIYGLPELNSRQAIVKARKISNPGCYATGAQVAIKPLVDYISGVPTIFGVSGYSGAGT
                     KPSPKNDIKILNNNLIPYSLTDHIHEREISAQLGHQVAFTPHVAQWFQGISHTISIPL
                     KEKMTSRDIRNIYQDIYQDEQLITVSGEAPLVKDISGKHGVVVGGFAVNAAQDRVVIV
                     ATIDNLLKGAATQCLQNINLAMNYGEYEGIPDDLIIRG"
     gene            <311994..>312517
                     /locus_tag="PAS_chr2-1_0169"
                     /db_xref="GeneID:8198552"
     mRNA            join(<311994..312043,312094..>312517)
                     /locus_tag="PAS_chr2-1_0169"
                     /product="Mitochondrial outer membrane protein involved in
                     membrane fission, required for localization of Dnm1"
                     /transcript_id="XM_002491011.1"
                     /db_xref="GeneID:8198552"
     CDS             join(311994..312043,312094..312517)
                     /locus_tag="PAS_chr2-1_0169"
                     /codon_start=1
                     /product="Mitochondrial outer membrane protein involved in
                     membrane fission, required for localization of Dnm1"
                     /protein_id="XP_002491056.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0169"
                     /db_xref="EnsemblGenomes-Tr:CAY68776"
                     /db_xref="GeneID:8198552"
                     /db_xref="GOA:C4QZV2"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR016543"
                     /db_xref="InterPro:IPR028058"
                     /db_xref="InterPro:IPR028061"
                     /db_xref="UniProtKB/TrEMBL:C4QZV2"
                     /translation="MTDKKIKYLPALEDANIPLTEQQLAILEKQVEAEQPNPTTQSSF
                     NYAWGLIKSDDVEDNRNGINILVSIFTNVPQRRRECLYYLSLGCLKLNELENAKRYVD
                     GILAHEPDNYQALQLKQVIENKISRDGLVGIALFGGAVAIGAAALSTMFRYNRKK"
     gene            <313058..>314152
                     /locus_tag="PAS_chr2-1_0170"
                     /db_xref="GeneID:8198553"
     mRNA            <313058..>314152
                     /locus_tag="PAS_chr2-1_0170"
                     /product="tRNA-specific adenosine deaminase, deaminates
                     adenosine-37 to inosine in tRNA-Ala"
                     /transcript_id="XM_002491012.1"
                     /db_xref="GeneID:8198553"
     CDS             313058..314152
                     /locus_tag="PAS_chr2-1_0170"
                     /codon_start=1
                     /product="tRNA-specific adenosine deaminase, deaminates
                     adenosine-37 to inosine in tRNA-Ala"
                     /protein_id="XP_002491057.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0170"
                     /db_xref="EnsemblGenomes-Tr:CAY68777"
                     /db_xref="GeneID:8198553"
                     /db_xref="GOA:C4QZV3"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="UniProtKB/TrEMBL:C4QZV3"
                     /translation="MVLEPELPNSLADRMADAVFQVYERDKILAQNKAAKPVTRTSGV
                     EEWTVLASILMIHDNKVKPLTLTTGVKCMPDETLKNSRGRIVHDMHAEILSIRAFQRF
                     IIQDMDFLRVLEKTQEGLKVKDGIEFALYISELPCGDASIKDAERWEYGFGIVDGKSK
                     RVRLSESVLLRGRSDVGDLGKVRTKPGRGDSFVSLSKSCSDKLVKIQKVGLFNGVVSQ
                     FVSQKHLKYLVLPHVPGSSESINRCFTRLKGERMTILTTSRDFVHRRKDGKLPCNISM
                     IYLVDQQLELLCKGIKNGTKGVSDKNSSMVSRYNLTKAIEKHLNREKLELATKSYYQL
                     KKNGNRYEQVEKSKAELGNWVPTYRDDFSL"
     gene            complement(<314197..>314685)
                     /locus_tag="PAS_chr2-1_0171"
                     /db_xref="GeneID:8198554"
     mRNA            complement(<314197..>314685)
                     /locus_tag="PAS_chr2-1_0171"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491013.1"
                     /db_xref="GeneID:8198554"
     CDS             complement(314197..314685)
                     /locus_tag="PAS_chr2-1_0171"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491058.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0171"
                     /db_xref="EnsemblGenomes-Tr:CAY68778"
                     /db_xref="GeneID:8198554"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C4QZV4"
                     /translation="MSEGASSSEQLIDAARRNNVDLLESIILENKDGITQLINTSQDV
                     MGNKALHLAAAYGAFEILDILLDQEGVELDSKNRLDENTPLHLAVKYSEEEPEHGTFI
                     VEELIAAGADVNATNKNGDKPVDLVVNNPELTQILLNAEYASNVVIVDEDENAGPASD
                     SD"
     gene            <315460..>320463
                     /locus_tag="PAS_chr2-1_0172"
                     /db_xref="GeneID:8198555"
     mRNA            <315460..>320463
                     /locus_tag="PAS_chr2-1_0172"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491014.1"
                     /db_xref="GeneID:8198555"
     CDS             315460..320463
                     /locus_tag="PAS_chr2-1_0172"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491059.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0172"
                     /db_xref="EnsemblGenomes-Tr:CAY68779"
                     /db_xref="GeneID:8198555"
                     /db_xref="GOA:C4QZV5"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR006970"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:C4QZV5"
                     /translation="MFLKSLLSFASILTLCKAWDLEDVQDAPKIKGNEVPGRYIIEYE
                     EASTSAFATQLRAGGYDFNIQYDYSTGSLFNGASVQISNDNKTTFQDLQSLRAVKNVY
                     PATLITLDETFELADTKPWNPHGITGVDSLHEQGYTGSGVVIAVIDTGVDYTHPALGG
                     GIGDNFPIKAGYDLSSGDGVITNDPMDCDGHGTFVSSIIVANNKDMVGVAPDAQIVMY
                     KVFPCSDSTSTDIVMAGMQKAYDDGHKIISLSLGSDSGFSSTPASLMASRIAQDRVVL
                     VAAGNSGELGPFYASSPASGKQVISVGSVQNEQWTTFPVTFTSSNGESRVFPYLAYNG
                     AQIGFDAELEVDFTEERGCVYEPEISADNANKAILLRRGVGCVENLEFNLLSVAGYKA
                     YFLYNSFSRPWSLLNISPLIELDNAYSLVEEEVGIWVKTQIDAGNTVKLKVSTSDQML
                     PSDKEYLGVGKMDYYSSQGPAYELEFFPTISAPGGDSWGAWPGGQYGVASGTSFACPY
                     VAGLTALYESQFGIQDPQDYVRKLVSTATDLQLFDWNAVKLETSMNAPLIQQGAGLVN
                     ALGLFETKTVIVSAPYLELNDTINRASEYTIQIKNENSETITYQVVHVPGTTVYSRSA
                     SGNIPYLVNQDFAPYGDSDAATVALSTEELVLGPGEVGEVTVIFSTEEIDQETAPIIQ
                     GKITFYGDVIPIAVPYMGVEVDIHSWEPLIERPLSVRMYLDDGSLAYVDDDPDYEFNV
                     YDWDSPRFYFNLRYATKEVSIDLVHPDYSIENDYEWPLVSGHNNYYGPVGYDYDYTSG
                     QAFLPRYFQQRINELGYLSFSRFANFSVVPAGEYKALFRVLLPYGDFWNKEDWQLFES
                     PVFNVLAPPNEENTTEEPTEESSEEPTEESTSESTEEPSSESTEKSSEVPTEEITEDA
                     TSTIDDDEASTESSTEEPSAQPTGPYSDLTVGEAITDVSVTSLRTTEAFGYTSDWLVV
                     SFTFNTTDRDITLPPYAVVQVTIPNELQFIAHPEYAPYLEPSLQVFYTKNERLIMTSQ
                     FNYDTRVIDFKFDNRDQVITQVEGVVYFTMKLEQDFISALAPGEYDFEFHTSVDSYAS
                     TFDFIPLIRSEPIKLIAGAPDEVEWFIDIPSAYSDLATIDISSDIDTNDNLQQYFYDC
                     SKLKYTIGKEFDQWGNFTAGSDGNQYSNTTDGYVPITDSTGSPVAEVQCLMESISLSF
                     TNTLAEDEVLRVVLHSSAFRRGSFTMANVVNVDITAGGLAKRELFSYILDENYYASTG
                     SEGLAFDVFEVADQVEEPTEESTSEESTEQETSTEEPTEESTEPTEESTQEPTEEPTD
                     EPTSESTEEPSEEPTSDDLSIDPTAVPTDEPTEEPTEEPTSESTEEPSEEPTSDDLSI
                     DPTAVPTDEPTEEPTEEPTSETTDDPSIAPTAVPTSDTSSGQSVVTQNTTVTQTTITS
                     VCNVCAETPVTITYTAPVVTKPVSYTTVTSVCHVCAETPITVTLTLPCETEDVTKTAG
                     PKTVTYTEVCNSCADKPITYTYIAPEYTQGAERTTVTSVCNVCAETPVTLTYTAPKAS
                     RHTVPSQYSSAGELISSKGITIPTVPARPTGTYSKSVDTSQRTLATITKSSDESNTVT
                     TTQATQVLSGESSGIQAASNSTSISAPTVTTAGNENSGSRFSFAGLFTVLPLILFVI"
     gene            <321077..>323644
                     /locus_tag="PAS_chr2-1_0173"
                     /db_xref="GeneID:8198556"
     mRNA            <321077..>323644
                     /locus_tag="PAS_chr2-1_0173"
                     /product="Non-essential glycogen phosphorylase required
                     for the mobilization of glycogen, activity is regulate"
                     /transcript_id="XM_002491015.1"
                     /db_xref="GeneID:8198556"
     CDS             321077..323644
                     /locus_tag="PAS_chr2-1_0173"
                     /codon_start=1
                     /product="Non-essential glycogen phosphorylase required
                     for the mobilization of glycogen, activity is regulate"
                     /protein_id="XP_002491060.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0173"
                     /db_xref="EnsemblGenomes-Tr:CAY68780"
                     /db_xref="GeneID:8198556"
                     /db_xref="GOA:C4QZV6"
                     /db_xref="InterPro:IPR000811"
                     /db_xref="InterPro:IPR011833"
                     /db_xref="UniProtKB/TrEMBL:C4QZV6"
                     /translation="MSERPKLHRRTLTGFTPTEIKSIDTAIPAKCRELWQKFGTQEFA
                     TKEEFQKSFINHVEKTLARSLYNCDVLAAYQATSDSIRDKLVVHWNKTQQLHTAKEAK
                     RIYYLSLEFLMGRALDNALINLNIKDLTSKGVDELGFKLEDIIGVEPDAGLGNGGLGR
                     LAACFVDSLSTGNYPGWGYGLRYQYGIFAQKIVDGYQVEVPDYWLNFSNPWEIPRFEI
                     QIPVDFYGYVSTVKTPSGGFVKQWNGGQRVLAVAYDNPIPGWDTSNVNNLRLWSAKPT
                     TEFDFSKFNSGDYQNSVADQQSAESITSVLYPNDNFYKGKELRLKQQYFWVSASLYDI
                     VRRFIKSKRPWAEFPEKVAIQLNDTHPTLAIVELQRILIDLQNLSWEAAWDIVTKTIA
                     YSNHTVMQEALEKWPLELFNNLLPRHLEIVYEINQRFLNYVGEKFKDEDLLSRVSIIE
                     ESSPKNIRMAHLAVIGSHKVNGVAELHSELIKTTIFKDFVTIYGSEKFTNVTNGITPR
                     RWLRQANPKLTELIASKLGGYTFLKDLNELKQLEQFVDDADFRHQWDEVKLHNKKRLA
                     VLVKDLTGFSVNPNVLFDIQVKRIHEYKRQQLNIFGVIWRYLQILATPEEERASKWLP
                     RVVIIGGKAAPGYYAAKNIIKLVNSVSQVVNNDKSVGDLLKVIFIPDYNVSKAEIICP
                     ASDLSEHISTAGTEASGTSNMKFVLNGGLIIGTVDGANVEITREIGEDNIFLFGNLSE
                     EVEDIRHEHNKGTTHIPQQLELVFNEILSGTFGDPIVFQELIDNVKYHGDHYLVSDDF
                     ESYLETQDLVDQEYKNKEEWIKKSIISVANMGFFSSDRCIDEYAENIWNIEPITDQV"
     gene            <323932..>325803
                     /locus_tag="PAS_chr2-1_0174"
                     /db_xref="GeneID:8198557"
     mRNA            <323932..>325803
                     /locus_tag="PAS_chr2-1_0174"
                     /product="Protease involved in the processing of killer
                     toxin and alpha factor precursor"
                     /transcript_id="XM_002491016.1"
                     /db_xref="GeneID:8198557"
     CDS             323932..325803
                     /locus_tag="PAS_chr2-1_0174"
                     /codon_start=1
                     /product="Protease involved in the processing of killer
                     toxin and alpha factor precursor"
                     /protein_id="XP_002491061.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0174"
                     /db_xref="EnsemblGenomes-Tr:CAY68781"
                     /db_xref="GeneID:8198557"
                     /db_xref="GOA:C4QZV7"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /translation="MLKLLCLLLPLVAVSASPIDLGSQKDYLVLDLPGLSHLSETQRP
                     TMHAGLLPLNLSFVADDDTEYFFWRFSKQDVDRADIVFWLNGGPGCSSMDGALMELGP
                     FVINPKQEVEYNEGTWVEAADVVFVDQPGGTGFSSTTNYLTELTEVADGFVTFLARYF
                     HLFPADVYKKFTLGGESYAGQYVPYILKAIMDDLKSDSGQLPKELYLKGALIGNGWID
                     PNEQSLSYLEFFIKKELIDIHGSYMPGLLQQQEKCQNLINHSSGEASESQISYSACEK
                     ILNDALRFTRDKKAPLDQQCINMYDYTLRDTYPSCGMSWPPYLPDVTAFLQKKSVLEA
                     LHLDSSASWSECSARVGSHLKNKISVPSVDILPDLLQEIPIILFNGDHDIICNCIGTE
                     RMIDKLEFNGDQGFTEGTEYIPWFYNEVNVGKVISERNLTYVRVYNSSHMVPFDNTPV
                     SRGLLDIYFDNFEDVEYNNVSGIATPVYDVDKNITYIDSNDPRLQNGPKSSSTDDSAA
                     HGNPFFYYVFELFVIVLLLCGLVYLYQYYSNSAPHSILADKHKKKSKNKSKNVRFLDD
                     LESNLDLDNTDDKKDNSVMSKLLSSMGYQAQEPYKPLDKGANADLDIEMDSHGTSEK"
     gene            <326075..>326635
                     /locus_tag="PAS_chr2-1_0175"
                     /db_xref="GeneID:8198558"
     mRNA            <326075..>326635
                     /locus_tag="PAS_chr2-1_0175"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491017.1"
                     /db_xref="GeneID:8198558"
     CDS             326075..326635
                     /locus_tag="PAS_chr2-1_0175"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491062.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0175"
                     /db_xref="EnsemblGenomes-Tr:CAY68782"
                     /db_xref="GeneID:8198558"
                     /db_xref="GOA:C4QZV8"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C4QZV8"
                     /translation="MSFEQPIYNDLDYKGFELGQDSTIDLSLFTNNQFFDLDVFADGV
                     TELKPEVVDPSPQNDISVSQTPILSVESSPDNKVQKPLDDKRRRNTAASARFRMKKKQ
                     KGKEMEEKAKQLTETVERLNQRIRTLEMENKCLKNLMSQRGAIEDTKDSSADPISKIA
                     GSTSNYELLKLLKSNSNDDGFTMTHL"
     gene            complement(<326711..>328273)
                     /locus_tag="PAS_chr2-1_0176"
                     /db_xref="GeneID:8198559"
     mRNA            complement(<326711..>328273)
                     /locus_tag="PAS_chr2-1_0176"
                     /product="ATP (CTP):tRNA-specific tRNA
                     nucleotidyltransferase"
                     /transcript_id="XM_002491018.1"
                     /db_xref="GeneID:8198559"
     CDS             complement(326711..328273)
                     /locus_tag="PAS_chr2-1_0176"
                     /codon_start=1
                     /product="ATP (CTP):tRNA-specific tRNA
                     nucleotidyltransferase"
                     /protein_id="XP_002491063.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0176"
                     /db_xref="EnsemblGenomes-Tr:CAY68783"
                     /db_xref="GeneID:8198559"
                     /db_xref="GOA:C4QZV9"
                     /db_xref="InterPro:IPR002646"
                     /db_xref="UniProtKB/TrEMBL:C4QZV9"
                     /translation="MFRFVRSMSSQLSSIKLDDKESQICSLLKYFCNHYNTKLRKPNE
                     PDLQLRITGGWVRDKLLGRSSHDIDIAINTLSGESFAEKLVSFIKENHKDEIESILSS
                     SIHKINKNPDKSKHLETCTTKLYGIDIDFVNLRNEKYTEESRIPTIDYGTPQEDALRR
                     DATLNALFYNLTTDQIEDFTEKGLIDLKQGVLRTPLEPSKTFLDDPLRCLRLIRFASV
                     FGFSVSEDALQAMKQPKIKEALNAKISRERIGVEIDKILVSKDPIRGLKILRDTNLLD
                     AIFNFGDLQDAVYELNPKVRERLNQVFTIYLPESASKISSLPQLIQQFPDDLKSVYSQ
                     LDLRVLYLNLLLYPFAQLRLKFSTKPTKNTRYATEMIVRDGLKYSSKDSDTVSLIVDN
                     YQEFQHLVQRDVSTLPRSVLGMAIRKYNGQWELNLIICLLLSIFEGADSNAIEKYHST
                     YQHIKNQDLSQVHSLRPLVDGKTLCKELGKKPGPWMKPLMDKLLVWQLDHPTEDSASY
                     ISRAKTVLDETL"
     gene            complement(<328343..>329179)
                     /locus_tag="PAS_chr2-1_0815"
                     /db_xref="GeneID:8198560"
     mRNA            complement(<328343..>329179)
                     /locus_tag="PAS_chr2-1_0815"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491019.1"
                     /db_xref="GeneID:8198560"
     CDS             complement(328343..329179)
                     /locus_tag="PAS_chr2-1_0815"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491064.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0815"
                     /db_xref="EnsemblGenomes-Tr:CAY68784"
                     /db_xref="GeneID:8198560"
                     /db_xref="GOA:C4QZW0"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4QZW0"
                     /translation="MSSFRDTSYNSNNYSEFRPEYPPSFIESIFGYHQGDFDKALDVG
                     CGPGEATFHLARKFKNTIGTDISPGMVSQATSLKERRDVSNVSFQQSSSEDLPFIEDS
                     SVDLVTAAECAHWFNAPKWFNEMARILKPKGTLCYFGYVDPYFVDLPLGNELYHKYVY
                     GEDYLGPYWEEPGRSILVDLFRPIDKQIPSDLFEDVIALRGNEPGSLVLERDFQLKDY
                     FQYLYTMSSAHKFVQQNPGKEDPIQMFRTELFERAGLEDSSVLRLKWLTTVTFLRRRS
                     NP"
     gene            <329702..>330799
                     /locus_tag="PAS_chr2-1_0177"
                     /db_xref="GeneID:8198091"
     mRNA            <329702..>330799
                     /locus_tag="PAS_chr2-1_0177"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491020.1"
                     /db_xref="GeneID:8198091"
     CDS             329702..330799
                     /locus_tag="PAS_chr2-1_0177"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491065.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0177"
                     /db_xref="EnsemblGenomes-Tr:CAY68785"
                     /db_xref="GeneID:8198091"
                     /db_xref="GOA:C4QZW1"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C4QZW1"
                     /translation="MDIEDENHAKNISQWLEDNALSADSEYKQMSSDLEDSTMRFHNN
                     QDQNEPGQEEAYGKMQQEAYNAHAAQIDDFIDIEGLEGGDNNALAYNDMLPTTSDLNF
                     TPLLSPNASSILTPSLPSQTYSFTPLTSPMIDAIPNLRTKRTSVESDHKYTGHKDSLR
                     SSRGTDIPPPMKKTKTPSSTPAFGPVTSRRSSPLLQPKKGSNNTTPVLISNNNSSFNQ
                     DFALPESSLPGPVTPLDLMGFKVQKQQSEDKGKSKSADKKATHKLAEQGRRNRMNNAI
                     QELDAILPLEMRKYVTTPSKATTVELACQYIQSLLERIGELEKPPQSSPNDKTTNDST
                     LPANASPEDQADNNYNPANDTDSISPLEFEK"
     gene            complement(<330889..>334098)
                     /locus_tag="PAS_chr2-1_0178"
                     /db_xref="GeneID:8198561"
     mRNA            complement(<330889..>334098)
                     /locus_tag="PAS_chr2-1_0178"
                     /product="Polyphosphatidylinositol phosphatase,
                     dephosphorylates multiple phosphatidylinositols"
                     /transcript_id="XM_002491021.1"
                     /db_xref="GeneID:8198561"
     CDS             complement(330889..334098)
                     /locus_tag="PAS_chr2-1_0178"
                     /codon_start=1
                     /product="Polyphosphatidylinositol phosphatase,
                     dephosphorylates multiple phosphatidylinositols"
                     /protein_id="XP_002491066.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0178"
                     /db_xref="EnsemblGenomes-Tr:CAY68786"
                     /db_xref="GeneID:8198561"
                     /db_xref="GOA:C4QZW2"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C4QZW2"
                     /translation="MRVLIHEKTRLIALVSSTHCLLIKYIKDKNQCAVDFVEKESFSP
                     KHMKPLSRNKAHGFLGLINVNEDVFLCVITGKTEVATPTDGETVNKIYNVEFHCLNRD
                     AWDFLELDGNGYPITTSDVNEEALRSRGSTEASDNHLSYEQNPTYELRRLLSNGSFYY
                     STNFDLTSTLQSRDVNSDSLSFDSFHLDYMWNSYMMKEVVNFRDRLPTDSKKILDRNG
                     FLTTVIRGFAETFRTRIGHQKCNATIISKQSWKRAGTRYNARGIDDEGYVANFVETEL
                     ILHSKDFIYAYTEVRGSVPIFWEQDTALVNPKVTITRSLEATEPVFEKHFAALNGKYG
                     PVHIVNLLSTKPSEIGLSNTYRKHFEIVNKKGSPQAYLTEFDFHKETGKNYALATKVI
                     PFLEESIYDFDYFSYDVKNQKVLTLQKGVFRTNCLDCLDRTNVVQQVISNATLNMFLQ
                     RHNLNTNYDSDLFNKHNTLWADHGDAISQIYTGTNALKSSFTRSGKMGIAGALSDATK
                     SISRMYINNFQDKAKQVTIDTLLGKMSNQVEVRIFDPVSDHVDNELSKLKSQFSAEDD
                     IRIFTGSYNLGGTAYADDFTDWLFPKENGGIEGAPDVVILGFQEVVELTASNILNSDS
                     SRSHYWSEEIKTQLNKISSSKYILLRSEQMTSLLLLFFIKEDKMPKVTQVEGCSKKTG
                     LGGITANKGAVALRFSFGSTTFCLLNSHLAAGLNSVVERNNDFTTISQGIRFSRNKTI
                     YDHDCVIWLGDLNYRVPLPNELVRSSALNGVYDELLAEDQLKTEMVHKGAFADFYEMK
                     INFLPTYKYDKGTSVFDTSEKQRVPSWTDRILYRGKRLQQVNYNSVQSITISDHKPIY
                     GTFKAHVTYVDERTKLTLMRKIYDDYRRDPKSEASSASSNGDKFGDLIDFNDASSSSN
                     TSIYTETEGKQVSQPVPGHFPPPPPPPRNRVTPPQPSTPETPPPPGYALNMAPLIPSR
                     ANSGNNTRPSSPFEVSTDRAKAEISTKPVRPMVPDKPSSLKAMSPENTIQTVPPVQKA
                     ISTDSLNTASAAPPPPPPRKQESINSSMSAFPVLMPKKK"
     gene            complement(<334877..>337441)
                     /locus_tag="PAS_chr2-1_0816"
                     /db_xref="GeneID:8198562"
     mRNA            complement(<334877..>337441)
                     /locus_tag="PAS_chr2-1_0816"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491022.1"
                     /db_xref="GeneID:8198562"
     CDS             complement(334877..337441)
                     /locus_tag="PAS_chr2-1_0816"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491067.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0816"
                     /db_xref="EnsemblGenomes-Tr:CAY68787"
                     /db_xref="GeneID:8198562"
                     /db_xref="GOA:C4QZW3"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR025069"
                     /db_xref="InterPro:IPR027075"
                     /db_xref="UniProtKB/TrEMBL:C4QZW3"
                     /translation="MFSYTLLSPDNENTVIRASLLYFDPGINIFADPSWDGVADLSYL
                     DKIIPQINVILLSHPTADFIGGFVYLLQKYPVLKTLPIYSTYPITNLGKVSTTELYRA
                     KGLVGPLEGSIMEKSDIDECFDSIIPLKYSQSTPLTGIAQGLSVTPYNAGHSLGGTFW
                     SINYNNEKIVYAPAWNHSKDSFLNSATFLQSNGHPIPQLVKPASVITGSDLGSSLSYN
                     KKLEKFFTLVDATIAQNGTVFLPTSMSGRFLELLHLMDQHLGNQPIPVLLVAFTGSKS
                     LSLAGNMLEWMSPKIIKDWEERNETPFDPSRVQLVDVDDLVQLPGAKVVFTADADLTI
                     GSTAHSTLASICIDEKNTIIFTERPTNSSFGASIYEIWEKLTLERNGKLEDGFPVPFE
                     KLLTFSRVTLKKLTGLELAQYTEIVNERKQEKRKKRQVEKMNTTILADKSIDINKPIS
                     EFDPAAVKALEEDEDEDEEEDKEDIGVEETANDERGNTTTTAVASTKKQEKDIYKIPL
                     DFDVRNAKGRNRLFPYHSRIQETDDYGIKIDHSDFVKEDKSEEFSRMLDNKLKRNNRG
                     KGNGHMGDDDDDDDDDDNDDGGENGPARKRRRNAKSVKETIYNFDPLVNPERLQLTSN
                     MITARCGLSFIDLSGTVDLRSVLLILNSLKPRNLLILPGRKSHREKTAESIVTSIKSK
                     NSRNTQVYVTIPDEAIEMESAQATLEVKLADTLESELQWQNIAGGYSVAYVNGVLETI
                     TDKKIESQTTENEDEGDKNKDESHYQELVLNPLDQLSTLKSTAPLAIGDIRLSDLKTR
                     LLGLQLKAEFKGKGTLVINDEIMIKKLNDGEIMIDGTCNELFYVIRSAVQGMLAYV"
     gene            <338334..>339011
                     /locus_tag="PAS_chr2-1_0179"
                     /db_xref="GeneID:8198092"
     mRNA            <338334..>339011
                     /locus_tag="PAS_chr2-1_0179"
                     /product="S-adenosylmethionine-dependent methyltransferase
                     of the seven beta-strand family"
                     /transcript_id="XM_002491023.1"
                     /db_xref="GeneID:8198092"
     CDS             338334..339011
                     /locus_tag="PAS_chr2-1_0179"
                     /codon_start=1
                     /product="S-adenosylmethionine-dependent methyltransferase
                     of the seven beta-strand family"
                     /protein_id="XP_002491068.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0179"
                     /db_xref="EnsemblGenomes-Tr:CAY68788"
                     /db_xref="GeneID:8198092"
                     /db_xref="GOA:C4QZW4"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004557"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4QZW4"
                     /translation="MLPTPLTKDLDFEKVYEPAEDSFLLLDVFEKEKPWLESYKWNSD
                     VPLVVEIGTGSGVVTTFVNQHIIPQGLFLATDLNPHCCNAVLGTHKRNIGKKGNLQVL
                     QCDLTTPLRRNQVDVLIFNPPYVPSETVPEVARDPDSEDWLDIALLGGPTGMDITEKV
                     LDSLYDTLSRNGVAYILFCARNHPERVMENFKAKETQRGNGWEIECVQHRKAGWEVLT
                     VWRFIRR"
     gene            complement(<338998..>344025)
                     /locus_tag="PAS_chr2-1_0180"
                     /db_xref="GeneID:8198563"
     mRNA            complement(join(<338998..340789,340887..343352,
                     343412..>344025))
                     /locus_tag="PAS_chr2-1_0180"
                     /product="Protein of unknown function, essential for
                     viability"
                     /transcript_id="XM_002491024.1"
                     /db_xref="GeneID:8198563"
     CDS             complement(join(338998..340789,340887..343352,
                     343412..344025))
                     /locus_tag="PAS_chr2-1_0180"
                     /codon_start=1
                     /product="Protein of unknown function, essential for
                     viability"
                     /protein_id="XP_002491069.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0180"
                     /db_xref="EnsemblGenomes-Tr:CAY68789"
                     /db_xref="GeneID:8198563"
                     /db_xref="InterPro:IPR007249"
                     /db_xref="UniProtKB/TrEMBL:C4QZW5"
                     /translation="MSPLGKGDVSARDKKYLSNVQKTIASFASVVEWADYISFLGRLQ
                     KALQSNPSKDTHWIPEAYQVSKLLSQCLSNTLPNGVHKKCLELYHDIFIMLGQEKLGQ
                     DISIWLPGLLPLMNYASITVRPQLIDLFSSFVAKIAPAYLHPVLRALLLGIWPALDDP
                     TSECFESAFQLVDNLKKAVDDNEHFWKCLFLSIINSGDRKLGALFQNENILALLSSEA
                     RECVNPEPGLLITAMCKGLQDESIFVQRGFFDLLTSRLELRSDVIQKLASQSDKEKLL
                     LTATSTVLKKDMSLNRRLWFWLLGPETSESSPTSRSEYFKNYGLEILTSSLLKLLDGN
                     FTGESIHAQKLQSFKISLAVLDKWEIAQFVIPRIFLPSLEACKETATPEILMGFGSLF
                     DSVEAVDIWSDFIKLIETKNYELMKFMLKNFNIDDEDMIVRHVPLVLITILISAGSAV
                     DSEYGSWIEIARIISNIIPARAYLPLEHADAEDQSVENIKENIDKFYSEKTDSLPYNP
                     ATVADITYNLLKTLVSKQLNSSAGHLAFTSDLLADFVERLPTTEESPKLVNDQLIQQI
                     VDLPFNNDLNIDLSFGLIKLVPYLSSIATHFQLLQLLKKIIGSLWPIICDPRGIFQVE
                     VVNSITKLEIFVDPHCIEGELAYLFLSSEFPFPDKLRAVATLWTHTNTISGSSTDSIL
                     SRSLELVVDNLAEKRSPRYVMVSKWIDNLLRSSSINRLYKNLVNPILTSNRFLSTGEI
                     TDEDDLALFAYQIETIINLLTLESSSIQDSFANELCVLDSDEEIHIVNTNNWNVDTYK
                     MLLVNILKQFISIPKVASDIQDYERCTISVVSLLELLIDGEEKVFSEIVEYLLEAIPS
                     SPVIYLECLTKLLSLAHSKHIGISIFEVRDDSCLFIDFLKQRIATSRDIVEIECLMQL
                     VSQCSLFLNDSIFSIVVPLTSTICRRLSDDFESYKSYVTGDIYSVDSKQLTPDLEQII
                     PLLMNGLEDLLTSTHGYWKATEASESVDLSKNANDQGFFGSMINGVFQAGGNKDLSVS
                     ISDNSNEASSITDLGLTISYAASTLKYRPKKLLGTLYGLESIETLESLVSFRITNSSI
                     FKLIHILDGAKHDLALQFLLNSLTSRVFPNSLDEDQVSTLNIELTEHEIVTFILGYCQ
                     SLDNDSIEDIWLTFTQFLKDVESNNVLYRQTLPGLIKITHSIGVKNTHTRFGEQKKIK
                     RELSDHFVKLLNFSINARLDHFEDIGDDSGKVLRSSELCEAMKDVSPKLTQLITDRDK
                     LSGIVSSLISNVLQPIVKSKSIPNIPDLVLELILAWTENGCLEFKSWKGFLGDVLNDT
                     DFFKVQPSQREYWDRIFVKYIGAESEKMAELVTKFQSLNNSNNLFNWNDAEIRGRSLL
                     VKRICYLILIGPQDTFMDSLKEIMFRLNEIIKDSTMKPLLFLTLRILVLKFSPIHLSP
                     YWTLIVSQMEELLLDVLEKSTLLDGAVEKDHNHGNGKHKLRKEAARPELEIDLDSLLS
                     GCKLLDVLIMMKPEEFQLSEWLFIQDSALSQSDDKTDTAIPALIERLSHIKDLNRYSV
                     LKSLNYELTEKTRRKPLLEGINTIDNIGELKEFFDSLSFHDFECNYNINAPDYDAPIA
                     DSFADVFEASTFE"
     gene            <344159..>344926
                     /locus_tag="PAS_chr2-1_0182"
                     /db_xref="GeneID:8198564"
     mRNA            <344159..>344926
                     /locus_tag="PAS_chr2-1_0182"
                     /product="Component of the ESCRT-I complex (Stp22p, Srn2p,
                     Vps28p, and Mvb12p), which is involved in ubiquitin"
                     /transcript_id="XM_002491025.1"
                     /db_xref="GeneID:8198564"
     CDS             344159..344926
                     /locus_tag="PAS_chr2-1_0182"
                     /codon_start=1
                     /product="Component of the ESCRT-I complex (Stp22p, Srn2p,
                     Vps28p, and Mvb12p), which is involved in ubiquitin"
                     /protein_id="XP_002491070.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0182"
                     /db_xref="EnsemblGenomes-Tr:CAY68790"
                     /db_xref="GeneID:8198564"
                     /db_xref="InterPro:IPR007143"
                     /db_xref="InterPro:IPR017898"
                     /db_xref="InterPro:IPR017899"
                     /db_xref="UniProtKB/TrEMBL:C4QZW6"
                     /translation="MNNQSPYAPTNIHSERSVSLGLVRNSSISLDVPFKLYENSKEQH
                     LYEALSELYSIIVTLNSLERAFIKDTLYDNYEARVNRLISQYNAILKQEEVLSLFGSL
                     EQFTTTYQLDAPYAKNRLEVGLPLQEPQLTYNGTGNVSITGTADLGAGAGAGTGSNYS
                     SRAVAEATGNFITCMDAIKLHYRTKEQLHPLFSDLIMSINKVLNNGEFEGKAKIVEWL
                     IKLNGLGIDESISEQESKTLLFDLDNSYKGFYSKLDS"
     gene            complement(<344923..>345594)
                     /locus_tag="PAS_chr2-1_0183"
                     /db_xref="GeneID:8198565"
     mRNA            complement(<344923..>345594)
                     /locus_tag="PAS_chr2-1_0183"
                     /product="Acyl-protein thioesterase responsible for
                     depalmitoylation of Gpa1p"
                     /transcript_id="XM_002491026.1"
                     /db_xref="GeneID:8198565"
     CDS             complement(344923..345594)
                     /locus_tag="PAS_chr2-1_0183"
                     /codon_start=1
                     /product="Acyl-protein thioesterase responsible for
                     depalmitoylation of Gpa1p"
                     /protein_id="XP_002491071.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0183"
                     /db_xref="EnsemblGenomes-Tr:CAY68791"
                     /db_xref="GeneID:8198565"
                     /db_xref="GOA:C4QZW7"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4QZW7"
                     /translation="MALGPVVIPALKGPAKGAMIIVHGLGDSGEGWRFFGELFGRYFP
                     DVTTILPNAPEMPVTVNGGYVMRSWFDIYEFGNPKAKQDADGILKSARVLQDLVKEQV
                     SKGIDPSKIVLGGFSQGASISLIAASTLDIKIGGVIAMSGFISIPKEVTPLITSANKS
                     TPFFQGHGTADPVIQFTYGEQCRDFFKSHGFTNYQFHSYEGMQHSTSDEELRHIYQFL
                     SKAYS"
     gene            <345726..>346304
                     /locus_tag="PAS_chr2-1_0184"
                     /db_xref="GeneID:8198566"
     mRNA            <345726..>346304
                     /locus_tag="PAS_chr2-1_0184"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491027.1"
                     /db_xref="GeneID:8198566"
     CDS             345726..346304
                     /locus_tag="PAS_chr2-1_0184"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491072.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0184"
                     /db_xref="EnsemblGenomes-Tr:CAY68792"
                     /db_xref="GeneID:8198566"
                     /db_xref="InterPro:IPR009851"
                     /db_xref="UniProtKB/TrEMBL:C4QZW8"
                     /translation="MATPPVPPLPSLPKEEVPAKIEFPLESVKGLDPSISSVPLSKLK
                     ELLDNQKLLKSYLLDSLQEFNQEIIHTLDENIRSLQNLLQQYEDNSKDIDQLNKSLDE
                     LNVLFRRWKQTEIEMYTILQRYQPNSLSKKLFELLEQSHLESQQLVSKLEGSVQESDL
                     QSFIREYRAKRKLYHLRKEKYHRCQEERVRFV"
     gene            complement(<346371..>348464)
                     /locus_tag="PAS_chr2-1_0185"
                     /db_xref="GeneID:8198567"
     mRNA            complement(<346371..>348464)
                     /locus_tag="PAS_chr2-1_0185"
                     /product="Protein subunit of mitochondrial RNase P, has
                     roles in nuclear transcription, cytoplasmic and mitoch"
                     /transcript_id="XM_002491028.1"
                     /db_xref="GeneID:8198567"
     CDS             complement(346371..348464)
                     /locus_tag="PAS_chr2-1_0185"
                     /codon_start=1
                     /product="Protein subunit of mitochondrial RNase P, has
                     roles in nuclear transcription, cytoplasmic and mitoch"
                     /protein_id="XP_002491073.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0185"
                     /db_xref="EnsemblGenomes-Tr:CAY68793"
                     /db_xref="GeneID:8198567"
                     /db_xref="InterPro:IPR013888"
                     /db_xref="UniProtKB/TrEMBL:C4QZW9"
                     /translation="MVFKTLASLSKQANKTAGYGIYHHPFFEPSYTKTQNICGFDNVI
                     HNDNKTSQNKTKYVAAVSTTANNLIIIDQKNGDPNDTKSRKLLIKKSTHKVSKNGHVS
                     ISVTQIDKAFSKLSIRKSNSALIRTFTISNNSLKHLESCKRFYSTDRAARLLDELNMN
                     EETNKLEQGKKSAQIEELEETAEPQQEEQSSTSGMEDEIRMIHSFVSQKRYNEVFALY
                     LRAKAKEIKLDRSVYTMVLRAITKRETNETVEEKLTHLLNVYSDLLTSNIKPNKDIYE
                     LVIGSLLAGATKQTYEFTTGQDFLKIAIELLIITKDYNASFAPQLYRDLLTSLNMYKF
                     NFGITNNDLQNMCGSIINEPIYYMGLIKLCQLSQDSKGAIELYHTYQSQCNENKSLVN
                     HQFEVYSVLLQTLIGCHEKDMATKFLNNIIEEVRVKSGMSYQIKMLLSSYLIGLANIN
                     QIKECETMLATINQISWLPDVSVKSLLFAVKKCLDNNQPELAWKFWNFAVTRSDFDSD
                     QALKSEQLLDEYVGTDVYNMLVVSLISSRDTNHIVKFCKEMIIKSSIRLEVQPLLSLI
                     KYLRAYHLDTVLLNVVVNQGNKSANLNQYLSIVIDSLPVPMVSQLMNTNFFKKCCEDY
                     RLVKDNIYGIMKAFKLMEDNNWQQQQTQDTTIMKKFRYYKKVISYELNEISNHYVEIP
                     EELEQFKQYLAVGSN"
     gene            <349435..>350884
                     /locus_tag="PAS_chr2-1_0186"
                     /db_xref="GeneID:8198568"
     mRNA            join(<349435..349459,349563..>350884)
                     /locus_tag="PAS_chr2-1_0186"
                     /product="Alpha-tubulin"
                     /transcript_id="XM_002491029.1"
                     /db_xref="GeneID:8198568"
     CDS             join(349435..349459,349563..350884)
                     /locus_tag="PAS_chr2-1_0186"
                     /codon_start=1
                     /product="Alpha-tubulin"
                     /protein_id="XP_002491074.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0186"
                     /db_xref="EnsemblGenomes-Tr:CAY68794"
                     /db_xref="GeneID:8198568"
                     /db_xref="GOA:C4QZX0"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:C4QZX0"
                     /translation="MREVINVNVGQAGCQIGNACWELYTMEHGITPDGYLQPGLEKPK
                     GAEAGFSTFFSETGSGKYVPRALYVDLEPNVVDEVRTGPYGNLFHPEQLITGKEDAAN
                     NYARGHYTVGRELLDDILDRVRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLEQFSN
                     DYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLENADCTFMVDNEAIYDMCRKNL
                     GIVRPTFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPV
                     LSKQRATHESNSVAEITAACFDPSNQMVKCDPRLGKYMATCLLYRGDVVTRDVQTAVA
                     HIKSKKTVQLVDWCPTGFKIGICYEKPTQPASSELADVKRALCMLSNTTAIADAWNKI
                     DHKFDLMYRRRAFVHWYVSEGMEEGEFAEARENLAALERDYVELGSDSFPEEEEEY"
     gene            <351089..>351808
                     /locus_tag="PAS_chr2-1_0187"
                     /db_xref="GeneID:8198569"
     mRNA            <351089..>351808
                     /locus_tag="PAS_chr2-1_0187"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491030.1"
                     /db_xref="GeneID:8198569"
     CDS             351089..351808
                     /locus_tag="PAS_chr2-1_0187"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491075.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0187"
                     /db_xref="EnsemblGenomes-Tr:CAY68795"
                     /db_xref="GeneID:8198569"
                     /db_xref="GOA:C4QZX1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR009145"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4QZX1"
                     /translation="MCTREIINNSSAFYRRIGACRHGNKCVKEHIHPTSSYCVVLRNF
                     FDFSLLKVANEGTEVADEGDKQKQQLSGDKKNEQNNGTEKVNQDTSTKDSTSPQNSEP
                     ERNDPYTKLKEISESERFNKLLQDIFVELSLNYGFIEDIVICENNNVHLKGNVYIKFS
                     TKESAANCNQELNNRWYNGRPIYSELSPVRSFEEATCRKHDFGRCERGDMCNYMHIKR
                     APPTVTNNLFDSQLVYYDQQA"
     gene            <351947..>352760
                     /locus_tag="PAS_chr2-1_0188"
                     /db_xref="GeneID:8198570"
     mRNA            join(<351947..351990,352052..>352760)
                     /locus_tag="PAS_chr2-1_0188"
                     /product="Alpha 2 subunit of the 20S proteasome"
                     /transcript_id="XM_002491031.1"
                     /db_xref="GeneID:8198570"
     CDS             join(351947..351990,352052..352760)
                     /locus_tag="PAS_chr2-1_0188"
                     /codon_start=1
                     /product="Alpha 2 subunit of the 20S proteasome"
                     /protein_id="XP_002491076.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0188"
                     /db_xref="EnsemblGenomes-Tr:CAY68796"
                     /db_xref="GeneID:8198570"
                     /db_xref="GOA:C4QZX2"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C4QZX2"
                     /translation="MADRYSFSLTTFSPSGKLVQIEYALNAVKQGVTSLGIKATNGIV
                     LATEKKSASSLVNSEHQRKIAQITPDLGMTYSGMGPDFRVLADASRKVSHTNYKRIYN
                     ENPPTKILVSEVAKLMQEATQSGGVRPYGVSLLVGGYDDNNGFMLYQVDPSGSYFPWK
                     ATAIGKNSNAAKTFLEKRWNEELELEDAIHIALLTLKESIEGEINGETVELSVIGNQN
                     DDLLGFKGAEGVHGPRFRTLSPQEINDRLDAL"
     gene            complement(<352773..>353555)
                     /locus_tag="PAS_chr2-1_0189"
                     /db_xref="GeneID:8198571"
     mRNA            complement(<352773..>353555)
                     /locus_tag="PAS_chr2-1_0189"
                     /product="Protein required for respiratory growth and
                     stability of the mitochondrial genome"
                     /transcript_id="XM_002491032.1"
                     /db_xref="GeneID:8198571"
     CDS             complement(352773..353555)
                     /locus_tag="PAS_chr2-1_0189"
                     /codon_start=1
                     /product="Protein required for respiratory growth and
                     stability of the mitochondrial genome"
                     /protein_id="XP_002491077.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0189"
                     /db_xref="EnsemblGenomes-Tr:CAY68797"
                     /db_xref="GeneID:8198571"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR026285"
                     /db_xref="UniProtKB/TrEMBL:C4QZX3"
                     /translation="MTRYKKTLPYSYHSKPTKPMSFNIAVVYTDRLLLEHKDVWAKAT
                     EHILTDELSAGSLDLRKLYVYLSQDLKFFEYGLRIVGRAISLCDDYPAANRLAKQAGF
                     FANDENDYFVNVIKDLKEKLVSDSLFTSERIQEIDAMLFPDVAAYINFLKSFGTDPSI
                     TYPKVITMMWVMEQVYLDWATRGVKNFQPDNLHWWYKGWIDLHYGDDFSSWTQFLKDE
                     VDKCYIKAFKENDAKTIEDIKSTFLKTADFEGKFFDETYHYV"
     gene            <353842..>357573
                     /locus_tag="PAS_chr2-1_0190"
                     /db_xref="GeneID:8198572"
     mRNA            <353842..>357573
                     /locus_tag="PAS_chr2-1_0190"
                     /product="Putative ABC transporter"
                     /transcript_id="XM_002491033.1"
                     /db_xref="GeneID:8198572"
     CDS             353842..357573
                     /locus_tag="PAS_chr2-1_0190"
                     /codon_start=1
                     /product="Putative ABC transporter"
                     /protein_id="XP_002491078.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0190"
                     /db_xref="EnsemblGenomes-Tr:CAY68798"
                     /db_xref="GeneID:8198572"
                     /db_xref="GOA:C4QZX4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZX4"
                     /translation="MKENDTPRVGISVRDLAVVTKKSRRAFFSSSSKRNDVPTSKVLL
                     EATSFDIEPGTITAIMGGSGSGKTTMLNCLANGNENSGNINIQGTIAYNGKTNINTIS
                     HAYVIQQDILLPNLTCYETLMYSAELRLKEPKEKLVEIVDQVILELGLKDCRNTLVGN
                     DTHKGLSGGEKRRLSIGIQMLCNPSVLFLDEPTTGLDAYSALLLIQTLKNLANQGKTF
                     VLSIHQPRSDIFFLFDNLILLSRGKTCYSGPLDKVIPYFEQIGYHVPKQVNPADYFIE
                     IVSINMKDQETENKCWESLSKISDHWKDSHDFEPISVDPTFVSKVKSPVSFSKKIKIL
                     TRRDMLLSFRSPLILLSLLIETIAVSLICGWVFFIPGSSLRGIRTMTGALYTTNGLQP
                     YLFLLFEVYRLSSVDIKIYDRERSEGVVSAPSFLISRRISKFFTEDVWIPILESIIGY
                     FMFGLRTDSPRHFFIYFAAVYIAHLVSMCFAMACVSISREYALASLMANLNFTLQSMA
                     CGYLANSRVIPVYVRWTKYIAYLWYGYGAVISNQFTGFRGECFQDTSQPNIDEVCAAY
                     YGNNIIRNLGFWPNFIALPLCVEVAMAFGFYLFAGLMLTYKTKSRSALSQEVSSSSKR
                     KSLKSSTQDATKEAEVLVRDGLTITLKDASLKVRVRKVLERTSTEKEILHGVNAEFKP
                     GQLNTIMGPSGSGKSSLLNLISGRLHSNVTTSYTSIGDIFLDSQLASFQDMDEICSYV
                     SQDGDHLIPSLSVRETLLFAARLRLNLERHQVEKRVDEIILKMGLRDVATVLVGSEFV
                     KGISGGERKRLSIAIQLINDPPILLLDEPTSGLDAFTAGSILKVLQTLCDENKTVVLT
                     IHQPRLDLFHSLGSILLLAKGGHVAFKGTPNEMLEHFESMGYPCPAFVNAADHVLDVI
                     SVNVQNEINETISRKRVNLFLDEWKSRDNQETKLLAVNTFSMEDVAIKKRSSFMKGYT
                     ILLQRQALCIRRDTNILFGRIAQIAGLGIILALFYSPLKHDYTSIQQRLGALQQMTAL
                     YFIGMLNNIMIFPLERTSFYTEYKDKVVSAESFFMAYLTLELPFELVSGAFFSVFMVM
                     VIGFPRTPGLFFAMYYASICIVNCGESLGVIFNVIFDEVGFAVNIISIFLSIATFMTG
                     VMSLNMGAFLRGINWLSPLYYAVMGVLNLAFPPSLRLTCEDDFRNPDGSCIFSNGTDV
                     LEIYQLKKNWQLLLGLLIVVVFVYRGIGYVMLKLKVRGF"
     gene            <357778..>359236
                     /locus_tag="PAS_chr2-1_0191"
                     /db_xref="GeneID:8198573"
     mRNA            join(<357778..357834,357947..>359236)
                     /locus_tag="PAS_chr2-1_0191"
                     /product="3-hydroxy-3-methylglutaryl-CoA (HMG-CoA)
                     synthase, catalyzes the formation of HMG-CoA from
                     acetyl-Co"
                     /transcript_id="XM_002491034.1"
                     /db_xref="GeneID:8198573"
     CDS             join(357778..357834,357947..359236)
                     /locus_tag="PAS_chr2-1_0191"
                     /codon_start=1
                     /product="3-hydroxy-3-methylglutaryl-CoA (HMG-CoA)
                     synthase, catalyzes the formation of HMG-CoA from
                     acetyl-Co"
                     /protein_id="XP_002491079.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0191"
                     /db_xref="EnsemblGenomes-Tr:CAY68799"
                     /db_xref="GeneID:8198573"
                     /db_xref="GOA:C4QZX5"
                     /db_xref="InterPro:IPR000590"
                     /db_xref="InterPro:IPR010122"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:C4QZX5"
                     /translation="MSRPSNIGIKAMEIYLPGQAVNQAELEKFDGVAAGKYTIGLGQT
                     NMAFVNDREDIYSMSLTALSNLLKNYNIDPNSIGRLEVGTETLLDKSKSVKSVLMQLL
                     GENTDVEGVDNINACYGGTNALFNSISWIESSSWDGRDAVVVAGDIAIYEKGAARPTG
                     GAGTVALLIGPDAPLSFESVRGSYMTHAYDFYKPNFTSEYPVVDGHFSLACYVQALDF
                     CYKAYSKKAIAKGIAANPVGPEAVGIKHFDYNVFHVPTCKLVTKSYARILYNDFRADP
                     TRLPDVDQELATLDYEKSLVDKAVEKTFVGLSKDLAKERLAPSLTLPTNTGNMYTGSV
                     YGALASLLTYVGNDQLQGKRVGLFSYGSGLASSLFSLKVNGDLSSIIKVLNVKQKLKS
                     RNIATPEDYETAIALREKAHLQKSFKPTGSTDYIPNGSYYLVNVDDKYRREYQVKN"
     gene            complement(<359322..>361040)
                     /locus_tag="PAS_chr2-1_0192"
                     /db_xref="GeneID:8198574"
     mRNA            complement(<359322..>361040)
                     /locus_tag="PAS_chr2-1_0192"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002491035.1"
                     /db_xref="GeneID:8198574"
     CDS             complement(359322..361040)
                     /locus_tag="PAS_chr2-1_0192"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002491080.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0192"
                     /db_xref="EnsemblGenomes-Tr:CAY68800"
                     /db_xref="GeneID:8198574"
                     /db_xref="InterPro:IPR018803"
                     /db_xref="UniProtKB/TrEMBL:C4QZX6"
                     /translation="MRIFHWILFFITTSLARQSILSNSASDNTPSLVEQYAHVVSEWD
                     INDLKEYLKDSKASIDEKRSKDVEFLRSIAIENLVKTKKQTNSYWDSFKSLFSAPKSY
                     LESPFNNDSGKTENVSDWIFETWSSSQLNNLLKDAGIKVQPYQSRSSLIDAAKKNYGK
                     ISKKSKASGKYPGAWLYNKWSNDDLVEWLLDNEVIGQQEAKRLNKNRNALLKKVRDHI
                     YSVSSYYRDLRDSLIEDLDLDLEDVSQFKDDTINSWSESQLLDWLKIHKIKVDEQYYH
                     NKDYLSKKVSENKALLKDDVESWLSSVNKVVSPYLSKSTEQLEKAKKTAGKKSQEAGE
                     FINDTFLIDVSKWSRSRLTSYLKSRGIRIPLFATKSHLVKLVEKNRSTPPISWQKGVK
                     DSIPDWIFEGWSTAQVENWLKQNNVPIDKGVKKRDDLIKKAIEWYGDAAKTASKQQEN
                     IKNTASEKTDDLKQAFQSLKTGANDWYESFYNYYNSWSEKDLKKYLKSYGIDTTGLSH
                     TDLINQARSVSERVLKGTPFDTQPSLVNRLSFGYFDKQTPFYYSLLSYYYQFKSYLAT
                     YIPFVH"
     gene            <361644..>363335
                     /locus_tag="PAS_chr2-1_0193"
                     /db_xref="GeneID:8198575"
     mRNA            <361644..>363335
                     /locus_tag="PAS_chr2-1_0193"
                     /product="Component of the RSC chromatin remodeling
                     complex"
                     /transcript_id="XM_002491036.1"
                     /db_xref="GeneID:8198575"
     CDS             361644..363335
                     /locus_tag="PAS_chr2-1_0193"
                     /codon_start=1
                     /product="Component of the RSC chromatin remodeling
                     complex"
                     /protein_id="XP_002491081.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0193"
                     /db_xref="EnsemblGenomes-Tr:CAY68801"
                     /db_xref="GeneID:8198575"
                     /db_xref="GOA:C4QZX7"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="UniProtKB/TrEMBL:C4QZX7"
                     /translation="MSYLSKSPRPESALSRKNPTNIIGSSVPEPSIIPKPIDIPTLDE
                     QDQEYLKNNNYLKNESSFKYTGLPGLNNPGPNLQYRLKMAFKSGLSEEVDWAVDTCLQ
                     ASVQQPGLLNLRANPWLIDELAANLSCSIFDPSETVNHNIERTLNVVVVLRNISQDTD
                     NSSVVALNPRVKEILLLILDNKIHLQVSMLDDLFEASKELLRYSVDLIETISSYISPA
                     PKDDPMFLSLISILLKSTDRSLVITTLRSLSRLMVRSNLTKPFGADDITDEVLDNVSS
                     YLMLTSTTAVRDSFNDDLILASVDFLYQYCLPGGIRVLNLLKNEKRALLIKSILPRLL
                     TYGLNFQTEFTNELPMLKLNKRVRPPAPAHPPQLTADLYSAIDQLGEPARATVWMRCC
                     YYAVEDGEVTQISLWRSYEKQFGDSSSKRLLPAVDFIKNVSNAFPSSSAVVIKLDNDQ
                     RKFIIKGIKPREYPVRVRVGEMEALRQPLPRESDKLAKDNIEASQESITLFNYSSNVS
                     ISLTEINTSAALLLNCLTESETGGKLLEGSKELLLEKVLQVPSLLEHIQPSLMSL"
     gene            complement(<363389..>363894)
                     /locus_tag="PAS_chr2-1_0194"
                     /db_xref="GeneID:8198576"
     mRNA            complement(join(<363389..363831,363879..>363894))
                     /locus_tag="PAS_chr2-1_0194"
                     /product="Subunit of the heterohexameric cochaperone
                     prefoldin complex which binds specifically to cytosolic c"
                     /transcript_id="XM_002491037.1"
                     /db_xref="GeneID:8198576"
     CDS             complement(join(363389..363831,363879..363894))
                     /locus_tag="PAS_chr2-1_0194"
                     /codon_start=1
                     /product="Subunit of the heterohexameric cochaperone
                     prefoldin complex which binds specifically to cytosolic c"
                     /protein_id="XP_002491082.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0194"
                     /db_xref="EnsemblGenomes-Tr:CAY68802"
                     /db_xref="GeneID:8198576"
                     /db_xref="GOA:C4QZX8"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR011599"
                     /db_xref="UniProtKB/TrEMBL:C4QZX8"
                     /translation="MSQQKVDLTTLPPQQIFEFKRQIQQEVQHLQSSIQALNTAKAKF
                     NECIANIDRVSKSPENDILTPLTSSLYVPGKIVDNDKFLVDVGTGYYVEKNVEDAKEF
                     YKLRIDKLNQDSEQLTQMIQEKINIMKSVDNVLKQKIQQEEKSRQQTTQA"
     gene            <363991..>364965
                     /locus_tag="PAS_chr2-1_0195"
                     /db_xref="GeneID:8198577"
     mRNA            <363991..>364965
                     /locus_tag="PAS_chr2-1_0195"
                     /product="Single-stranded DNA endonuclease (with Rad1p),
                     cleaves single-stranded DNA during nucleotide excisio"
                     /transcript_id="XM_002491038.1"
                     /db_xref="GeneID:8198577"
     CDS             363991..364965
                     /locus_tag="PAS_chr2-1_0195"
                     /codon_start=1
                     /product="Single-stranded DNA endonuclease (with Rad1p),
                     cleaves single-stranded DNA during nucleotide excisio"
                     /protein_id="XP_002491083.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0195"
                     /db_xref="EnsemblGenomes-Tr:CAY68803"
                     /db_xref="GeneID:8198577"
                     /db_xref="GOA:C4QZX9"
                     /db_xref="InterPro:IPR004579"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="UniProtKB/TrEMBL:C4QZX9"
                     /translation="MSGADDGKDKTDTTSFEAILAGVKRLREQDQNKDAKQGSEKLKI
                     PLKRLPKRSLPTPKSDQIQNVKTTEDAAPVSSAPVTSTTTSKVIRMDNTPSNLAIRHQ
                     KKTGKTTFNSIQVNKSQTGNPLLKHLKTVSWEFSSNIKQVDYLVNSQTFVLFLSLKYH
                     KLHPEYIMNKIKSMNGNDTSFTNNNLKLLLVVVDIDSHEDILRELTKTCVNNDLSLVL
                     SWSFEEAANYIVYLKQYELSDLSESTLINNSKQDSSSYNSLVKSVTSIRNITKTDAVN
                     LISEFGSLRELVNANPESMSAVQGMGDIKVNRWASVVEDQFVLNKEYT"
     gene            complement(<364969..>366051)
                     /locus_tag="PAS_chr2-1_0196"
                     /db_xref="GeneID:8198578"
     mRNA            complement(<364969..>366051)
                     /locus_tag="PAS_chr2-1_0196"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491039.1"
                     /db_xref="GeneID:8198578"
     CDS             complement(364969..366051)
                     /locus_tag="PAS_chr2-1_0196"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491084.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0196"
                     /db_xref="EnsemblGenomes-Tr:CAY68804"
                     /db_xref="GeneID:8198578"
                     /db_xref="UniProtKB/TrEMBL:C4QZY0"
                     /translation="MAPKIGTKSLRLLCSMEIARNCESLRLAHIDKECWNNLWKQIWE
                     IILYNNMDSPYLFKLFATQFSQCTDFPCHTKLSIDFQHQYRRLVNQERDVVLHRHLLI
                     GASPKHRIETICGNFHLASFINVHQSFSYGGLVSIKVRSQLSRESLILLSNLTSITHL
                     DVSGCRNVDDSVINSWCIAINVGKLPHLNCLVLNDCPITKSGFMKLLNLTRGDIFYLE
                     SHIQIDLKESLNEWNSSYQNTALLSLCSLDKWYHVNLLYYTAQKTLNFYLTRMKSTIV
                     EDYRIVEDKISPYSDIDKINTQLTSAWLHNLQRKLGNNPVYSYLLSQRVPPQPNKVIK
                     VTKENKLSVVPKRKVKITSLNSFFEI"
     gene            <366517..>368091
                     /locus_tag="PAS_chr2-1_0197"
                     /db_xref="GeneID:8198579"
     mRNA            <366517..>368091
                     /locus_tag="PAS_chr2-1_0197"
                     /product="D-Arabinono-1,4-lactone oxidase, catalyzes the
                     final step in biosynthesis of D-erythroascorbic acid"
                     /transcript_id="XM_002491040.1"
                     /db_xref="GeneID:8198579"
     CDS             366517..368091
                     /locus_tag="PAS_chr2-1_0197"
                     /codon_start=1
                     /product="D-Arabinono-1,4-lactone oxidase, catalyzes the
                     final step in biosynthesis of D-erythroascorbic acid"
                     /protein_id="XP_002491085.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0197"
                     /db_xref="EnsemblGenomes-Tr:CAY68805"
                     /db_xref="GeneID:8198579"
                     /db_xref="GOA:C4QZY1"
                     /db_xref="InterPro:IPR006093"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR010031"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /db_xref="UniProtKB/TrEMBL:C4QZY1"
                     /translation="MSFVPQELAGFAVPKVVHTTWAKTFVCHPELYFQPSTLEEIQLL
                     VKSALKHQKTIMTVGSGHSPSDMTMSDEWLLNLDKYSSILKVDEHDMYTDVTVEAGIR
                     VYQLNELLAKKGLAIQNLGSISEQSMGGIISTGTHGASPLHGLVSQQLVDITLVNGLG
                     EVVKCSPTDKPELFRAAMLSLGKIGIIAQLTIRTVPRYAIKSYQEVISFKTLLDIWET
                     VWTSDEFVRVWWFPYSKRCVLWRASKSVEEYKNPRSSWYGTKWGRLTYEFLLWVCVHV
                     YPKLTPIVERFIFSKQYGNKETLGHGTTAVQESVEGLNMDCLFSQYVNEWAAPLNNGP
                     EILRSLERSIDTAAHNGDFFVHAPIEVRCSNTTYNNEVGEPDVSHRHIDTKGPVIGNN
                     LRPYLDTTPELSWVPKDKITNSQLTLYINATMYRPFRTSVPIGKWYRIFESSLEAAGG
                     KPHWAKNFIGSEEWAGGELKSDGYKDGEMKGFAVKMRDWYGDDLVKFNQVRREQDPNG
                     VFCSGRSWAVRNGIII"
     gene            <368807..>370068
                     /locus_tag="PAS_chr2-1_0198"
                     /db_xref="GeneID:8198580"
     mRNA            join(<368807..369535,369607..>370068)
                     /locus_tag="PAS_chr2-1_0198"
                     /product="Fe(II)-dependent sulfonate/alpha-ketoglutarate
                     dioxygenase, involved in sulfonate catabolism for use"
                     /transcript_id="XM_002491041.1"
                     /db_xref="GeneID:8198580"
     CDS             join(368807..369535,369607..370068)
                     /locus_tag="PAS_chr2-1_0198"
                     /codon_start=1
                     /product="Fe(II)-dependent sulfonate/alpha-ketoglutarate
                     dioxygenase, involved in sulfonate catabolism for use"
                     /protein_id="XP_002491086.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0198"
                     /db_xref="EnsemblGenomes-Tr:CAY68806"
                     /db_xref="GeneID:8198580"
                     /db_xref="GOA:C4QZY2"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:C4QZY2"
                     /translation="MSITAKLSTVNLNTDKEAKQAAINDKKIRYGGDVVHFSPGTDIV
                     REDGVLTVSKQAQAESKYPQWLPTWDPKLRFDDEPRFSHVDRGFFADPELKRLFPQGG
                     DHKLKNLTPKLGTEVEGVQLSQLTPEQKDDLALFVAQRGVVVFRDQDLRDRPLEEIKK
                     FGQYFGPLHIHQTSGAPDGFPEFHIVYKRPGASKALENKISVPAWHSDTTYELQPPGT
                     TFSVLSKVQKQVETHCLLMQLKLTSAALSQGSIQRKNFTPETVHPLVRYHPVLGKRSI
                     YANKVFGTRIIGLKQEESDLILDFIQFFIAAALDLQVRANYKPGTVVAWDNRTVYHSP
                     VFDFDYDAPVRHCFRITPIAERPVGSKEEYESWSPNGEEKTVEEWEELYAGGVPDLKT
                     VLSS"
     gene            <371168..>372085
                     /locus_tag="PAS_chr2-1_0199"
                     /db_xref="GeneID:8198581"
     mRNA            <371168..>372085
                     /locus_tag="PAS_chr2-1_0199"
                     /product="Essential protein required for maturation of
                     Gas1p and Pho8p, proposed to be involved in protein tra"
                     /transcript_id="XM_002491042.1"
                     /db_xref="GeneID:8198581"
     CDS             371168..372085
                     /locus_tag="PAS_chr2-1_0199"
                     /codon_start=1
                     /product="Essential protein required for maturation of
                     Gas1p and Pho8p, proposed to be involved in protein tra"
                     /protein_id="XP_002491087.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0199"
                     /db_xref="EnsemblGenomes-Tr:CAY68807"
                     /db_xref="GeneID:8198581"
                     /db_xref="GOA:C4QZY3"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C4QZY3"
                     /translation="MVEDKTELLKTPLHGVYIPCALIVFGVAIHDYHFIPHTLLVLGL
                     FVGIRLLIAYNKRASIQSDKWNDFELIDKTVVSKNSAIYRFKLYRDEEILDIPVGHHL
                     ACQINVDGKNEVRYYTPISSQFDQGFFDILVKSYKDGSVSKAFASLNQGQTVKFKGPV
                     GRMSYKNNMASEIGMIAGGSGITPILQVLSYITTTPEDTTRINLLFANEYENDILLRD
                     EIDELARIYPFFDVHYTLTHPPENWDGDVGYVTKEMIEKYLPPPTKTSKIFISGPLEM
                     KKLCLELTEELGFDKGKLNSDQNDQVFCF"
     gene            <372275..>374335
                     /locus_tag="PAS_chr2-1_0200"
                     /db_xref="GeneID:8198582"
     mRNA            <372275..>374335
                     /locus_tag="PAS_chr2-1_0200"
                     /product="F-box receptor protein, subunit of the
                     Skp1-Cdc53-F-box receptor (SCF) E3 ubiquitin ligase
                     complex"
                     /transcript_id="XM_002491043.1"
                     /db_xref="GeneID:8198582"
     CDS             372275..374335
                     /locus_tag="PAS_chr2-1_0200"
                     /codon_start=1
                     /product="F-box receptor protein, subunit of the
                     Skp1-Cdc53-F-box receptor (SCF) E3 ubiquitin ligase
                     complex"
                     /protein_id="XP_002491088.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0200"
                     /db_xref="EnsemblGenomes-Tr:CAY68808"
                     /db_xref="GeneID:8198582"
                     /db_xref="GOA:C4QZY4"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4QZY4"
                     /translation="MEEEEVNSLGNRIATASPLPDNVPVRGLPELPSEVLVTIFSFLD
                     PMTLDGLSLVCKRWKMVINDNELWRENFIKFFGSKQFQSLTRSTQWRTELLMRKELAQ
                     RWIKGKGMYHTYAVRNGVITDIAADFRNDKLVLFSKNTGDLTITSLRSNKGETPITGV
                     FPNGTTSCELSKNAMIFGRWDGKVYLKLLNQKNVYLNDSISLKESTHEGIVTVTKINK
                     DSIAGKHGSVRAFSGDHRGRVIGWDLKNYQKVVDWPISNASITNIESNYQDCVIVRDQ
                     LGIIYVIDHNLKDSKGPMRSPRIIKTEKIDENATFSMQVDFGDENIVISYENKVRVYS
                     YSLHMFGHFSELEVAEDDQVYRTVISQMNLQCCRKDDTLAGHDGLLCGTIFKSGKTVI
                     WNVRSWEDQQPIPIIHVIVPKFQHYVYLNEDSPRVVSLDINSSVIIFGSHNSYCSLYD
                     AVSGEFMRFVSRKLPRKILLHDQILPVTETLLDKEDNFATNGVIVMGNIIQYFQFGEQ
                     KNYDKFKKKMARNSLKRAGVDDRKVKNRRHIKDDVEDFTFQQIQEQQKSELLDKYNGD
                     SFEDEEEEMSIAIALSESLKVKERAEGSEEEEEELKRALELSRSQSAILGDEVVGHED
                     PTLNSEDRELNYALDLSKRETQRSNIFPDGEGSSSRIESDLDNTSNNDDEMELALKLS
                     LIEH"
     gene            complement(<374370..>375155)
                     /locus_tag="PAS_chr2-1_0201"
                     /db_xref="GeneID:8198583"
     mRNA            complement(<374370..>375155)
                     /locus_tag="PAS_chr2-1_0201"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491044.1"
                     /db_xref="GeneID:8198583"
     CDS             complement(374370..375155)
                     /locus_tag="PAS_chr2-1_0201"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491089.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0201"
                     /db_xref="EnsemblGenomes-Tr:CAY68809"
                     /db_xref="GeneID:8198583"
                     /db_xref="UniProtKB/TrEMBL:C4QZY5"
                     /translation="MTETSKSSHYRKASFSPYEDTKSKLAADLEKLAASSEQGDDLSP
                     INKEKKRVSKPKNKVRRRKFDSWDYVFIVIIMFASCGIIYNLFRGPRIIFTTQKDLDT
                     ALSEIVKPVVTYTNDGVPTSTDTAGQSLTNKDEDQTRFDVAKEFRAIGEISPLIILTT
                     NDNESEQLKKTISLYSITPQPALVAVNRHPHVEKLTSYINSLAAPQGSSSSTSNLPEE
                     AVPGIVINGVPVASAKEIVLLHSAGKLNEFLSRKSQGRYRIEH"
     gene            <375923..>377083
                     /locus_tag="PAS_chr2-1_0202"
                     /db_xref="GeneID:8198584"
     mRNA            <375923..>377083
                     /locus_tag="PAS_chr2-1_0202"
                     /product="S-adenosylmethionine decarboxylase, required for
                     the biosynthesis of spermidine and spermine"
                     /transcript_id="XM_002491045.1"
                     /db_xref="GeneID:8198584"
     CDS             375923..377083
                     /locus_tag="PAS_chr2-1_0202"
                     /codon_start=1
                     /product="S-adenosylmethionine decarboxylase, required for
                     the biosynthesis of spermidine and spermine"
                     /protein_id="XP_002491090.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0202"
                     /db_xref="EnsemblGenomes-Tr:CAY68810"
                     /db_xref="GeneID:8198584"
                     /db_xref="GOA:C4QZY6"
                     /db_xref="InterPro:IPR001985"
                     /db_xref="InterPro:IPR016067"
                     /db_xref="InterPro:IPR018166"
                     /db_xref="InterPro:IPR018167"
                     /db_xref="UniProtKB/TrEMBL:C4QZY6"
                     /translation="MTLHSVAVPDFINHELSTTLDSTNAFEGPEKLLEIWFAGSAEEM
                     EDDGLRQIPLEDIESLLELVNCEILSKISSSSFDSYLLSESSLFVYPHKLILKTCGTT
                     TTLNCFDKLFDLMKTHLQWDLSSRSPYRIFYSRRSFMFPSQQKHVHQSWQSEVEWLNK
                     YFGKSSSKVYIVGDLSNDHWYLYLNGTDGSHMPSPPSSPNDFKGKDETFELLMTELDP
                     VKCERFMTDIRVDQFSDVNLDIDDYGHVIGMKTLKETGIDSFFSKERSKHDAFAFKPC
                     GFSSNSIVDKDYYYTIHITPEEAFSYASFETNYPKLADKTQLINQILSFLNPGKFVMV
                     FVQEVDEDEVLSNDFMNLKRFNLEGYTKVDNIIYDLKFNYKLIYSQFEKIKQ"
     gene            complement(<377117..>379411)
                     /locus_tag="PAS_chr2-1_0203"
                     /db_xref="GeneID:8198585"
     mRNA            complement(<377117..>379411)
                     /locus_tag="PAS_chr2-1_0203"
                     /product="Phosphotyrosine-specific protein phosphatase
                     involved in the inactivation of mitogen-activated prote"
                     /transcript_id="XM_002491046.1"
                     /db_xref="GeneID:8198585"
     CDS             complement(377117..379411)
                     /locus_tag="PAS_chr2-1_0203"
                     /codon_start=1
                     /product="Phosphotyrosine-specific protein phosphatase
                     involved in the inactivation of mitogen-activated prote"
                     /protein_id="XP_002491091.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0203"
                     /db_xref="EnsemblGenomes-Tr:CAY68811"
                     /db_xref="GeneID:8198585"
                     /db_xref="GOA:C4QZY7"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C4QZY7"
                     /translation="MCSASLEGHPNLRSSSMENAYEESRTTSTPSPASPPLLLAPLIP
                     TLKVTEPESPQLKPALTDSPKTASETSLSTHRSSASMPFLSSMTKNKLTQTFKLEEDA
                     VQPINGYEELVDLFDGKESVIVLDVRPYSFYLTSRLKGALNICVPTTLLKRKTFTMQS
                     VISTMSQQHKEVMQSKLLDCSISSLDIIIYDESSSLDSCSFHLYETIKKFLQENSKTA
                     TDESAKHFNLFILQNGFSEFQNRYKLFDPLHLIDTTPVLLSPSSPLSQNSQLTSPSVS
                     PETAATTTAAGLGRISTKHTSIPAPLSGFSLPPNRFSGIVDESLLKKQSASNLQSENE
                     DDLDQGELVVPEHIRDVPVWLLPFTDKIRGYKLAKKRFVKIEKIENRRLRNLISNTLN
                     QKTQHFQQQNAISHNHKHFTNGSDDELNTPAGSCNICDKIDYSLPSEGLENGIKNRYS
                     NIWPYEHSRVKLSHSQSVSHLEKSNEYFNASYVTVPLISSKRYIATQEPLETTLQDFW
                     RCCLNNKVPMIICLTSSGLENGVPNSVPKYYHTQHFKDSNISVTLLKEEKNDDCSSIV
                     RTIQVSKEDKVHTVTQIEFQDWPDFGIPPSALSILKLIDLKNRLLQDKNLSTTSDKDS
                     TIMVHCSAGCGRTGTFITIDLLLDSLNRTLEDDAVLASPGCGLTTHSPFSQLSQKLFY
                     DKTAEQADIEDKAASAKDLQRFHHHNSILNFYKSDLDLVYKTVNELRRLRVSMVQNLS
                     QYIICYEAVLKYLELKESDHQHNK"
     gene            complement(<380191..>381435)
                     /locus_tag="PAS_chr2-1_0204"
                     /db_xref="GeneID:8198586"
     mRNA            complement(<380191..>381435)
                     /locus_tag="PAS_chr2-1_0204"
                     /product="RNAse"
                     /transcript_id="XM_002491047.1"
                     /db_xref="GeneID:8198586"
     CDS             complement(380191..381435)
                     /locus_tag="PAS_chr2-1_0204"
                     /codon_start=1
                     /product="RNAse"
                     /protein_id="XP_002491092.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0204"
                     /db_xref="EnsemblGenomes-Tr:CAY68812"
                     /db_xref="GeneID:8198586"
                     /db_xref="GOA:C4QZY8"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="UniProtKB/TrEMBL:C4QZY8"
                     /translation="MLFKFHSAYQMISELLQGVLDHTPNPIEVPQLPNQFPLSTDYCP
                     IDVPLTCSNKTEVKDTCCFEHPGGVLVLTQFWNYYPAIGPDKLFTLHGLWPDNCDGSY
                     DQFCSNSDTITEVSGILRSFGEEELLEKMKQVWKNNNHNDEQLWIHEFNKHATCMTTI
                     QSKCYDQYEKHVNVVDFFRTTVAVFETVPTYDWLANNGIVPSTAQTYSRQQIEDTLTA
                     QFGQPVRISCNKYGALDEVWYFHHLKGSVRMYNNSLPDLYPIPALAESRCPEHGIKYL
                     PKDFKPPAPTHTQPNLPRPTDGVYKHGYLKLSGQSGCLISTGKWYTSGTCATFQLFKA
                     PFGGYNLKSSKGFCGVTVDGELICHRGQQPIQFEFDKSKNQINYGGVHVWSAFNEPSR
                     FEQIPIFSGRKGSIVFKLILEE"
     gene            <381807..>383332
                     /locus_tag="PAS_chr2-1_0205"
                     /db_xref="GeneID:8198587"
     mRNA            join(<381807..381945,381993..>383332)
                     /locus_tag="PAS_chr2-1_0205"
                     /product="Subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex"
                     /transcript_id="XM_002491048.1"
                     /db_xref="GeneID:8198587"
     CDS             join(381807..381945,381993..383332)
                     /locus_tag="PAS_chr2-1_0205"
                     /codon_start=1
                     /product="Subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex"
                     /protein_id="XP_002491093.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0205"
                     /db_xref="EnsemblGenomes-Tr:CAY68813"
                     /db_xref="GeneID:8198587"
                     /db_xref="GOA:C4QZY9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:C4QZY9"
                     /translation="MCKLDLQSFDVRCLLDIFSINSSFVSIHPHSPIMSATEITQQEE
                     AKITFEIHEKYRQQEKIINEEFKIWKKSVPLLYNFIYTSVTQWPNLSADWLTSVKQND
                     QSFTVQFVVGSNSSSDEDYLALYQIDLPLSVTTTSAEQTVDEEDIKKAIEQDSKSNKF
                     QLVHKWPHPGEINKLAFNSDNLVATVTKTGSILVFDINNVSSSKPKFTLNFHKQEGFA
                     LQWNPSNNQQLVTGANDGKIAVWDLSKNTTAPVQEFSPHSSSVNEVSWNSEYNFLIGS
                     ASDDRSFQIHDLRSGETIIKVDDAHNGDVNAIKFHPVLGDLLVTAGQDTLVKVWSLSK
                     LLSPADEPSKNDESTNDEIQEERDQAIRYLHGHFNSVTQVDFNPENPNYLLSSSCLDK
                     RVMVWNLANLDEDFEEDEAEKNPEYNDPALIFIHGGHTSSLSEARWHPTLHDVILSCG
                     EDNLLEVWQPLLPREEDSSEEDEKIDENEQDEVTEDKEMKDV"
     gene            complement(<383381..>384529)
                     /locus_tag="PAS_chr2-1_0206"
                     /db_xref="GeneID:8198588"
     mRNA            complement(<383381..>384529)
                     /locus_tag="PAS_chr2-1_0206"
                     /product="Subunit of COMPASS (Set1C), a complex which
                     methylates histone H3 on lysine 4 and is required in tel"
                     /transcript_id="XM_002491049.1"
                     /db_xref="GeneID:8198588"
     CDS             complement(383381..384529)
                     /locus_tag="PAS_chr2-1_0206"
                     /codon_start=1
                     /product="Subunit of COMPASS (Set1C), a complex which
                     methylates histone H3 on lysine 4 and is required in tel"
                     /protein_id="XP_002491094.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0206"
                     /db_xref="EnsemblGenomes-Tr:CAY68814"
                     /db_xref="GeneID:8198588"
                     /db_xref="GOA:C4QZZ0"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ0"
                     /translation="MTEELSKEELKRLQKKFQEFEKAPKYNLNSEEVFCICRKPDDEG
                     QLMVACDGCDEWFHFRCMKLDPKYEKLVANFYCVFCDRLFNKGKTLWKRKCKLEGCFN
                     PIELSEEKKSKYCSEEHGLMYMKQALLDKVLKQEDLNGQRLLKLKEVSSILREVDDCK
                     ALAKLGEELPIYSDFYPDAKLSPHLTEKVAAWDKQIQQVTTELERLDSRLRLVLALKE
                     FLKLLNENINIITIPDYIPGPRTKSSKSKSKNSKKSDICGFNRVILDLDRATDMDQFK
                     AKISPYLGKNAIDPEDFKKLYREIYPDDDDMVDSVGPENWLARFCLKDKRKCNKHHSW
                     LNILADDYYLQTQLLEEKKKRLQDERQTLMTDYNIERWSNLEAKVASN"
     gene            <384750..>387287
                     /locus_tag="PAS_chr2-1_0207"
                     /db_xref="GeneID:8198589"
     mRNA            <384750..>387287
                     /locus_tag="PAS_chr2-1_0207"
                     /product="Mitochondrial GTPase related to dynamin, present
                     in a complex containing Ugo1p and Fzo1p"
                     /transcript_id="XM_002491050.1"
                     /db_xref="GeneID:8198589"
     CDS             384750..387287
                     /locus_tag="PAS_chr2-1_0207"
                     /codon_start=1
                     /product="Mitochondrial GTPase related to dynamin, present
                     in a complex containing Ugo1p and Fzo1p"
                     /protein_id="XP_002491095.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0207"
                     /db_xref="EnsemblGenomes-Tr:CAY68815"
                     /db_xref="GeneID:8198589"
                     /db_xref="GOA:C4QZZ1"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ1"
                     /translation="MLPRSRHMVPMMRRTFGVRLIQHQIPKKQIQFGLIKTRPFSIYS
                     FGKFAGRVVKAPAAVGGGLAAAGSYVAYKVEQASSYTKDQVDRAKDLAGGLYDNISGF
                     FGKFGGNGSEGVPPDGNGSNAAALGGTAAAVGFKSDDDEDEETLYLDEDEDEEEEEED
                     SETMDDEMLNLTRQMIEIRSILQSIDPNDNTLKLPSIVVIGSQSSGKSSVLEAVVGRE
                     FLPKGSNMVTRRPIELTLVNSPDLAAEVAEFPALRMNNLTDFEQVQKILYDLNLAVPI
                     TEAISNDPIQLTIRSPRVPDLSLVDLPGYIQVEAADQPTELKRKIRQLCDKYLEEPNI
                     ILAISAADVDLANSTALRASRQMDPKGERTIGVVTKLDLVDGAEARGILTNRKYPLKM
                     GYVGVVTKVPQTSIFKKKTGYQAFIAQQNFESTFLKDNKDEFAGTSVGTRTLKKRLMR
                     VLERSMALSLKPTYDRVQQELEEASYKFKVEFNDRSLTPETYIASSIDTLKGAVKEFS
                     ERFGRNEIKSVLKNELDQKVLDLLASKYWNKPHDQSREIDLDLRDIVNASPTDVYWHR
                     KLDLTTNSLTKLGVGRLSTTLLTNALLTEIDNMIDNTTLRTHPMIKQVVRDAAEEVLN
                     SRYYSTADQVENCIKPFKFEIELENSEWKQSRDHIIRLLNEELRSCDQYLQLLKKNIG
                     SRKLTQIMTYLENKDNSIGETIERENIGFSPGILSRGRDALFLKDRASLLQFRISCLK
                     SSQCKIKENKYKCPEIFLAAVADKLTQTAVLFLNVELLSDFYYNFPRALDAKLSNGLT
                     QEQIEAFAKEDPKVKRHIELQQRKELLELATSKIEDVMTLQKHRTKH"
     gene            <387451..>388338
                     /locus_tag="PAS_chr2-1_0208"
                     /db_xref="GeneID:8198590"
     mRNA            <387451..>388338
                     /locus_tag="PAS_chr2-1_0208"
                     /product="Protein of unknown function, localized to the
                     mitochondrial outer membrane"
                     /transcript_id="XM_002491051.1"
                     /db_xref="GeneID:8198590"
     CDS             387451..388338
                     /locus_tag="PAS_chr2-1_0208"
                     /codon_start=1
                     /product="Protein of unknown function, localized to the
                     mitochondrial outer membrane"
                     /protein_id="XP_002491096.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0208"
                     /db_xref="EnsemblGenomes-Tr:CAY68816"
                     /db_xref="GeneID:8198590"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ2"
                     /translation="MSFPGKVELSPVQPLPLDIGIPVTPNEKELRERRRFSKLIPFLY
                     TVQKWSILPFGCFALLHIPAVVVMPSLSVNLAKQLFTMGRCVYQAPGLESLMIWGSLG
                     VHILSGVTLRLLKIYRNYSYYGMVHKRTRRRKSLFAKENTDDLDPSFGMGGITSLLGL
                     GFKGSYISKILGISPLSFTGYLLLPVLAAHINDMRLLPASIDGDSNLIDVEYITQALA
                     QHKWTTSLGLLALVGLASYHTIGGMMRYLKLYSLRSRQWSYALVVGMFTVAGFSLRAI
                     SQLPLIQGYVGKRYSVYLA"
     gene            complement(<388384..>390708)
                     /locus_tag="PAS_chr2-1_0209"
                     /db_xref="GeneID:8198591"
     mRNA            complement(<388384..>390708)
                     /locus_tag="PAS_chr2-1_0209"
                     /product="One of two large regulatory subunits of
                     ribonucleotide-diphosphate reductase"
                     /transcript_id="XM_002491052.1"
                     /db_xref="GeneID:8198591"
     CDS             complement(388384..390708)
                     /locus_tag="PAS_chr2-1_0209"
                     /codon_start=1
                     /product="One of two large regulatory subunits of
                     ribonucleotide-diphosphate reductase"
                     /protein_id="XP_002491097.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0209"
                     /db_xref="EnsemblGenomes-Tr:CAY68817"
                     /db_xref="GeneID:8198591"
                     /db_xref="GOA:C4QZZ3"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ3"
                     /translation="MTKSKEAISFDEARLKRSLLKLSFGLNLKFVDIALVVEKVSLAI
                     IENLHLQDLLNLTSEILASLSTRHYDYSNLAARLLSNHLRKRLGDSFFANCERLAEHG
                     FVDKGLLTIARSNSEQLDGSIKPERDFDFDYFGYMTLQSIYLLKKDDLILETPQFLFM
                     RVALGIHGEDLSSAIQTYDLMSQGYFIHASPTLFHAGTPTPYLSSCFLMGLQDADVNS
                     VYQSLHKIAMISNAAGGIGINVHDIPAEDACNRGIVPLIKVLNETARYVQQGSNKRPS
                     AFAIYLEPWHEEVFDLLNLRKNHGKEEIRARDLFYALWIPDLFMEKVEKNEDWCLFNP
                     LHAKGLNDVYGEQFNLLYAEYEKKGMYVRKIPAQQLWNAIVDAQIETGTPFMLYKDSC
                     NRKSNQSNLGTIQCSNLCCEIVEYSSRDQIAVCNLASIGLPKYVVDGKFDFESLKNSV
                     RIVTENLNKVIDISKYPVPEASYSNDLTRPMAIGVQGLWDTFMLLKIPYDSEEAAALN
                     SQIFETIYYSALETSMNIAKKDGPYKSFQGSPASKGLLQMDLWNVKEEDLTLDWKSLR
                     SDIVKHGLRNSLLVGPMPTASTSQILGFCESFEPLSYNFYTRRVSSGEYQVVNKYLID
                     DLINLGLWTDSLRQEIIGNDGSIQEIDEIPQEVKSLYKTVWEISQRITINMAADRGRF
                     IDQSQSMNLYLAKPNRGKLTAMHFYAWKKGLKTGMYYLRTKAASSAIKFSIDISKRKR
                     DGTYNTPTKRQAVQSEALETTPSCQLNNCESCSG"
     gene            <391953..>392399
                     /locus_tag="PAS_chr2-1_0210"
                     /db_xref="GeneID:8198592"
     mRNA            <391953..>392399
                     /locus_tag="PAS_chr2-1_0210"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491053.1"
                     /db_xref="GeneID:8198592"
     CDS             391953..392399
                     /locus_tag="PAS_chr2-1_0210"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491098.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0210"
                     /db_xref="EnsemblGenomes-Tr:CAY68818"
                     /db_xref="GeneID:8198592"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ4"
                     /translation="MQFKSLIGATLALSVVKATTELEPIFTNDVNVTVPTVPPEITST
                     PDVSVPGNLTETGGLTNTTGTGGFTNTTATGTGGFTNTTATGTGTGTGTGTGTGTGTG
                     TGTGTGTGTGTGTGTTGTGTETGNGAQAVLGSSVLAAAGLFVAMLI"
     gene            complement(<392460..>393794)
                     /locus_tag="PAS_chr2-1_0211"
                     /db_xref="GeneID:8198593"
     mRNA            complement(<392460..>393794)
                     /locus_tag="PAS_chr2-1_0211"
                     /product="Subunit of phosphatidylinositol (PtdIns)
                     3-kinase complexes I and II"
                     /transcript_id="XM_002491054.1"
                     /db_xref="GeneID:8198593"
     CDS             complement(392460..393794)
                     /locus_tag="PAS_chr2-1_0211"
                     /codon_start=1
                     /product="Subunit of phosphatidylinositol (PtdIns)
                     3-kinase complexes I and II"
                     /protein_id="XP_002491099.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0211"
                     /db_xref="EnsemblGenomes-Tr:CAY68819"
                     /db_xref="GeneID:8198593"
                     /db_xref="GOA:C4QZZ5"
                     /db_xref="InterPro:IPR007243"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ5"
                     /translation="MNEAEYKCQRCRLPLTIDGSLEDLSISQANLLTGRNGNFTKNTI
                     PLEDAVEEDLPKVPQSRLNLFKEVYQKMDHDFTNARDEFVVLNKHNDNSDVNVEYDYE
                     ENNTISRRINTMTNIFNILSNKYEIDFPVCYECATLLMEELKNEYERVNADKEVYAKF
                     LSKLRKQDAGTNMKERTAQLLEQLEKTKQEERDKEKKLQGLYDERDSLEKVLASLENE
                     MEQLNIEEQQIFELENKYEYELMEFKNEQSRMEAMYEDGLTQLDNLRKVNVFNDAFNI
                     SHDGQFGTINGLRLGTLDSKRVSWYEINAALGQVVLLLFTLLSRLELELKHYKIFPIG
                     STSKIEYQVDPDSKPVTINCFSSGEQLLDKLFHSNKLDPAMNAILEITIQIADHFTKQ
                     DPTNELPYKMENETISNLNIKPSKRKSNEEWTLACKHLLTNLKWIIAFSSST"
     gene            complement(<393967..>396336)
                     /locus_tag="PAS_chr2-1_0212"
                     /db_xref="GeneID:8198594"
     mRNA            complement(<393967..>396336)
                     /locus_tag="PAS_chr2-1_0212"
                     /product="Protein O-mannosyltransferase, transfers mannose
                     residues from dolichyl phosphate-D-mannose to prote"
                     /transcript_id="XM_002491055.1"
                     /db_xref="GeneID:8198594"
     CDS             complement(393967..396336)
                     /locus_tag="PAS_chr2-1_0212"
                     /codon_start=1
                     /product="Protein O-mannosyltransferase, transfers mannose
                     residues from dolichyl phosphate-D-mannose to prote"
                     /protein_id="XP_002491100.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0212"
                     /db_xref="EnsemblGenomes-Tr:CAY68820"
                     /db_xref="GeneID:8198594"
                     /db_xref="GOA:C4QZZ6"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ6"
                     /translation="MCQIFLPQNVTRCSVSLLTMSKTSPQEVPENTTELKISKGELRP
                     FIVTSPSPQLSKSRSVTSTKEKLILASLFIFAMVIRFHNVAHPDSVVFDEVHFGGFAR
                     KYILGTFFMDVHPPLAKLLFAGVGSLGGYDGEFEFKKIGDEFPENVPYVLMRYLPSGM
                     GVGTCIMLYLTLRASGCQPIVCALTTALLIIENANVTISRFILLDSPMLFFIASTVYS
                     FKKFQIQEPFTFQWYKTLIATGVSLGLAASSKWVGLFTVAWIGLITIWDLWFIIGDLT
                     VSVKKIFGHFITRAVAFLVVPTLIYLTFFAIHLQVLTKEGDGGAFMSSVFRSTLEGNA
                     VPKQSLANVGLGSLVTIRHLNTRGGYLHSHNHLYEGGSGQQQVTLYPHIDSNNQWIVQ
                     DYNATEEPTEFVPLKDGVKIRLNHKLTSRRLHSHNLRPPVTEQDWQNEVSAYGHEGFG
                     GDANDDFVVEIAKDLSTTEEAKENVRAIQTVFRLRHAMTGCYLFSHEVKLPKWAYEQQ
                     EVTCATQGIKPLSYWYVETNENPFLDKEVDEIVSYPVPTFFQKVAELHARMWKINKGL
                     TDHHVYESSPDSWPFLLRGISYWSKNHSQIYFIGNAVTWWTVTASIALFSVFLVFSIL
                     RWQRGFGFSVDPTVFNFNVQMLHYILGWVLHYLPSFLMARQLFLHHYLPSLYFGILAL
                     GHVFEIIHSYVFKNKQVVSYSIFVLFFAVALSFFQRYSPLIYAGRWTKDQCNESKILK
                     WDFDCNTFPSHTSQYEIWASPVQTSTPKEGTHSESTVGEPDVEKLGETV"
     gene            complement(<396410..>398140)
                     /locus_tag="PAS_chr2-1_0213"
                     /db_xref="GeneID:8198595"
     mRNA            complement(<396410..>398140)
                     /locus_tag="PAS_chr2-1_0213"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002491056.1"
                     /db_xref="GeneID:8198595"
     CDS             complement(396410..398140)
                     /locus_tag="PAS_chr2-1_0213"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002491101.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0213"
                     /db_xref="EnsemblGenomes-Tr:CAY68821"
                     /db_xref="GeneID:8198595"
                     /db_xref="GOA:C4QZZ7"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLARKVLARQCLVVARLCAGRFASSLCGCSCRGLMRPPKFNSSK
                     SLSRSMTSSSLFESPNCPSCGVVLQTEHPDKDGYCLLPKGERKVKNYQNELKEKLFLN
                     VKREELADRLGHEVDSESLIIPKEMYQKPRTPKRLVCQRCFKSQNYSLIDHSIREENP
                     EHKILDEIPSNANIVHVLSAVDFPLGLSKELVNRFKPTQITYVITKSDVFFPDKLGLQ
                     RTGAAYFEDSLVKLVGADPRKVVLVSGKRNWGLKQLLSTLPRGPNYFLGMTNTGKSTL
                     IRSIVGKDYSKKQTENGPGVSHLPSFTRKPMKFKMDNNSLELVDLPGYTAPNGGVYKY
                     LKEENYRDILNVKQLKPLTSLKAYTETLPSKPKLFNGVRVICIGGLVYIRPPKGVVLK
                     QFSLVNLPSFMYSSLKKATSVIQAPPQALVNCSVVKEDSPDELVRYVIPPFYGLIDLV
                     IQGVGFIKLLPTGARNTRELIEIFAPKDIQLMVRDSILKYVYKTHAEHDSTNNLLHKK
                     NIKARGQTILRRLPKKPVFTKLFPVPANVPSHELLTMVTGKDDLAEEDKEYRYDIQYP
                     NRYWDETICK"
     gene            <398658..>402401
                     /locus_tag="PAS_chr2-1_0214"
                     /db_xref="GeneID:8198596"
     mRNA            <398658..>402401
                     /locus_tag="PAS_chr2-1_0214"
                     /product="Mitochondrial protein required for assembly of
                     ubiquinol cytochrome-c reductase complex (cytochrome"
                     /transcript_id="XM_002491057.1"
                     /db_xref="GeneID:8198596"
     CDS             398658..402401
                     /locus_tag="PAS_chr2-1_0214"
                     /codon_start=1
                     /product="Mitochondrial protein required for assembly of
                     ubiquinol cytochrome-c reductase complex (cytochrome"
                     /protein_id="XP_002491102.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0214"
                     /db_xref="EnsemblGenomes-Tr:CAY68822"
                     /db_xref="GeneID:8198596"
                     /db_xref="InterPro:IPR004022"
                     /db_xref="InterPro:IPR013136"
                     /db_xref="InterPro:IPR018501"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ8"
                     /translation="MVLFKRKQVEVVPPQQLPDDLDTEIWYIPQTGEWFLNYDEYLDR
                     MDYYSQKKFACEITGNSSFDFFEALKYEQEEMQAVENKFPEPVREPILRYVQFSLIPR
                     LDQLVDDVYLHFKKEFFPGDLVNVKSAGSNRYKGIIREKARFAPITLPDGTVREGYCS
                     YRVGLSNSDGEVTVNENQVSRDRNAFTKWYVKTFLKLTLTRSQRSGAPWVVKDQYAAK
                     YRIPTEYPEELKKFEEEEEEDEKPSRKRRKKVSTQDSKKRVKSEFPNIFENLKETPPA
                     LSSEDTESLQRWKDRWNEVLSRCNYYLDLSADDSSDVEPRTKLNQLLGFAGVSRQLVF
                     DPNTTNIIVTMRSYHPKTQYEPPDMFSYVESRHIKVWHYEKVFRFLKSLNVTMRKVRQ
                     QEKSTKARTESPATLIPSNTAFMSINQSANGTKDQNQSTLQPSKGSVEDLALPFQIIK
                     DKPVTKQLDGIDHVDELMETWAFINVYREALIIDTFTLDDYITCLKWSNRSRKSSLLE
                     EIFCSLLSCIIDTNYTKPKSNDPHHGLLITLPESLTDLLDDGDSTKEFQDDIKQENAN
                     GIVNGTENGDAVDPSIKNEKSDEEDDHESNASSTINHNAYQLLNYRKRPWQEILRDRN
                     FKDGGWQIALVGVLSLVDHLPEYQADIEQVYEILAPEDLGVSPASVETRFYENLGINL
                     RIKVLSIVCSLLIDSTTIRSHIDNCLEEAAKLRRERLEKMREYKLASDEAQALHKECM
                     LILCTADTSLETSSAPQREDKKQKSRARSSDKVPLKPTDKELALAKADPKFLKLLTSR
                     TDAMVKAQSANKEKRQLEKRLNEIDLQRIRCIGFDRSYNRYWWFENNGLPTLKNVHTT
                     SDDEEEDGDDKEDAIEDDEDLEDVAEETYLVGRLWIQGPTDEDRRNLLLFSDEQLERW
                     NNLVEQLEKDKEKEKITNDSFLKTEETNSNVKVEDSTTVADDSPELASKEEKTSVIDE
                     AISKFFEFDFQENGSVQRPSGRTIIDEYGAPCIQEFKFIDRKILQETPDLLLSKENWR
                     YIDTSEDIDKLLKLLNQYGIREGNLHKQLTILEHLIKGSIEARRKALYLDENSEEHVR
                     LRDIIENTVIPEQTAEENEEKEDPEVLELESSDNAENDDLVELEADSDSDSAVLPTRS
                     RRSKAVRNTRGTRGSRKTPVIHTELDFTRKKAHYATRQTTKSQEREEKIKMVQEAKHQ
                     LEHLKEDRMITRCLEWVNSSAIEELGHTHLNGPKKKSTNKKRR"
     gene            <402551..>403519
                     /locus_tag="PAS_chr2-1_0817"
                     /db_xref="GeneID:8198597"
     mRNA            <402551..>403519
                     /locus_tag="PAS_chr2-1_0817"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491058.1"
                     /db_xref="GeneID:8198597"
     CDS             402551..403519
                     /locus_tag="PAS_chr2-1_0817"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491103.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0817"
                     /db_xref="EnsemblGenomes-Tr:CAY68823"
                     /db_xref="GeneID:8198597"
                     /db_xref="InterPro:IPR007129"
                     /db_xref="InterPro:IPR021150"
                     /db_xref="UniProtKB/TrEMBL:C4QZZ9"
                     /translation="MSSFLTRRSPCFVNSLRALRRYQSVKVDGKLNLKTTPTELATSS
                     TLPNIEKEHLPKRDIDPKRKLEVNKKETTGYVIPKWQEALGEAFIGVFKVDMDKIRSG
                     SIGGSKYYYMCKDQGLQFKNEPLSDTAKFYYETLGLNRSFSQWFQITALHVWLLFVRM
                     RAMPFKYGKLYQQKLVDRLFKDIELRLSEEMNVMSGSIRDNYLKDFDSQLRGIVMSYD
                     EALISDDATLAAALWRNFFNGDKNVDLVHVEAMVRYIRMQLYVLDKTSDREFGFGDFQ
                     FVKPNEVVEPLTKENEDLLRKKVREKYEPLEGKQLPSNRSVLSLEE"
     gene            <403744..>404439
                     /locus_tag="PAS_chr2-1_0818"
                     /db_xref="GeneID:8198093"
     mRNA            <403744..>404439
                     /locus_tag="PAS_chr2-1_0818"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491059.1"
                     /db_xref="GeneID:8198093"
     CDS             403744..404439
                     /locus_tag="PAS_chr2-1_0818"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491104.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0818"
                     /db_xref="EnsemblGenomes-Tr:CAY68824"
                     /db_xref="GeneID:8198093"
                     /db_xref="UniProtKB/TrEMBL:C4R000"
                     /translation="MKLTPDVVQNASIYTDPEKQRVLMLRNKNIFMIENLGVLNNNNS
                     TIIEAIDFTGNDIRHLGNIPYSPRLKTILIAKNSVRSIQSNLAQNVPNVESIVLINNK
                     IKSLTSLEPLVQAKRLKNLYLMENPVTSHKYYRLWVIWRISSLKILDFKKIKDKERTQ
                     SSELFGQHDSPTELANEILKDAISNGPATQEESNETFTLTEEEREELKTQLANATTLA
                     EISKIEQLIKQVS"
     gene            complement(<404484..>408575)
                     /locus_tag="PAS_chr2-1_0215"
                     /db_xref="GeneID:8198094"
     mRNA            complement(<404484..>408575)
                     /locus_tag="PAS_chr2-1_0215"
                     /product="DNA binding protein with similarity to the S.
                     pombe Snt2 protein"
                     /transcript_id="XM_002491060.1"
                     /db_xref="GeneID:8198094"
     CDS             complement(404484..408575)
                     /locus_tag="PAS_chr2-1_0215"
                     /codon_start=1
                     /product="DNA binding protein with similarity to the S.
                     pombe Snt2 protein"
                     /protein_id="XP_002491105.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0215"
                     /db_xref="EnsemblGenomes-Tr:CAY68825"
                     /db_xref="GeneID:8198094"
                     /db_xref="GOA:C4R001"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001525"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR029617"
                     /db_xref="UniProtKB/TrEMBL:C4R001"
                     /translation="MSSGARPKRSASLKVNYKEATEKEYDAMLHKSISKSPSKRQKKV
                     TPPSTANTSETPNLDTANPSIYVPIDEEVPLNWQPPVKKQDRFNNVLDLEGAIISENT
                     LILKNRQPISKGQCIYMISEPAGEPYYIGRILGFEKKENFTDNPQDAKNFMFKINWYY
                     RPRDLVKRSTDSRLLYATMHTDNCPIQSYRGTVTIKHKSEIANLDEFKQTPNCFYFEK
                     LFDRYMIKLYDVLPTKSLDHLPENYYRALNKRFEYVFVETGKAQTLLSAPKNCEKCYQ
                     WCSNMDSVHCLNCEKYYHMLCLDPPILSKPKRGFGWYCAKCSRDMEVELSERRGKLLE
                     DSVDDDKDDEVEDDEKNEVERQSTPSSLPHYEEAAIQFLENDSTHSLEERRKLEEWPY
                     RYLGVHAKLEDALDLQDRPYPRAASRLGAKHQCNYIPDWFGHPLKYYDKLDDDGKVVD
                     SHKKKQRYFKSKSKVSPPPISVIEDANVLKVPDEYKGQTPDTYPPWLLPRPRGYIERG
                     GDDTAVLMWRQPKDQSDMVESYIEKCSEVSDKLGLYRKTPNFMDAILKFLMDSNYDPI
                     KAFEEVKKLTRDSVKEPTLTPEELEKFEAAVKKYGSELYPVYQAVGTQKCPDIVRFYY
                     LWKKTPNGHRIWDNFEGRHKNKIKAAIKTTKGTPEDINDSGDDSAFDSKKIKAQRFEC
                     KYCHSNHSTQWFKVSGAEISENGSRIALCMRCARLWRRYGVVWEEPNEKPTPKAGAAW
                     KKKIESELVRDNEAIIKAREMYRQHPRKIGSKRKADDYESPTTKQNGSVKRSKQDKEK
                     NKTEQIKLESKKSEPKKADNKKAATKKTESKKVVTNPEQKQKVKRKKVEKKSPDPKLK
                     GDSTKPLTKKSRSKDSTKQDKSSLATTTKVKANKEPKDSNKLLKIAPKKLPPQKQPLV
                     SDKAIEEAKLPFAVSELASFLPWRKLFNRYASDYEISNLTLDTIKRIMKSIRPGNPIE
                     DNKKVWKLLKSAQLPGLTSKNMSLPLYDLQSRPCSVCRTFDDINEMLICINCGLNVHA
                     SCYGMDTKIEGNSFQMESGYYNYKWCCDPCSNDLHPLISTYYSCMLCNAREIDHDACI
                     TGQPNAIPDCLKRTTSDDWAHVICALFTKGITFGNPAAMQPIQGVEAVLHKNTNLSCG
                     ICGVRGGGMADCHLCKKEMHLTCAVDVAGCMFGFLIDNSSDNRDAIKISDEVCGLPSQ
                     CLICNSHPISTLPKNFVPLRAHGTLLNQIGKPFVLVLSQFLKVSKSADSLQLHSKIIQ
                     REIAPDLTEKRIVLNPSPLFQNILNSVSPESKNNSVKLSCQRCNGIQSPIWYPYHEDS
                     QAENNSKVECHSCHYGPQQNREIPNLKRFTERLDLSRLQIVND"
     gene            <408874..>410301
                     /locus_tag="PAS_chr2-1_0216"
                     /db_xref="GeneID:8198598"
     mRNA            <408874..>410301
                     /locus_tag="PAS_chr2-1_0216"
                     /product="Alpha (guanylyltransferase) subunit of the mRNA
                     capping enzyme, a heterodimer (the other subunit is"
                     /transcript_id="XM_002491061.1"
                     /db_xref="GeneID:8198598"
     CDS             408874..410301
                     /locus_tag="PAS_chr2-1_0216"
                     /codon_start=1
                     /product="Alpha (guanylyltransferase) subunit of the mRNA
                     capping enzyme, a heterodimer (the other subunit is"
                     /protein_id="XP_002491106.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0216"
                     /db_xref="EnsemblGenomes-Tr:CAY68826"
                     /db_xref="GeneID:8198598"
                     /db_xref="GOA:C4R002"
                     /db_xref="InterPro:IPR001339"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013846"
                     /db_xref="InterPro:IPR017075"
                     /db_xref="UniProtKB/TrEMBL:C4R002"
                     /translation="MVEMEERDVPTIPGEPLGQEMTRFLKGVVSTITRVPPTTFPGSQ
                     PVSFQRVHLEDNLMNKDYYVCEKSDGLRCLLLTLLHPETGDEGTFLITRANEYFMVPN
                     FHFPLSPNDFSKPHNGTIVDGELVLSRTPEGTKQLRYLIFDCLAYNGESVMNKLTPKR
                     LYYASELFYKPYRKLREKHPVDCQNFPFKLYFKDMTEPFKISKIFQQLHNLSYVSDGL
                     ILTCSETPYVVGTDSTLLKWKPAEENTIDFKLLLEFPKYEDEDVPEGPDRVYPDYDSK
                     PTIYLYEWVGGQSAVNSTDPEKYEADFSKHQEFGQLTLTDEEWQELKESGERFNGRIA
                     EVNQDKSKHWRLLRFRDDKLNANHYTVVGKVIQSIRDGVTKEELIQAQEQIRKNWEIR
                     QRRRKEMAAGAAANGGQTSHRSAPAPVKPPTQQRPQPVPQQKPTTELKRPLEDQESSD
                     DALDEFPTYDRSPSPDYSRKKVKGE"
     gene            complement(<410448..>412007)
                     /locus_tag="PAS_chr2-1_0217"
                     /db_xref="GeneID:8198599"
     mRNA            complement(<410448..>412007)
                     /locus_tag="PAS_chr2-1_0217"
                     /product="Mitochondrial ribosomal protein of the small
                     subunit, has similarity to mammalian apoptosis mediator"
                     /transcript_id="XM_002491062.1"
                     /db_xref="GeneID:8198599"
     CDS             complement(410448..412007)
                     /locus_tag="PAS_chr2-1_0217"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the small
                     subunit, has similarity to mammalian apoptosis mediator"
                     /protein_id="XP_002491107.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0217"
                     /db_xref="EnsemblGenomes-Tr:CAY68827"
                     /db_xref="GeneID:8198599"
                     /db_xref="GOA:C4R003"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R003"
                     /translation="MSTELSLVIVNRCIYFKPSPLGHPPATCLYPILRHPPSIFAYNY
                     YVCHYLSLPSFTTSDQILLFPYIISCTTQYLPTNRSYRKVFLHSTMFRGIRALHTSAA
                     SLAEKKVSLSFRKEAKGFVKRSKGPGNHKNFINVSSTTLLKKSESHLPDLKPQNLTKN
                     VVTNFPNDSVKALHHLGSFRKGQFNEAFSRPVSLVRDATIRLEKILQKALTTDSTNTR
                     IAIIGESGVGKTTTLAQFQSMAKSHKAIVFAINNADNFVDGSSDFGPSALDTVEYRQP
                     MVTRKLIKKFFKANKDELNIPLTEDIKFATVKSFGERKGKQQDLAFKAKENTLFDVLN
                     HAVHYRGDLSHCLHFTFSQLSASNVPVFLTVDNFTAFTQNPITAYRDTKNNRIYFDRF
                     EIPSLILRYIRGDDKFNKGGVLISSSGKHKSNDTLSVALGDKSYEPYAKFGDFDRKLA
                     ATLQNLEKFEVPSLNKEEVGSLLQYYLDQGIIHNEKTDEINFESFRDNKFFYSSGNPR
                     ELLKSCTLNYY"
     gene            complement(<412670..>413169)
                     /locus_tag="PAS_chr2-1_0218"
                     /db_xref="GeneID:8198600"
     mRNA            complement(join(<412670..413062,413158..>413169))
                     /locus_tag="PAS_chr2-1_0218"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491063.1"
                     /db_xref="GeneID:8198600"
     CDS             complement(join(412670..413062,413158..413169))
                     /locus_tag="PAS_chr2-1_0218"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491108.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0218"
                     /db_xref="EnsemblGenomes-Tr:CAY68828"
                     /db_xref="GeneID:8198600"
                     /db_xref="UniProtKB/TrEMBL:C4R004"
                     /translation="MSTENQEIKEQIDATNQEIVNNAQEAAEPATEAVAESSTQAEAT
                     GEVTSEHAKSLKEKTEEFLDHSKKEVEHAFETAKEKADELVKGAKAKKTEAAESNAET
                     SEAATESADKVEEKGIKKYFTKFKNVIKKVAN"
     gene            <414155..>415510
                     /locus_tag="PAS_chr2-1_0219"
                     /db_xref="GeneID:8198601"
     mRNA            <414155..>415510
                     /locus_tag="PAS_chr2-1_0219"
                     /product="Protein kinase involved in regulating diverse
                     events including vesicular trafficking, DNA repair, an"
                     /transcript_id="XM_002491064.1"
                     /db_xref="GeneID:8198601"
     CDS             414155..415510
                     /locus_tag="PAS_chr2-1_0219"
                     /codon_start=1
                     /product="Protein kinase involved in regulating diverse
                     events including vesicular trafficking, DNA repair, an"
                     /protein_id="XP_002491109.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0219"
                     /db_xref="EnsemblGenomes-Tr:CAY68829"
                     /db_xref="GeneID:8198601"
                     /db_xref="GOA:C4R005"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R005"
                     /translation="MDLRVGGKYRIGRKIGSGSFGDIYMGKNLISGEEVAIKLENVKA
                     KHPQLAFEARVYKALAGGLGIPFLRWYGQECDYNAMVIDLLGPSLEDLFNYCNRKFSL
                     KTVLLLADQLLSRLEFIHARSFIHRDIKPDNFLMGVGRTGHLVHVIDFGLAKRYQDPR
                     TNFHIEYRENKNLTGTARYASTLTHLGIEQSRRDDLESLGYVLIYFCRGALPWQGLKA
                     LTKRQKYDRILDKKLGTSVEALTRGLPVEFADYMTYVKSLRFTDKPDYIYLKKLFRDL
                     YVRQRFTKDYLFDWSIYKFKLKHPGLTKGENDTQTDEQQQQQQQQQVQQAISQQKQQQ
                     LQQQDQQQPQQQAQPQPQLQQQAQQPQQQPQQQQSQPQQQLQRDSVQQGLNSDVHMYP
                     MYPDQNNQMSKTPSTQQKPVRNISSPGLKMNIHSSAAKDADYSQFNNPSNETPKVNKW
                     L"
     gene            complement(<416390..>419308)
                     /locus_tag="PAS_chr2-1_0220"
                     /db_xref="GeneID:8198602"
     mRNA            complement(<416390..>419308)
                     /locus_tag="PAS_chr2-1_0220"
                     /product="Karyopherin with a role in the assembly or
                     export of 60S ribosomal subunits"
                     /transcript_id="XM_002491065.1"
                     /db_xref="GeneID:8198602"
     CDS             complement(416390..419308)
                     /locus_tag="PAS_chr2-1_0220"
                     /codon_start=1
                     /product="Karyopherin with a role in the assembly or
                     export of 60S ribosomal subunits"
                     /protein_id="XP_002491110.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0220"
                     /db_xref="EnsemblGenomes-Tr:CAY68830"
                     /db_xref="GeneID:8198602"
                     /db_xref="GOA:C4R006"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R006"
                     /translation="MDLGGLVQLLQVSADESRGINSKQAEEQLKQLEQVPGFHYNLQT
                     IYLNTNYPLQVRWLAIICFKNGVDQYWRPTRKFAISKQEKDSIKSRLFELLEVNGNQL
                     TIQNAQAISRIVRYDFPHEWPNLFEQLEGLLNSTNYVYLHNILVILNQIIKTVGSIKV
                     GRARATMQAKVPILTPHLIKLYEQFFQSWSRDFNLASVEVGYLSLKCIRRIIDVVSEF
                     HDRDDDVKHFFNLSLRHLRLLLNERDRQEISIVERYIKCYTKIYLSVLNNNPTSFILL
                     DGASDILITMLSILENKADLIYNSREDSDETSFWEQLAINSLLMLKKLVNFVYRKGAL
                     TLKKQHDKAEVEKAIRVLTTKFFTESLVANLIDLIIKNYLRLRPEDLELWSEDPEQWA
                     NDELTNSWEYQIRPCAENFFRDLVTHFQETRNFVLVRINEFDPSPNSNLSEVLTKDAL
                     LSAFQLSSASLANDVNFDNLLTSVFIPLVEQNQPILVRRILLIISEWISINCSKQSRQ
                     LVYKLLLSLLQSSQDRIVRITAVQTLRYAIDDYDFDRTDFQPYAEHVIAHLIGLVSEM
                     TLTESKLNVMNVLSILLEQCNSIIPRDSLFDVLSLVTKVWGNSETILKAAFLRLLKNV
                     CACLKSDVTETYSITLPLIETCCSESSEKYTVLSEDGYELWLEVLRSIPEPIPSRLVD
                     TFSLIVPALLNSTEILPTILSIIRSYILLDPTLFEHDTGLQIFKIMGQYLPNMRDDAL
                     NIFMSILDIFFLQLQRTHNQLESSLLTTQFMESGLLESLLTFALNTDEAVITSNKVLI
                     PLSRFLYIGPHLLKEMINHISRHQNTQIFDQLYSLMLKRIDYLGDPRNRKSFLLALLS
                     PYLTIEMDSDFEFLISNFAPLMAEVTKQFEEINETPSGDCQVYHRSYSYEGLEFLPQD
                     RNELLRVNKLLELDPIHCLPLKEQVSKVLNHLKQVLGDRFDEVVKTLDPSSLDQLKRL
                     "
     gene            complement(<419464..>420696)
                     /locus_tag="PAS_chr2-1_0221"
                     /db_xref="GeneID:8198603"
     mRNA            complement(<419464..>420696)
                     /locus_tag="PAS_chr2-1_0221"
                     /product="Nicotinate phosphoribosyltransferase, acts in
                     the salvage pathway of NAD+ biosynthesis"
                     /transcript_id="XM_002491066.1"
                     /db_xref="GeneID:8198603"
     CDS             complement(419464..420696)
                     /locus_tag="PAS_chr2-1_0221"
                     /codon_start=1
                     /product="Nicotinate phosphoribosyltransferase, acts in
                     the salvage pathway of NAD+ biosynthesis"
                     /protein_id="XP_002491111.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0221"
                     /db_xref="EnsemblGenomes-Tr:CAY68831"
                     /db_xref="GeneID:8198603"
                     /db_xref="GOA:C4R007"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:C4R007"
                     /translation="MAIVSLLDTDLYKITMQAAVHKNFLSVPVKYKYTNRTKALSLNK
                     EAIAWLKPQILALGDLRYSSDEIEFLKTNYGYLPAEFFAFLKDFKLDPEKEITLINED
                     DPENFGLEIAGTWVQTIPYEIPLLSLISEAYFKFVDVNWNLDGQFELAYEKCKTLISN
                     GCAFSEFGTRRRRSFETQKIVLEGLLKCANDNPDLKHFFLGTSNVYFAKQLGLTATGT
                     VAHEWMMGIAAIHNDYINANKLAMDYWIKTVGSDHAGLALTDTFGTEAFLRHFVPPYS
                     DYYIGVRQDSGDPEQYAKLIATHFYEKLGLPKYSKSICFSDALNVEKCLRYKKTAEAL
                     GLKVTFGIGTCMTNDFKNSPPLNIVIKLLEADGNHAIKISDNIGKNMGDPATVKRVKQ
                     ELGYIEKDWEEDETKRWK"
     gene            complement(<421264..>423555)
                     /locus_tag="PAS_chr2-1_0222"
                     /db_xref="GeneID:8198604"
     mRNA            complement(<421264..>423555)
                     /locus_tag="PAS_chr2-1_0222"
                     /product="U3 snoRNP protein, component of the small
                     (ribosomal) subunit (SSU) processosome containing U3
                     snoRN"
                     /transcript_id="XM_002491067.1"
                     /db_xref="GeneID:8198604"
     CDS             complement(421264..423555)
                     /locus_tag="PAS_chr2-1_0222"
                     /codon_start=1
                     /product="U3 snoRNP protein, component of the small
                     (ribosomal) subunit (SSU) processosome containing U3
                     snoRN"
                     /protein_id="XP_002491112.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0222"
                     /db_xref="EnsemblGenomes-Tr:CAY68832"
                     /db_xref="GeneID:8198604"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R008"
                     /translation="MTVGSWTFTEHGGGRLIERGSALSTDGRFMFVVSSDSLRVFNVD
                     NRIGVRNVKFSEMTVRGDFPELDITKKLVRMLVSSDILHFVFSDGHHLWLNWKEFMSG
                     DLELKVEKFQVPGTVLDVLHYKDEFYTIIGKRNKGHNRQVVKDGEVLYTVESVRLHNK
                     SLYDRKIVFLTTDHKVTVIDLETNTSSDVKFSYRRDVMSVAVAEKSDMVALGTATGII
                     HLVESNTERLLKWHIDQVKAMEFTVDEMYLVSGGVEKVLVFWNLSTGKQQFLPRLNGV
                     IVDIDLSNPELYTLTLISNSIVEFLVISSIDLASRISVASVKNRFKGLNKKKSTDKDV
                     TKLGFDITTDFEVVKDQLFFPLRSQIQVYDYIRNEQQALQTVAPVSQIGKVRSELAIQ
                     DPKVKCFAVSENGKWMCTFDSVPTPSADALLSTGEQTYSLKFWKHVPGDAMYGSWELT
                     TKIIDPHAQKPVSEIIPAPSSLYGGDAFVSVDGKGNVRLWRPRALDPNAVAAANNKAL
                     QHTEWTLRKAFSGFESSSESVHASWSPDGSIIALSHETNVLLLEVNTSQMDPIPLPSL
                     VQNRITGLKFVDDGNLLLLTKRSLANFNILTWSKTPLNLSLDFPAKGQSLVAVDQAKR
                     IIAVVLNYYNHDKDIQSKVYLFKADSLVPIGEVSLSKGISGIRYSSYNDTFVVVDTSS
                     MIFTLSNKDLPKFNQDSDYVTEINTLVGIAQSNHKVLNNVENSMDLLTESVMLNANSF
                     DKILENTEGLTVTNLFERVLKVI"
     gene            <423742..>423960
                     /locus_tag="PAS_chr2-1_0223"
                     /db_xref="GeneID:8198605"
     mRNA            <423742..>423960
                     /locus_tag="PAS_chr2-1_0223"
                     /product="RNA polymerase subunit ABC10-beta, common to RNA
                     polymerases I, II, and III"
                     /transcript_id="XM_002491068.1"
                     /db_xref="GeneID:8198605"
     CDS             423742..423960
                     /locus_tag="PAS_chr2-1_0223"
                     /codon_start=1
                     /product="RNA polymerase subunit ABC10-beta, common to RNA
                     polymerases I, II, and III"
                     /protein_id="XP_002491113.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0223"
                     /db_xref="EnsemblGenomes-Tr:CAY68833"
                     /db_xref="GeneID:8198605"
                     /db_xref="GOA:C4R009"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:C4R009"
                     /translation="MIIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYC
                     CRRMVLTHVDLIEKFLRYNPLEKKDFDS"
     gene            <424210..>425187
                     /locus_tag="PAS_chr2-1_0224"
                     /db_xref="GeneID:8198606"
     mRNA            <424210..>425187
                     /locus_tag="PAS_chr2-1_0224"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491069.1"
                     /db_xref="GeneID:8198606"
     CDS             424210..425187
                     /locus_tag="PAS_chr2-1_0224"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491114.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0224"
                     /db_xref="EnsemblGenomes-Tr:CAY68834"
                     /db_xref="GeneID:8198606"
                     /db_xref="GOA:C4R010"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR014043"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:C4R010"
                     /translation="MKAIICPGQGVFNVKTLLRLSKHIKSSTYHTEFVRHVDNSLKLP
                     IKKYLLTPDELTPNDLNNLQKTSYQQPLLLLASYLLLELNNYKITPGNTDFMVGHSMG
                     ELTLLTLQKKISIEGSIKLAYTRGVLMESVVEKLENPTEFKLYALMIKPKDFRFIQDT
                     LELNPHVNISNINGFNQIVISGRESKCLQLFEQFKLDKISFKPIDLKVSIPFHNPVLD
                     PVIPKLSLYITTHQLFDNSSLSIPSISNLNGQVVKETQTFVDNFIQTTNKTVNFLGCL
                     ETLIKESQDDQLEIHNISAVSTNLVKSFAKQKGLKNITNIDLEEHYWGT"
     gene            complement(<425204..>426742)
                     /locus_tag="PAS_chr2-1_0225"
                     /db_xref="GeneID:8198607"
     mRNA            complement(<425204..>426742)
                     /locus_tag="PAS_chr2-1_0225"
                     /product="Zinc cluster transcriptional activator involved
                     in conferring resistance to ketoconazole"
                     /transcript_id="XM_002491070.1"
                     /db_xref="GeneID:8198607"
     CDS             complement(425204..426742)
                     /locus_tag="PAS_chr2-1_0225"
                     /codon_start=1
                     /product="Zinc cluster transcriptional activator involved
                     in conferring resistance to ketoconazole"
                     /protein_id="XP_002491115.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0225"
                     /db_xref="EnsemblGenomes-Tr:CAY68835"
                     /db_xref="GeneID:8198607"
                     /db_xref="GOA:C4R011"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4R011"
                     /translation="MAADQPEEKTTKAKEKESSKDEVETKKASRKEGAPRRPRRQKVQ
                     VACVYCRRSHMICDDSRPCQRCIKRNIGHLCRDEQNSKRLKRKSSQEEEQSDSHQQTM
                     SPMMQSSLSMSPPAVSGSMSGQIPLPMSMSMPQQTNSQMNSSDPNVVVTGYNKPQSAN
                     SLNGSHTKLSTLNKQPFFFSEHAGSEFSSLNEFLSMIDDPDMINHINYNNDPILQNFD
                     STTNLVNHFNQEANNGNINTGNVQEISAETSAPPLEVAYDNSQVYPNFTYPQQQQQQQ
                     QQAPAVKNNDEYNQPVISDTARDKFFLTAADPTTEISPEERLKQVINAKLEAGLLKPY
                     NYAKGYARLQAYMDNYMNITSRQRILKPLSTFRPGFRAIAKTLKDIDLILVEEHFERM
                     LLDYDRVFTSMAIPACLWRRTGEIYRGNKEFASLVEVSIDDLKNGKLTIYELMTEESS
                     VNFWEKYGSIAFDKSQKAVLTSCNLRTKDGRKRKNCCFSFTIRRDKHNIPSCIVGNFI
                     PISP"
     gene            <427098..>427886
                     /locus_tag="PAS_chr2-1_0226"
                     /db_xref="GeneID:8198685"
     mRNA            <427098..>427886
                     /locus_tag="PAS_chr2-1_0226"
                     /product="Mitochondrial inner membrane protein required
                     for delivery of copper to the Cox1p subunit of cytochr"
                     /transcript_id="XM_002491071.1"
                     /db_xref="GeneID:8198685"
     CDS             427098..427886
                     /locus_tag="PAS_chr2-1_0226"
                     /codon_start=1
                     /product="Mitochondrial inner membrane protein required
                     for delivery of copper to the Cox1p subunit of cytochr"
                     /protein_id="XP_002491116.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0226"
                     /db_xref="EnsemblGenomes-Tr:CAY68836"
                     /db_xref="GeneID:8198685"
                     /db_xref="GOA:C4R012"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:C4R012"
                     /translation="MLHPGSSNMISSMMAPAFQAIRQPLKRGNTGVNSFRSMRCQSTQ
                     PKSRMPKMSTQEFQQLYRERQQEKLRMKNRSIGLYASSLGMVFLTLAFGSVPLYRAIC
                     QKTGWSGTPMTDVSKMTPDKLIPVDTSKKIRVQFTAETSGILPWKFVPQQREVYVTPG
                     ETALAFYKARNESAHDIIGMATYSVTPDHVAPYFNKIQCFCFEEQKLAAGEEVDMPLF
                     FFIDPEFMNDPTMRNIDDIVLHYTFFKANYGQNGQLMTSPLIPR"
     gene            complement(<427947..>430154)
                     /locus_tag="PAS_chr2-1_0227"
                     /db_xref="GeneID:8198776"
     mRNA            complement(<427947..>430154)
                     /locus_tag="PAS_chr2-1_0227"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491072.1"
                     /db_xref="GeneID:8198776"
     CDS             complement(427947..430154)
                     /locus_tag="PAS_chr2-1_0227"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491117.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0227"
                     /db_xref="EnsemblGenomes-Tr:CAY68837"
                     /db_xref="GeneID:8198776"
                     /db_xref="UniProtKB/TrEMBL:C4R013"
                     /translation="MWILIQDGQEHLLIPGKVYKLGRGSRTSEQSIIDFQCPQPYVSK
                     LQLTISVDQPSSQEIQDPKHISRLLIQNVGQGKVHYSGKIYKAKKDPVDIPVDYNQES
                     VTLELGNLTKEYISVRFKWVNTVLWYSRSDNEDRLDELFHLARSLDIRLVTNYVDNVT
                     LFLQGSQHTSKLAKALIKAIPIVKFDYLKVLFERKGKLEDSFELPNVENYVPEATLRF
                     NRGRYELFQGLYFLVSRKDSLFLDFVALAKGKLVVLDLEDPPEILSEKFGLKKLDPQK
                     IICFKPSNEIEREDEHHKMKKLASYLGVKLVGNPQVMESILKVDSSMLLTKEPLNLDK
                     KRQISEVSPPETNTTQPKRSRFKRREIKPLDAMELLSQQVLSQQHEKKPIESAQRGEE
                     PSVATVKKESRFRRNRMKQIALEDMIDVSQPNILSTQHDDQEETQIEELNKPLGKATG
                     QTTEVKLTTPIQEDQMVVETELPVKEHSIADGSGLVSQHEPKATPEPPSSLVSTTAQV
                     SKAKKPKTYKYTDSQIDALNPNASSNNQQKLSSMIMQAKELKLKESIDDDIQELLEET
                     TNDTREKLKIHSDETLFRKEKASVRSHVDKSPFHPEWKGRVNFKKFKRKDLQGSLIST
                     KIYVPLVDCQIEKENEKEKVLTKELEFLNELNQPIQDLDSQFPDISGKHKGKRMFVAE
                     SDEESEMETEQFESRPRTKTRSSITSRNKPAEPDVIESDDDDDEPKFRFTTPS"
     gene            complement(<430224..>432434)
                     /locus_tag="PAS_chr2-1_0228"
                     /db_xref="GeneID:8198777"
     mRNA            complement(<430224..>432434)
                     /locus_tag="PAS_chr2-1_0228"
                     /product="DNA helicase involved in rDNA replication and
                     Ty1 transposition"
                     /transcript_id="XM_002491073.1"
                     /db_xref="GeneID:8198777"
     CDS             complement(430224..432434)
                     /locus_tag="PAS_chr2-1_0228"
                     /codon_start=1
                     /product="DNA helicase involved in rDNA replication and
                     Ty1 transposition"
                     /protein_id="XP_002491118.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0228"
                     /db_xref="EnsemblGenomes-Tr:CAY68838"
                     /db_xref="GeneID:8198777"
                     /db_xref="GOA:C4R014"
                     /db_xref="InterPro:IPR003840"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028880"
                     /db_xref="UniProtKB/TrEMBL:C4R014"
                     /translation="MLSLFLEPGVRSTLNLGVRAVAQMAHHCMIYNNIKFRLLWSVEG
                     CMSPVDFSCWTQCPNGAFAPTARSTFLRVCFHLRICKVMLTKKKKDKNQPSINAFFTS
                     RSKNDRFSALKRFKSDLGPPKSSQHSSQEASTEDVIDLSEPQVRPSSFLSQEKRQAFD
                     EVPSNILPNLSQKTANNFKKIRIQKQENSVLDKQYGAPLKAASDQRKLPWEVPQFSWS
                     RKKDASSGIKNPRMASKAIPTIASKISLTKEQEKVLSLVVDDGLNIFYTGSAGTGKSV
                     VLRELVQRLNNLYGPDKVGVTASTGLAAVNIGGQTINRWAGIGIGKQTPVALAGLIKK
                     NGNTYARWRNVKVLIMDEVSMIDGVLFSKLNEVAQIVRKNQLPFGGIQVVLTGDFFQL
                     PPVPDKDTKMTYCFQSECWDSVINKTILLKQVFRQTDMDLIDMLNALREGHVYPEIIQ
                     QFSKLGKEVVYTDGIEPTELYATRNEVEAANKSRLAKLEGPLVTYTAKDVSDRPDTPP
                     YIMKLLNDVMAPSGLQLKEGCQVMMLKNKDEELVNGTLGKVQCFMTSDMWHYIQTQLT
                     TVDLLQEDVIKELNLVSKFMNNPQPDESLFRQLDTVSPHRKQIMDELITIARTRSDEV
                     LPLVQFAIGSRRARFELIQREEFPIDVKNNNVRITRIQLPLLLSWALSIHKSQGQTLD
                     RVKVDLRRTFADGQVYVALSRAVSKERLQIVGFHPSKIRASAVVKGFYEKLESV"
     gene            complement(<432543..>433868)
                     /locus_tag="PAS_chr2-1_0229"
                     /db_xref="GeneID:8198778"
     mRNA            complement(<432543..>433868)
                     /locus_tag="PAS_chr2-1_0229"
                     /product="Protein binding phosphatidylinositol
                     3-phosphate, involved in telomere-proximal repression of
                     gene e"
                     /transcript_id="XM_002491074.1"
                     /db_xref="GeneID:8198778"
     CDS             complement(432543..433868)
                     /locus_tag="PAS_chr2-1_0229"
                     /codon_start=1
                     /product="Protein binding phosphatidylinositol
                     3-phosphate, involved in telomere-proximal repression of
                     gene e"
                     /protein_id="XP_002491119.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0229"
                     /db_xref="EnsemblGenomes-Tr:CAY68839"
                     /db_xref="GeneID:8198778"
                     /db_xref="GOA:C4R015"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:C4R015"
                     /translation="MSSNLKIDSSIRVIDEQSADFDQDSPVLSFKKQPIKTRTASCST
                     ISNLTPDFNSYHLTLKGSFRDSSEVSSTQDKTQPAQTDNNPDDLDYDAKIRAPKMSSQ
                     SLFKSNPIKIAQHEPFQCCDISQNSKDQATKPGSVETSQTDNKEFSRNTSNLSNDSLT
                     SAETKVAEEVTDKTNSTFTPATFDINQPLRRHSIDEISSDLSNTLPGFSTNASYSRLD
                     NLQNAQNGNNPMSFSNRGSRNGISGPIRQINEPKTPNYVPAVLRPSSSHSLVVGNTPQ
                     FQLGSSSPLPDEEDDNSSYDDDKLYHYSSSENHANAARFPYTMVPIKSHWLQNNKRSS
                     CMDCQVKFSLLFRRHHCRHCGDIFCSNCLTQRASLNLMAKFDLVHGMKSKVCNGCAKS
                     WNQYLVKQYNNNVGSSVSKLQVKQTVPDEDPQRERMGSIVPSDWTWSSF"
     gene            <435007..>435960
                     /locus_tag="PAS_chr2-1_0230"
                     /db_xref="GeneID:8198779"
     mRNA            <435007..>435960
                     /locus_tag="PAS_chr2-1_0230"
                     /product="Mitochondrial ribosomal protein of the small
                     subunit"
                     /transcript_id="XM_002491075.1"
                     /db_xref="GeneID:8198779"
     CDS             435007..435960
                     /locus_tag="PAS_chr2-1_0230"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the small
                     subunit"
                     /protein_id="XP_002491120.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0230"
                     /db_xref="EnsemblGenomes-Tr:CAY68840"
                     /db_xref="GeneID:8198779"
                     /db_xref="GOA:C4R016"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:C4R016"
                     /translation="MLRASCKVFTRRQSTSLLPQFKIKDLEFLRDKGITGLYSSKGLN
                     NVWYDKADYCRENLNQLLQQSVNKNALLSCFLNKSLDKGSIHLSDTSDSIDRLNQLIS
                     TAAQSCEGSESFTVDHEIYNLSTQLYNHHFAMSSLNSGGNESNRVYKPDASELLKTHP
                     NTDVSISLSHDAQLLKQIKSSFGSLEQLKTLLINSSLAIKGNGFTWLIALFSKSDSKL
                     FLDDLYVVNSYNNGTPSDRLKNGQLDDFRAFIKEGNSNSEFVKDYHQNDSFDFVPLLA
                     INASPYAYLSDYGVFGKRVYLENVWNCINWPTVASRWPKEA"
     gene            complement(<436024..>437696)
                     /locus_tag="PAS_chr2-1_0231"
                     /db_xref="GeneID:8198780"
     mRNA            complement(join(<436024..437113,437437..>437696))
                     /locus_tag="PAS_chr2-1_0231"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491076.1"
                     /db_xref="GeneID:8198780"
     CDS             complement(join(436024..437113,437437..437696))
                     /locus_tag="PAS_chr2-1_0231"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491121.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0231"
                     /db_xref="EnsemblGenomes-Tr:CAY68841"
                     /db_xref="GeneID:8198780"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="UniProtKB/TrEMBL:C4R017"
                     /translation="MTSLYTHQNSSRASSGSARRVSSYNPFRLNGNNQSSSSVGESND
                     PTFKAWRDNVAQLEDLSDEATETVFVDMGLERPQLTSTNSSNQMNKYSNNPFAEDLLQ
                     SNSGGSANTPIRQQAPPINRDSKPPKESPELPPSYEEVAGSSPTKEYPPEKPLGSQEE
                     RRSTRSHNYRSHSHPRREDDAKQHSQHRSGRREREKEKERQRYIERDRQRSTKGRSKK
                     DKDPLKPSKNLDTIDKLDVTGFFGGGGFHHDGPFDACTPHRNTNKKAPPVMAFPVDGP
                     NSTIKGMGPLHSKEEQMDIVFGISEQDPLYAGSKNASRARGMSSNQRLSQPMYQNGNS
                     TSTSLPSVIKHDPSVVQFDTNVKAEPVHGQTTLGLGSSTFLDGAPASKDAELQDHAAK
                     SNELSRKKSLLRRMKAASPPTARRTSEDNNIYHKEGEERNGANGLLKRVRSLKVSRK"
     gene            <438097..>440043
                     /locus_tag="PAS_chr2-1_0232"
                     /db_xref="GeneID:8198781"
     mRNA            <438097..>440043
                     /locus_tag="PAS_chr2-1_0232"
                     /product="Cleavage and polyadenylation factor I (CF I)
                     component involved in cleavage and polyadenylation of m"
                     /transcript_id="XM_002491077.1"
                     /db_xref="GeneID:8198781"
     CDS             438097..440043
                     /locus_tag="PAS_chr2-1_0232"
                     /codon_start=1
                     /product="Cleavage and polyadenylation factor I (CF I)
                     component involved in cleavage and polyadenylation of m"
                     /protein_id="XP_002491122.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0232"
                     /db_xref="EnsemblGenomes-Tr:CAY68842"
                     /db_xref="GeneID:8198781"
                     /db_xref="GOA:C4R018"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C4R018"
                     /translation="MADNTKKRRLSNDVIGQLQDDLKQSPLNVNTWDTLIDKVIAKDK
                     HEQVIQVFEDCLVYFSYLGYFWNRYATYLLERLEFDKTKEIFNRCLPKVANVELWRSY
                     IRYVRRTNSIITGGEEARRLIIKSFEISLENIGMDYNSDVLYDDYIEFLNEWQPINPN
                     ERNHRNDLLRGLYRSLIKSPVKDLERYWTDYTNFENEANPNKQISRKLVNEISGEYMN
                     TRIKLSDLVNKIKGIPKADRYLMNNEFDFSKVGSLSLVIAWSEWERTNPFNLEKNVVK
                     KRVNLSFQKSLQLYPFIPKLWYNYFTYLMDQQQDPSTEATNGESNQAQQAQELIVTVK
                     QAISLNPTSFILSTLLSDLLQSDGKDVDTIKKVYLDLIEALQKYYNTDQVEDSIVNRS
                     ITEAYILLMNMLKSSKDGRSEIRKVFSQARKFENLTYHCYVQNAYLEYYTFNDVKVAK
                     KIFDLAFKKFNDNISFLNYYLNFVISIKDFSQAKVVYETFIKSNQDSLDREKLFKVYQ
                     SFMQFESQFGDPISLRNLEKRLSNQFGLDSLYLAMINRLSPFCSPSNLLELEPPFNSV
                     KQIDEKQGSLDSILSTPVSASTSIEDPTNRPKNGPKKQKIDDNLVIKDDIYNLLRILP
                     KKTFFKDVPILNEKLVEVLTSLNL"
     gene            complement(<440217..>441098)
                     /locus_tag="PAS_chr2-1_0233"
                     /db_xref="GeneID:8198782"
     mRNA            complement(<440217..>441098)
                     /locus_tag="PAS_chr2-1_0233"
                     /product="Cytoplasmic RNA-binding protein, contains an RNA
                     recognition motif (RRM)"
                     /transcript_id="XM_002491078.1"
                     /db_xref="GeneID:8198782"
     CDS             complement(440217..441098)
                     /locus_tag="PAS_chr2-1_0233"
                     /codon_start=1
                     /product="Cytoplasmic RNA-binding protein, contains an RNA
                     recognition motif (RRM)"
                     /protein_id="XP_002491123.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0233"
                     /db_xref="EnsemblGenomes-Tr:CAY68843"
                     /db_xref="GeneID:8198782"
                     /db_xref="GOA:C4R019"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R019"
                     /translation="MTEEASAAEPLPESVDKNETLIEDKAGEAVNPPLPPTPESNDVA
                     VAEDLENTVENSLQELNIDNSSATLKEDSATSEEGTANEAPAPEEKEEPVVVTPEENE
                     ISPKPEPTPKLKLGEFQPANQADIDKRSVFVGNVHSSADPEELVQIMTKAGVVNRVTI
                     LLDHYTGHPKGYAYVEFEEEASVPKAIELFHQYVFKEKELNVVPKRTNVPGLAKRHPR
                     GAHRGSHEGYKGSETGRGRGRGRGRGRGRARGRGSGRGRGGRLDSNDTDGQGLWDSGR
                     SNASSETKTEAQLESND"
     gene            <441282..>441959
                     /locus_tag="PAS_chr2-1_0234"
                     /db_xref="GeneID:8198783"
     mRNA            <441282..>441959
                     /locus_tag="PAS_chr2-1_0234"
                     /product="Constituent of 66S pre-ribosomal particles,
                     involved in 60S ribosomal subunit biogenesis"
                     /transcript_id="XM_002491079.1"
                     /db_xref="GeneID:8198783"
     CDS             441282..441959
                     /locus_tag="PAS_chr2-1_0234"
                     /codon_start=1
                     /product="Constituent of 66S pre-ribosomal particles,
                     involved in 60S ribosomal subunit biogenesis"
                     /protein_id="XP_002491124.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0234"
                     /db_xref="EnsemblGenomes-Tr:CAY68844"
                     /db_xref="GeneID:8198783"
                     /db_xref="InterPro:IPR019002"
                     /db_xref="UniProtKB/TrEMBL:C4R020"
                     /translation="MVSVRRRKSNHSGTSKVSVRVKDKQRRHIATNKVLRAHWDSKLT
                     LSQNYAKLGLRLKLGKPTGGVEKPLAIDKGLDGKKHDKSQREDENIDDFYNSEGEIDP
                     AKIPEGRAHIVRDESGEVVKIVYGTKVSGMFEQGPSEKEEPAQESVVINELMEKAQSR
                     PEKPPKRLTELEEIWVDGLQKKYGNDYERMKWDRKLNPMMLTPRKLEKLFERKLQVED
                     YDRRHTA"
     gene            <442707..>444437
                     /locus_tag="PAS_chr2-1_0235"
                     /db_xref="GeneID:8198784"
     mRNA            <442707..>444437
                     /locus_tag="PAS_chr2-1_0235"
                     /product="Na+/Pi cotransporter, active in early growth
                     phase"
                     /transcript_id="XM_002491080.1"
                     /db_xref="GeneID:8198784"
     CDS             442707..444437
                     /locus_tag="PAS_chr2-1_0235"
                     /codon_start=1
                     /product="Na+/Pi cotransporter, active in early growth
                     phase"
                     /protein_id="XP_002491125.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0235"
                     /db_xref="EnsemblGenomes-Tr:CAY68845"
                     /db_xref="GeneID:8198784"
                     /db_xref="GOA:C4R021"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:C4R021"
                     /translation="MSLVALHQFDYIFAIAMMFAFLDAFNIGANDVANSFSSSVSSRC
                     LKYWQAMILAAIMEFLGAVLAGARVTDTIRKRIINVHAFDDDPAMLMLTMATALVGSS
                     VWLSIATYVRAPVSTTHSIVGGVIGAGIAAKGAGEIHWGWSGFAKIVASWFIAPCVAG
                     GFASVLFLFCKFSILERKHDARNALLFAPCIVFLTFAVLTMLIVWKGAPNLNLDDLST
                     GATVGSIFGVAGVATIIYITFFFPFLKRRIIDEDWTLKWYQVFYGVKYWFMSKDSIPP
                     KPDNYDFFIDYYEGRRYEGGEQDSAIVADAKEEATIGELKLSDNSTSNSNADENRLVH
                     ESKLEPKEDTKTKWSKLVKSPKQWPYLAWLIISHGWTQDVIASQKNGGRLAGDLQGMH
                     GRAKYYSNKVEHIFSLFQAFTACTMSFAHGSNDISNAAGPLSTVWVVYTTNDVVAEPP
                     IWILCYTAAALVLGVWIFGYRLMANLGNKLTLQSPSRGFAIELGAAITTVFATQLEIP
                     ISTTQCAVGATVFVGLCNRDVRAVNWRMVAWCYLGWVFTLPCAGLISGIIMGIIINAP
                     QWGGQYELTP"
     gene            <444624..>445025
                     /locus_tag="PAS_chr2-1_0236"
                     /db_xref="GeneID:8198785"
     mRNA            <444624..>445025
                     /locus_tag="PAS_chr2-1_0236"
                     /product="Sulfiredoxin, contributes to oxidative stress
                     resistance by reducing cysteine-sulfinic acid groups i"
                     /transcript_id="XM_002491081.1"
                     /db_xref="GeneID:8198785"
     CDS             444624..445025
                     /locus_tag="PAS_chr2-1_0236"
                     /codon_start=1
                     /product="Sulfiredoxin, contributes to oxidative stress
                     resistance by reducing cysteine-sulfinic acid groups i"
                     /protein_id="XP_002491126.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0236"
                     /db_xref="EnsemblGenomes-Tr:CAY68846"
                     /db_xref="GeneID:8198785"
                     /db_xref="GOA:C4R022"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR016692"
                     /db_xref="UniProtKB/TrEMBL:C4R022"
                     /translation="MSLQTNNLSNIQYLPLSSIKRPITPVLDYAKIDAMESTLRGVPM
                     ASSTCPNISEITAGELPPIDVLCVRHEGKTHYFAFGGCHRFQAYDRMQQKEGDETNEK
                     SPVLVRCKVLPATVKQLKLYLGASVESVLNE"
     gene            complement(<445015..>445986)
                     /locus_tag="PAS_chr2-1_0237"
                     /db_xref="GeneID:8198786"
     mRNA            complement(<445015..>445986)
                     /locus_tag="PAS_chr2-1_0237"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491082.1"
                     /db_xref="GeneID:8198786"
     CDS             complement(445015..445986)
                     /locus_tag="PAS_chr2-1_0237"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491127.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0237"
                     /db_xref="EnsemblGenomes-Tr:CAY68847"
                     /db_xref="GeneID:8198786"
                     /db_xref="GOA:C4R023"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R023"
                     /translation="MKEKYVGNVNISRILSQPAKSSSKQSTTKPLYKGPTKQSKSASK
                     KSIASPKSLTNDLNLKYNPKHSLSQKIIKPDQRVQSYTANLFSNARFKLDWSIYEFKN
                     LPHNRQAEEFDAEQDVEEASKPQKKITPIYDPRDYKDLPEVLFLGRCNVGKSSLINSL
                     IDKPLARVKRFAGLTPCLNTYNIGNVVRLVDSPGYGVKGKQWQGELTMQYIRERQQLR
                     KIYLILNAHLGINEFDEMILSQLVESKISFDLVFNKVDKISPAQRRTHCDQIVEQLLK
                     TSQISKLMRPTLHFVSCNDDNTRTLSGISDLQLNIVLSSGISGRFTR"
     gene            <446662..>447666
                     /locus_tag="PAS_chr2-1_0238"
                     /db_xref="GeneID:8198787"
     mRNA            <446662..>447666
                     /locus_tag="PAS_chr2-1_0238"
                     /product="Mitochondrial malate dehydrogenase, catalyzes
                     interconversion of malate and oxaloacetate"
                     /transcript_id="XM_002491083.1"
                     /db_xref="GeneID:8198787"
     CDS             446662..447666
                     /locus_tag="PAS_chr2-1_0238"
                     /codon_start=1
                     /product="Mitochondrial malate dehydrogenase, catalyzes
                     interconversion of malate and oxaloacetate"
                     /protein_id="XP_002491128.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0238"
                     /db_xref="EnsemblGenomes-Tr:CAY68848"
                     /db_xref="GeneID:8198787"
                     /db_xref="GOA:C4R024"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:C4R024"
                     /translation="MLSTIAKRQFSSSASTAYKVAVLGAAGGIGQPLSLLMKLNHKVT
                     DLALYDIRLAPGVAADVSHIPTNSTVTGYTPEDNGLEKTLTGADLVIIPAGVPRKPGM
                     TRDDLFNTNASIVRDLAKAVGDYSPSAAVAIISNPVNSTVPIVAEVLKSKGVYNPKKL
                     FGVTTLDVLRASRFLSQVQGTNPASEPVTVVGGHSGVTIVPLLSQSKHKDLPKDTYDA
                     LVHRIQFGGDEVVKAKDGAGSATLSMAQAGARFASSVLNGLAGENDVVEPSFVDSPLF
                     KDEGIEFFSSKVTLGPEGVKTIHGLGELSAAEEEMITTAKETLAKNIAKGQEFVKQNP
                     "
     gene            <448275..>449840
                     /locus_tag="PAS_chr2-1_0819"
                     /db_xref="GeneID:8198788"
     mRNA            <448275..>449840
                     /locus_tag="PAS_chr2-1_0819"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491084.1"
                     /db_xref="GeneID:8198788"
     CDS             448275..449840
                     /locus_tag="PAS_chr2-1_0819"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491129.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0819"
                     /db_xref="EnsemblGenomes-Tr:CAY68849"
                     /db_xref="GeneID:8198788"
                     /db_xref="GOA:C4R025"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R025"
                     /translation="MTSPPHNPLAKINQWKDSAWSHMSTKLHVNSSSPINDEILDFDD
                     QVTQSPHDTHIDPDNSLCFKDTTTELDVTLDDFDMSVDTSDIVAHALPMESDFDPAGG
                     GDDDGGGGGVAGDEYTSNNEPLHNQDHDHVHPHDHLHHHDHAHHDHHSDNLHSHNVHP
                     FQISQSNSSSTISSFDSSAPTYSDTLPTNSLPSSMSPSNTRTPARRRSVSATPQTASH
                     GFHQQPLVMPQYQTPIKKTDSLTPRRLKSRSLSRLSLDHLRSPAGNPFYTPPAFLSPK
                     LESPYSSRDTPQQEVVMISPSQLSLSLNRKSRSFTAPAGIPKKLRTAPSFSFADLPPQ
                     PLPQSHSMYHVQGGSHNSVPKSAPAAFNSMQRSRSSTNLSAIALSKESSLSRRNVTAL
                     ETPFQVRQTSQQLQKASTVPNMHSEVNMTVPEHREVFHEEIEDTDKVKEIEEEKKKKK
                     FSCPVCHARFQRPEHVKRHMRSHSSEKPFVCPEEGCGTRFNRKDNLKAHLKKIHSLHK
                     NQVNQKVDGKEYE"
     gene            complement(<449957..>450454)
                     /locus_tag="PAS_chr2-1_0239"
                     /db_xref="GeneID:8198095"
     mRNA            complement(<449957..>450454)
                     /locus_tag="PAS_chr2-1_0239"
                     /product="Integral membrane protein localized to late
                     Golgi vesicles along with the v-SNARE Tlg2p"
                     /transcript_id="XM_002491085.1"
                     /db_xref="GeneID:8198095"
     CDS             complement(449957..450454)
                     /locus_tag="PAS_chr2-1_0239"
                     /codon_start=1
                     /product="Integral membrane protein localized to late
                     Golgi vesicles along with the v-SNARE Tlg2p"
                     /protein_id="XP_002491130.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0239"
                     /db_xref="EnsemblGenomes-Tr:CAY68850"
                     /db_xref="GeneID:8198095"
                     /db_xref="GOA:C4R026"
                     /db_xref="InterPro:IPR019365"
                     /db_xref="UniProtKB/TrEMBL:C4R026"
                     /translation="MAFTDYLNFKGLGEDFKSRNFSIYGQWIAIINIFFCLALGIANI
                     FHFSLVILFSIISIVQGLVVVFVEVPFLLKICPMSANFIEFINRFKQNWPRAGFYAGM
                     ALVQWLSIIVQATSLIVVASLFTLSAACYGYAALAHQEFRNSNVVGDFDVEALPAEAV
                     VRNIL"
     gene            <450719..>452740
                     /locus_tag="PAS_chr2-1_0240"
                     /db_xref="GeneID:8198789"
     mRNA            <450719..>452740
                     /locus_tag="PAS_chr2-1_0240"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491086.1"
                     /db_xref="GeneID:8198789"
     CDS             450719..452740
                     /locus_tag="PAS_chr2-1_0240"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491131.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0240"
                     /db_xref="EnsemblGenomes-Tr:CAY68851"
                     /db_xref="GeneID:8198789"
                     /db_xref="GOA:C4R027"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017921"
                     /db_xref="UniProtKB/TrEMBL:C4R027"
                     /translation="MSRGNDSDSDDSLTNSLEKVGRFTLPTLSLSLDTAGYQSYISER
                     RNKVNHLINDLTRGFSMQRALERFQPVTDILNENINLVLDAEHDDHENEEESIVDPPG
                     VTKAKERQQPVIEDLVLPQDFNRNRSTSTTLRTPVRSRSNTQQDTFKKLYDEIKIING
                     ASLNDDAFLRKKIKLILGLPTITDKQKSLLVQKLMSKSYFEQQQKRLNRENANMNNSD
                     TEDSYDDSDSDEGEDEVILTVNDKKPSYHDESAQIFGCTHYQTNCKLECSVCNRWFPC
                     KFCHDEVVKDHQLMRNETKHVLCMFCGTPQAPSQYCIEETCGNMLACYYCDKCKLFDN
                     NAEKDIYHCDDCGICRLGLGLNQDYFHCRGCNACISIDLKNQHKCIENSTHSNCSICG
                     EYMFSSTKPVVFMSCGHAIHQNCYDEYTRHNYKCPVCQRSIVNMDAQFRVLDTEISER
                     PLPLPFGNWECIIKCNDCGAKSKTKYHILGLKCDNCKSYNTSQLRLIKPELKSQYDDY
                     ESSKSPKVDLRSSFVHNSLNTNFQYDQVDTSEYVADVEDADYDGDQTETIGSHFAATL
                     NRFTNSSLSDTAQRFINDRLNLLTRKQSNSSADESMDEDYVDSFIRIRNNFDRYTSIG
                     DAFRDWLESAKESFSVNGTDFEYPNTSAYESEPDTMIGANNSDDNFGGF"
     gene            complement(<452768..>454573)
                     /locus_tag="PAS_chr2-1_0241"
                     /db_xref="GeneID:8198790"
     mRNA            complement(<452768..>454573)
                     /locus_tag="PAS_chr2-1_0241"
                     /product="Component of a complex containing the Tor2p
                     kinase and other proteins, which may have a role in regu"
                     /transcript_id="XM_002491087.1"
                     /db_xref="GeneID:8198790"
     CDS             complement(452768..454573)
                     /locus_tag="PAS_chr2-1_0241"
                     /codon_start=1
                     /product="Component of a complex containing the Tor2p
                     kinase and other proteins, which may have a role in regu"
                     /protein_id="XP_002491132.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0241"
                     /db_xref="EnsemblGenomes-Tr:CAY68852"
                     /db_xref="GeneID:8198790"
                     /db_xref="GOA:C4R028"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C4R028"
                     /translation="MEPKERLRNAVKEGNEFLVTRILKKFPDLLDNIDPANGWSNLHY
                     ASYHGNYLIATKLLKGKEKYHEYEYSYDSEEVLVTFKNETCLHLAAMNNHEQTLHLLL
                     QHLPNCIDNRDIDDQTPLHIAAAKGNTSCLQLLLDLHASINVQDKNGNCPLHLASIFG
                     HLSCIQSLSFYNADMGLKNADGYTPLDVCFSFEIQKQLEHLKENAPTLPPFPSKISEE
                     SLASPSLSNFIIQRPSATKPESPQSKSTLPHLPSVTTARKFSSSSQTTLNSSATSTET
                     KSARGERPVSRLEKQISVPSFHNGDDFKRTQSFTSLYKVGSGSYSDLGETQSKMLPII
                     KPINEKKQATPYLLINTGSANSLSNSSSTIQAGPRARRTVESPMTPKEKISNLMPIIK
                     NTVNESNNNHNQISVEKLSPTSKSRRVRSNSNLSNLSLKTSHSSLRKLRSQSISNAFH
                     KLTHTEPRHRRTPSMNSPSEHDNAKATFLFNPNISTHSFESISEGYNSDEEEEEEFTQ
                     VPADKDLVTLDNYYEDATHPETELNVPEQVEARRKLNLKIDTLYKHKNHSLEQMDERM
                     LVSPTTTNSFSQSLRPSRVLSIPIANLSKKRRDQG"
     gene            complement(<454732..>456021)
                     /locus_tag="PAS_chr2-1_0242"
                     /db_xref="GeneID:8198791"
     mRNA            complement(<454732..>456021)
                     /locus_tag="PAS_chr2-1_0242"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491088.1"
                     /db_xref="GeneID:8198791"
     CDS             complement(454732..456021)
                     /locus_tag="PAS_chr2-1_0242"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491133.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0242"
                     /db_xref="EnsemblGenomes-Tr:CAY68853"
                     /db_xref="GeneID:8198791"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R029"
                     /translation="MSQAVRAGSRLKPLYPMVTELSYKESFKQWFERKSLADYEARVL
                     SYLPFFPDSDGVREAKTLDVPVDAKGNKIHELYIENKQKAPEERHLVIVHGFGAALGF
                     FYRNFNGLSLIPGVKIHALDLLGYGLSSRPKFPSLDVTKEEDIHKAEDFFVDSMEAWR
                     KERNIDRFVLVGHSLGGYLSSCYSLKYKDAVEKLILVSPVGIERSEMSLTEINRPPAV
                     QAQDIARKSSPNIEEELLQSQEQSQQHHQNVSDSASIASTESRNNDERMQQARTRPQL
                     RKFLVKMWENHCSVFSIVRAAAPFGPKLVSLWTFSRFGAIEDPQELMDIHRYSYNTFV
                     AKGSGEYSLTVLLAPGAWARLPLLDRLPGNITIPTLWLYGENDWMSKKAGRQCVSEIN
                     SQGEKSAKFRIIDGAGHHVYLDNPTDFNQSVRKFVGW"
     gene            <456146..>457477
                     /locus_tag="PAS_chr2-1_0243"
                     /db_xref="GeneID:8198792"
     mRNA            <456146..>457477
                     /locus_tag="PAS_chr2-1_0243"
                     /product="UBX (ubiquitin regulatory X) domain-containing
                     protein that interacts with Cdc48p"
                     /transcript_id="XM_002491089.1"
                     /db_xref="GeneID:8198792"
     CDS             456146..457477
                     /locus_tag="PAS_chr2-1_0243"
                     /codon_start=1
                     /product="UBX (ubiquitin regulatory X) domain-containing
                     protein that interacts with Cdc48p"
                     /protein_id="XP_002491134.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0243"
                     /db_xref="EnsemblGenomes-Tr:CAY68854"
                     /db_xref="GeneID:8198792"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR021569"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4R030"
                     /translation="MSLNVTYQLRSFRVKTTPGTILNEVLTNACDHFDLDASSYQLYH
                     GTRLLDLSLPVRLTGLAQGAKLELKVGKAVGNVTLRFSIVGRTLNVDPKSLVLTVKSS
                     NTIRSVLVLLGKNIGLDLSSENFTIQSFSLRISPGPDFDKPLSSLGLSSGNSVMRLVF
                     EAQGPTTKSEKKVSSPSSSALPTSAPATETHQDIKDTPNHDSTVVKDTAAGEKSTKAH
                     IFQAQAFKPSSNRIHSSQDDDEVYELSVDQALKYQAILSKQAHASPMMRRLAEEKKKN
                     AKKIDNCHIRIRFPDHSNLELTIDASITLKQLCSILTTDFLSLNEEEKNAQNAFNLYI
                     PHPHQILNTTANMNKRLDSDLKFGPRILLLYESANKVSKISYLKPEYLKDAKSIEDAP
                     DVLRDREIEMGVDSTPVSQSPVSAVDQSSFESPTNSSLKKKVPKWLKLGKK"
     gene            <457588..>459966
                     /locus_tag="PAS_chr2-1_0820"
                     /db_xref="GeneID:8198793"
     mRNA            <457588..>459966
                     /locus_tag="PAS_chr2-1_0820"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491090.1"
                     /db_xref="GeneID:8198793"
     CDS             457588..459966
                     /locus_tag="PAS_chr2-1_0820"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491135.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0820"
                     /db_xref="EnsemblGenomes-Tr:CAY68855"
                     /db_xref="GeneID:8198793"
                     /db_xref="UniProtKB/TrEMBL:C4R031"
                     /translation="MNSVCRIRSFIPARSIRTRAVRNPLKNSKATERPPVLKTKPENL
                     KQLRSKRRNALKKDPSIPSFVKPAEQIRRELTAEFDRLGQEVDENFIKGVIEQSKEDE
                     IKLRESNGDLSILDEKDDFLSLFDRVMDQCALELSENVDLQQDAYQLDPNATLEDSVF
                     KLAEDFETIVKASQSSLPLFVSILKILSINSKRNLIPIELASKAFELSTQIYDPKHRT
                     NLIYYSGNLIYSHPRVRADPINESLYMEALLEHRQFLRCEYLFTSRLNQTDVQGQRFW
                     LENGMKMYLRSFKVSKAEELAAKVLQEHMYLHPSVIVQFIDVFSRLEQYGQVLKWTNT
                     LNTIRKSFGKGAGVVKTVNPLDLGLVDDANIIMNYWNQRDPITHNDLRKVAVSLINAG
                     YYELLFRVIETYASRYPTTLKLFKGVVGKCKYSVAQELIELTTKLSEPFIRDSLSKAL
                     EKNLEFQKRNAKQAMIHDTLLGNINIEGLRDGTSNNQEYLTEKDCNRLIKRMLSSNRP
                     NYQLVENFIEEMINSYKLEKAGKSHGFIPPINAHIYATLIKYFGKVTNRNIEKLELVL
                     QELESLEVPMNAYCANQIILEYTGRRRFERAFAFIDQVLNSDFPRTNKLYETMLQSHR
                     DFVTFSHKYGLNKRPNHNQLRRIFVDFYNSDKGVSFTKQVVSIINCFIYTSDFISSVG
                     MLQLFGSLKMKLNARQVDLLLKTLIKNLELCPHSDDLDTYVEKLKQFTTSNTKDLEWK
                     DVATIIIEAFQLNPLLTEKSQAAYEKELGTFQHLLSLESLSIDEIRVDGFCI"
     gene            <460074..>462425
                     /locus_tag="PAS_chr2-1_0244"
                     /db_xref="GeneID:8198096"
     mRNA            <460074..>462425
                     /locus_tag="PAS_chr2-1_0244"
                     /product="Mitochondrial translation initiation factor 2"
                     /transcript_id="XM_002491091.1"
                     /db_xref="GeneID:8198096"
     CDS             460074..462425
                     /locus_tag="PAS_chr2-1_0244"
                     /codon_start=1
                     /product="Mitochondrial translation initiation factor 2"
                     /protein_id="XP_002491136.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0244"
                     /db_xref="EnsemblGenomes-Tr:CAY68856"
                     /db_xref="GeneID:8198096"
                     /db_xref="GOA:C4R032"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR015760"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R032"
                     /translation="MYSIKTVRSVIGTTGWLKRPCFGCNSASIRTAADLAMLNKLRSK
                     KRINRNPLPTTVDPQKGQPETGNKGVPPHTQSKIASEHKVVRNGVKKVEDKFQKKPHS
                     KSQGNSRSRKISKEEEKALKEISTEFETHRTEASKSASKKKRSPNKPKTAVERPKIPL
                     TLPSFLTVSNLSTILRVRNEDLLTKLKELGFENMTYNYILDSETAALIADEYGFEATT
                     NDNTSVDLFEQPECTEQKLLVPRAPVVTIMGHVDHGKTTILDYLRKSSIVNGEFGGIT
                     QHIGAFSVKTPKTKKMITFLDTPGHAAFLKMRQRGADVTDIVVLVVAADDSVMPQTKE
                     AIKHAKNSGVPIIVAINKCDKPDANPDKVVADLAGHDIDVEDYGGETQVVRVSGKTGL
                     GMEDLEESIITLSEVLDLKAQESKTLCEGWVIESEMKKGLGNTATFLVRRGVLERGKI
                     IVAGNTWCKVKIMKDEHGKVLKKAGPSTPVEVIGWKDLPEAGQLGLEAKDEALAKKVI
                     LNRMAREEKFKEAQDIEKINEMRQSELREANKRQKIEELAKNGLSLEDIRKLDSEEYK
                     DLLDETKQECEIVPFIIRADVSGSSEAIAESIDGLGNDEVKSKVLYQEVGPPTETDIE
                     RAETSGAIIFAFNLKTPKDIILKAERRGVHIKSHNVIYHLIEEVTHELQSRLKPDIKV
                     EVLASAKVRAVFSITGKNKKEFKIAGCKVSQGIIKRNSQIQVTRNGQMIYRGHIDALK
                     HERDDVAEVKKGMDCGVSLGRWQNFEEGDDIEVYEEKEVPRYL"
     gene            complement(<462568..>463860)
                     /locus_tag="PAS_chr2-1_0245"
                     /db_xref="GeneID:8198794"
     mRNA            complement(join(<462568..463782,463843..>463860))
                     /locus_tag="PAS_chr2-1_0245"
                     /product="Essential protein, constituent of 66S
                     pre-ribosomal particles"
                     /transcript_id="XM_002491092.1"
                     /db_xref="GeneID:8198794"
     CDS             complement(join(462568..463782,463843..463860))
                     /locus_tag="PAS_chr2-1_0245"
                     /codon_start=1
                     /product="Essential protein, constituent of 66S
                     pre-ribosomal particles"
                     /protein_id="XP_002491137.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0245"
                     /db_xref="EnsemblGenomes-Tr:CAY68857"
                     /db_xref="GeneID:8198794"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="InterPro:IPR029188"
                     /db_xref="InterPro:IPR029190"
                     /db_xref="UniProtKB/TrEMBL:C4R033"
                     /translation="MSNSLEERLKSHASSFDGLLSLIPAKYYYEDSNKSNEIREQGKQ
                     KKKPISEVRQDKKKKLDPAFHSENVETATVKDVMRNREKAGKGAVIPGNKKIQVDAQD
                     TSETDEKDNDNNHNILDAELEKDREVPAPLKTQEPATIFDDEGNEIKSKEMSSEEIAQ
                     QKAMKEKRLSELRNKLTAKINNMREKRKAPGTNAKGAPMSREQILAERKRKDELKKKR
                     QQQQKEKEKEKEKEEDSDSDDDDEEKIDADVMFNNIKFTDGEKVSSDLSSLRKVKKKG
                     PSHGDFKAHLQLLERQKEKFSKLDKEQQAQIQEKARWNKALAGIEGKKIKDDEKLLKK
                     SLKRKEVKKRKSEKEWKDRKETIEITQKARQDKREENLRLRKENKGKKRKDQTRLKKF
                     SGIVKPTRAGFEGKHKRK"
     gene            <464078..>465238
                     /locus_tag="PAS_chr2-1_0246"
                     /db_xref="GeneID:8198795"
     mRNA            <464078..>465238
                     /locus_tag="PAS_chr2-1_0246"
                     /product="Subunit C of the eight-subunit V1 peripheral
                     membrane domain of vacuolar H+-ATPase (V-ATPase)"
                     /transcript_id="XM_002491093.1"
                     /db_xref="GeneID:8198795"
     CDS             464078..465238
                     /locus_tag="PAS_chr2-1_0246"
                     /codon_start=1
                     /product="Subunit C of the eight-subunit V1 peripheral
                     membrane domain of vacuolar H+-ATPase (V-ATPase)"
                     /protein_id="XP_002491138.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0246"
                     /db_xref="EnsemblGenomes-Tr:CAY68858"
                     /db_xref="GeneID:8198795"
                     /db_xref="GOA:C4R034"
                     /db_xref="InterPro:IPR004907"
                     /db_xref="UniProtKB/TrEMBL:C4R034"
                     /translation="MAEPLGSYLLISLPKTQNLLHDETQDWLETNVNGGKVSVTNVDV
                     PEFKIGTLDTLMQQTEEISKLDNQLNQAVNKVLEIIQTVFDKNPAFVEQAKQVEGRSV
                     IDYLENFKWNTSKYRTDRSIRQLIDTISLDGLNLDNDVKATFQNYNSAKSNLAAAERK
                     RTGDLTVKSLHDIVDETDFVLDSDHLQTILLVIPKNLVQSFLNTYETVVPFVVPRSAK
                     RITADSEFVLYSVILFKKYVPEFLAAARENKWITREFNYDEESIKLLRNEYNDASTQE
                     HSLRNDLIRLVKAAYADIVSSWLHIKILRTFIESVLRYGIPPDFSYFLLKLPHKAIEK
                     GKSQLVEKFGYLGGAAVGVDRRGKIVKDSLHEYASLVDTDYQPFVLYELEIN"
     gene            <465428..>467215
                     /locus_tag="PAS_chr2-1_0247"
                     /db_xref="GeneID:8198796"
     mRNA            <465428..>467215
                     /locus_tag="PAS_chr2-1_0247"
                     /product="Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /transcript_id="XM_002491094.1"
                     /db_xref="GeneID:8198796"
     CDS             465428..467215
                     /locus_tag="PAS_chr2-1_0247"
                     /codon_start=1
                     /product="Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /protein_id="XP_002491139.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0247"
                     /db_xref="EnsemblGenomes-Tr:CAY68859"
                     /db_xref="GeneID:8198796"
                     /db_xref="GOA:C4R035"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C4R035"
                     /translation="MSSNVPRTPPLQRRMSNRSSYKSPMESPLKMMKTNSSKRSPIKT
                     SSADYTKVVVRFRPSIFRHGESQEIVDDNLALGKKTDSQLITIEPHQSVYISGTSFSG
                     RFTFDRVFGPETSQTEVFDYSINETVNDFCNGYNGTIFAYGQTGSGKTHTMLGNMDSP
                     SEYGVVPRVADKLFEQIANGSPSSEYTVSIGVLEIYMEQLRDLLNPDNSNNLCIRDSG
                     ALSEGVTVQHLETRYVSSKDELLGAVILANKLRTTGVTDANADSSRSHAIFQIKLAQR
                     SLDDGVVKISTLFLVDLAGSERIARTGATGQTLEEAKKINTSLSALGNVINALTDGQS
                     TYIPYRDSKLTRILQESLGGNARTTLIVNCSPDQVDEGESVSALRFGARAKRIQNKAR
                     VNQEIASTELQKRLVTLESENAALIHRVAELEEQSKLKEIQQEATNTVTVDATKIKRL
                     ESSVSQLAIRLKQNEAITEELTQELDRARAINERRKIKIEQLEKAMQAQHEDMIMETD
                     KFANKLSYLKARITSVKRMNQTQVPYNEDGLQPAVNIYESPTTLEENEEGLESLSINV
                     CRSPVQFSNKAGLHLNIVKPMRGGSAKPA"
     gene            complement(<467254..>468543)
                     /locus_tag="PAS_chr2-1_0248"
                     /db_xref="GeneID:8198797"
     mRNA            complement(<467254..>468543)
                     /locus_tag="PAS_chr2-1_0248"
                     /product="Catalytic subunit of Nem1p-Spo7p phosphatase
                     holoenzyme"
                     /transcript_id="XM_002491095.1"
                     /db_xref="GeneID:8198797"
     CDS             complement(467254..468543)
                     /locus_tag="PAS_chr2-1_0248"
                     /codon_start=1
                     /product="Catalytic subunit of Nem1p-Spo7p phosphatase
                     holoenzyme"
                     /protein_id="XP_002491140.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0248"
                     /db_xref="EnsemblGenomes-Tr:CAY68860"
                     /db_xref="GeneID:8198797"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4R036"
                     /translation="MNAIQFLSSRVHGGSLQEKQPQKETTLDLDVDQTEDSDIVTRVD
                     YPEIPVVKTSVTLWQTLVSIIWFFPNLLVFSPLKFIISIVLFPFRLLSKDATGGAPIE
                     EEFPEDDSIISQSSENIADSSYSLLDTIAESDDIEVEFPQQEIDTMKSPMTSDEATPS
                     PLRAPTTRHTDANTIQSVKKAPRKKTKFVFPILLINNSFNLNKPPELPKKVLVLDLDE
                     TLIHSLSSHNSSVLGKAKGQMVEIKMSNDMIALYYIYKRPYVVEFLKLVKQWFSLVCF
                     TASIQEYADPVIDLLEQDVSFTEKNQSSSKKLFEARYYRNNCVWEKGKGYIKDLSILL
                     SPQEPLLSPPSTPRQGKSRRKSIPAKDSLANYVIIDNSPISYCKHNFNGIMVEGWIND
                     PNDTELMNLLPLLNSLRFTSDVRSILCLKDGEKALNE"
     gene            <469206..>470018
                     /locus_tag="PAS_chr2-1_0249"
                     /db_xref="GeneID:8198798"
     mRNA            <469206..>470018
                     /locus_tag="PAS_chr2-1_0249"
                     /product="Hypothetical protein, peroxisomal
                     2,4-dienoyl-CoA reductase"
                     /transcript_id="XM_002491096.1"
                     /db_xref="GeneID:8198798"
     CDS             469206..470018
                     /locus_tag="PAS_chr2-1_0249"
                     /codon_start=1
                     /product="Hypothetical protein, peroxisomal
                     2,4-dienoyl-CoA reductase"
                     /protein_id="XP_002491141.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0249"
                     /db_xref="EnsemblGenomes-Tr:CAY68861"
                     /db_xref="GeneID:8198798"
                     /db_xref="GOA:C4R037"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R037"
                     /translation="MVNLDVNGKSVVITGGSRGLGLHCAEVYVLNGAKRVVITSRKED
                     QCMKAVQYLKDLSTTANPEVEIDFIAADLSTDEGAKRLKSEYQQRYGDRLNILVANAG
                     ATWGANFEDHSRKAIDKVLGLNVAGVFQTIQLFGEFLEKAGTPKDPSRVLIMSSVAGL
                     TTSFPAGGTYGYLASKAAVSHLGKTLAVELGPRNITVNVLAPGFFPTKMSNGLLDVVG
                     DQMVKNNPRRRLGEKEDIQYLVLYLSSSLSNYVNGAVIPLDGGSHLVGLPKL"
     gene            complement(<470086..>471573)
                     /locus_tag="PAS_chr2-1_0250"
                     /db_xref="GeneID:8198799"
     mRNA            complement(<470086..>471573)
                     /locus_tag="PAS_chr2-1_0250"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491097.1"
                     /db_xref="GeneID:8198799"
     CDS             complement(470086..471573)
                     /locus_tag="PAS_chr2-1_0250"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491142.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0250"
                     /db_xref="EnsemblGenomes-Tr:CAY68862"
                     /db_xref="GeneID:8198799"
                     /db_xref="InterPro:IPR018829"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R038"
                     /translation="MPPPPAIVSTKVFEKEGVKIVLIADLRGKLTLLNELADIHNADL
                     IIHTGNFGFLEQESVDRIHESYLRHIVEFSPLLREETILRISKLSKVTGDNVEHLSNQ
                     DFNLKILLKDEKLSELQDFIRGDYQLKIPVYTIYGMCEDLVVLNKFKHGIYAVPNLHV
                     IDHDTLYKVNVPRLGHSILLTGIGGSLSYHKLFHQGTSFDSNDITSDPNLASIIDTNP
                     NQLLPISGDPGNIWITFMQLGKLINTIIEYSTKNPTDYNKAIKFFITHQSPTREPILE
                     HLSIFFKMDYTISNSLHFKYSSSYNELSINPNFESFKIKFNDSRNKLATIWKNIHTKY
                     ESMLFNLNDPLMIRSLGLALEVFDKIPITTKSSEVIYPLQLNRDNEHSTNDADDSSSS
                     TEDEMLKTKELNSIIRQLNDLYYVSFQNSWHFNLCDLSLGQMILNLDEEGRIQMESKC
                     EGFNFNYRLRDDFNTVRDDEADKRPVGSFRGRGKPRGRGRGRGKP"
     gene            complement(<472242..>472952)
                     /locus_tag="PAS_chr2-1_0251"
                     /db_xref="GeneID:8198800"
     mRNA            complement(<472242..>472952)
                     /locus_tag="PAS_chr2-1_0251"
                     /product="N alpha-acetyl-transferase, involved in
                     acetylation of the N-terminal residues of histones H4 and
                     H2"
                     /transcript_id="XM_002491098.1"
                     /db_xref="GeneID:8198800"
     CDS             complement(472242..472952)
                     /locus_tag="PAS_chr2-1_0251"
                     /codon_start=1
                     /product="N alpha-acetyl-transferase, involved in
                     acetylation of the N-terminal residues of histones H4 and
                     H2"
                     /protein_id="XP_002491143.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0251"
                     /db_xref="EnsemblGenomes-Tr:CAY68863"
                     /db_xref="GeneID:8198800"
                     /db_xref="GOA:C4R039"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C4R039"
                     /translation="MQDDLEKWITSSLESRDVEPQPDIIAKRDLIANEILPDLIDNMA
                     KAAGAPSTSIINASRFKIFTPRRENAPSIAKAIRLIDRGLGELYIKVNGPHWLEHKVE
                     EATESGLIYLAVEDEALGELRGFVSFMHDLDNSLPVLYLYEIHVAEQFRNLQLGSQLL
                     TLFHTVGERIVRDWKSSISLVATSLTVFSDNTRALSWYKKQGYKIADHSPQDRQLRNL
                     TRKPQYYILIRWLVRAGE"
     gene            complement(<473174..>474193)
                     /locus_tag="PAS_chr2-1_0252"
                     /db_xref="GeneID:8198801"
     mRNA            complement(<473174..>474193)
                     /locus_tag="PAS_chr2-1_0252"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491099.1"
                     /db_xref="GeneID:8198801"
     CDS             complement(473174..474193)
                     /locus_tag="PAS_chr2-1_0252"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491144.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0252"
                     /db_xref="EnsemblGenomes-Tr:CAY68864"
                     /db_xref="GeneID:8198801"
                     /db_xref="GOA:C4R040"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R040"
                     /translation="MSQGWYQNFDMSKTPAQEQPSHEDGNVDQRPRQASRKVQRQSQS
                     HIQTSQQPQLPCINQPQLLDSFAQSLDSQANSYLYTGNQNDPNQVSHVPQSSEYMDLQ
                     PSNRPYSPASLLYLHPPVSRQFVSSSQEDAEPTSSSGQSSSNCTAIDQQHRFQIANSR
                     NVFNSSEGIPMVPVQEVRMAPPVSGPDSRPQGFGQDQPYNPQLFGYYPEGLPTQQFPS
                     SIVNLVNPPPFDEVMKNLPNPVAFDDLGLEGQKTVPSSTRTHSQTPSLRIEERIGNQC
                     PHCKKKFRRPSSLQTHIYTHTGEKPFQCRWPNCDRRFSVRSNMVRHYRLHKKVNKQGS
                     DEKEQ"
     gene            <475115..>475798
                     /locus_tag="PAS_chr2-1_0253"
                     /db_xref="GeneID:8198802"
     mRNA            <475115..>475798
                     /locus_tag="PAS_chr2-1_0253"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491100.1"
                     /db_xref="GeneID:8198802"
     CDS             475115..475798
                     /locus_tag="PAS_chr2-1_0253"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491145.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0253"
                     /db_xref="EnsemblGenomes-Tr:CAY68865"
                     /db_xref="GeneID:8198802"
                     /db_xref="UniProtKB/TrEMBL:C4R041"
                     /translation="MNGDQLRSFTFDNGSSKPASINEGDPLAAPGSPVNSVDSDKDLI
                     FERMVQDPLTESPVLQCPRCGNHTSKCHHNSILKLPQHFNTENFIPAALDSTTSLINS
                     QEDMDLDLSTPPRRPSVVSLSQAFPNSYDGTGPASSVNLNAGGPVMRTSPSSPALSRN
                     QSFCSYADMIKREDQEGNVHRRPSIQQTLSGRKLPALLRRSTTASVGSDEQLSLDGTL
                     SLRRKVIRS"
     gene            complement(<475856..>477196)
                     /locus_tag="PAS_chr2-1_0254"
                     /db_xref="GeneID:8198803"
     mRNA            complement(<475856..>477196)
                     /locus_tag="PAS_chr2-1_0254"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491101.1"
                     /db_xref="GeneID:8198803"
     CDS             complement(475856..477196)
                     /locus_tag="PAS_chr2-1_0254"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491146.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0254"
                     /db_xref="EnsemblGenomes-Tr:CAY68866"
                     /db_xref="GeneID:8198803"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C4R042"
                     /translation="MSDNANETSSSLLDNVYLDSSDLLIARYDKWILALAFFENFFAR
                     YDSILSSTAKDYGKLVKHFSTDTLPQFEVSPSSNIAGAVYGSVNSEADPNKNVTGVNS
                     FIELLKFRSSEDQGKIAGLETSIREQIIPEFKKYSADLSAKKKDLTADASKQRKELKK
                     LGLHLSSSISKLQHSTQVFESASGTGKMDYKNDPYMLKRAVSLHGTELIAKEHNHMDF
                     LKREELSLMTLEKRTLEFIQLIFADVSNRITAADSVFSRSFDSLSKTLSSIDLEYEWK
                     QFSEVNKQRLVTVEGNDDISGANISADNKKRGLSDLSFPNDHHPATEPILEGILQRKE
                     GKVNKKYVSEYYVITKTRYLYEFESNAPKNSTQPNTVLYLPECTLKSLNGPDNSKFKI
                     EISGKDATQAFSVIKSTLILKTSTYDEMRTWFNVLSEVSGLMQTQEESRLDSPN"
     gene            complement(<477349..>479547)
                     /locus_tag="PAS_chr2-1_0255"
                     /db_xref="GeneID:8198804"
     mRNA            complement(<477349..>479547)
                     /locus_tag="PAS_chr2-1_0255"
                     /product="Protein of unknown function involved in
                     maintenance of proper telomere length"
                     /transcript_id="XM_002491102.1"
                     /db_xref="GeneID:8198804"
     CDS             complement(477349..479547)
                     /locus_tag="PAS_chr2-1_0255"
                     /codon_start=1
                     /product="Protein of unknown function involved in
                     maintenance of proper telomere length"
                     /protein_id="XP_002491147.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0255"
                     /db_xref="EnsemblGenomes-Tr:CAY68867"
                     /db_xref="GeneID:8198804"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:C4R043"
                     /translation="MAIFGSRLVRKDDKNASGLGGPSPSNTNLHSSPVKLSISLESPP
                     VVLYGQPHESTGSILSGLLSLDVLSYTQIASPTMSGSNSPGILTPVRSTSSLNVLTPT
                     TSLTMSQDYSKLDSIEIVNVTLSFVQTITYGKPLAPPSNTLQNCPDCKQKKLELARWD
                     ILAQPTSFAKGAVHAYPFSHLLPGALPATTLLGNTNTVIKYELVADAEYLNARKKPEY
                     LRIKLPIIIKRSILRGPDRNSLRVFPPTDVTATAVLPNVVYPKSTFPIELRLDNVCTK
                     YRRWRMRKLVWRMEEHIKVRAVSCEKHETKLKVLQDYANKQHHRFKRPHNTGGQTFTH
                     LSVGTASGHDINTNGPINPVRTVTTEEEVAITPAAGGIDHVALTQEALAQEQAREYES
                     RYGGSAANSNSENHNNNTNSSNTENSNIPIDHFNDERGSNKPVLFLEEIRTISQGEIK
                     SGWKSDFSGKGVVELVADINIMNLSSIALDSSLSNLSSVTSQNCNQPMFNHDDLFVSS
                     MANCSCDLSEKELGVFVSHLLVVEIVVAEELIQRKGVTHTHRGSNSQAKSPSVRFGGV
                     NGGGNAFEQTHSSEPADDTDELRFQLSNNSELPVSEVTSEQDNDSVVGIATGVARVLR
                     MQFKVLLTERSGLGVSWDDEVPPTYENVSALSPPTYDQARKPEGPMTGEDLTPPTHPA
                     GAHTRERETPLNSSPSMVTPGVLYGIGDTPGVSIDGVLQLDDAIQELKLS"
     gene            <480498..>482750
                     /locus_tag="PAS_chr2-1_0256"
                     /db_xref="GeneID:8198805"
     mRNA            <480498..>482750
                     /locus_tag="PAS_chr2-1_0256"
                     /product="Protein O-mannosyltransferase, transfers mannose
                     residues from dolichyl phosphate-D-mannose to prote"
                     /transcript_id="XM_002491103.1"
                     /db_xref="GeneID:8198805"
     CDS             480498..482750
                     /locus_tag="PAS_chr2-1_0256"
                     /codon_start=1
                     /product="Protein O-mannosyltransferase, transfers mannose
                     residues from dolichyl phosphate-D-mannose to prote"
                     /protein_id="XP_002491148.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0256"
                     /db_xref="EnsemblGenomes-Tr:CAY68868"
                     /db_xref="GeneID:8198805"
                     /db_xref="GOA:C4R044"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C4R044"
                     /translation="MTGRVDQKSDQKVKELIEKIDSESTSRVFQEEPVTSILTRYEPY
                     VAPIIFTLLSFFTRMYKIGINNHVVWDEAHFGKFGSYYLRHEFYHDVHPPLGKMLVGL
                     SGYIAGYNGSWDFPSGQEYPDYIDYVKMRLFNATFSALCVPFAYFTMKEIGFDIKTTW
                     LFTLMVLCETSYCTLGKFILLDSMLLLFTVTTVFTFVRFHNENSKPGNSFSRKWWKWL
                     LLTGISIGLTCSVKMVGLFVTVLVGIYTVVDLWNKFGDQSISRKKYAAHWLARFIGLI
                     AIPIGVFLLSFRIHFEILSNSGTGDANMSSLFQANLRGSSVGGGPRDVTTLNSKVTIK
                     SQGLGSGLLHSHVQTYPQGSSQQQITTYSHKDANNDWVFQLTREDSRNAFKEAHYVVD
                     GMSVRLVHSNTGRNLHTHQVAAPVSSSEWEVSCYGNETIGDPKDNWIVEIVDQYGDED
                     KLRLHPLTSSFRLKSATLGCYLGTSGASLPQWGFRQGEVVCYKNPFRRDKRTWWNIED
                     HNNPDLPNPPENFVLPRTHFLKDFVQLNLAMMATNNALVPDPDKEDNLASSAWEWPTL
                     HVGIRLCGWGDDNVKYFLIGSPATTWTSSVGIVVFLFLLLIYLIKWQRQYVIFPSVQT
                     PLESADTKTVALFDKSDSFNVFLMGGLYPLLGWGLHFAPFVIMSRVTYVHHYLPALYF
                     AMIVFCYLVSLLDKKLGHPALGLLIYVALYSLVIGTFIWLSPVVFGMDGPNRNYSYLN
                     LLPSWRVSDP"
     gene            <482906..>484210
                     /locus_tag="PAS_chr2-1_0257"
                     /db_xref="GeneID:8198806"
     mRNA            <482906..>484210
                     /locus_tag="PAS_chr2-1_0257"
                     /product="Nucleoside transporter with broad nucleoside
                     selectivity"
                     /transcript_id="XM_002491104.1"
                     /db_xref="GeneID:8198806"
     CDS             482906..484210
                     /locus_tag="PAS_chr2-1_0257"
                     /codon_start=1
                     /product="Nucleoside transporter with broad nucleoside
                     selectivity"
                     /protein_id="XP_002491149.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0257"
                     /db_xref="EnsemblGenomes-Tr:CAY68869"
                     /db_xref="GeneID:8198806"
                     /db_xref="GOA:C4R045"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4R045"
                     /translation="MSTYRELEREEGDFSDKKLLTGWFSLTVGQLQYAAFMAVGIALL
                     WPWNCFLSASDFFGERLQEHKWLSANYSSSMMTISTLTSTLCNVFLSQKQSGVDYSKR
                     LVMGQTITIVVFAFMGLLCVWNTGLDPIIFFVLVMINVALSSVAVSLSQVGAMAIVNV
                     LGPIYANAVVVGNAVAGVLPSIALIISTALSGTHVAGKLQPKRDYAVMAYFLTACVVS
                     GIALVLFGLAESHGPIDVVAAPVHTSSTADEAIEELGIPLEEEEYVPFSTLWAKLRFV
                     ALTIFTVFGVSLVFPVFASSIVSANGINSRIFVPLAFLLWNLGDLAGRLLCAYPRFVT
                     RSPIKLFIFSLARFLYIPLFAICNIRDKGGLIQSDVLYLLFQLSFGISNGLIYSSAFM
                     IVGDIASGENEQKAASGFTAVFLSLGLACGSLGSYLVVAFIL"
     gene            <484340..>484939
                     /locus_tag="PAS_chr2-1_0258"
                     /db_xref="GeneID:8198807"
     mRNA            <484340..>484939
                     /locus_tag="PAS_chr2-1_0258"
                     /product="Protein required for maturation of mitochondrial
                     and cytosolic Fe/S proteins, localizes to the mitoc"
                     /transcript_id="XM_002491105.1"
                     /db_xref="GeneID:8198807"
     CDS             484340..484939
                     /locus_tag="PAS_chr2-1_0258"
                     /codon_start=1
                     /product="Protein required for maturation of mitochondrial
                     and cytosolic Fe/S proteins, localizes to the mitoc"
                     /protein_id="XP_002491150.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0258"
                     /db_xref="EnsemblGenomes-Tr:CAY68870"
                     /db_xref="GeneID:8198807"
                     /db_xref="GOA:C4R046"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="UniProtKB/TrEMBL:C4R046"
                     /translation="MRLALIPLLSAKSTFHIGTRALLTHSFNQSWPKQFLTRPYSEAS
                     TSSTSFKKETFSQQPDDFAKTRLTNPQYSDNNGLLLVVAITPAARDKLLSIAKEENNP
                     NVALRVSVSSGGCHGFQYNLELNDIKNYDKSVDSLFERDGAKVLIDKTSLEILRDSKI
                     DYTHELIGSQFKVVDSPYTATSCGCGASFDFDFDKLKQG"
     gene            complement(<484926..>485777)
                     /locus_tag="PAS_chr2-1_0259"
                     /db_xref="GeneID:8198808"
     mRNA            complement(<484926..>485777)
                     /locus_tag="PAS_chr2-1_0259"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491106.1"
                     /db_xref="GeneID:8198808"
     CDS             complement(484926..485777)
                     /locus_tag="PAS_chr2-1_0259"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491151.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0259"
                     /db_xref="EnsemblGenomes-Tr:CAY68871"
                     /db_xref="GeneID:8198808"
                     /db_xref="UniProtKB/TrEMBL:C4R047"
                     /translation="MERALVNTTFRLNYILSIDGTTLEELREPENLTLLKTLIVDELK
                     KYELSLTSRSSRLPLSEQLDQEVEISPKTVQVSLNRQEIGGYNVLYLSIVCRGVIKRQ
                     VVILVMNPQKRGVIALSRCDTRYLGLIWSHLTSKMGQIVRPMDITSVFMTELFDKSMQ
                     EIPSSNIFNIVGSLHLNFTVETLGNSLKNIIIDIPGDVLEKCDSKSYVQDIYSRLRKQ
                     LGIDLSQLELTTIRSNIFMITNTGRIRFNQGTSLDSSDKDTVAVWTMIDQLYTYAERL
                     TAIPIPV"
     gene            <485907..>489342
                     /locus_tag="PAS_chr2-1_0260"
                     /db_xref="GeneID:8198809"
     mRNA            join(<485907..487437,487502..>489342)
                     /locus_tag="PAS_chr2-1_0260"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491107.1"
                     /db_xref="GeneID:8198809"
     CDS             join(485907..487437,487502..489342)
                     /locus_tag="PAS_chr2-1_0260"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491152.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0260"
                     /db_xref="EnsemblGenomes-Tr:CAY68872"
                     /db_xref="GeneID:8198809"
                     /db_xref="UniProtKB/TrEMBL:C4R048"
                     /translation="MSFVNKENAQKSAGAAASFIGKGAKAGYSAIKNHKSGSSNKDSE
                     HEEHYSSVRPLESLTDPRTFQPPPKRSVGSYSGSIPPSFSAHSLAATSSAIPPPQATV
                     QNPAQYQLQIQPSMSAPQQQPGNQVYAAGNYQDPSQASQTYPGPPQLPGRQPSQNQIG
                     GNPQVPAQSQAESYISDSVTRTGQSAGSQYVQSQLQNSGYAEAQNPQIQKAGAAFGSF
                     IGGQLAQQGQQQAKQQLQQQLQNFQNPQSTIQTPQSQDVSQQQSQFPQVQQPEQTPQA
                     PSISQIQGPDQFQQPGIAQQATQQPNQFQQLGIAQQPNQFQQPAPAQQPIQQSAQFQQ
                     HLPAQQPNQFQPPGPAQQSSSQPNQFQQPGIAQQPNQFQQPAPAQQPGIAQQPKQFQQ
                     PAPAQQPIQQATQFQLPSPAQQPSQFPEASPQQQVPQLQQGSQVPVSPQLQQASPVHQ
                     FSQNKQVHSQDVREIQYQQRPQPQPPSNHQSQDVLNTQYQPTNQPSQMYPTASIQPPP
                     TSAVPREPEPLPQQSASVIASPPQSFAPPPVHVARGSSPSNHAQTELSPTISTAAPVQ
                     GVHSGSTAPPPPPRNTFSLPDISTVGPPPPKPFRSAQEKEKLEQERRHQEEFNKMRNA
                     HRTASSTSTPSYVPKPNSPLKTEDTGEPAPLPPEKNASKDTTAFSPPPSTFRSSSSTK
                     NHSVPVAAPKPTVKTDIDDIASPSPPPPAPRKKFSSKESESLVLESHKKPPPKPSKPK
                     SLANINSKQGELENNKQFANSEPIPDSKTSRAVPAEQDLVSEMERVMLNRRKKLQDQE
                     TATPDVSNKPSRPAKPVKFEKISSPTQRQHHNIFETPNQSTKNTSGIHDAAPVKPTRP
                     PKPTFSKPPKPLPAVSKPKPYVRTKVPIPDSNQQLNLQLETGWYKRLDQIPPDAAGLI
                     YRTSMGQIGGDYTRYISFRMKDLGTVQAEIKWSDSTAPIVTQKYTAPPTATQEQLFEG
                     RNLFNEHVATWAESHEGKCVGDGECWTLAKLALEKGCGKHAFVSEYYHHGALLFTKDA
                     SGVIKSNPTDSIARGDILQFYECTTKNNYSTTKLGAPHHTAIVVSCNSDGSLEIIHQN
                     VNGVKKVMKQNLVLNVVEGTMKVYRPVTKTWIEEL"
     gene            <489797..>491524
                     /locus_tag="PAS_chr2-1_0261"
                     /db_xref="GeneID:8198810"
     mRNA            <489797..>491524
                     /locus_tag="PAS_chr2-1_0261"
                     /product="Activator of Chs3p (chitin synthase III),
                     recruits Chs3p to the bud neck via interaction with Bni4p"
                     /transcript_id="XM_002491108.1"
                     /db_xref="GeneID:8198810"
     CDS             489797..491524
                     /locus_tag="PAS_chr2-1_0261"
                     /codon_start=1
                     /product="Activator of Chs3p (chitin synthase III),
                     recruits Chs3p to the bud neck via interaction with Bni4p"
                     /protein_id="XP_002491153.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0261"
                     /db_xref="EnsemblGenomes-Tr:CAY68873"
                     /db_xref="GeneID:8198810"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C4R049"
                     /translation="MSTHPYRQKIPQLPGSTGSFDRPDVTSTQSGVETASTEPNSRAT
                     LANLGSVSALPQLDVQQPVLPFTSQVSHNRSSSKPGSVTSRSNANSPAGSVSSHSPRS
                     SLSSPLIHPLNPEAQRATGSKVVSPNGSIGNLNEFGHKYRNSGSRLSINTSSSGHSSP
                     MYNIKPDHRTSSRSVDLGSFYQLDRSVSPAITIGTNMDFSQSLLANQQTAEHPSALVP
                     RMKTIEMYRKNARKSHDPAVLFQYAQYMLQTALLLDTESEEEGKLRKDFLQEAQHYLK
                     KLADKGYLDAQYLLGDAYSVAAFGKTDDKESFSLFQSAAKHGHVECAYRTALCYEEGL
                     GTGRNSRKAVEFLKFAASRNHAAAMYKMGLYSFYAKMGLPNNITTKKAGIQWLSRATM
                     RATELTAAAPYELAKIHYHGFEDIVIPDRKYALELYVKAASLGHVKSAAILGHHYEVG
                     DVIPQDPDLSIHYYNIAAMGGDCESMLAMCAWYLVGSEKLEKDENEAFEWAIRAAHGG
                     LAKAQFAVSHFLEQGIGCEIDFAQSKVWLEKSAQGGNSRAITKLKNLNSSSENSTKDS
                     KKDKDCIIM"
     gene            complement(<491647..>493602)
                     /locus_tag="PAS_chr2-1_0262"
                     /db_xref="GeneID:8198811"
     mRNA            complement(<491647..>493602)
                     /locus_tag="PAS_chr2-1_0262"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002491109.1"
                     /db_xref="GeneID:8198811"
     CDS             complement(491647..493602)
                     /locus_tag="PAS_chr2-1_0262"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002491154.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0262"
                     /db_xref="EnsemblGenomes-Tr:CAY68874"
                     /db_xref="GeneID:8198811"
                     /db_xref="InterPro:IPR018825"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:C4R050"
                     /translation="MKLSRLIVPICFCLSRGAIALSAYAHDGSHGGMDMDMDMSRNSV
                     TAETTETATHQLNGSADSETAIPSIEPVPFEGHHHHGLPILDTDLSPAERLYWENYNT
                     TTYFTVESNSRFFLYAHVISMVVTFVFLYPVCLVLNNVKNKWYLPALSVHAIVTVLSL
                     ISYSIFIDSVPDLYPNNAYTKMGVVLFVFTVVHFVSAVIYQGSKFFAVLPSTPNDNSH
                     AQFLPLEDLSNKEHNKKHEVNSTSSTLFDYETRDSHSKQFRSQYRDSLNSSFQLDDRE
                     ANFSIDNSSNGTIHDVPSIPSQDHDSYSYKVDGALQRLFEVPWIARIAVSLGSVASVV
                     FNLLNFGIFFFFLIYFPTGVAVLNCLGMANTVFNLLAHFIKGGVFFSLGLLSLARYCG
                     GFQKLGWAWNYSFINRYEKKDSIWFRFQPRNVMITMEMLESSLILFYGCTNVFMEHLS
                     NPGGEWAAKDLQHVSIAFMYIGCGLCGVITELKLNNWRLIKFQSTVEEINNENEPIDA
                     ECFTNVTCGFSPNPFPAFTIFWTGLLMSQHAQASELSTSIHVQWGSLLTYGSLFRIAT
                     MLYLMFNKTYKGDLFQPSRPLTELVTSFCLLCGGLVFAESTDPIVLAMAYRGLTGMFT
                     LNVSVGVVALLMAWIMTVFSIKDHLKR"
     gene            <494748..>500015
                     /locus_tag="PAS_chr2-1_0263"
                     /db_xref="GeneID:8198812"
     mRNA            <494748..>500015
                     /locus_tag="PAS_chr2-1_0263"
                     /product="Catalytic subunit of 1,3-beta-D-glucan synthase"
                     /transcript_id="XM_002491110.1"
                     /db_xref="GeneID:8198812"
     CDS             494748..500015
                     /locus_tag="PAS_chr2-1_0263"
                     /codon_start=1
                     /product="Catalytic subunit of 1,3-beta-D-glucan synthase"
                     /protein_id="XP_002491155.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0263"
                     /db_xref="EnsemblGenomes-Tr:CAY68875"
                     /db_xref="GeneID:8198812"
                     /db_xref="GOA:C4R051"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:C4R051"
                     /translation="MFSALKTPFITTGRWADIKRVGNLYGYDPNSALDDESSLLNQKL
                     AEGGIFDTFDNNYDPYPTWASDDEVPISKLKIQIIFNQLQEIFHFQPSNIRNMFDYLM
                     KLLDSRASRMGPHLALQSLHADYIGGINANFRKWYFASQLDLDDSIGFENISYNGTAK
                     RHSPYTVPMLSVAQKRWTENMNALSPDDATVHLALYLLCWGEANNIRMIPECLCFIFK
                     CCNDYYYSLDLSKSIPSPERPFLDHIITPLYQFHFNQMYAINSKGETIPRNIDHDKIL
                     GYDDMNQLFWYRKGLERIVLQSSKRTILSFPPAERYIHLHNIEWSRAFFKTYYESRTS
                     LHSVLNFNRVWSIHVCVFWLYTSFNSPTLYTSDYDYRRDNQPTASARLAVLSIAGSIC
                     LFLNWIAVIAEIKFVPRKWPGAESMIPKLLLLLILTLVQVAPIVYILFFNSLDYQDMF
                     LLIISIFEFILSIAIIFYFSIVPFGALFGSYMSKGERTYLPSKYFTGSVPKLKGKAEL
                     ASIGLWVCVFLSKFIETYFFLTLSIRDSVRELSTLEINTCIGETYFGDLLCKRQPLIL
                     LVLLFSTDLILFLLDTYLWFIIWNTLFSVCISFSIGISILTPWRNIFSRLPKRIYSKI
                     INDNGSTSMKSKQLVSQLWNSIIISMYREHLLSIDHVNKLIYQQIIVPGQQDTSEQIL
                     KEPTFFVSQEDHALKTSLFKGHKEAERRITFFAQTLSTPIPESIGIEKMPSFSVLIPH
                     YAEKISLSLREIIKEEDENSQLTLLEYLKQLHPAEWVNFVEDTKILAEEINSSEDSFS
                     KSSIKDRLIDLPYYTVGFKTATPEYILRTRIWASLRTQTLYRTVSGFMNYSRAIKLLH
                     DIENKDIADSSDSNKRLEEASIMALRKFRMVVSMQRFHKSSPEQRESKETLLRAYPEL
                     QIAYLEERYCEDRGCLEYYACLIDGSCEILEDGERKPKYRIRLSGNPIIGDGKSDNQN
                     HALIFCRGEYIQLIDANQDNYLEECLKVRNIFSEFEELNSTDDPYCLDEDTNNPNPVA
                     IIGAREYIFSENVGVLGDVAAGKEQTFGTLSARTLALIGGKLHYGHPDFLNSVFMTTR
                     GGVSKGQKSLHLNEDIYAGMNALLRGGRIKHSEYLQCGKGRDLGFGSILNFTSKIGSG
                     MGEQMLSREYFYLGTQLPLDRLLSFYYAHAGFHLNNMFIFLTINLFILFSANLAALVK
                     NSLVCSYHKNIPITDPKSPEGCFNLVVVILWLQRCVVSIILVFFISFIPLFVQEVTER
                     GIGKAVTRLSKQLASFSIFFEVFVCKIYANSLLNNLSTGSAKYIATGRGFATTRMPFS
                     VLYSKFSTVSLHEASILFFLLLFTSISMWRTVLIYFWFTITALVISPFLFNPNQFAPQ
                     SFFLDYRKTLQWLFKGNSKWQQESWIGYVRNNRALYTGSKRKEVKLGENIDLGYLNKP
                     SIINLLLTQVGTHLLKTLIVFNAYLFSNSQLNTGALRVNTIMRLAVCSLGPIAVNIVL
                     LLLLQPLSLIIAPLVSSTCWKSFPSVLAAITRILGLLNHILFFNLLWMFQNWELATTV
                     LGFCCSCLIESLLFRLVTSLFLTSEFRHGRTNRAWWSGKWITSGLGFNVLSQPVREYF
                     CKVIEQSLFAADFIYVHILLFLQIPIVLTPFIDSIHSLMLFWLPPSKQLKPQLFPMRN
                     SKRKRTHAQLLSVLFLLILSLQVALIIGPYIISIVYGNEVFRENMPEIFQQLFQPIAY
                     KNPNLGLKSHSIITDISNMDTVNARKDNR"
     gene            complement(<500020..>500907)
                     /locus_tag="PAS_chr2-1_0264"
                     /db_xref="GeneID:8198813"
     mRNA            complement(<500020..>500907)
                     /locus_tag="PAS_chr2-1_0264"
                     /product="Mitochondrial outer membrane protein with
                     similarity to Tom70p"
                     /transcript_id="XM_002491111.1"
                     /db_xref="GeneID:8198813"
     CDS             complement(500020..500907)
                     /locus_tag="PAS_chr2-1_0264"
                     /codon_start=1
                     /product="Mitochondrial outer membrane protein with
                     similarity to Tom70p"
                     /protein_id="XP_002491156.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0264"
                     /db_xref="EnsemblGenomes-Tr:CAY68876"
                     /db_xref="GeneID:8198813"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR025986"
                     /db_xref="UniProtKB/TrEMBL:C4R052"
                     /translation="MSFSLKQKGNQAFADGSFQEAANIYQEALQLDPQNPVLYSNRAM
                     CYVKLNNWHQVLADTTAGLELRVNDTKTQVKLLWRKGLALSKLGNVSEALESFNKALE
                     LDPNNATVKSELERLVLNKRRKHLQSENGSLLSLTIENYDVLPSEFTSNHIQEADTYQ
                     EKPASSSELFEGSSFNPPAFPSVYFLSRLKFLPASQKPPAYHYVLSFSPETYSSLFKE
                     GGLDSNFLDFFIEAVINNQIKNPDNVLQCLKIFSTCKRFSIYLSFTEANNITLMFEKL
                     SNLSDKQLFTTTRNIWGLP"
     gene            <501107..>502003
                     /locus_tag="PAS_chr2-1_0265"
                     /db_xref="GeneID:8198814"
     mRNA            <501107..>502003
                     /locus_tag="PAS_chr2-1_0265"
                     /product="Protein that inhibits activation of Gcn2p, an
                     eIF2 alpha subunit protein kinase"
                     /transcript_id="XM_002491112.1"
                     /db_xref="GeneID:8198814"
     CDS             501107..502003
                     /locus_tag="PAS_chr2-1_0265"
                     /codon_start=1
                     /product="Protein that inhibits activation of Gcn2p, an
                     eIF2 alpha subunit protein kinase"
                     /protein_id="XP_002491157.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0265"
                     /db_xref="EnsemblGenomes-Tr:CAY68877"
                     /db_xref="GeneID:8198814"
                     /db_xref="GOA:C4R053"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:C4R053"
                     /translation="MESEELIDEIGAIDVIFPNCVSKIKPSLYHVKVPQNEDIAFDLN
                     FPPNYPETKPKIETIKSAVPGLQDIRYFRSRLESLLDQVFVEQNVCLFEFISEVNNTV
                     EELEAEWDQRNQHLKENSEPPEDDADVRISAISSQLQNSTINSSGSNGKMVKQDNDHD
                     HLKGWFISEPVVDRKSTFIGYSRAVHSEKEVLDCINELKMDRKIAKSNHVMTAYRIQA
                     ENGIRYKDCDDDGETAAGSRLLHLLDIIDAWNVVVVVVRWFGGLHIGPDRFKHINSTA
                     REALVKGNLVEDNKKKTKKKKC"
     gene            complement(<502051..>502590)
                     /locus_tag="PAS_chr2-1_0266"
                     /db_xref="GeneID:8198815"
     mRNA            complement(join(<502051..502461,502549..>502590))
                     /locus_tag="PAS_chr2-1_0266"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491113.1"
                     /db_xref="GeneID:8198815"
     CDS             complement(join(502051..502461,502549..502590))
                     /locus_tag="PAS_chr2-1_0266"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491158.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0266"
                     /db_xref="EnsemblGenomes-Tr:CAY68878"
                     /db_xref="GeneID:8198815"
                     /db_xref="UniProtKB/TrEMBL:C4R054"
                     /translation="MSNKGLSSRVLNMKFMKSSDEKAEEFKTARVTDSSEWSLPNASK
                     MKKKLRRVHVESVGYSDAAGFSSRRRVFGETDEKFGEEEVEKSDEETYSKDSVKTKKK
                     KKGLKESEGFLDDLWKKTQAKRKLSRKESQEDFLEDSHQDTSKKLRTE"
     gene            <502751..>505384
                     /locus_tag="PAS_chr2-1_0267"
                     /db_xref="GeneID:8198816"
     mRNA            <502751..>505384
                     /locus_tag="PAS_chr2-1_0267"
                     /product="Conserved 90S pre-ribosomal component essential
                     for proper endonucleolytic cleavage of the 35 S rRNA"
                     /transcript_id="XM_002491114.1"
                     /db_xref="GeneID:8198816"
     CDS             502751..505384
                     /locus_tag="PAS_chr2-1_0267"
                     /codon_start=1
                     /product="Conserved 90S pre-ribosomal component essential
                     for proper endonucleolytic cleavage of the 35 S rRNA"
                     /protein_id="XP_002491159.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0267"
                     /db_xref="EnsemblGenomes-Tr:CAY68879"
                     /db_xref="GeneID:8198816"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:C4R055"
                     /translation="MKSDFQFSNLLGTVYRQGNLVFINDGNTLISPVGNRVSVFDLIN
                     NKSFTFPYEHRRDVAAITVNKQGTLLMSVDEHGRAILVNFKARIVLHHFNFKSPVKAI
                     EFSPDGHYFAVGCGKILQIWRTPNVLEDKQFAPFVRHAYYTGHYDDITSVSWSGDSQF
                     VLTTSKDMTTRLYGVDRDRMDEVRMTLGGHRDYVVNAFFDEAQEVIYTVSKDGALFRW
                     EYTSDPKSKEDEYEEEDEEDRSTDEDGILQKPKKPESWRIVARHYFFSHSKLKCAAFH
                     PKSNILVVGFGNGEFRLYELPTFTLIQQLSMGQNSVNTVSINASGEWLAFGSSTLGQL
                     LVYEWQSESYILKQQGHFDAINALTYSPDGSRVVTAADDGKIKIWDVLSGFCLATFEE
                     HSSAVTSVRFAKRGQVLFSSSLDGTVRAWDLIRFRNFRTFTAPERVQFGCLAVDPSGE
                     VVCAGSLDDFQIHVWSVQTGALLDSLAGHEGPVSCLSFGQEGEAATTLASASWDKTIR
                     VWNIFGRSQQVEPFEVYSEVLAIDMRPDGKEVAVSTLNGQILFWNVESGNQTNFIDAK
                     RDIQVGRYSDDRFEAKNSKRGKCFSTISYSFDGLSLIAAGDNNSICLYDVKNSVLLRK
                     FTVSLNMNLEGTLKKLNSKNLIEGGPIDLLDRDGENSDYEDRVDLKLPGSHRGDPSVR
                     NIKAAVRVTSIAFSPGASSFAAASTEGLLIYSVDDSVNFDPFDLDIDITPASCLEMLE
                     EKEFLIAVVMSFRLNERYLIHRIYESIPLNEIDLIVADLPKVYVERFLRFIGELSLES
                     QHIEFNLIWIKSILAAHGKYISAHKFEFSVATRMIQRFLARIAKDVVKTSVRNGYLAE
                     FLLDTRTQQDSIRIEEEKLTL"
     gene            <505500..>507026
                     /locus_tag="PAS_chr2-1_0268"
                     /db_xref="GeneID:8198817"
     mRNA            <505500..>507026
                     /locus_tag="PAS_chr2-1_0268"
                     /product="Essential protein of unknown function"
                     /transcript_id="XM_002491115.1"
                     /db_xref="GeneID:8198817"
     CDS             505500..507026
                     /locus_tag="PAS_chr2-1_0268"
                     /codon_start=1
                     /product="Essential protein of unknown function"
                     /protein_id="XP_002491160.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0268"
                     /db_xref="EnsemblGenomes-Tr:CAY68880"
                     /db_xref="GeneID:8198817"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019156"
                     /db_xref="UniProtKB/TrEMBL:C4R056"
                     /translation="MEPIECLTVLSRILVTLGSNGDKVLKDYRHNLDLLSACLSHANS
                     NAGFRREVFQSQSVWVMLNQIFSFYLENSDTRVVQDEIWQYRTRTVRGISLLARSMIT
                     ACTAQDSSAQPYVENTHRNISNVTRVSIAKLCDSSLSDSTRDLYVKLISSNFQFLTNL
                     MNTKLGDEYHGTIDYKLAQDLFRRIAHVKEPGDAPLDLEFAEHGLYLVNSLVDNKEFS
                     FTLMDDQETFNLFLSALLNSFEEFSTNAAIEIEAAKDQDLNAIELLIVSICSKIITKP
                     RFVTWIDTMDPFDGNMPNYLKLFQTIIVNRDSWSSDQLIVLITWLTTLFDRLNVDDNS
                     VLTASLNKVLVSTLDSIASICQYEEVRQYISEYHYFVKFLDLLKMLSIKVPRKALKDS
                     ASKIQFPNTKSIIVEILTFLVHKNFKVQEAMRDFQGIEVILNNCNIDENEPFIKERSI
                     LCIKYLLENNQANQDFVAKLEAKKVTDDKVLSEAGYEVDIVDGKVKLKPPKPRSNPSE
                     "
     gene            <507151..>508659
                     /locus_tag="PAS_chr2-1_0269"
                     /db_xref="GeneID:8198818"
     mRNA            <507151..>508659
                     /locus_tag="PAS_chr2-1_0269"
                     /product="Threonine synthase, conserved protein that
                     catalyzes formation of threonine from 0-phosphohomoserine"
                     /transcript_id="XM_002491116.1"
                     /db_xref="GeneID:8198818"
     CDS             507151..508659
                     /locus_tag="PAS_chr2-1_0269"
                     /codon_start=1
                     /product="Threonine synthase, conserved protein that
                     catalyzes formation of threonine from 0-phosphohomoserine"
                     /protein_id="XP_002491161.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0269"
                     /db_xref="EnsemblGenomes-Tr:CAY68881"
                     /db_xref="GeneID:8198818"
                     /db_xref="GOA:C4R057"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:C4R057"
                     /translation="MSVYRSTRSSAEQQVSFEDAVITGLAKDGGLFIPSEIPSVPTDF
                     LSAWKDLSFQDLAFKIMRLYIKEAEIPDNDLKDLVERSYSTFRSEEVTPTVKLDSHDN
                     LFLLELFHGPTYAFKDVALQFVGNLFEYFLQRKNKGKAEDDPTRDTITVVGATSGDTG
                     SAAIYGLRNKKDVSVFILYPTGRISPIQELQMTTVVDDNIHTLSVNGTFDDCQALVKE
                     VFNDSEFNDKWHIGAINSINWARILAQITYYFYSYLQVSQAVGHGRVKFIVPSGNFGD
                     ILAGFYASQMGLPVEKLVVATNENDILNRFLTTGKYDKGDVKPTHSPAMDIVVSSNFE
                     RFLWYMIKETIGKNDEKATGEILNNYMKELSTKGVFTVPQAVLDKATSILDSDRITNE
                     ETVSTIKKIYEATSNNYIIDPHTSVGIATTLNQIKKDNDPSITYVSLSTAHPAKFSEV
                     VDAALTSYPDYSFEKDVLPEELKNLSTLPKKIKLIETATLESIKDTIVKTLS"
     gene            complement(<508992..>509882)
                     /locus_tag="PAS_chr2-1_0270"
                     /db_xref="GeneID:8198819"
     mRNA            complement(<508992..>509882)
                     /locus_tag="PAS_chr2-1_0270"
                     /product="Plasma membrane protein with roles in the uptake
                     of protoprophyrin IX and the efflux of heme"
                     /transcript_id="XM_002491117.1"
                     /db_xref="GeneID:8198819"
     CDS             complement(508992..509882)
                     /locus_tag="PAS_chr2-1_0270"
                     /codon_start=1
                     /product="Plasma membrane protein with roles in the uptake
                     of protoprophyrin IX and the efflux of heme"
                     /protein_id="XP_002491162.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0270"
                     /db_xref="EnsemblGenomes-Tr:CAY68882"
                     /db_xref="GeneID:8198819"
                     /db_xref="GOA:C4R058"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:C4R058"
                     /translation="MAFKLFNYNPSLPAAIAFAVVFGLLTLIHSFMVFHVGFKQNLTF
                     NSGRKKRLCCIMIPFIIGLVMESVGYVARAIATQNKDSVIVYCMQSTFILIAPVLMAA
                     TLYMVFGELVKTTDTEKHICISMKYFTKILVAADIVSLLVQAAGGGLIAMDSARKWGK
                     IIVIVGLFIQIIFFGGFFVLSILYTIQVHKHAKRHISKYSHWMLSFVVLFVTSLLILV
                     RSVFRVVEFFGGYDGAIASNEKLIYGLDAVPILVGSVIFVFFNYSRLLCKYQTLNDGS
                     DFLLVDKILPSEEGSQKESY"
     gene            <511580..>512968
                     /locus_tag="PAS_chr2-1_0821"
                     /db_xref="GeneID:8198820"
     mRNA            <511580..>512968
                     /locus_tag="PAS_chr2-1_0821"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491118.1"
                     /db_xref="GeneID:8198820"
     CDS             511580..512968
                     /locus_tag="PAS_chr2-1_0821"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491163.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0821"
                     /db_xref="EnsemblGenomes-Tr:CAY68883"
                     /db_xref="GeneID:8198820"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:C4R059"
                     /translation="MNRGKPVTREPQINPQSVSFKPTDLIIPESLQEMFPEQVDLFKN
                     LQDKEKQLDLLVNRKLLDLQDYQNNNINGVMEDSDKNEILRIFIYNISENQPWQLAKQ
                     SEDQSEEAKAIAAGSAQADPSWTLRIEGRFLNDEAADNASRKKFSSFLSSISVELFKG
                     ATKEKLDANNIIEWHDELQQIKSEIEREEQQFDGLDIKRVGSSIPGNPTEEVSCQILI
                     QPKMYPIKLSILSKDLVELLGTNEITQHDCFVKLFNYIQVNDLFQFDQDKNLQQQQNS
                     ILIKSDDALLKIFQLEKFNVPQMLDIISTRLLKPVEPIKLNYTVNTLTNSTLGDMIID
                     LKINSDLLNKSSAGGANKSVSDLINELMNNQANSIEVNKLNENISLTLQLLNYNKIKY
                     DFYKKFSEDPVKFLQKINDKNHEFLKIICSDSVGYNTNEYIDEEIFRKSEYYKDNIIS
                     EQVNLLLSSGRL"
     gene            <513024..>513314
                     /locus_tag="PAS_chr2-1_0822"
                     /db_xref="GeneID:8198097"
     mRNA            <513024..>513314
                     /locus_tag="PAS_chr2-1_0822"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491119.1"
                     /db_xref="GeneID:8198097"
     CDS             513024..513314
                     /locus_tag="PAS_chr2-1_0822"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491164.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0822"
                     /db_xref="EnsemblGenomes-Tr:CAY68884"
                     /db_xref="GeneID:8198097"
                     /db_xref="InterPro:IPR023231"
                     /db_xref="UniProtKB/TrEMBL:C4R060"
                     /translation="MIEDLIQISREYPEYFKKLTLEGDWEPEGDYRKAGLFCQTFEGK
                     DYNITISPQGWTVDDETYYPTFEALAHRISKSFSVKWNEELMKKLESVIESD"
     gene            <513445..>514629
                     /locus_tag="PAS_chr2-1_0271"
                     /db_xref="GeneID:8198098"
     mRNA            <513445..>514629
                     /locus_tag="PAS_chr2-1_0271"
                     /product="Subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex"
                     /transcript_id="XM_002491120.1"
                     /db_xref="GeneID:8198098"
     CDS             513445..514629
                     /locus_tag="PAS_chr2-1_0271"
                     /codon_start=1
                     /product="Subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex"
                     /protein_id="XP_002491165.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0271"
                     /db_xref="EnsemblGenomes-Tr:CAY68885"
                     /db_xref="GeneID:8198098"
                     /db_xref="GOA:C4R061"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:C4R061"
                     /translation="MSESLSLEETPQENEELTIEEEYKLWRKNCHYMYDFISETALTW
                     PSLSIQWLPQSFQAPSNAEITQSLLLTTLTSGKDTDYLKIAGTQLPDSLTGKKSEEKV
                     KSRLKVFKKYPQSTEINRARYMPQNPNIIGTINASGQVFTYDVKSLAEPVINEYIHHK
                     ESGYGISWNRKKEGVFATSSDDKTVAIWNINHSKPLRTYEHKDIVNDVAFHNFDVNII
                     GSVSDDKSLKIHDTRTQKTVNSEQVSEKGVNSLTFSTFSENLVAVGGEDFNVSLFDLR
                     NLTRPLHSMVGHTSTITSLSWDPHHENIVASGSADRRVILWDISKIGEEQLQDEMEDG
                     VSELFMMHGGHTGSIYDLSFNPDIPWTLASCSNDNIVHLWTVSRKVLGSGNEEVDLKS
                     LE"
     gene            <514834..>515574
                     /locus_tag="PAS_chr2-1_0272"
                     /db_xref="GeneID:8198821"
     mRNA            <514834..>515574
                     /locus_tag="PAS_chr2-1_0272"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491121.1"
                     /db_xref="GeneID:8198821"
     CDS             514834..515574
                     /locus_tag="PAS_chr2-1_0272"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491166.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0272"
                     /db_xref="EnsemblGenomes-Tr:CAY68886"
                     /db_xref="GeneID:8198821"
                     /db_xref="InterPro:IPR009027"
                     /db_xref="InterPro:IPR020070"
                     /db_xref="UniProtKB/TrEMBL:C4R062"
                     /translation="MNRLLKRPLLTLEKPSCVRFTAISKRNRIKVQLLKDFPGVGVRG
                     EVVNVRPSLMINTLHHNNGACYLLPGQGPRIPVVEKKHEAKQKEPLSSQSETRTTKAD
                     SKPTMTPDLLAKLTGLSFKESTSPSKAENSGSANELELATAIQDMPKVIFMRYATDDN
                     GTLKNEIRKDRLCEHLFKLTGFTIPTEFITIQYMSPNGPIDLDYMDFVGDYTLTFKLS
                     STFEPIVKNAKIISSNIDLALQKDLIRP"
     gene            <515647..>516558
                     /locus_tag="PAS_chr2-1_0273"
                     /db_xref="GeneID:8198822"
     mRNA            <515647..>516558
                     /locus_tag="PAS_chr2-1_0273"
                     /product="Protein involved in bud-site selection"
                     /transcript_id="XM_002491122.1"
                     /db_xref="GeneID:8198822"
     CDS             515647..516558
                     /locus_tag="PAS_chr2-1_0273"
                     /codon_start=1
                     /product="Protein involved in bud-site selection"
                     /protein_id="XP_002491167.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0273"
                     /db_xref="EnsemblGenomes-Tr:CAY68887"
                     /db_xref="GeneID:8198822"
                     /db_xref="GOA:C4R063"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C4R063"
                     /translation="MDFETETATSRTLDCLSCSSQVVHGHVGNSAIQFPLQLNGWNVD
                     TINTTQFSNHPGYGRFKGQKTSASEVEAIFLGLMNIGCHYDTLLLGYVADAGTLRTIG
                     NLFAEYSTNHGARFVLDPVLGDNGKLYVSEDLIPVYKEIIRSGKVDMVTPNQFELELL
                     LGSKINSLKELRNAMFQFQEEFRVKNVVVTSVSFPTGPNHDDSNIYLAGLCEDQWFYE
                     KVPEIDAIFSGSGDLFLSLLNHLYYHFPLQEALIKTASSVSKVLQLSYEMELDNPCKI
                     FKLDKLYVPHLRMVEARDILVLSVPNK"
     gene            complement(<516567..>517568)
                     /locus_tag="PAS_chr2-1_0274"
                     /db_xref="GeneID:8198823"
     mRNA            complement(<516567..>517568)
                     /locus_tag="PAS_chr2-1_0274"
                     /product="Protein involved in postreplication repair"
                     /transcript_id="XM_002491123.1"
                     /db_xref="GeneID:8198823"
     CDS             complement(516567..517568)
                     /locus_tag="PAS_chr2-1_0274"
                     /codon_start=1
                     /product="Protein involved in postreplication repair"
                     /protein_id="XP_002491168.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0274"
                     /db_xref="EnsemblGenomes-Tr:CAY68888"
                     /db_xref="GeneID:8198823"
                     /db_xref="GOA:C4R064"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C4R064"
                     /translation="MDATVGNIGSISDPSDWLGTKVPKLFDLESMLSCHICKETLKAP
                     VMTQCGHCFCSLCIRRYLKVNQECPLCHEVQYESNLVKVLLLDSIGKWFISNRSQLLA
                     KLNADDDSVIILQEEKKRPKPQKPVYESRKKPKTAGFGKSVPSREEMVECPICGEFMS
                     AEELQGDHIDICLVGKDNKDEKEEDSKEDREHHESAQKVPEKDIVVTIPKDQDFQVQK
                     AVDMKRLAKLDFASLSTNKVKEKLAQLRLPTSGTRAQLEARYVEYSNLYNSNLDSANP
                     KDSVVLRDKLEQWEALSEIDNNKSNHTEKFNRSAWVKTHGNEFRELIQAAKKTHFSK"
     gene            <517738..>518319
                     /locus_tag="PAS_chr2-1_0275"
                     /db_xref="GeneID:8198824"
     mRNA            <517738..>518319
                     /locus_tag="PAS_chr2-1_0275"
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /transcript_id="XM_002491124.1"
                     /db_xref="GeneID:8198824"
     CDS             517738..518319
                     /locus_tag="PAS_chr2-1_0275"
                     /codon_start=1
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /protein_id="XP_002491169.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0275"
                     /db_xref="EnsemblGenomes-Tr:CAY68889"
                     /db_xref="GeneID:8198824"
                     /db_xref="GOA:C4R065"
                     /db_xref="InterPro:IPR019364"
                     /db_xref="InterPro:IPR020178"
                     /db_xref="UniProtKB/TrEMBL:C4R065"
                     /translation="MTDYSKVPINSLESLRLRLTQAMHSLNKLNDSIHQSQTLPQWSS
                     IQNQLTVILSQLTSLSTTLETQREILQYINVYPLPEFPSTTHEGLLTTLLRKKNIPEV
                     SEWITQSLEESKDKNPSASDQFATWCAETSAQESENWIFTGFRTKYEIDNDIPQAPEY
                     SLRESTSTNVSQDEVSTDDLNKLIYMGIDPRKQ"
     gene            complement(<518367..>520607)
                     /locus_tag="PAS_chr2-1_0276"
                     /db_xref="GeneID:8198825"
     mRNA            complement(<518367..>520607)
                     /locus_tag="PAS_chr2-1_0276"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491125.1"
                     /db_xref="GeneID:8198825"
     CDS             complement(518367..520607)
                     /locus_tag="PAS_chr2-1_0276"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491170.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0276"
                     /db_xref="EnsemblGenomes-Tr:CAY68890"
                     /db_xref="GeneID:8198825"
                     /db_xref="InterPro:IPR024312"
                     /db_xref="UniProtKB/TrEMBL:C4R066"
                     /translation="MDPFSSPSLAQAESFSPPKPNSNITFRKDPKRIDHGLTSKIEAR
                     HTHIHSHSHSHINANFQSKNHTLRRESFSELSKSKSPFQRNLQLSSPSQRMPLTVPRN
                     DIVNLPSGIHLGAKAKIQLKSPKTTVKEDNPFLESSPAKRKSLDSVQRLTKIPKLDKP
                     DEETPMRPTKPNPASPATEQQSRIIDALGDGEDYPIIDNPSSPLLNHSKIQSFEEEAS
                     DNSPGVFNKSAMLDELDEDRRETLVSVHAEDEINEGEVEEPEREGEEQQDSILNELDD
                     NEESDEYTHLEEEDFESLGEIISNIKSVHEGNVIALESRLNDRVEENETLALELNSAN
                     QQLIALKSQLANLESDKINNESQITALRLEIEALNLSLAKQDKYKGVISSLILQLKDT
                     KLKYQDAFDIVCFYQKKFETDSAHNESVLAELNAKKSLIDQNLEKIQAQSREIEQLKE
                     IHNDHLDDSSKEIQSWKEKVKEITEQLDTQLQHRDQLLQDAEAEIKKLKATQEKLEGS
                     LNESLNNADSLRSQLADLVNEKAQQQSQFESLEQNVESLKKELQVKSIELDSYETNNK
                     ELKESLESLETRYNSKLESQSSKINELETSQQDKLTELEESYKISMAQKEERIKELEK
                     QLVEKQTFFSTGAQKGLVSELQQKIDDLQRELSTHDEQAEQKLQQLAQDLYVQYSAKH
                     EQKVSVLKKGYETKWSSKLNKVTEEKNTLKQEVQKLKQKLTSEREEKTRLVKLWDELV
                     DMESSK"
     gene            <520940..>521727
                     /locus_tag="PAS_chr2-1_0277"
                     /db_xref="GeneID:8198826"
     mRNA            join(<520940..520957,521023..>521727)
                     /locus_tag="PAS_chr2-1_0277"
                     /product="TFIIA large subunit"
                     /transcript_id="XM_002491126.1"
                     /db_xref="GeneID:8198826"
     CDS             join(520940..520957,521023..521727)
                     /locus_tag="PAS_chr2-1_0277"
                     /codon_start=1
                     /product="TFIIA large subunit"
                     /protein_id="XP_002491171.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0277"
                     /db_xref="EnsemblGenomes-Tr:CAY68891"
                     /db_xref="GeneID:8198826"
                     /db_xref="GOA:C4R067"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR013028"
                     /db_xref="UniProtKB/TrEMBL:C4R067"
                     /translation="MSNSEAARLYESIIEEVTAESRQDFEDSGIDESTLQDLRKIWRN
                     KLSESGVAEFSWTQNTKEEFSQQQQQQQQQLRSGDLQSNFRHQIDPLAGIQDIQIPND
                     IQLPTITPKNEDSGLEFPGMGQTDGAGKSYNFELHIDATPEQVEHMRRRLGKRQVDGP
                     GSDNDNVNDSDDINSDLDDTDDDEINSDDDNDEQEDNIMLCLYDRVQRVRNKWKCNLR
                     DGIVNMDGRDYTFQKATGESEW"
     gene            complement(<521798..>523720)
                     /locus_tag="PAS_chr2-1_0278"
                     /db_xref="GeneID:8198827"
     mRNA            complement(<521798..>523720)
                     /locus_tag="PAS_chr2-1_0278"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491127.1"
                     /db_xref="GeneID:8198827"
     CDS             complement(521798..523720)
                     /locus_tag="PAS_chr2-1_0278"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491172.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0278"
                     /db_xref="EnsemblGenomes-Tr:CAY68892"
                     /db_xref="GeneID:8198827"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R068"
                     /translation="MYSRRIWLATKIRPLRPVLRSQIRCINPFLPVDILDEVTNDDEN
                     TIREKRKLKRLQDLDEKIKNKKDGPINEYQTPQEEERNRERQKKENRQENWERFGSFL
                     FRCFETAGITFSSLAVLALSGYMYHKIYNSQVLSKINSAFDEGDPTLQLSMYKRTDNN
                     KYWVARPQQLLLDDIVNGKIKGRYFLLVGEKGTGKFSAILQSIRSVKGLNCTVVDGHS
                     DPEIFRIRLGQALNFGYHEDYIGSLFSIRGPRDTTALLDIERAFKKLEMVALKRVKSA
                     EEGVQVKPLIVVINNTHLIKDDEEGNKLIELLQQKAESLSGSGLATMIFNSDDYWVYE
                     RMKQLSTRLEVINFNDLGREDTIKVLKAARMKHYNVYLPLETANKIYDLIGGRPQHLA
                     LVSANKDPLLTSHQIIDREKTWFLNQCGLLGGDMDDDVMESGKLSTSAMLLMRELVQM
                     DREKFSLPLQNDDKIDHVLPSLPLWRARQVMTRPDYIQLFDNLNIFTIDCNSRVHADS
                     VPMMRAFHEIASQPGFDELLNETIERVSEIESLGRTRELVAKDLLLGGHYTVQEDKNN
                     KLNIKLHGGTRDLLESANEDDPIKMEDFSDGAHKKWWSKRMSHYRDSYKPEEVAELGL
                     TRNPEEQNSSVELSKS"
     gene            <524046..>525805
                     /locus_tag="PAS_chr2-1_0279"
                     /db_xref="GeneID:8198828"
     mRNA            join(<524046..524129,524231..>525805)
                     /locus_tag="PAS_chr2-1_0279"
                     /product="Triacylglycerol lipase of the lipid particle,
                     responsible for all the TAG lipase activity of the lip"
                     /transcript_id="XM_002491128.1"
                     /db_xref="GeneID:8198828"
     CDS             join(524046..524129,524231..525805)
                     /locus_tag="PAS_chr2-1_0279"
                     /codon_start=1
                     /product="Triacylglycerol lipase of the lipid particle,
                     responsible for all the TAG lipase activity of the lip"
                     /protein_id="XP_002491173.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0279"
                     /db_xref="EnsemblGenomes-Tr:CAY68893"
                     /db_xref="GeneID:8198828"
                     /db_xref="GOA:C4R069"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:C4R069"
                     /translation="MPQPSRAKQQTLQIKFWLFGLEVSYFVVNYVPAPIWKLMVLIFD
                     VFMFWFRKVYDVLSGRSATSRYKQDLQNAQSLEEWSYVASRLDSISGGELWRQNFISN
                     KYDYKLISERLHSLRNARESKDFPHLLTLLRSSLLRNFGGIAEKELYTRAYSGTKTLI
                     ETYVAEILKCLIFINDFEYKDDFTNTVNSFNQLKLDFFHDVRQTYGSTALILQGGSLF
                     GLCHIGVIKAMYFKGLLPRIISGSGVGAVVAAFVCCLIDDHLLSHLVTLSKQMANLPD
                     EVLDKRSGKVVENVVVRGFSEDTLNFMKYTKSTIKHLTFEEAYLSTGKVLNIMVHPTN
                     SSAPFLLNYITTPNVMIISALYCSMGSGVLVENAHLYVKDINGEIKPMDYPEPCIFMT
                     PHEANTYMGVTYTRLTELFNVNHFIVSLARPYLAALVGNGLRHSSTWYPKRVLRTVMG
                     LELQHRIDMLNRSGLLFGFIKRLAVDDKTPTTSTSEITIVPHLRTLVKDFTRIFDVSR
                     SNENIPYWILVGERSVWPLFPILWTRTAIEFTLDDLYNNQRKMR"
     gene            <526185..>530594
                     /locus_tag="PAS_chr2-1_0280"
                     /db_xref="GeneID:8198829"
     mRNA            <526185..>530594
                     /locus_tag="PAS_chr2-1_0280"
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter, multidrug transporter involved in multidrug"
                     /transcript_id="XM_002491129.1"
                     /db_xref="GeneID:8198829"
     CDS             526185..530594
                     /locus_tag="PAS_chr2-1_0280"
                     /codon_start=1
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter, multidrug transporter involved in multidrug"
                     /protein_id="XP_002491174.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0280"
                     /db_xref="EnsemblGenomes-Tr:CAY68894"
                     /db_xref="GeneID:8198829"
                     /db_xref="GOA:C4R070"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R070"
                     /translation="MERDTHEADPAQPVLSHNNSSGDEVLSYRAEDEQAQLEGVNLDR
                     LQSLTKQMSHVTASEMATMVDLNDFDLTRILAVFAEKAEQRGLPIKSTAVELKDVSVL
                     GVNDSASLLPTVSDLLYLPSTIARKIRNRKPALRHILKGVDFHTVPGEMCLVLGRPGA
                     GCSSLLKTIAGETSHFVRVEGDIAYNNIPQAEMVKRFKNELIYNPELDLHFPHLTVEE
                     TLSFALACKTPRIRIDDISRKKHVDNWLKILLTVYGLGHTRNTIVGNDFVRGVSGGER
                     KRVSIAEAMAANGTVYCWDNATRGLDASTALEFTESVRATTNLEQTTSFVTLYQPSER
                     IYELFDKVLVLYEGRQIYFGPADAAKQFFVDMGYDCPPRQTTGEFLTAVTDPLQRYPR
                     PGFENRVPINADEFQEYWRASSTYSDLQNQFQETLKAGLSETTKETFLKAAANEKMKG
                     VSDNSKYTVNYFEQLRLCIVRGFQRIKGDINYTIVMVVSALIQGLVVGSLYWNTPENS
                     SGVFGRAGVIFFAILFFVLMSLAEIANIFKDRPVLAKQIGYSLYHPSTEVIANALIQI
                     PVKFIASLFFSIVVYFLANMKRQPGPFFAFLLFVNLGSQTMAALFNLVAAVSPTLAVA
                     NAFDGLLVLSSVLYTSYMIQRPSMVPWFEWFSYMNPMLYAFESMLTNEFHGSIIDCSD
                     VDLIPNGPGYEDYPDQYRSCAITGANGRTYVDGDTYLDLSFEYSYSHIWRNMGILFLF
                     YVAFLVIHSVMSEIMNMSTSTADRLIFLKANDLPVEVAAALNGSASSNDEETGQDTSL
                     NEKYELERDKSEVKVSDKLLGSDEVFTWKDVNYVIPYQGSERTLLDHVQGYVKPGTLT
                     ALMGESGAGKTTLLNVLSQRIDVGVVTGDMLVNGNPVSASFKRRTGYVQQQDLHISEL
                     TVRESLIFAAKLRRPLSVPVAEKIQYVDQVIEILQMTKYKDAVAGELGAGLNVEQRKK
                     LSIATELVSKPDLLLFLDEPTSGLDSQSSWAIVKLLRQLADAGQAILCTIHQPSATLF
                     EQFDRLLLLRKGGQTVYFGDIGENSSVITGYFERNGARKCSPAENPAEYILEVIGAGA
                     TASITENWFDVWIKSPESQEVSQEISTLVTRAGNSTSSVDDAAHLGTFATPWHYQYQL
                     VLQRTAQQFFRDMEYFMAKFMLLLSGGLLIGFSFWDVKHTIVGMQNAMFAVFSAMILS
                     APLSNQIQSKAIASRELYEARESKSNTFHWSALLLSQFLVEIPYSVVFSTIFYICWYF
                     PVQLDNAPERAGVWWLHYCIFFQLYYISFALATVYFAPDLPTANVILSFLFNFIFAFC
                     GVVQPVDMMPGFWTFMNKVSPYTYFVQSFLGNVLHGREVHCAANEMTYIQPPSEQSCG
                     EYLTPFIEEHTGYVANPGAFEDCGFCKFAVGDQYLSTVGIKYSYGWRNVGFYWVYIVF
                     NLSAMLFLYYMFKVRKQSIFAPIIGLFGRKQKD"
     gene            complement(<530639..>531454)
                     /locus_tag="PAS_chr2-1_0281"
                     /db_xref="GeneID:8198830"
     mRNA            complement(<530639..>531454)
                     /locus_tag="PAS_chr2-1_0281"
                     /product="Subunit of Elongator complex, which is required
                     for modification of wobble nucleosides in tRNA"
                     /transcript_id="XM_002491130.1"
                     /db_xref="GeneID:8198830"
     CDS             complement(530639..531454)
                     /locus_tag="PAS_chr2-1_0281"
                     /codon_start=1
                     /product="Subunit of Elongator complex, which is required
                     for modification of wobble nucleosides in tRNA"
                     /protein_id="XP_002491175.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0281"
                     /db_xref="EnsemblGenomes-Tr:CAY68895"
                     /db_xref="GeneID:8198830"
                     /db_xref="UniProtKB/TrEMBL:C4R071"
                     /translation="MSHQAQDFSLFRSGEVIPQALIDSQAFRSCFTYTDTQGTSSSWL
                     TTCFVENLIFGTCNINKDANSFKTSNFSLKNPRSRVVIVSFLHGISFYNKTWVKYLGV
                     ESSFQGDENLSFFDLSTAEAPVDKLFKPVIAALKSSALPCTLILDHPELYFLTNQCSI
                     NEFMSQISYINSLANVLVSTFADANLIDLNETDSSTITHRQTEFLTKLYHRSQGIISI
                     RPLETGRADDVTGTITVSKGSISFEDEAKNLETNEQQYLYLVNKEGFVKVFFR"
     gene            <531600..>532940
                     /locus_tag="PAS_chr2-1_0282"
                     /db_xref="GeneID:8198831"
     mRNA            <531600..>532940
                     /locus_tag="PAS_chr2-1_0282"
                     /product="Cytosolic ribosome-associated chaperone"
                     /transcript_id="XM_002491131.1"
                     /db_xref="GeneID:8198831"
     CDS             531600..532940
                     /locus_tag="PAS_chr2-1_0282"
                     /codon_start=1
                     /product="Cytosolic ribosome-associated chaperone"
                     /protein_id="XP_002491176.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0282"
                     /db_xref="EnsemblGenomes-Tr:CAY68896"
                     /db_xref="GeneID:8198831"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C4R072"
                     /translation="MSLTLPALPSSVSTAASLGKYTAAVRKPIEPVGRHFLALYLWGH
                     TWSEFEKIQAETDVKKAEDVNEDAEFDIEQSEELIEHDPRDWKSADLYAVLGLNNYRY
                     KATEDQIRRAYRVQVLKHHPDKMGEKGGLDKDGFFKIIQKAHETLMDPVKRQQFDSVD
                     EEANIEPPAPKSKYDFFEAWGPLFASEGRFSKKQPVPELGNADTPKEEVDAFYKFFSN
                     LDSWRTFEFLDEDVPDDTSNRYHKRMIEKKNKAARQKRKTEDNKRLSELVRRAANEDP
                     RLKAFRDKEKEEKNKKKQEREAEAAKAAEEVKAKREAVERARAEAAKARAKSKAKPSY
                     QPIQTQSKGKGKGKGKGKGKKSTVSKEQRTESKINIRNSVKDANYFGTELQSEIDHDI
                     NVFLDNFEDEKSVEVSNAIAGATADAVKEIFDAAAKEYIEQGFITADDLKFFAK"
     gene            complement(<533607..>534428)
                     /locus_tag="PAS_chr2-1_0283"
                     /db_xref="GeneID:8198832"
     mRNA            complement(<533607..>534428)
                     /locus_tag="PAS_chr2-1_0283"
                     /product="Putative tRNA acetyltransferase"
                     /transcript_id="XM_002491132.1"
                     /db_xref="GeneID:8198832"
     CDS             complement(533607..534428)
                     /locus_tag="PAS_chr2-1_0283"
                     /codon_start=1
                     /product="Putative tRNA acetyltransferase"
                     /protein_id="XP_002491177.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0283"
                     /db_xref="EnsemblGenomes-Tr:CAY68897"
                     /db_xref="GeneID:8198832"
                     /db_xref="GOA:C4R073"
                     /db_xref="InterPro:IPR004114"
                     /db_xref="UniProtKB/TrEMBL:C4R073"
                     /translation="MKRKQNGQGKDRKKRYKPGANGIVEPGQYGIFATCVRGKERACL
                     SELTELVLDKVDEYYGEDFYKQQKDEDENKEGETNEQEGKDESAVSIEESIRQELQEM
                     GETKKGNTILINGVELGTECFVFVKMKKPLIPSQFATKLVQELFDNRRKATKFTLRLS
                     PVDGSCSGTLPELTKLAQRLLKPHFHQDKEVQKPLKFAIQVNRRNFSVLEKLDVIKTV
                     ASCVGNEGGHKVDLKDYDVLILVECFKNNISMSVLDGKIYDKCKRFNLQEVLNVK"
     gene            complement(<534510..>535766)
                     /locus_tag="PAS_chr2-1_0284"
                     /db_xref="GeneID:8198833"
     mRNA            complement(<534510..>535766)
                     /locus_tag="PAS_chr2-1_0284"
                     /product="Subunit of Elongator complex, which is required
                     for modification of wobble nucleosides in tRNA"
                     /transcript_id="XM_002491133.1"
                     /db_xref="GeneID:8198833"
     CDS             complement(534510..535766)
                     /locus_tag="PAS_chr2-1_0284"
                     /codon_start=1
                     /product="Subunit of Elongator complex, which is required
                     for modification of wobble nucleosides in tRNA"
                     /protein_id="XP_002491178.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0284"
                     /db_xref="EnsemblGenomes-Tr:CAY68898"
                     /db_xref="GeneID:8198833"
                     /db_xref="GOA:C4R074"
                     /db_xref="InterPro:IPR008728"
                     /db_xref="UniProtKB/TrEMBL:C4R074"
                     /translation="MSFRRRQEVIGGAPSAPSPGVNSSRNPVLGAPSRGPLSPPSRAP
                     LRNTPHVNPTGPSPGLHNRASNNDMLTQHPGIRPSTITSQPTLSTGSADLDRLLAHQG
                     LPLGNSLLIEENGTTDFSSVLLKVYAAQGIVHNRTAGKLNTHVIVIGSDQHWGRQLPG
                     LYRGSSKEQKKNKVATNESKVTVGNINDSNLKIAWRYGLKKDSPSEELSDPSQTYPNY
                     QHAFDITSSLLPAPAANEMSFVPLNVPDYSKVMLHIQRIISQHQGKLIRIVLQSFLNP
                     AMYPPQLIQHNQSLNFIKSLRHLLHNSPNISLVSSVNLDLYPRHNALVTMIEMLFDGV
                     IELKPFPPELVQMMERIYKNQPAKIKQGFLNVLKLPVLSESGLMVIKEIEYCFKNGKK
                     KFEIEEWSIPIDEEEEERSTTKDIEF"
     gene            <535903..>538352
                     /locus_tag="PAS_chr2-1_0285"
                     /db_xref="GeneID:8198834"
     mRNA            join(<535903..537543,537585..>538352)
                     /locus_tag="PAS_chr2-1_0285"
                     /product="Mitochondrial integral membrane protein involved
                     in mitochondrial fusion and maintenanceof the mitoc"
                     /transcript_id="XM_002491134.1"
                     /db_xref="GeneID:8198834"
     CDS             join(535903..537543,537585..538352)
                     /locus_tag="PAS_chr2-1_0285"
                     /codon_start=1
                     /product="Mitochondrial integral membrane protein involved
                     in mitochondrial fusion and maintenanceof the mitoc"
                     /protein_id="XP_002491179.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0285"
                     /db_xref="EnsemblGenomes-Tr:CAY68899"
                     /db_xref="GeneID:8198834"
                     /db_xref="GOA:C4R075"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR027091"
                     /db_xref="InterPro:IPR027094"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R075"
                     /translation="MVDKTTPEDNKTVVNLDLDDKDSKNEHHSNGNAPTQLIFNGRDL
                     EGSTLVDGQHHHKIPPTMEGNSLTQDIDSHVQQLKYNDNRVALDRAINALVDILRQMV
                     EENKSRPVLYPTTDNDLNVLKLNIKMEHSTVEDYSRLNKDSLAHLLSEKVTNVIRHLF
                     SLKDRIDDTASKVFVTGDLNSGKSTFCNALLRRKILPEDQQPCTNVFCEVIDPRDNNG
                     LEEVHAVPIGVTYNIRDESTYQIFPISELESLVYKSSLYSILKIYVHDQRPIEQSLLK
                     NGVVDISLIDAPGLNLDSYQTTQVFSRQEEIDLVVFVVNAADLFTLSGREFITAAANE
                     KNLIFIVINKFDCIRDKQRCKERILNQISELSPQTHKDASEFVHFVSSEEVVNGLPGP
                     SDDGDENNGPDNSGRPDPDFDHLEASLRKFVLEKRAVSKLLPAKTYLINLLDDLDTVF
                     KLNERLYKENRNLLLSQLDEITPQYEKAMSSSSKISGHIDRLIETTATECYNFTRDAI
                     KNTIDNIEDTPLIAFPGLNDMYRFTKETRMALVEKVLGSTFEIIRDVGRKALDDDNLL
                     ADKSLRDDYMFTSKKHHQLRRVIDEEISIKDFFDPSYERFMQAIGLSGTFSSVSNTSS
                     PSWWVLSGKQGQIWKNSLSAVAVYSSTKIFHNGLFMVKNFVSIRDVFNWRFLQNVVTP
                     LSIGMAIVSVSYLVYDIPTAFQRKSIQRIKRHLGSTDYIHNNSSRVSKECTKVLNYAS
                     REVMNSFRTSIDTTAAKKDKIISQLKDSEQSVQFYHRLFRSIRTQGEIVRGIKIDNFY
                     SSVD"
     gene            <538527..>539465
                     /locus_tag="PAS_chr2-1_0287"
                     /db_xref="GeneID:8198835"
     mRNA            <538527..>539465
                     /locus_tag="PAS_chr2-1_0287"
                     /product="Protein localized to COPII-coated vesicles"
                     /transcript_id="XM_002491135.1"
                     /db_xref="GeneID:8198835"
     CDS             538527..539465
                     /locus_tag="PAS_chr2-1_0287"
                     /codon_start=1
                     /product="Protein localized to COPII-coated vesicles"
                     /protein_id="XP_002491180.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0287"
                     /db_xref="EnsemblGenomes-Tr:CAY68900"
                     /db_xref="GeneID:8198835"
                     /db_xref="GOA:C4R076"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="UniProtKB/TrEMBL:C4R076"
                     /translation="MSYRPQFQQNQGGPPYQHLGAPYQSYSTQQPSPNSLNGFFNQFE
                     TISNKIEEIVDKYTKPLKPFMPAIARFFIVATFYEDSLRLVGQWTEQVYYLHVYRRYW
                     GWFVKLFLTTNIIVMLVGSTLLIARKRSEIASSFLVAVVFFQGIVYGLFFDLGYFLRN
                     VSVIGGLLLAFSDSIVRDKRNLSMPGLPLMEHKDNKKYFLLAGRIMLILLFATFAFNS
                     NWSLGRILVVLVGFITSISIVVGYKTKFAAIVLTLMLMTYNVIVNHYWSFGYKDSRRD
                     FLKYEFFQTLSIVGGLLIIVSTGAGELSFDEKKKIY"
     gene            <539591..>540199
                     /locus_tag="PAS_chr2-1_0288"
                     /db_xref="GeneID:8198836"
     mRNA            <539591..>540199
                     /locus_tag="PAS_chr2-1_0288"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491136.1"
                     /db_xref="GeneID:8198836"
     CDS             539591..540199
                     /locus_tag="PAS_chr2-1_0288"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491181.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0288"
                     /db_xref="EnsemblGenomes-Tr:CAY68901"
                     /db_xref="GeneID:8198836"
                     /db_xref="GOA:C4R077"
                     /db_xref="InterPro:IPR007062"
                     /db_xref="UniProtKB/TrEMBL:C4R077"
                     /translation="MTNKPRGILRNAPQDTNYDENAKVDEEFDRKKVLENTNINAKLF
                     KDAADAAQTKGDKIRQKLKEKKQQLEEEHLKWNEANLYMNEQEKCATMKIDEPKTPYE
                     GGVDPTGEYYQDDEEELDNFALGEPEFTVPKEEQEPFEPSEPSEPSSEDSETEHAPKE
                     TAQQKHKRFEEMRKQHYHLKGSVLGKPLSVSDEEEDETEESK"
     gene            complement(<540321..>540902)
                     /locus_tag="PAS_chr2-1_0289"
                     /db_xref="GeneID:8198837"
     mRNA            complement(<540321..>540902)
                     /locus_tag="PAS_chr2-1_0289"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491137.1"
                     /db_xref="GeneID:8198837"
     CDS             complement(540321..540902)
                     /locus_tag="PAS_chr2-1_0289"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491182.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0289"
                     /db_xref="EnsemblGenomes-Tr:CAY68902"
                     /db_xref="GeneID:8198837"
                     /db_xref="UniProtKB/TrEMBL:C4R078"
                     /translation="MFYQDSIQSDDKETLRTSPLLYQFNDVKKVFDDIKISSKNLFKI
                     YASKDSETFYDVWRINGDVPERSNTFYSQFPRKPSNLDTEHHYEYVHLNHYYIGRWLP
                     DWVLTLLFPMNSGVKLTGKGVPTRNECVKCQSLNGRLTWDKSGNWSCVDDTFVNNGEF
                     FESYREFLRWRGNHEKEGVYEHQTVPYTFIIRT"
     gene            complement(<541229..>541633)
                     /locus_tag="PAS_chr2-1_0290"
                     /db_xref="GeneID:8198838"
     mRNA            complement(<541229..>541633)
                     /locus_tag="PAS_chr2-1_0290"
                     /product="Late endosomal protein involved in late endosome
                     to vacuole trafficking"
                     /transcript_id="XM_002491138.1"
                     /db_xref="GeneID:8198838"
     CDS             complement(541229..541633)
                     /locus_tag="PAS_chr2-1_0290"
                     /codon_start=1
                     /product="Late endosomal protein involved in late endosome
                     to vacuole trafficking"
                     /protein_id="XP_002491183.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0290"
                     /db_xref="EnsemblGenomes-Tr:CAY68903"
                     /db_xref="GeneID:8198838"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:C4R079"
                     /translation="MKINPLTKIISLATVLAAGFLLIVLAGAIYGNWSPVAIALVFAF
                     AHLPIAISNQLNVNFDDFLNESTAYALDFGKFLSAFLFVSGVALPILLFHSHILQFPA
                     MILTLSGGILIYGTVFTFTEFFDAREDDVFDV"
     gene            <541861..>542746
                     /locus_tag="PAS_chr2-1_0291"
                     /db_xref="GeneID:8198839"
     mRNA            join(<541861..541863,541916..>542746)
                     /locus_tag="PAS_chr2-1_0291"
                     /product="Alpha 6 subunit of the 20S proteasome"
                     /transcript_id="XM_002491139.1"
                     /db_xref="GeneID:8198839"
     CDS             join(541861..541863,541916..542746)
                     /locus_tag="PAS_chr2-1_0291"
                     /codon_start=1
                     /product="Alpha 6 subunit of the 20S proteasome"
                     /protein_id="XP_002491184.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0291"
                     /db_xref="EnsemblGenomes-Tr:CAY68904"
                     /db_xref="GeneID:8198839"
                     /db_xref="GOA:C4R080"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C4R080"
                     /translation="MFRNNYDNDSVTYSPTGRLFQVEYALEAIKQGSATVGLVSKTHV
                     VLVALKRNAEELGSYQKKIIEIDDHMGIALAGLAPDARVLSNYLRQQAMNSKMVFNRP
                     LSITKAAFSIADKAQENTQQYGGRPYGVGLLVGGVDETGPHLFEFQPSGSVLEYHGAA
                     LGARSQAGRTLLERSLEEIKTASRQELIKLGLLALRDTLAQDKELTAANTSVSVVGID
                     EKFTLYDDEDVQQWLDLLDSTANSRNRDTHDAPEDDNDNTTAPDAGVDTEGDVPVQDA
                     D"
     gene            complement(<542787..>543392)
                     /locus_tag="PAS_chr2-1_0292"
                     /db_xref="GeneID:8198840"
     mRNA            complement(<542787..>543392)
                     /locus_tag="PAS_chr2-1_0292"
                     /product="Ureidoglycolate hydrolase"
                     /transcript_id="XM_002491140.1"
                     /db_xref="GeneID:8198840"
     CDS             complement(542787..543392)
                     /locus_tag="PAS_chr2-1_0292"
                     /codon_start=1
                     /product="Ureidoglycolate hydrolase"
                     /protein_id="XP_002491185.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0292"
                     /db_xref="EnsemblGenomes-Tr:CAY68905"
                     /db_xref="GeneID:8198840"
                     /db_xref="GOA:C4R081"
                     /db_xref="InterPro:IPR007247"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR024060"
                     /db_xref="UniProtKB/TrEMBL:C4R081"
                     /translation="MVYIHKSSAKTTIPTQPLTPASFKPFGSIICTDQQLDHPHKSAA
                     NQGTAIKLFQVSQIVNNYSSCPSGNPATINWNIFRCTVPNTLTKSDQGNRVYTGKVLE
                     RHPYTTQTFLPMGISKEKDTYMVICALNDETTDQKLPDLSTLTAFICKGNQAVTYGAG
                     VWHAPMIVLNETVDFAVLVHENDQPQENCEEVEYEGLQVLI"
     gene            <543803..>544252
                     /locus_tag="PAS_chr2-1_0293"
                     /db_xref="GeneID:8198841"
     mRNA            <543803..>544252
                     /locus_tag="PAS_chr2-1_0293"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491141.1"
                     /db_xref="GeneID:8198841"
     CDS             543803..544252
                     /locus_tag="PAS_chr2-1_0293"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491186.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0293"
                     /db_xref="EnsemblGenomes-Tr:CAY68906"
                     /db_xref="GeneID:8198841"
                     /db_xref="InterPro:IPR001602"
                     /db_xref="UniProtKB/TrEMBL:C4R082"
                     /translation="MPSGTSHWEQVEFSFKKHQKGCHLVTSEVLSKIPQLKDYTIGTL
                     TVFIKHTSAALTLNENCDPSVRVDMHNTLARIAPEDERLYTHNDEGPDDMPGHVKSSL
                     LGASVTIPITNGRLNTGTWQGIWLCEFRDEVYRGRTAVATINGLKAK"
     gene            <544698..>546158
                     /locus_tag="PAS_chr2-1_0294"
                     /db_xref="GeneID:8198842"
     mRNA            <544698..>546158
                     /locus_tag="PAS_chr2-1_0294"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491142.1"
                     /db_xref="GeneID:8198842"
     CDS             544698..546158
                     /locus_tag="PAS_chr2-1_0294"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491187.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0294"
                     /db_xref="EnsemblGenomes-Tr:CAY68907"
                     /db_xref="GeneID:8198842"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C4R083"
                     /translation="MNLPIEIWSLISDHLDGNDLIKTRMTNHCMWQKLQDNELWRPKL
                     EDFYSLNKDCEYQQYQDKGQLFQLYAKKRSIKSQLKGWLLNLCNGTGQLKDFQYWRND
                     LVPIFLQLQNEFQDIERLTERFFISNCLQVHRYSIFYQLLLSVCQKKKDLLLEDVFIA
                     FHALHDSFYDNFKRRNQVYKRLTKSQIVEKNFLSNTQVVLTILQALRRSNLTLLHPLE
                     LSAMAQKACLQLGIKTTIHKMFLEVSDPTYKSGSSFLYISKDQVLSYSRENMFRLLAR
                     RSINFTDLEVSIPQFIERLCYHLNLSPFVVSLYRIFCQNDCSYFEFQTHKTIVGDFLR
                     KQFQLHLPVLQNLFPNFQDFGVVELDISSLQKDYVTCLYSYLYLTNQHSSTQFPIGSV
                     IKTRNNESAAIIGNKVQRDFVGTNKVVIYYHCLTNKNAPVICQEGSIIRQKVEDVNEL
                     FPNLDELGCFFKRYDKSSGMFVPNIYLERYLHISVK"
     gene            <546255..>546698
                     /locus_tag="PAS_chr2-1_0823"
                     /db_xref="GeneID:8198843"
     mRNA            <546255..>546698
                     /locus_tag="PAS_chr2-1_0823"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491143.1"
                     /db_xref="GeneID:8198843"
     CDS             546255..546698
                     /locus_tag="PAS_chr2-1_0823"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491188.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0823"
                     /db_xref="EnsemblGenomes-Tr:CAY68908"
                     /db_xref="GeneID:8198843"
                     /db_xref="UniProtKB/TrEMBL:C4R084"
                     /translation="MSTLESQLKSTDGSVLVKTSTGKIKVRKGQTEEAFLEQKQQFLE
                     TGPQINDYNWLIEDYDKRLEKFTQLAPEERKGKHFFDPLNKVDTEKIIRCLNLLYYEK
                     RYDECLQRCHFLIGIEDADIEKNKKFQLFKSDVASIKSACELKSS"
     gene            complement(<546769..>547137)
                     /locus_tag="PAS_chr2-1_0295"
                     /db_xref="GeneID:8198099"
     mRNA            complement(<546769..>547137)
                     /locus_tag="PAS_chr2-1_0295"
                     /product="Subunit of both RNase MRP"
                     /transcript_id="XM_002491144.1"
                     /db_xref="GeneID:8198099"
     CDS             complement(546769..547137)
                     /locus_tag="PAS_chr2-1_0295"
                     /codon_start=1
                     /product="Subunit of both RNase MRP"
                     /protein_id="XP_002491189.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0295"
                     /db_xref="EnsemblGenomes-Tr:CAY68909"
                     /db_xref="GeneID:8198099"
                     /db_xref="InterPro:IPR020241"
                     /db_xref="UniProtKB/TrEMBL:C4R085"
                     /translation="MKRERIDGTLIKHPPMRKYKVTEEKNTFFVKSSTLYVSAIKQIS
                     KKVEKLNATQAKNKVFIVKGMGKSIPKVLSIGVYFQLKNYRVEVFTGSVKVLDEFEKE
                     DDDSILSKRTVSSVEVRIIL"
     gene            <547302..>547787
                     /locus_tag="PAS_chr2-1_0296"
                     /db_xref="GeneID:8198844"
     mRNA            <547302..>547787
                     /locus_tag="PAS_chr2-1_0296"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491145.1"
                     /db_xref="GeneID:8198844"
     CDS             547302..547787
                     /locus_tag="PAS_chr2-1_0296"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491190.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0296"
                     /db_xref="EnsemblGenomes-Tr:CAY68910"
                     /db_xref="GeneID:8198844"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:C4R086"
                     /translation="MFPPTLLELKANKPTTMMLASPPSLIPQQGIEKAKPKSVNLQLN
                     KLKYKKAWELAYSPAKNIPMNLIMMYFSPNSLQIISIMMTINLFTTPLKDIFNCNEIF
                     EKSVDVSVIDTYDLIMMKLFFIVCHFGTLLVGMWKLNNMGIIPTKADFIGSINNTLET
                     I"
     gene            complement(<547796..>550216)
                     /locus_tag="PAS_chr2-1_0297"
                     /db_xref="GeneID:8198845"
     mRNA            complement(<547796..>550216)
                     /locus_tag="PAS_chr2-1_0297"
                     /product="Essential 113kDa subunit of the exocyst complex"
                     /transcript_id="XM_002491146.1"
                     /db_xref="GeneID:8198845"
     CDS             complement(547796..550216)
                     /locus_tag="PAS_chr2-1_0297"
                     /codon_start=1
                     /product="Essential 113kDa subunit of the exocyst complex"
                     /protein_id="XP_002491191.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0297"
                     /db_xref="EnsemblGenomes-Tr:CAY68911"
                     /db_xref="GeneID:8198845"
                     /db_xref="GOA:C4R087"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="UniProtKB/TrEMBL:C4R087"
                     /translation="MLTHSNEVSKESLLLHSLSSDDYIENIGPIIRTAIKNNGLDNLI
                     ETLQETVCDKEQQLQEVSVKGSSDIKLAVGSIIEVKKISDDLRYKVLEINDDLESTGK
                     VLNEKNKVSIKYKKLYNKINETIFVLKSCLQILELTNKIIDLIGKKSFYHALKNLQDL
                     VNIHLNEIETFEFTKKIISSVPTLHKMIKEDSFSFVKKWLGNLERHFHTIGDDCFQQL
                     QALNSYWAETRSQNPILAQYSINSPIELSVRPDKFKTFDPFSLNNITLDSVYDSMMVY
                     DTINELDELKEQFKKEWLIKKDRLVYPMYNSNPSQEMFLDRNQLRDFIYSLIGLLVCD
                     RLIGVKTHFKLRSSNESREMFVTICKRLVPILKKHVDEKITTLDDIIFFKKLICCSIQ
                     ILEQCDYPIENLYSILLCILQRYMKIITNNFKIELVKNMNADDSMPLVVKDMESYKSI
                     SIISWYRHTPSNNRFPKQLPFSSIYPMTCLQIQNLIKEVNEFIDDFYSYQGREILRIT
                     IETIDSVLNNIVIKNLRHKIESTIKEVIAQNLINLEFFSTSVREIENLLSYSSESRSI
                     DSIHLTAYDNFLATRKLAEDKLFEMVDTKVEDLLDFVDYNWRTKEQNPEPNIFIKDIG
                     QFLQMMFTSTFSNLPRTVKSLLLLRTFDLLSSYFLDFLKRSSLFTKEAIYNFDMDITY
                     IESIINELNGQNQNQPADEDEEKSIEEHSIPTSVSLQSTFIELRQLINLLKSGTLDEF
                     REQSIRMRKYDRIKPEDAISAIHKLEREPEIGEEANELQQNSAIASISGSGRFARFGY
                     KFKKSTAG"
     gene            <550402..>550995
                     /locus_tag="PAS_chr2-1_0298"
                     /db_xref="GeneID:8198846"
     mRNA            <550402..>550995
                     /locus_tag="PAS_chr2-1_0298"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491147.1"
                     /db_xref="GeneID:8198846"
     CDS             550402..550995
                     /locus_tag="PAS_chr2-1_0298"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491192.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0298"
                     /db_xref="EnsemblGenomes-Tr:CAY68912"
                     /db_xref="GeneID:8198846"
                     /db_xref="UniProtKB/TrEMBL:C4R088"
                     /translation="MNRVIIVGQKKTAKIALLRSLFEGVTERSDGDDNSGLILSNVPL
                     STRYYSCNLDFMVDEYDDSKEWEDWCEEILSVEALELREAINGIIFIFDFSSKSILQD
                     LTKLSKVYDQIEQDFLLRNKDSIQWEGIKLAVGFSRSPVAQQLLDEVYDASLEKGIEL
                     VDLSIASQENAYGEATGIRRVKEILETCSWPDVVKLR"
     gene            <551196..>551737
                     /locus_tag="PAS_chr2-1_0824"
                     /db_xref="GeneID:8198847"
     mRNA            join(<551196..551246,551294..>551737)
                     /locus_tag="PAS_chr2-1_0824"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491148.1"
                     /db_xref="GeneID:8198847"
     CDS             join(551196..551246,551294..551737)
                     /locus_tag="PAS_chr2-1_0824"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491193.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0824"
                     /db_xref="EnsemblGenomes-Tr:CAY68913"
                     /db_xref="GeneID:8198847"
                     /db_xref="UniProtKB/TrEMBL:C4R089"
                     /translation="MIRTFVRNISYKPQPQLFIHELPSLNKAKLSFHENPNKLEVGII
                     NNVQGKSLENLKILPKDFEENKEFLSKLQEIIKNNIQNDFAFIVEAGAYPSSHLPIYD
                     FRLPPSHGRIPEVENVFGYVKVSDDGVIEPGSYQSNNMYRLLSGTDGPINLSDYLLEQ
                     IQNS"
     gene            complement(<551747..>553456)
                     /locus_tag="PAS_chr2-1_0299"
                     /db_xref="GeneID:8198100"
     mRNA            complement(<551747..>553456)
                     /locus_tag="PAS_chr2-1_0299"
                     /product="Protein involved in proteasome-dependent
                     catabolite degradation of fructose-1,6-bisphosphatase"
                     /transcript_id="XM_002491149.1"
                     /db_xref="GeneID:8198100"
     CDS             complement(551747..553456)
                     /locus_tag="PAS_chr2-1_0299"
                     /codon_start=1
                     /product="Protein involved in proteasome-dependent
                     catabolite degradation of fructose-1,6-bisphosphatase"
                     /protein_id="XP_002491194.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0299"
                     /db_xref="EnsemblGenomes-Tr:CAY68914"
                     /db_xref="GeneID:8198100"
                     /db_xref="GOA:C4R090"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:C4R090"
                     /translation="MSLGNDRESKRFCVPSYLRKLKKGKELLQKSTSITESDNGIERT
                     QQFTQNLAKFGILGNNPSQLMQNEDYTSHLVNLFQERQQVAGNPPLSNTDSSSANGTS
                     NANDDEELINEIDSPMEKMVYEELMYKKDSVAMLPTTWNIPGTSTFTESENGLNLSTN
                     FDPIENPRAHSATSNNGRSATRADMSVPVDCGIYYYEIEILVGLREADISLGYLQYGE
                     DSSSANISNAPGFENGTYGYNGKEGQILNLSNSIHTKYGTTFGLNDTMGCGINYYTET
                     IFYTKNGVFLGDAFYGISSTRAHYPIVGMGVGNQIRTNFGFTGNFLFDIDNYVQDFYR
                     SCLKYMTSSNTLDFNALNCDLQELKIPAVLSKDPSYCLNKLIHSHFERNGWQDCVDDL
                     REDTSLEFEQSNTAYPKIGARGKIKSLIESGEIDEAIANIKQHFPQLVSSVSLSFNLM
                     LLKLINLVKKDNVNGIIAYSKELFSKFDTIPQFDRRIKNVLTLIAFKDPMDSNYSCLL
                     DPIENYKVSELFNRLAIASVSNNQVNPKEPFNEIRLKALEKLNKLDNHTRILGDKDEF
                     FDF"
     gene            <554946..>561179
                     /locus_tag="PAS_chr2-1_0301"
                     /db_xref="GeneID:8198848"
     mRNA            <554946..>561179
                     /locus_tag="PAS_chr2-1_0301"
                     /product="Voltage-gated high-affinity calcium channel"
                     /transcript_id="XM_002491150.1"
                     /db_xref="GeneID:8198848"
     CDS             554946..561179
                     /locus_tag="PAS_chr2-1_0301"
                     /codon_start=1
                     /product="Voltage-gated high-affinity calcium channel"
                     /protein_id="XP_002491195.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0301"
                     /db_xref="EnsemblGenomes-Tr:CAY68915"
                     /db_xref="GeneID:8198848"
                     /db_xref="GOA:C4R091"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:C4R091"
                     /translation="MTDKHRKNNSFESGGAISSSSSLNSRGSSTTRHNAGNQDIPHVS
                     IDDTDSGRESRSPRRFQKQISPFRSPRLGFLNNLHSPKLKTKFEPAYHELEDQDDGND
                     NDVSRTMPTLRIDTEYSETGSNPFLVADEQPKSPSGSFLHSPILENAQSSDVLNTGLE
                     LALGERLGKGAWLPTAENADETQDQDFTNYQEHSIPDDGSQAQKYDQSSSLSPYENIE
                     MASLNSKLSNIETRVESNSSKPSSPKLDTSPKKVTSAVRRLSLRVSGKDDLEESQNMR
                     TSGDMPQIYLSDTSDSNDYLQPAVSKSDFLSVHPESTRGSFLPTDGKQDGLSSIGSAK
                     EEVQKHEDEHEEICLFGSTLRLFDNDSRVRQRCAKIVMHKYFDPVVVFLIFLVTVLLS
                     YQLWIPEVRGYHHAEEYTSVDWVLVFIYVLFTIETVLKIITFGLVDDSQMYEALNITM
                     KTNQFWLFWDRWDWKKLQFKSQTSSYRKTMSEPSEKFSHSSTKLNRAYLRVSWNRIDF
                     VSVFAFWISLFLSINHYDLRNGIFIFRSLMCLKILRLVNLTHGTFTILKALKEAIPEL
                     IDVILFLVCFWSFFAILGVQCFKASFRRQCVWTNPADPTDTFVNEMQFCGSYLDNGRT
                     MPYIYSNGESSGIAKGYRCPQNSVCVSDVNPYGGVLSFDNIAHSFEIVFVIMSANTFT
                     DLMYYVIDSENLAASLFFIVTLFTLTVWLVNLIIAVIVHSFMRIKDNIKAQNKSRNAD
                     RLLISKTCKKQHETYSKTKRILYYSKFEPLFCLLIVCNIAIRAKFDNASIVYRFDCAV
                     TIVLLLEIIARFCIFLPKWRIFFYSYANVIDLLLAVITALIIIPPIRTNLNIAYDWLS
                     FFFLFRIYRVVMMISYIKMTWYRIIVNLQSIIDLSIFYFVLLFLVSIIVTRLTEGILP
                     EEEIEENMLTLYNLPNSFISLYIITTTEDWTSILYLVQQYSPNTSTAVFVACYLIFWF
                     FFSNMLIFNIFIAVIAKSLEVSEMDKRKLQITSFYNKLKRHLNEQKYTGLLSSFKRKF
                     TKKSDYKDKEEFDEALLLLLLNGKLNEYLMVNAAQKPESNRIYNYISKFSFVQKIEKF
                     LTSCFQNPFYNFDSFHNGYKKRDDLTFAEASQFLMDQKQLLANERTKYLKENPFYNTS
                     LYIFAPNNKLRMKCQRIVRPTNGKRIEGVQPNEKLKDTFLFVSFLVTIMMVVSVCIVT
                     PLYRREYAFYSSDWGWPTYLDCAFTIFFTLEFIVSVIADGLAFTPHAYLRSPWNCIDA
                     AVLITLWINFISELQHSGPASRVVNGFRALRAFRLLTLSSTAKETFQNTMISGFWKIL
                     NAAVVSMTLLVPFSIWGMSIFKHRLGYCNDEESTMAECMDEFANEVFNWEVLSPRVYV
                     EPPLYLDDFVTSFKSLYEIISLEGWVDLLEDVMNITGLGLPPSHFADPFNGLFVVLFN
                     FCSTVFILTLFVSVIISNYSKNTGTAYLTEEQKSWYEIEKVLGTVKPSKRRDASRFGP
                     VTRWSYRLVVERNVYWKAFLNTCLFVHTIALFCEIYPSPAMLNDFRYAAYLICSIAFT
                     INVILTMVAIGPKDFFTSRWNLFKTVVVIGALLTSAIAYDLPRNTVFANINKLFLISL
                     LFFVIPRSDRLNQLLKFASASLPALLSLAYTWGVLFLVYAIAMNQIFGLTRTNENSSN
                     NVNFRTVPKALILLFRMSFGEGWNYVMNDFAVEAPFCFYSSNVYDSDCGSKSYAYFLF
                     MTWNILSMYIFVNMFISLVVDSFSYVYRSSGPLSNVTRGELRLFKQAWLPFDQRGTGY
                     ISEERLMSFLRKPKGVFSYHIYDERYSVTTLSKRWFVQHNASDPYDVFIDYGAMSTDI
                     THLSQMRLKTQNRIQTYERMVEYFRLINRRNNFKGIDFTSTIRRLALVTLFEESSCLK
                     LEDFLTHFMTNQKCDLAIKEKRVIETLKMVICRWKFKMKDYDALRSMVLEDELNTAFI
                     KQEFIPTESENPFEETESNKLQGEYPKPDIQAQPYPKFDYHNTFDRYDPYNYASYGYR
                     GDEHGFSQDIRLRNLTTSNDETTVNPFVHTSVEADENDSDKKTTTSVKETELASRTSS
                     SST"
     gene            complement(<561226..>563451)
                     /locus_tag="PAS_chr2-1_0302"
                     /db_xref="GeneID:8198849"
     mRNA            complement(<561226..>563451)
                     /locus_tag="PAS_chr2-1_0302"
                     /product="Putative catalytic subunit of a class II histone
                     deacetylase complex"
                     /transcript_id="XM_002491151.1"
                     /db_xref="GeneID:8198849"
     CDS             complement(561226..563451)
                     /locus_tag="PAS_chr2-1_0302"
                     /codon_start=1
                     /product="Putative catalytic subunit of a class II histone
                     deacetylase complex"
                     /protein_id="XP_002491196.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0302"
                     /db_xref="EnsemblGenomes-Tr:CAY68916"
                     /db_xref="GeneID:8198849"
                     /db_xref="GOA:C4R092"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:C4R092"
                     /translation="MEILKEEATESNGKRKLEEESDALQLSKQEGEGHLSGLPPSGKW
                     DDNQIVNGSVIVPVVEPKLRYITLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRI
                     YRIYKILAENGLITDPTLSGIDQIGDYMLKIPVREATAEEILLVHSEEHLKFIESTSS
                     MSRERLLEETEKGDSVYFNHDSLLSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHH
                     AEPDSPGGFCLFSNVAVAAKNILRNYPESVRKIVVLDWDVHHGNGTQKAFWEDPRVLY
                     ISLHRYEQGKYYPGTKAGGADQCGENEGLGKNINIPWPVGGMNDADYLYAFRKVVMPV
                     CREYAPDLLIISSGFDAAEGDIIGGCHISPAGYSQMTHMLKSLARGNVCVVLEGGYNL
                     DSIANSALSVTKVLLGESPEEPKVTVPSAHAIEVIDDVIKIQSQYWKTLQPAYTGICF
                     TNPSIMGNYSLLVNPATEKKVLSDLAVNPRLCDAVRNSQAQYLSSKFGFINLPVVSGK
                     GLTSPSLDNQVLSTKDIFQANTIIIVIHDPSDVWARQDPRSGLLDLSGSMIVDTSSKF
                     VEWAVNLKYGVIDINVPLTLTGKDDETYNNVTASQELLLYIWDNYIQYFPVTKIALVG
                     FGDAYNGVIHLCGHREVRSIVKASINFLDRTPLRAIVSSIDESVTDWFYKNSLVFTST
                     RHPCWGEQGTSEMKRPRKKYGRVLKADIDGLPNIVDERFEETTDFILDSIEEYEDESS
                     N"
     gene            complement(<563827..>566202)
                     /locus_tag="PAS_chr2-1_0825"
                     /db_xref="GeneID:8198850"
     mRNA            complement(<563827..>566202)
                     /locus_tag="PAS_chr2-1_0825"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491152.1"
                     /db_xref="GeneID:8198850"
     CDS             complement(563827..566202)
                     /locus_tag="PAS_chr2-1_0825"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491197.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0825"
                     /db_xref="EnsemblGenomes-Tr:CAY68917"
                     /db_xref="GeneID:8198850"
                     /db_xref="InterPro:IPR007365"
                     /db_xref="UniProtKB/TrEMBL:C4R093"
                     /translation="MSYQQLAGEDPPRLPPDYNDIERFNIEEPESEQERRSLREVTRD
                     MADQLNSKLVIPITRVLDPVYEYYSIASMKFDSYLAKVGNPLIVKRLFFVFLVALLMY
                     VITITGLYDNAYGSYTGEFRSNDALFAFLDEQVSGAQLEEQLEYISSMPHAAGTAGGL
                     SLARYVDKFIADCGLDLRDFFEVRPFINYPNEVSLKLYNEKEEEKFTAKLKERGIKEE
                     GGDDMQLISFNYNSMYGEHRGNLVYANYGLSRDFNYLKDKNIELKDSVLLIRNGVVPA
                     FQKVQYAEVFGCKGVIFISDPDSSSGYDMFSIEREDVGVSNFAPGDILSPGFSTAKSD
                     HQYHWDDSPGTSRIVTIPISWADAIPLLKSLDNVGEKVPESWNLNIKGEKIATFTGGS
                     TKSQVHIVNHPIMKEQKSIWNVLGKIQGREQDEEAIVIGAQRDSSCFGACESGTSTSI
                     LLSLIRIFGEMSRRLNWKPLRSIYFASFDGTNFNMAGSTEWVEARSRELRRQAYCYID
                     LSDAITGNQLDIKSHPLLKTAIESALFQVTDPISNETFSQLKTKISPLDGLKRNYIPF
                     TSYEAIPSLDIGFRSPEGYPKGSCLDSFERFKEKQVDPDMQYHETLVKIIGRIMIHLT
                     NEPSIPFDFGAYANELAGIKEDVNRYYKDVLGDANTLNFQSLDSSLGQLRHVSDQLSE
                     WITGWSNDVGLSGGLESTLLAINRWTWNNRQSLFEKKLRSNYGIPRRPWFKNLIYGQQ
                     YIIPDHPENYLYSTFPGVRDAIYNKDAESAQQQLEDIAKSLSNVCEDFLSR"
     gene            <566442..>567752
                     /locus_tag="PAS_chr2-1_0303"
                     /db_xref="GeneID:8198101"
     mRNA            <566442..>567752
                     /locus_tag="PAS_chr2-1_0303"
                     /product="UDP-GlcNAc-binding and catalytic subunit of the
                     enzyme that mediates the first step in GPI synthesis"
                     /transcript_id="XM_002491153.1"
                     /db_xref="GeneID:8198101"
     CDS             566442..567752
                     /locus_tag="PAS_chr2-1_0303"
                     /codon_start=1
                     /product="UDP-GlcNAc-binding and catalytic subunit of the
                     enzyme that mediates the first step in GPI synthesis"
                     /protein_id="XP_002491198.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0303"
                     /db_xref="EnsemblGenomes-Tr:CAY68918"
                     /db_xref="GeneID:8198101"
                     /db_xref="GOA:C4R094"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="InterPro:IPR013234"
                     /db_xref="UniProtKB/TrEMBL:C4R094"
                     /translation="MNIAMVSDFFYPQPGGVELHMYHLSQKLIDRGHSVVVITHSYGG
                     RTGVRVLTNGLKVYYIPFAVVMMQCTLPAVFSAFPILRNIFIRENIEIVHGHGSLSFL
                     CLEAIMHAKTMGLKTIFTDHSLFGFATVSSIVGNKLLTFTLTEIGHVICVSHTCKENT
                     VLRSSLDPNKASVIPNAVVASDFTPEPNFRDENTITIVIISRLFPNKGADLLTAIIPR
                     ICAYHEKIRFIIAGDGPKFIDFEQMVEKYQLQDKVQLIGSIKHEEVRNVMVKGHIYLH
                     ASLTEAFGTVLVEAASCGLFVVTTNVGGIPEVLPNHMTAYALPEEESIVSALTSAIDK
                     ISAGKIHTSGFHNQVKEMYDWRDVAQRTELVYINVKRTTKPTTTLERIKKYYIHGFWG
                     GKLFVLCLVVDIFILTVLDFWYPRDKIDRAAKWPHGQKYAKPQS"
     gene            complement(<570082..>572415)
                     /locus_tag="PAS_chr2-1_0304"
                     /db_xref="GeneID:8198851"
     mRNA            complement(<570082..>572415)
                     /locus_tag="PAS_chr2-1_0304"
                     /product="Kex2 proprotein convertase"
                     /transcript_id="XM_002491154.1"
                     /db_xref="GeneID:8198851"
     CDS             complement(570082..572415)
                     /locus_tag="PAS_chr2-1_0304"
                     /codon_start=1
                     /product="Kex2 proprotein convertase"
                     /protein_id="XP_002491199.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0304"
                     /db_xref="EnsemblGenomes-Tr:CAY68919"
                     /db_xref="GeneID:8198851"
                     /db_xref="GOA:C4R095"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR002884"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:C4R095"
                     /translation="MYLPALRLACWILIGLRSTEALETSEREIFALKLDKSWLPTFLE
                     TFQDKFRYERQINGLDDYHVFSHSKNEEFQLENFKVKTLLTRDNANLHSELISHNVDE
                     VHMLRPSHYLHKRAPVVMDKSEELREQIAKDFDIDDPLFAKQWHLFNPRYPGHDVNVS
                     QVWYDGITGKGVVTAIVDDGLDMDSKDLKESFCEEGSWDFNANTRLPKPRLRDDHHGT
                     RCAAEIAAKKGNKYCGVGVAYDSKVSGIRILSDKITPEDEALSLIYGLDVNDIYSCSW
                     GPADNGITMQGPSSLVKEAMLKGVQDGRKGKGALYVFASGNGASSGDNCNFDGYTNSI
                     YSITVGAIDIKGLHPPYAEACSAVMTVTYSSGSGEHIHTTDINDKCSDTHGGTSAAAP
                     LAAGLYSLVYQANPDLTWRDIQWLTVLTAVPVNEQEPGWQKTAIGKMYSHKYGYGKID
                     AYALVNLARSPDFPYLKPQSWIYGTEVHESLNTSEANGVLTSKYELTQEAKDLMNFEK
                     IEHVTVTVDIKAAERGKVLVELISPSGVVSELAPYRRMDKDKEGFPNWTFMSVAHWGE
                     DGLGEWILKITNKEGNSVVLNSWQIKFFGESQDPEKAEKFSLTKKYDEILVNPPSSST
                     STTVDTSSTEATFSSSSVSEASATETDVKETSTTGDEDFENEEGSYKHSNSSHITEYL
                     AFLLGLGFLICIIFLFTNRNKLERRQRRNRRDEYEFDLIPADDDFDTEEDQEANSQFT
                     LDSDAELMFEDTSQREASPHEYQDSLGSNEHPKRAAL"
     gene            <572844..>574355
                     /locus_tag="PAS_chr2-1_0305"
                     /db_xref="GeneID:8198852"
     mRNA            <572844..>574355
                     /locus_tag="PAS_chr2-1_0305"
                     /product="Nuclear architecture related protein"
                     /transcript_id="XM_002491155.1"
                     /db_xref="GeneID:8198852"
     CDS             572844..574355
                     /locus_tag="PAS_chr2-1_0305"
                     /codon_start=1
                     /product="Nuclear architecture related protein"
                     /protein_id="XP_002491200.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0305"
                     /db_xref="EnsemblGenomes-Tr:CAY68920"
                     /db_xref="GeneID:8198852"
                     /db_xref="InterPro:IPR004108"
                     /db_xref="InterPro:IPR009016"
                     /db_xref="UniProtKB/TrEMBL:C4R096"
                     /translation="MSAILRADDLNDFIMPGVACIKPVESGKKGSGEDLEIQIDSEGN
                     ALEVTKEGHERKLDKAQISLSDCLACSGCITSAEEVLIAQHSHKELLNALETDGNRKV
                     FVASISHQTRASLASAFDVQIEAMDKVLIYLLKNVMKFKYVIGTETGRRLSHIFTTLD
                     LQNRSPHSEKPLINSTCPGWVLYAEKTHPFILPRISTIKSTQQITGHLLKNIVSKDLG
                     IEKSQIYHLSVMPCFDKKLEAARDSDVPDVDCVITARELVQVIEELNIDLQTILKESV
                     LDNTDIYSVYRSSSPPGWYQPEQSWLNNKGSASGGYAMQYLLDVQQRHADSEIITIEG
                     RNSDIYEHRLVLRDGQVVASSAVVNGFRNIQNLIRKLKPNHKATGGGISARRRSRKLK
                     EDQTGDQGQSNAVVDPSKCDYVEIMACPGGCINGGGQIAAPADQNSKDWINKATTKYY
                     NVPDTEYSDIQLYDWVKQTVLSYDIEMDRLIHTTFKQIERPTDTTSIALGSTW"
     gene            <574659..>574865
                     /locus_tag="PAS_chr2-1_0306"
                     /db_xref="GeneID:8198927"
     mRNA            <574659..>574865
                     /locus_tag="PAS_chr2-1_0306"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491156.1"
                     /db_xref="GeneID:8198927"
     CDS             574659..574865
                     /locus_tag="PAS_chr2-1_0306"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491201.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0306"
                     /db_xref="EnsemblGenomes-Tr:CAY68921"
                     /db_xref="GeneID:8198927"
                     /db_xref="UniProtKB/TrEMBL:C4R097"
                     /translation="MSRRFYRKFDRKLKLRRSWAHTEISQWNGKTHLGPALIGGRSSR
                     KQVDPDLFEKLNVILENRKQKRSV"
     gene            <575422..>577782
                     /locus_tag="PAS_chr2-1_0307"
                     /db_xref="GeneID:8198995"
     mRNA            <575422..>577782
                     /locus_tag="PAS_chr2-1_0307"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491157.1"
                     /db_xref="GeneID:8198995"
     CDS             575422..577782
                     /locus_tag="PAS_chr2-1_0307"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491202.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0307"
                     /db_xref="EnsemblGenomes-Tr:CAY68922"
                     /db_xref="GeneID:8198995"
                     /db_xref="GOA:C4R098"
                     /db_xref="InterPro:IPR000269"
                     /db_xref="InterPro:IPR015328"
                     /db_xref="InterPro:IPR015798"
                     /db_xref="InterPro:IPR015801"
                     /db_xref="InterPro:IPR016182"
                     /db_xref="UniProtKB/TrEMBL:C4R098"
                     /translation="MKFGNLLSFTTLVGLAVAVPDFYDKREAVSTKEAALLRRGASQC
                     KTNENVNIEAPKPNIWDSLSNDELNQVVDLLNETYNLTEIMDADFYSNYVLTIETLRP
                     NKSDALVFLDEDGDIPDRNAKTLVYFGEGEEGYFQELKVGPLPVSENTTIEPLSFYNT
                     NNKSTLPFKYGFGDSVLNTAKNQFITDNLNTTVLRDVIVDLIGVTFEEITCWATDPQI
                     FDPATETTVAYGTCYILTPNDAEDLVPIGFFYKFDMTGRDVSQWKMLEFIYNNKVYTS
                     EEELYEATQKDDFVRLPKINVDDLSWTVIQRNSSSPVRHLDDRRAPQLVETQGRRWAF
                     DADEEYFTWMDWGFYTAWSRDTGISFFDITFKGERIIYELSLQELIAEYGSDDPNNQN
                     TFYSDISYGVGNRFSMVPGYDCPTTAEYFTTDYYENNHHYNRSLSYCVFENMEDYPLL
                     RHTGGTYSTVTQNPTLNVRFVATIGNYDYNFLYKFFLDGTLEVSVRAAGYIQAGYWND
                     QTSSDFGLKVHDVLSGSFHDHMLNYKVDLDIAGTKNRATQYVMKNVDVEYPWAPGVVY
                     NTKKIAREVIEKEDFNGINWPENGQGLLLIESAEETNSFGNPRAYNIMPGGGAVHRIV
                     KNSRLAPETENWARSNLFLTKQKDSELRSSTALNSNALYDPPVNFNAFLDDESLDGED
                     IVAWVNVGLHHLPNSNDLPNTIYSTAHASFMLTPFNYFDSENSRDTTQQVYYEYDADT
                     KESTWEFYGNDWSSCDLEIQEPNFDDFTYGEETRINKKTTNAYEIY"
     gene            <578841..>580355
                     /locus_tag="PAS_chr2-1_0308"
                     /db_xref="GeneID:8198996"
     mRNA            <578841..>580355
                     /locus_tag="PAS_chr2-1_0308"
                     /product="Glucose-6-phosphate dehydrogenase (G6PD),
                     catalyzes the first step of the pentose phosphate pathway"
                     /transcript_id="XM_002491158.1"
                     /db_xref="GeneID:8198996"
     CDS             578841..580355
                     /locus_tag="PAS_chr2-1_0308"
                     /codon_start=1
                     /product="Glucose-6-phosphate dehydrogenase (G6PD),
                     catalyzes the first step of the pentose phosphate pathway"
                     /protein_id="XP_002491203.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0308"
                     /db_xref="EnsemblGenomes-Tr:CAY68923"
                     /db_xref="GeneID:8198996"
                     /db_xref="GOA:C4R099"
                     /db_xref="InterPro:IPR001282"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019796"
                     /db_xref="InterPro:IPR022674"
                     /db_xref="InterPro:IPR022675"
                     /db_xref="UniProtKB/TrEMBL:C4R099"
                     /translation="MTDTKAVEFVGHTAIVVFGASGDLAKKKTFPALFGLYREGYLSN
                     KVKIIGYARSKLDDKEFKDRIVGYFKTKNKGDEDKVQEFLKLCSYISAPYDKPDGYEK
                     LNETINEFEKENNVEQSHRLFYLALPPSVFIPVATEVKKYVHPGSKGIARIIVEKPFG
                     HDLQSAEELLNALKPIWKEEELFRIDHYLGKEMVKNLLAFRFGNAFINASWDNRHISC
                     IQISFKEPFGTEGRGGYFDSIGIIRDVIQNHLLQVLTLLTMERPVSNDPEAVRDEKVR
                     ILKSISELDLNDVLVGQYGKSEDGKKPAYVDDETVKPGSKCVTFAAIGLHINTERWEG
                     VPIILRAGKALNEGKVEIRVQYKQSTGFLNDIQRNELVIRVQPNEAMYMKLNSKVPGV
                     SQKTTVTELDLTYKDRYENFYIPEAYESLIRDAMKGDHSNFVRDDELIQSWKIFTPLL
                     YHLEGPDAPAPEIYPYGSRGPASLTKFLQDHDYFFESRDNYQWPVTRPDVLHKM"
     gene            <580596..>582104
                     /locus_tag="PAS_chr2-1_0309"
                     /db_xref="GeneID:8198997"
     mRNA            <580596..>582104
                     /locus_tag="PAS_chr2-1_0309"
                     /product="Protein with similarity to mammalian
                     monocarboxylate permeases"
                     /transcript_id="XM_002491159.1"
                     /db_xref="GeneID:8198997"
     CDS             580596..582104
                     /locus_tag="PAS_chr2-1_0309"
                     /codon_start=1
                     /product="Protein with similarity to mammalian
                     monocarboxylate permeases"
                     /protein_id="XP_002491204.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0309"
                     /db_xref="EnsemblGenomes-Tr:CAY68924"
                     /db_xref="GeneID:8198997"
                     /db_xref="GOA:C4R0A0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R0A0"
                     /translation="METPSYPLKAKTKDEGEIIVRDIILTNHEETQGHSSAVDRFSIV
                     DDHGSRTSQNSPESLDLIFEVDAEEDFPDGGWDAWLVVIGALCGCTPILGLINSIGPI
                     ESYISTHQLEKTSTTVIAWIFSIFTAVGYMSGILVGVLVDEFGVKLPMLMGSIFHLMG
                     LVATAECKTVYQFILAFSVCTGMGTSLCLTSNMAVIPHWFKRNKAKATGIATIGGSLG
                     GVVFPLMMKGLYDKVGFQWTMRIVGLVCFALNMMAFFLIKTRLSGKTGVFDIPEFDEN
                     GQKFSFVRKSWLRFEQFSVYVTKLIDFKAFKEAKYTCCVIAFALSELMLVCCMTYLMS
                     YFIKRGHSSATAFNMIIIVNATGILGRFVPGIAADRYGVYNVMIGMLVTLGIVQFVLW
                     LSLGQHLWSLYTFSVLFGFFSASVLSLSPVCLSAISPTKDFAKRFSTAFLVVGFVSLM
                     GLPIGGAIIDNASISNYNNFIVYTGILCAASSVFWALTRYAIRRTWKINIKV"
     gene            <582195..>582368
                     /locus_tag="PAS_chr2-1_0310"
                     /db_xref="GeneID:8198998"
     mRNA            <582195..>582368
                     /locus_tag="PAS_chr2-1_0310"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491160.1"
                     /db_xref="GeneID:8198998"
     CDS             582195..582368
                     /locus_tag="PAS_chr2-1_0310"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491205.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0310"
                     /db_xref="EnsemblGenomes-Tr:CAY68925"
                     /db_xref="GeneID:8198998"
                     /db_xref="UniProtKB/TrEMBL:C4R0A1"
                     /translation="MLKQLWLKYNQLPFKVRMYIGISTMAVAYFGDRISSQIIENNKL
                     EARAKEELRRSAK"
     gene            complement(<582573..>585695)
                     /locus_tag="PAS_chr2-1_0311"
                     /db_xref="GeneID:8198999"
     mRNA            complement(<582573..>585695)
                     /locus_tag="PAS_chr2-1_0311"
                     /product="NAD(+)-dependent glutamate dehydrogenase,
                     degrades glutamate to ammonia and alpha-ketoglutarate"
                     /transcript_id="XM_002491161.1"
                     /db_xref="GeneID:8198999"
     CDS             complement(582573..585695)
                     /locus_tag="PAS_chr2-1_0311"
                     /codon_start=1
                     /product="NAD(+)-dependent glutamate dehydrogenase,
                     degrades glutamate to ammonia and alpha-ketoglutarate"
                     /protein_id="XP_002491206.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0311"
                     /db_xref="EnsemblGenomes-Tr:CAY68926"
                     /db_xref="GeneID:8198999"
                     /db_xref="GOA:C4R0A2"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016210"
                     /db_xref="InterPro:IPR028971"
                     /db_xref="UniProtKB/TrEMBL:C4R0A2"
                     /translation="MVDRLQVSNLTLNNNFSSRSFDNLSDDELKKSGYNPLPFEGKLD
                     QIEKVQDALDEAGFIPEPLIESEVRWFYESLGIDDVYFARESVQGIVSHIHALYSAKL
                     ESYSRGENENPTLQHKREADDHAVYFDSSDPKSPQFKLINYEERIDDRYLDHGVDSPG
                     YRLESFSSAVGNVRCYFVYKCSFPKAAPAAESESLDLTKISDETFLKICSNHTKRLYS
                     EIINDVAAVDGPIIKHFGIKSTGEHRVIIGYRQNSSPRYNSALTSLCQFYGLKVTRKY
                     VEQFSNGISIISMYITPPDAGDSSFIQFPIDQVVKEASLLYTIPHNIFQEEFAKGELS
                     IQECIYAHCGVIFVTHFLNRLGTEYQSLLEILNPNKNLLHFEILSKIKDRLRTETFTQ
                     DYITEVFKKQTPLVKKLYRSFADVHYINSKLEKTLSYKRLEAIEPIKSESDFENLLNH
                     ACSQNQRHALILRALFSFNKSILKTNFFLPSKIAISFRLEPSFLPALEYPNKPFGMFF
                     VVGSEFRGFHIRFRDIARGGIRIVKSRSVENYNVNKRNLFDENYNLASTQQRKNKDIP
                     EGGAKGVILLDPQAQERPKECFIKYIDSLMDLLLLDHQDKSNGIVDLYNKPEILFMGP
                     DENSAGYVDWATLHARKRGAPWWKSFFTGKSQTLGGIPHDEYGMTSLSVRAYVNKIYE
                     KLDIKDLSKITKLQTGGPDGDLGSNEIKLSRDESYVAIVDGSGVIVDENGLDKAELLS
                     LATKRKMVDQFDRTKLSPKGYFVSVDDVDFKTPDGKIITNGTVFRNTFHLKIAEVFGK
                     DRLKLFVPCGGRPNSIDANNVHFLIDENTGKSYIPFIVEGANLFISQAAKVQLEKAGT
                     VLFKDASTNKGGVTSSSLEVLAALSFDDEGFLSNMCLDPKTGVKPEFYQEYVKQVQKV
                     IVANAESEFESLWALNKETGKPLSDLSNDLSIAINDLADQLSSSEELWNDDLSFRNAV
                     LQDALPPLLLEKIGIESIVNRVPVNYLKALFATRLASRFVYTRGIDANPARFLEFISS
                     LKREYKSRGL"
     gene            complement(<585982..>586200)
                     /locus_tag="PAS_chr2-1_0312"
                     /db_xref="GeneID:8199000"
     mRNA            complement(<585982..>586200)
                     /locus_tag="PAS_chr2-1_0312"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491162.1"
                     /db_xref="GeneID:8199000"
     CDS             complement(585982..586200)
                     /locus_tag="PAS_chr2-1_0312"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491207.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0312"
                     /db_xref="EnsemblGenomes-Tr:CAY68927"
                     /db_xref="GeneID:8199000"
                     /db_xref="UniProtKB/TrEMBL:C4R0A3"
                     /translation="MTHRLDSTMAIWGIRTLARALIFQDKRKCHGSRERHSYCKPRPS
                     NLSYRLPVTQLSLGNSSPSSGLQPAKPN"
     gene            complement(<587014..>588096)
                     /locus_tag="PAS_chr2-1_0313"
                     /db_xref="GeneID:8199001"
     mRNA            complement(<587014..>588096)
                     /locus_tag="PAS_chr2-1_0313"
                     /product="Bifunctional enzyme with alcohol dehydrogenase
                     and glutathione-dependent formaldehyde dehydrogenase"
                     /transcript_id="XM_002491163.1"
                     /db_xref="GeneID:8199001"
     CDS             complement(587014..588096)
                     /locus_tag="PAS_chr2-1_0313"
                     /codon_start=1
                     /product="Bifunctional enzyme with alcohol dehydrogenase
                     and glutathione-dependent formaldehyde dehydrogenase"
                     /protein_id="XP_002491208.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0313"
                     /db_xref="EnsemblGenomes-Tr:CAY68928"
                     /db_xref="GeneID:8199001"
                     /db_xref="GOA:C4R0A4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R0A4"
                     /translation="MSVMKALVYGGKNVFAWKNFPKPTILHPTDVIVKTVATTICGTD
                     LHILKGDVPEVKPETVLGHEAIGVVESIGDNVKNFSIGDKVLVSCITSCGSCYYCKRN
                     LQSHCKTGGWKLGHDLNGTQAEFVRIPYGDFSLHRIPHEADEKAVLMLSDILPTAYEV
                     GVLAGNVQKGDSVAIVGAGPVGLAALLTVKAFEPSEIIMIDTNDERLSASLKLGATKA
                     VNPTKVSSVKDAVYDIVNATVRVKENDLEPGVDVAIECVGVPDTFATCEEIIAPGGRI
                     ANVGVHGTKVDLQLQDLWIKNIAITTGLVATYSTKDLLKRVSDKSLDPTPLVTHEFKF
                     SEFEKAYETSQNAATTKAIKIFLSAD"
     gene            complement(<588280..>588885)
                     /locus_tag="PAS_chr2-1_0314"
                     /db_xref="GeneID:8199002"
     mRNA            complement(<588280..>588885)
                     /locus_tag="PAS_chr2-1_0314"
                     /product="Protein that binds tRNA and methionyl-and
                     glutamyl-tRNA synthetases (Mes1p and Gus1p)"
                     /transcript_id="XM_002491164.1"
                     /db_xref="GeneID:8199002"
     CDS             complement(588280..588885)
                     /locus_tag="PAS_chr2-1_0314"
                     /codon_start=1
                     /product="Protein that binds tRNA and methionyl-and
                     glutamyl-tRNA synthetases (Mes1p and Gus1p)"
                     /protein_id="XP_002491209.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0314"
                     /db_xref="EnsemblGenomes-Tr:CAY68929"
                     /db_xref="GeneID:8199002"
                     /db_xref="GOA:C4R0A5"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C4R0A5"
                     /translation="MSFRYLKRHFSTATNAIALLSRPEFKIGRIVDVVKHPNADKLYV
                     SSISVGNNYASGTSNTLTVCSGLVDYFSVPELLQRRVVVVTNLKPSKMRGVTSEAMLL
                     AGEKSGKVELVEPPMSGREGESLHFEGVEITSEESANQLHLPAKRLKKSEWSQLAEGL
                     QTNDQREVVFHSQIGSKRIYALVGASTEKCTLATLAQAVVR"
     gene            complement(<589060..>590061)
                     /locus_tag="PAS_chr2-1_0315"
                     /db_xref="GeneID:8199003"
     mRNA            complement(<589060..>590061)
                     /locus_tag="PAS_chr2-1_0315"
                     /product="Omega class glutathione transferase"
                     /transcript_id="XM_002491165.1"
                     /db_xref="GeneID:8199003"
     CDS             complement(589060..590061)
                     /locus_tag="PAS_chr2-1_0315"
                     /codon_start=1
                     /product="Omega class glutathione transferase"
                     /protein_id="XP_002491210.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0315"
                     /db_xref="EnsemblGenomes-Tr:CAY68930"
                     /db_xref="GeneID:8199003"
                     /db_xref="GOA:C4R0A6"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:C4R0A6"
                     /translation="MELFSRSCFRQVRNMSKIDIQKFHNAKGEFKRQDSSFRSVIGKD
                     PKFPVEPDRYHLYVSYACPWANRTLIARKLKGLEDYLDYSVVHWHMDSKGWRFPSNDD
                     PCEGATPDKLYGYKRLSELYYRANPNYEGRFTVPVLWDKKQHTIVNNESSEIIRIFNT
                     AFNELLEKDGKHEQAKLDLYPESLQAQIDQTNDWIYNNINNGVYKAGFAGKQEVYEEE
                     VKKVFAHLDKVEDELSNDGQEFIVGDQLTEADIRLFVTIIRFDPVYVQHFKCNIGMIR
                     FDYPNIHKWLRRLYWNYPELKDTVHFDHIKFHYTKSHPQINPLGITPVGPLPNILPL"
     gene            <590434..>591303
                     /locus_tag="PAS_chr2-1_0316"
                     /db_xref="GeneID:8199004"
     mRNA            <590434..>591303
                     /locus_tag="PAS_chr2-1_0316"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491166.1"
                     /db_xref="GeneID:8199004"
     CDS             590434..591303
                     /locus_tag="PAS_chr2-1_0316"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491211.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0316"
                     /db_xref="EnsemblGenomes-Tr:CAY68931"
                     /db_xref="GeneID:8199004"
                     /db_xref="UniProtKB/TrEMBL:C4R0A7"
                     /translation="MNGLGIHVREHSGEQQDDLLPSLPASASQFEPPLEALESKTSNY
                     SSAVSLAQIPLDTSTSGIDLSDIKVSSPTLDESSTFDEKIDGDRTLSKRFRTSFAKLR
                     IQSKVVPAHETDDTHTLKKMRSGLLRKWISHDNTGTDYDTPLSQTNSKPRSSPTLVTQ
                     TINVPSRSSSPSFHTIASTSATTSDFKGFETSPVISVNEKFFGTTSAIATHSTLQNTN
                     EKVFVNIFDELQFWKKLRSDKARGFEITESRLKSSGWSSSQDIEELRRHKEASLHIYD
                     EKIKSLEERLQGD"
     gene            <592019..>594529
                     /locus_tag="PAS_chr2-1_0317"
                     /db_xref="GeneID:8199005"
     mRNA            <592019..>594529
                     /locus_tag="PAS_chr2-1_0317"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491167.1"
                     /db_xref="GeneID:8199005"
     CDS             592019..594529
                     /locus_tag="PAS_chr2-1_0317"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491212.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0317"
                     /db_xref="EnsemblGenomes-Tr:CAY68932"
                     /db_xref="GeneID:8199005"
                     /db_xref="UniProtKB/TrEMBL:C4R0A8"
                     /translation="MSSTKTENAKESLRRGTSNFWIRRYWASFVRFPILNKPLNQVRS
                     VGYSYLKNSLISLDLVSTLRRLFVHADLIPYDENHNFFISAFLSSLIMIVEDYEYVVG
                     NRPTTYHVAIPKEISSKKPVLKLHPDFIKSRNCNLYFDEEFYHFLTFLTLEKANILWE
                     AFMNLKGDHTLFQSQLTSHDKLVFMRIWRDYLSTLDIFREFHSIRCIILSHDFLQKED
                     NLGQLEFWDKIQKDFSSFVYFNDSRKPWYSPFSLNVRIQKLFSIYSDSFSVGTSFGES
                     KGQHGQRRLSRSSKIVASPYVTPKFQGLTFTIPPFFPLHYWRQYVMEVYISKSFKQEN
                     VPPLMKTGHIIIDHSNSTVDVEAIRHRYGLSTFRSTTNSYVESLFYSDRLDLFYLPLV
                     ELNTKILYVLGYLADPSDVLSDSDPDDDSIKVIVEELSDMNVEEMVARIQSLAKPKFL
                     KTFNVDDLIQYLADFYEFLLHVELPTKLEIEARKIHELVESSCITGEILELCFIFYGE
                     CMTFGLSVWFIKCLDIIGEDLMKFEAVVFNEIHCTKELPLKEAYPYLHYVMEKFTFEF
                     THDNHIQYFVNLFSYFTVSQKENTWQKFNHVPEQLQAFEKRFRSVCDDIECMVMTLSI
                     VQLIHFYWNESGVNFSCNWDHTAKTIYTHIQNCNDIQQFSSLKNGLSGEIVDLFQLQF
                     SADETKSIQRSEFDPQFLSSYLVNADHTSINPKQSVKMIVMQKLVELFVLSTQSTKQD
                     QFYRLLKKVFHLSDTLRLQFLGTIFEMSCILKTSLTLYNSIYEQVYEMHFNTHSLTTT
                     LIDFPRIQQQRHKQKDLKFQSVKLSPTSGSNGLEDARD"
     gene            <594670..>595809
                     /locus_tag="PAS_chr2-1_0318"
                     /db_xref="GeneID:8199006"
     mRNA            <594670..>595809
                     /locus_tag="PAS_chr2-1_0318"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491168.1"
                     /db_xref="GeneID:8199006"
     CDS             594670..595809
                     /locus_tag="PAS_chr2-1_0318"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491213.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0318"
                     /db_xref="EnsemblGenomes-Tr:CAY68933"
                     /db_xref="GeneID:8199006"
                     /db_xref="GOA:C4R0A9"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR005303"
                     /db_xref="UniProtKB/TrEMBL:C4R0A9"
                     /translation="MISLIQLLNTSFLLLLLVPFGADFGVKLTSYQLNKPTRLTLLLV
                     ALINFRHRLVYYAQSLLDLLFGTSPDLSKSPKIKEIYVHPVKSLRGDSVQEWEIDQHG
                     LKCDRMYTLGIFRDGKFKAVTQRECQKMTLVYCDIDKENKCFKYTWDLGNGPGSFTLP
                     MEPDIASVDSQKPVELWGVNFETYVLPDMIPSKFFEDLGMDKDTQILYSPKGKAVKTN
                     APQFNNQYRFSLFQDYYPLLMVSDKDIDDLNVRIKAKGGNLVCSARNFRPNMVLERVG
                     KLFDTDTWDKFSVYTKDGKVHHWSVTSKCPRCPIPNINTETGVNDNKSIVSRVLSTYR
                     RVDFGSVYDSFFGMSCVQHDYNYSISVGDAVVVKSRRINHYECIG"
     gene            complement(<595815..>598016)
                     /locus_tag="PAS_chr2-1_0319"
                     /db_xref="GeneID:8199007"
     mRNA            complement(<595815..>598016)
                     /locus_tag="PAS_chr2-1_0319"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491169.1"
                     /db_xref="GeneID:8199007"
     CDS             complement(595815..598016)
                     /locus_tag="PAS_chr2-1_0319"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491214.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0319"
                     /db_xref="EnsemblGenomes-Tr:CAY68934"
                     /db_xref="GeneID:8199007"
                     /db_xref="GOA:C4R0B0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4R0B0"
                     /translation="MGAIRARTACQKCRSLKHRCDFRYPRCSRCEKSKIECMVHHPVT
                     KLLMSRTDYEKLLSSTSDTDEITPLNDSNSVLPKESSELRGGSLVATVQRRKLAEAEL
                     FEKLPQLSVLSLVPFHFSNPDEPTSTLASLSVVNLPLKEELLLVIEYFFKDSMSHLHL
                     VDREWVLDVTNKVYKKLNQFQGLSSENAILYLLNCKVSALELYVLYTILTLVVSQKLS
                     QLENSETILSSDEYHKSAQYFLRHILLQLTKDSKPPIIQQTETLRCLLLMSLCGFYKS
                     METDIYSILNVCGRIVIEMSLYLESSLLSLEQKLPINTESPDLFQHEETIRFRKLFWA
                     WYCQERLVNGLSSRPYMVNDFDITALLGPLESNESYYPLCSLVKLRKIQSQIWQTLYR
                     PYIVNPFLKSTSRAWISSRHNQINDWFSTVYTNKEMGIKKNDVLFMYYSTLNQLYRPC
                     IQHTKLSTGDFIILHNSTLNLLRLYDQNLTSNYRFPSSFRFGGFYDTAILYFYSVCSD
                     TLPLTSSELLLELDTMMDLFHNDNHRPVAFGLQMTQMIVIFRLIYKHTKILLDRRVKP
                     AKNPPPRRLSPSKSVTPPLTGSTNREENDDAKSIGTRISLIDVLAPEEPESKALTSRF
                     LPKLPQYDDPMNRTYDSEYARHLIPVKTKSSRSEKRIDNSDELLELYIVGLIKDLKEL
                     PTNPLSEMVLSALTDNTTEDNPKERFTSFWWKLLNEVFQPSQLFTGKYPYN"
     gene            complement(<598214..>600403)
                     /locus_tag="PAS_chr2-1_0320"
                     /db_xref="GeneID:8199008"
     mRNA            complement(<598214..>600403)
                     /locus_tag="PAS_chr2-1_0320"
                     /product="Protein containing a UCS (UNC-45/CRO1/SHE4)
                     domain"
                     /transcript_id="XM_002491170.1"
                     /db_xref="GeneID:8199008"
     CDS             complement(598214..600403)
                     /locus_tag="PAS_chr2-1_0320"
                     /codon_start=1
                     /product="Protein containing a UCS (UNC-45/CRO1/SHE4)
                     domain"
                     /protein_id="XP_002491215.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0320"
                     /db_xref="EnsemblGenomes-Tr:CAY68935"
                     /db_xref="GeneID:8199008"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R0B1"
                     /translation="MDQLTELTATIDEYLESKSKDSREKVKKLVKQPAYIKLWIFDPD
                     YKKTVSLLQALLADEDPFLADFVLSHFCSGFTDLLKWYKKNGSSTISTNHVVTYLQLF
                     NNLIDTNFHSIKEDLEGPVMSMLYLLNDALVRPDILLVLAHLKQVDKRISDYCEFERT
                     AEYYVDSFLNDVGLQELNSFLYECVSHLIVIFPETVSKYASNESFLRLLTTDISRLTT
                     LNAAELENSSLLLKILYMLSNLCIDESTRNLIHSHYSQLLSKLLTVSFSKNERAQLIL
                     TLTALVIVKTWHMPSMGDKSTQLTMTYDIFIAGVITDASTEILDLSLEGLTYLSIKVE
                     AKRMIRNDDDLLITILQLLKEKKNLNLAYGILSILENVTSTKTPDESISKVLEDTEKD
                     DPTEILNFIFHILAHQDLMSSLLALFKDEASTSLVHNSIINLIHNIVIFKETRSIVFE
                     QKGLDILFSHLISTKDNQAQLESQMVCIESVSKILLTSNPEVVVEKYDLIPVAFLVQL
                     VQAYDHQKYQTRYKTIFAMHLESQVANQAVFEVIISLTNLASVPNMDLKKTISNAVLP
                     SLPNFLISEISSIRQSMLELLSNLSDCPDCLQYVFNWSKPDTKKNYDTLLDLLYHLST
                     GPSQSAILSFFANASVYDLVADVLVENKDFIHYLSKVLDKQRSEEPIVERTLFILINC
                     GQISTSKLREALPKTFNDVLNEVLRNIRSTELRKMCLEVARLSKGEN"
     gene            complement(<600554..>601339)
                     /locus_tag="PAS_chr2-1_0321"
                     /db_xref="GeneID:8199009"
     mRNA            complement(<600554..>601339)
                     /locus_tag="PAS_chr2-1_0321"
                     /product="Subunit of the NuA4 histone acetyltransferase
                     complex that acetylates histone H4 and H2A"
                     /transcript_id="XM_002491171.1"
                     /db_xref="GeneID:8199009"
     CDS             complement(600554..601339)
                     /locus_tag="PAS_chr2-1_0321"
                     /codon_start=1
                     /product="Subunit of the NuA4 histone acetyltransferase
                     complex that acetylates histone H4 and H2A"
                     /protein_id="XP_002491216.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0321"
                     /db_xref="EnsemblGenomes-Tr:CAY68936"
                     /db_xref="GeneID:8199009"
                     /db_xref="GOA:C4R0B2"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:C4R0B2"
                     /translation="MDAATVLEQYTQDLSNLPSELAHLLEELRDKDMTLYQIRKRTQG
                     KDNQLHKYIKQHGSLVKHPKEQQLYSKINEDFTKAKALQEEKILLSNTALLLISKHLV
                     RLESDIEKLESEGLLAPDDMIEEDKNMSDGMSSLTPVPPSQSSTPGVVPKKRQRNGVS
                     RTQSRFESPPLSSSAPTRTHRKKNASELNQTGEEDELYCFCQQVSFGDMIACDNPDCK
                     YEWFHYDCVGLTAQPPSGIWYCPDCKNDQSVRKRDRKKKKVET"
     gene            complement(<601428..>602216)
                     /locus_tag="PAS_chr2-1_0827"
                     /db_xref="GeneID:8199010"
     mRNA            complement(<601428..>602216)
                     /locus_tag="PAS_chr2-1_0827"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491172.1"
                     /db_xref="GeneID:8199010"
     CDS             complement(601428..602216)
                     /locus_tag="PAS_chr2-1_0827"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491217.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0827"
                     /db_xref="EnsemblGenomes-Tr:CAY68937"
                     /db_xref="GeneID:8199010"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:C4R0B3"
                     /translation="MKKFLLKFITKKFFGETKLNRFGFDDPYYEEVQLDPTDPNSKVI
                     RSYIQPPVGLSDNDTKLFQKIQRRSYRLDYLFNICGVKFGWNGVISVVPVVGDVLAAI
                     NSLLIYRLIFQLDNPVPWDIHFFILLNIIADFLFKLIPIVGSFVDIGFKANSRNAALI
                     EKHLATVAKANQFFNDVDSESASTKSLVSWQTSSVTGIPDIVGSLRSRIFGRGAKVEE
                     KPIESIDLGVSSKSVLNKPRPRVNSTGGISTARAVDSPQKTMLK"
     gene            complement(<602354..>604051)
                     /locus_tag="PAS_chr2-1_0322"
                     /db_xref="GeneID:8198102"
     mRNA            complement(<602354..>604051)
                     /locus_tag="PAS_chr2-1_0322"
                     /product="Calnexin"
                     /transcript_id="XM_002491173.1"
                     /db_xref="GeneID:8198102"
     CDS             complement(602354..604051)
                     /locus_tag="PAS_chr2-1_0322"
                     /codon_start=1
                     /product="Calnexin"
                     /protein_id="XP_002491218.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0322"
                     /db_xref="EnsemblGenomes-Tr:CAY68938"
                     /db_xref="GeneID:8198102"
                     /db_xref="GOA:C4R0B4"
                     /db_xref="InterPro:IPR001580"
                     /db_xref="InterPro:IPR009033"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR018124"
                     /db_xref="UniProtKB/TrEMBL:C4R0B4"
                     /translation="MKISTIASSTLFAVGALAESEPAEFRPLEAQLDKSSFFEQFDKE
                     PKLGDTWKISHAVKNEEFTYVGEWAIEEPVVYPGFKKDRGLVVKSEAAHHAISAQLPQ
                     VFDNTDNTLVLQYEVKLQQGLNCGGAYVKLLSAEGLNKNEFSNETPYQVMFGPDKCGT
                     TNKVHLIIKRKNPATGEYEEHQLATPPMGRIVKTTSLYTLIIKPNNDFEIRINGEVAK
                     AGNLLNEKLIKPPFGAPKEIDDPEDQKPEDWVDEDMIPDPDAVKPEDWDESEPLRIVD
                     PEAVKPENWNEDAELYIPDPEATKPEDWDDEEDGEWVAPVIPNPECADIGCGPWKAPY
                     ITNPNYKGKWSPPLIENPDYKGPWSPKKIANPNYFEDKKPANLEPIGGLGFELWTMNA
                     DILFDNIYLGHSIKEAEFIGNETFVPKLELEEAESAKNAPKPDFEPETPPETGLDSTG
                     NIFTDVFDTVFQTVLEYYVSANAFLNDVVQEPSVLLERPGEAVYYLVTFFSGFTFLVA
                     VWSGLIFALTGAGKKPETSAKTPTKSTQKIEEVTEDETEKTDSSSAAKNSTKATKRT"
     gene            <604352..>604924
                     /locus_tag="PAS_chr2-1_0323"
                     /db_xref="GeneID:8199011"
     mRNA            <604352..>604924
                     /locus_tag="PAS_chr2-1_0323"
                     /product="Essential Hsp90p co-chaperone"
                     /transcript_id="XM_002491174.1"
                     /db_xref="GeneID:8199011"
     CDS             604352..604924
                     /locus_tag="PAS_chr2-1_0323"
                     /codon_start=1
                     /product="Essential Hsp90p co-chaperone"
                     /protein_id="XP_002491219.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0323"
                     /db_xref="EnsemblGenomes-Tr:CAY68939"
                     /db_xref="GeneID:8199011"
                     /db_xref="GOA:C4R0B5"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /translation="METTCGLPVLPQKISVNFMLRETVDDLGLSKSVTFFLLNSPIML
                     RLFQRTQFQGSKTCPRVFSKSFHSLPFLRQELILKVEPLKRDNESEDVKRRRLVYQSR
                     KRGILETDLLLSRFAKRYLPTMSVEEMEEYDDLLNELDWDIYYWAVKNYEVTPLPEKW
                     KDSKILAKLQEMSANNEGEILRMPNLDDSP"
     gene            <605174..>606667
                     /locus_tag="PAS_chr2-1_0828"
                     /db_xref="GeneID:8199012"
     mRNA            <605174..>606667
                     /locus_tag="PAS_chr2-1_0828"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491175.1"
                     /db_xref="GeneID:8199012"
     CDS             605174..606667
                     /locus_tag="PAS_chr2-1_0828"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491220.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0828"
                     /db_xref="EnsemblGenomes-Tr:CAY68940"
                     /db_xref="GeneID:8199012"
                     /db_xref="GOA:C4R0B6"
                     /db_xref="InterPro:IPR004918"
                     /db_xref="InterPro:IPR013855"
                     /db_xref="InterPro:IPR013873"
                     /db_xref="InterPro:IPR013874"
                     /db_xref="UniProtKB/TrEMBL:C4R0B6"
                     /translation="MPIDYSKWDKIELSDDSDIEVHPNVDKRSFIKWKQRDIHEKRLQ
                     RNTEIKTLKIQREMYTQLNKRVDSMLSKLDLNQIADESTRNSFLASNFDASEKCTIEE
                     DQQNNPTYNEMVEDLFTQITEDISKEGKDAKNGSIIVDKLKEHRAKIDAVLKEIDPKL
                     DQLLQEKALHISSEDIHEGFDSVIINKSATSKIASSRSPGETVKTTTIETINNPQPTV
                     PLPDITKAPSQELSTLGELDVLDETLEFSKIDVSQYRAIARFLDQHPYIISEQQQQAL
                     TMKAFDAQLEGNSQRAFQIVHQALVIQYVNQLCGARPKSEILPSYKPQETAIKLFIGK
                     LTDKNHPARKAFEEDVKRTFTHILERCKILAEENKAMGEEQVEQIQLRSMDEGTELMV
                     TIPQENTPEYEAFLKIPKVMQDALRTSSIDEVNKVFSNMSVPEAEKILELFDQSGAIS
                     VAQLLENEEEFDKLKHTMGDQSIDQEVDNLALNDKPNEEAKTEDVVD"
     gene            complement(<606751..>609225)
                     /locus_tag="PAS_chr2-1_0324"
                     /db_xref="GeneID:8198103"
     mRNA            complement(<606751..>609225)
                     /locus_tag="PAS_chr2-1_0324"
                     /product="Oligomeric mitochondrial matrix chaperone"
                     /transcript_id="XM_002491176.1"
                     /db_xref="GeneID:8198103"
     CDS             complement(606751..609225)
                     /locus_tag="PAS_chr2-1_0324"
                     /codon_start=1
                     /product="Oligomeric mitochondrial matrix chaperone"
                     /protein_id="XP_002491221.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0324"
                     /db_xref="EnsemblGenomes-Tr:CAY68941"
                     /db_xref="GeneID:8198103"
                     /db_xref="GOA:C4R0B7"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:C4R0B7"
                     /translation="MLKARTVKPNQLRLNALRAKVPRILLASSLSTLSLRTSSNTLAV
                     RPVQPKIPFARHNVNHLRLRTPMSIRFASSGGPQINMNGQQEEELPALQKYGVNLTQL
                     AKDGKLDPVIGRDEEIRRTIQILSRRTKNNPALIGNAGTGKTAIMEGLAQRIIKGEVP
                     ESMKDKEVVALDLGSLISGAKFRGEFEERLKAVLKELDEAHGNIILFIDELHILLGLG
                     KAEGSIDASNLLKPALARGQLQCCGATTIEEYRKYIEKDAALARRFQSVLVNEPSVQD
                     AISILRGLKEKYEIHHGVRITDSALVTAAVYSNRYITDRFLPDKAIDLVDEACSALRL
                     QHESKPDVIQQLDRQIMTIQIELESLRKETDPISVERRDKLDEQLKLKKEELERLTQV
                     WEDEKNSLEKIKTAKEELEQSKLELERAQREGDFGKASMLRYSKIPELEQKVSATAQR
                     VKEGESETTTNLLHESVTSDDIAWVVSKMTGVPVQSLMKGEKDKLLYMEESIKSRVIG
                     QDEAIHSVADAVRLQRAGLTNEKRPIASFMFLGPTGTGKTELTKSLAEFLFNDENAVV
                     RFDMSEFQERHSLSRLIGAPPSYVGFEEGGELTEAVRRKPYAVVLFDEFEKAHRDISK
                     LMLQILDEGNLTDSQGHKIDFKNTIIIMTSNLGQDLLLADTELENVGGKVSEKTKNEV
                     IQVMKQNYPPEFINRLDDVLVFNRLSRESLRKIVDIRLSEVQDRLVDRRIELKLTDAA
                     KEWLTEKGYDPLYGARPLNRVIKKQLLNPLSIRLIQGEITNNSTVKVDLVDGDLQITS
                     EKNEAEAETVRKEDGDEPAEYEIIKD"
     gene            complement(<609467..>610468)
                     /locus_tag="PAS_chr2-1_0325"
                     /db_xref="GeneID:8199013"
     mRNA            complement(<609467..>610468)
                     /locus_tag="PAS_chr2-1_0325"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491177.1"
                     /db_xref="GeneID:8199013"
     CDS             complement(609467..610468)
                     /locus_tag="PAS_chr2-1_0325"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491222.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0325"
                     /db_xref="EnsemblGenomes-Tr:CAY68942"
                     /db_xref="GeneID:8199013"
                     /db_xref="UniProtKB/TrEMBL:C4R0B8"
                     /translation="MFTRLGRFAGVQRSFHTYSARKSSVSSLNQVVKKEILERENVSE
                     EHVLNMLRTCSIMKGKISQGEQIDSLIEKIFDAPNVKITPNILRKFWLTKPSFANIEC
                     SIQSYYDKNKDLSINREDAMIPFRQFLWDGEVDKALKIVDLTTAHSRYISTQKSKMRS
                     YLIRYAGSCFGLIGAIEVLTRIFFADVGSLGKVYAMVLAYIGNTSFLASLAFTGKNIS
                     QDTGPLRWRPGTLQNYWYQHNDELMMCSKVLEVDAEIHGSEGFATKEIIQNFFDRKMI
                     PNEPEQEIMMQQYWLGGGDGFEWVEPDQDPLDFLWKQHLEKLKGQALPKAEQKLSIG"
     gene            <610645..>611541
                     /locus_tag="PAS_chr2-1_0326"
                     /db_xref="GeneID:8199014"
     mRNA            <610645..>611541
                     /locus_tag="PAS_chr2-1_0326"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491178.1"
                     /db_xref="GeneID:8199014"
     CDS             610645..611541
                     /locus_tag="PAS_chr2-1_0326"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491223.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0326"
                     /db_xref="EnsemblGenomes-Tr:CAY68943"
                     /db_xref="GeneID:8199014"
                     /db_xref="InterPro:IPR013911"
                     /db_xref="UniProtKB/TrEMBL:C4R0B9"
                     /translation="MGVILPDDGKQSGGQPNRRAKVLSRFLPPEHQRPSIGLFLGPFT
                     PAADNEIALWTCIGAQLFSGLALLRMSRRFVFSPDQSVRRFLFKTFHNVVGAALIFGS
                     GLEGTRMLLPEDPWKEEARKARILAQLKGEPVSWWYGPKSFIPSGRLEYTKQMQFHNF
                     EVMHKSPEKIARALMIKDKLKEETNTLYSSIHEKAEQQTIRLSKDLQNNVPLKGVTSY
                     VPQFSTSNTDTKLYLKNVSLKTHADLEKVWAEHNPWDILEEKISPISVIALPKFNPII
                     SEVEPDKQQPSTGDIKYISDRK"
     gene            <611713..>614208
                     /locus_tag="PAS_chr2-1_0327"
                     /db_xref="GeneID:8199015"
     mRNA            <611713..>614208
                     /locus_tag="PAS_chr2-1_0327"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002491179.1"
                     /db_xref="GeneID:8199015"
     CDS             611713..614208
                     /locus_tag="PAS_chr2-1_0327"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002491224.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0327"
                     /db_xref="EnsemblGenomes-Tr:CAY68944"
                     /db_xref="GeneID:8199015"
                     /db_xref="GOA:C4R0C0"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR011678"
                     /db_xref="InterPro:IPR026895"
                     /db_xref="UniProtKB/TrEMBL:C4R0C0"
                     /translation="MNGKHLLLQVLLVQLVAAVLDTQVGYIDWLVTSTGSFLDLSSCL
                     FNYEQIYCLTEANDLIGLDSDAQITYRLHLDGPDQGKLTKLNNKKFGSVRGNYLDIFN
                     EKGHLLHTEKFPSPIVDVYLDNSLLAVDLEGVVREIDLSTHSSKEVATLQSLACAMFS
                     KVDDKVTIAFKGSNSDFVKIAILEDKVSTISTNISSVVHIKNNLLETDEGIYSIEGST
                     VKKILDGTAYLTDIGAISVDTVKNSVRSSGNSFEPQSKILKVHAEDEFIVVLTVDEVL
                     EIDLETFDLSSVKENSLTEEYLNSVDYEIFFKNQEVQLIIQDRSARELIITNGVIQKV
                     LDLSLNDVVDYSIVTLQPQLKAIEDEIIEEENSTFFKAYTSRLFNTLAALKENIKKRE
                     FTSLFQYDTSGQDQSFGLDKRLVIGCSHGKLSAYHLLTKTPQLSWEIQLPLIDEVSSF
                     NEGEVSVLSGTTVFTIDAETGDILSETVATAEDPQKEFDIKSDDRTISGLKLINNEYS
                     STWTFKASPEEKILKVVRREDDNSNVASAGHILGNNSVLFKYLFQNLISAVLLNEHTN
                     DIRFVILNAITGQQVYSDVHSGIDSNTNVNLIYDENFIVVSYFGSDPIPEQHIVVYDL
                     YESLTPNKRVEPKDGLVSNFDTDTPIPQISSQSFLFPSRINFIAASRSKFGIASKWII
                     SVLENGQIFAIPKVVLNSRRVVGRDLTSTEKQEYGMSVYSPFISLPENIFTISNIRNL
                     VLDNNSNTLPSGKPILTVEPTGLASTSFVCLINSFNVYCTQISPSKKFDMLRENFDQY
                     KLLLSIFGLLAIVLLVRPYVYSRNVQKLWTTKI"
     gene            <614395..>616143
                     /locus_tag="PAS_chr2-1_0328"
                     /db_xref="GeneID:8199016"
     mRNA            <614395..>616143
                     /locus_tag="PAS_chr2-1_0328"
                     /product="Palmitoyl transferase involved in protein
                     palmitoylation"
                     /transcript_id="XM_002491180.1"
                     /db_xref="GeneID:8199016"
     CDS             614395..616143
                     /locus_tag="PAS_chr2-1_0328"
                     /codon_start=1
                     /product="Palmitoyl transferase involved in protein
                     palmitoylation"
                     /protein_id="XP_002491225.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0328"
                     /db_xref="EnsemblGenomes-Tr:CAY68945"
                     /db_xref="GeneID:8199016"
                     /db_xref="GOA:C4R0C1"
                     /db_xref="UniProtKB/TrEMBL:C4R0C1"
                     /translation="MVAPIPFKKFRFHRYDRYTAGSRWLYETRYHFNFWSYNLKTCAG
                     LLGVCIYITMILTMNFLYENGTRMDFPVDVELDPFFLKEQLYMQLQATYFNQTNIVVN
                     KTIGVNPFYQTMPEASQLSSIDRIAMLTEPVVRDENIHVPKLPLKLNYFDYKTASLQQ
                     SIISTFKGRMGHLNKFLEYKITTQYSLRVPELTHQPTEVKISDKGILYELVWNGGDEK
                     KVEDRGSAAEYFQSLGVPPEHFLIFKGSKTAPAHFNFSKPQWTLHDLGSHMIREYSYL
                     NHEKTAAMQTLADLIIFFSKQRFNLTVTNYDLVVKSLEDSIEKHRSKIILGRDLYFFS
                     VIGCVGICASIILITILLDFLNRSASKSYLKTLCWGIRVVQILLSILCLYGVSAGIVY
                     TALFTQAIESVDNDSFSELSRLLNSLELTAKFKVLKGFTNWFDFLFFRLLSTVFSFVI
                     PTLAFIYFLQCEFHDLQVRLNYKMIDKYSYYVHKEAARSLLRHDLRAMDKEDDDYDNR
                     QIYLYQDKQKRFLPVWIYLKNPKQYQRIINEFSKDREKHPIYTEMQLEKNILNYRVLA
                     ADYKLKPGEDIRSLPC"
     gene            <616284..>618443
                     /locus_tag="PAS_chr2-1_0829"
                     /db_xref="GeneID:8199017"
     mRNA            <616284..>618443
                     /locus_tag="PAS_chr2-1_0829"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491181.1"
                     /db_xref="GeneID:8199017"
     CDS             616284..618443
                     /locus_tag="PAS_chr2-1_0829"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491226.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0829"
                     /db_xref="EnsemblGenomes-Tr:CAY68946"
                     /db_xref="GeneID:8199017"
                     /db_xref="GOA:C4R0C2"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C4R0C2"
                     /translation="MNEAEPLDKTSLNEDKIQDSLFSNENPTTLTGSEEILLKETEDA
                     EIDLNLIARFKHACVIGDLKTVQDILENGLLSVDELDDENLTGLHWAGLNNRYSVCKY
                     LIEKGADLSLVGGELSATPLHFAAQRGHVYIADLMLSHGANVTAKDSQGADILQAAVL
                     SGNVLLVIYLLNTQDQCNINTHDKNLLTPLHWASYRGDALTVDILLKHGADVTMVDNK
                     GFTPLYWALTRPDIRIIKILVAYGSSLHVETLEGQKNAFKIAQEMETESLLLAALKLN
                     DQNPDGSPTKHYLTEKQAKSITFFTPYLVLFAALHLVKFQSSLWLLNLAILVVVAFAA
                     VKLLNVFAFPVYLRVHGPLLKSPYLAGTFSATAFWAIFTWLVRILPFTLFESFVINVI
                     FAAMSGLMILTFYKTLMLNPGYVPLPLEKSEIKKTIEDLLELHKYDTRHFCIKSFIRK
                     PKRSCYSEFQKRTVARYDHFCPWVFNDIGVRNHKPFIAFSVSLQVAILCFIILTIEYF
                     DEMKLTNEKEIKHSCSFLGEDLCKGYRGAPFTFNVLVWVTFQFIWLSMVNIVQFIQIF
                     KGLTTEEAKNFSNPDRMNKPWENFGSVPPEFWNDGSTLDPLEVEGPDFENSHEACQSP
                     MERIKGGFNKCFKLVGIDQLLGMAREVVKNTHRQRYTDFGWKQNMIDFWFLRDEDEGL
                     SMETLFRIPIKGEGNLNGKLVDYYTLWELPGENSEPV"
     gene            <618580..>620355
                     /locus_tag="PAS_chr2-1_0830"
                     /db_xref="GeneID:8198104"
     mRNA            <618580..>620355
                     /locus_tag="PAS_chr2-1_0830"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491182.1"
                     /db_xref="GeneID:8198104"
     CDS             618580..620355
                     /locus_tag="PAS_chr2-1_0830"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491227.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0830"
                     /db_xref="EnsemblGenomes-Tr:CAY68947"
                     /db_xref="GeneID:8198104"
                     /db_xref="GOA:C4R0C3"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:C4R0C3"
                     /translation="MIGRRVLGQVPNEGELSPTASPNGAESLSCPICNENMINLGQLN
                     QHLDDTHTNNDPSESVNIGPYLEKDLKNWFRTKVVDRANSLHPLISSKLNTMDVVDNM
                     GYFTISDSATSSAPNSTTNSRISSPGLETSEISRSHWKKPKGNDFCHLKECKRRLNIK
                     NGIVNCRKCGFLFCNEHTYYRIKVNQTLQYDPLGGQFVRCCITCFTNKPFFNNFEGFA
                     LDDTKTFQELREKRLESDRLKTIVLEKRLRKIFAFVYDRDNPSKVNNSEVTNYVKQII
                     HWQTDNELNNCPLCFKQFGRFLMRKHHCRLCGEIRCDDGCSLDIPMNYLKQLFDQSPE
                     TNEQYDQNHPTEDDTIVFDKVSLRICKLCKNRVFHRRLFTQNRSSSTGIDDLLSTIRL
                     VNIYKEKIHQLLPGFEEDLQRLQTIDSASNSNQILPTKELEDDEQFLKMLVEKRYKIM
                     SVFNKIDKIAKGLKLTIDQNDTLLSLKKPLAEGMTIDQLKIARSIYMQLASFLQENML
                     KLQKVPNLTNKPSTENEGLSKLEIREYRDKLMVLQEQHYLINSMIDDSKKKRKFDDLK
                     ILDENLADIETEIQTISRKLGDDSF"
     gene            complement(<620382..>623015)
                     /locus_tag="PAS_chr2-1_0329"
                     /db_xref="GeneID:8198105"
     mRNA            complement(<620382..>623015)
                     /locus_tag="PAS_chr2-1_0329"
                     /product="Transcriptional activator of proline utilization
                     genes"
                     /transcript_id="XM_002491183.1"
                     /db_xref="GeneID:8198105"
     CDS             complement(620382..623015)
                     /locus_tag="PAS_chr2-1_0329"
                     /codon_start=1
                     /product="Transcriptional activator of proline utilization
                     genes"
                     /protein_id="XP_002491228.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0329"
                     /db_xref="EnsemblGenomes-Tr:CAY68948"
                     /db_xref="GeneID:8198105"
                     /db_xref="GOA:C4R0C4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R0C4"
                     /translation="MAQGFPVQRIKLKEQIDTTPVGVIGRLHYACLRCKAQKIKCSGD
                     KPSCSNCIMARKGSECSYPNKDRKVIILESQLDKLTDRIKYLETVIVDLVKEPDSNSI
                     QIKRELERRDRIPDSNLNGDSVYNPSIKSDVDSKTDDETEMQYLQARSTPSIPFIGAE
                     QRRKNNQSDTLSADSGKEFEDLSMKLDSAISLSFGDNDGNAKSNNKVSKFLKSHSKYY
                     LPDSQFKKPIDNQTSLILPSQAYALKISQLCLDFFQSQQLYCFDHSIFVPHFYKLYED
                     GATDNQLLLVQLLLSLSIGEQIYYSLVSNKDPDFVINKQLYFQQNNLDSNTPGLRFFK
                     QAMEISNYIEEDPSLTNIQNCLLIAYYSQSLNRITTSYAYLGLATRLCLVLGLHTKYV
                     NTTNNDVIYNEKRKRVWWTTFILDSFATSRVRLPQHITFDQTDIELPTENFLDLGDGF
                     DGTILQRQVQLGKFAGKILSLIYNHSKRSYFGDKNTVMLHRETTEDIINNTLACLKLL
                     EEHFERNLKEDFIQLNRDIASNNNDTKRPLIHLFLKFNQYIITTTRPLVLVIFKKYLV
                     ETEQTRQITSRCILAACHSIDLLYQLRKIEGLPIFDYWDTHFCFSSVLILMMAIFTGK
                     SYSQLDKGVELLKYMANCGNHVAKDNFIKLRNIHKLFEQIGLPNRTTVDLTLLDDDIN
                     DSSNSSETASIKLENQDNVKLVLNPRQGPTITPSLNEFLIPEPSDTTNASSGDNVFSF
                     NGSQFNKINSTANSSYNDLSYLSTTMNSDLANQRYHFTPYTEANSNRQSFGLPPSGEY
                     ENGNRNPKNNTNGNPVDINYPNVYNQSINQGEQRPTNEIFPDFLSNINSWEYNPNFIF
                     EPVIQQMNQDQQAEINNAQSL"
     gene            <623299..>624333
                     /locus_tag="PAS_chr2-1_0330"
                     /db_xref="GeneID:8199018"
     mRNA            <623299..>624333
                     /locus_tag="PAS_chr2-1_0330"
                     /product="Probable cochaperone, regulates activity of
                     Cyr1p (adenylyl cyclase)"
                     /transcript_id="XM_002491184.1"
                     /db_xref="GeneID:8199018"
     CDS             623299..624333
                     /locus_tag="PAS_chr2-1_0330"
                     /codon_start=1
                     /product="Probable cochaperone, regulates activity of
                     Cyr1p (adenylyl cyclase)"
                     /protein_id="XP_002491229.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0330"
                     /db_xref="EnsemblGenomes-Tr:CAY68949"
                     /db_xref="GeneID:8199018"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR007699"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4R0C5"
                     /translation="MTLESLISSGVELIEQGNYLKAIDQFSRALQLSDSSFKAYLNRS
                     IAYQRSQKLDLALKDVDQAIHIAKDLRQSQEYISASYFRKAIILYLLKNYAESYQNIL
                     LAQKYHCSDITFPSWKSKIEAKLDSEKSKPVQSVPDSSKAEKPSANEKPLQPTTPSIA
                     SKPRIDWYQNSTEVNISIFVKKIDKSSLKVDFAKDSLEVSFPLPDSGEDYTYKIEKLF
                     AKIDPSQSSYTVFGTKLELTLQKIEPIQWNSIEFDQQRQPSTTHEESTLAYPSSSKKK
                     IDWSKLGDDEDEAKDDQSPDAFFQQLYKNADDDSKKAMMKSFIESGGKSLSTNWDNVE
                     NKDFSAEAEP"
     gene            complement(<624343..>625902)
                     /locus_tag="PAS_chr2-1_0331"
                     /db_xref="GeneID:8199019"
     mRNA            complement(<624343..>625902)
                     /locus_tag="PAS_chr2-1_0331"
                     /product="Mitotic spindle midzone localized
                     microtubule-associated protein (MAP) family member"
                     /transcript_id="XM_002491185.1"
                     /db_xref="GeneID:8199019"
     CDS             complement(624343..625902)
                     /locus_tag="PAS_chr2-1_0331"
                     /codon_start=1
                     /product="Mitotic spindle midzone localized
                     microtubule-associated protein (MAP) family member"
                     /protein_id="XP_002491230.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0331"
                     /db_xref="EnsemblGenomes-Tr:CAY68950"
                     /db_xref="GeneID:8199019"
                     /db_xref="GOA:C4R0C6"
                     /db_xref="InterPro:IPR007145"
                     /db_xref="UniProtKB/TrEMBL:C4R0C6"
                     /translation="MMIQEKNGNLDMNTVDYIIEDTNFKHMSIPLLANLNFEIKALIG
                     NATDKIKDLFQNKLSKYMSTFEVLNGYIPDDSLIQNLVSIRSTILHEKLPEVTSLLKE
                     DLSVSSLLIIQAFFNDSTISHLLLSDFEELECNLKLVLKEKDVREKKLAELKSQCQSL
                     WAKLDTEVDANYITEFLLSNNNIHQSSIENYQHELERLNELKLKNAAKFISILRKEIE
                     SYWNLLMYTQEEKRNECPEYFVSESTRLDEDLLNKHQLYISENLNVKVEQLKPILNNV
                     ERLKELVKEKRELEESCKDSSRLLSRDSFKILKREEQIRTRITKHIPLLLEVLKPQLE
                     NYKQEAGKSIIVDGVDVWETINELESKFFKSRIKRTPSRRLNKSAPSSSRSGDGNRRN
                     SSTATTPTRNKVIRSNSTLGVFRTHHNTNGKLLNLKDSYKSKQPGARQGPGPLRPINI
                     NVNSRGANRMGKPKHVLKVRKPQLVVSKNVNVFSSPERFKDQTPVYLSSEDELDTENK
                     LPAWNMDLETF"
     gene            complement(<626058..>626456)
                     /locus_tag="PAS_chr2-1_0332"
                     /db_xref="GeneID:8199020"
     mRNA            complement(<626058..>626456)
                     /locus_tag="PAS_chr2-1_0332"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491186.1"
                     /db_xref="GeneID:8199020"
     CDS             complement(626058..626456)
                     /locus_tag="PAS_chr2-1_0332"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491231.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0332"
                     /db_xref="EnsemblGenomes-Tr:CAY68951"
                     /db_xref="GeneID:8199020"
                     /db_xref="UniProtKB/TrEMBL:C4R0C7"
                     /translation="MDPTNIDSFLSRLKPDLVRLKSLRESLGTDSNDCKDEQTITNTI
                     QNLISNTETIIKQINYELNVKLKNTAKIYNIIKNCQLSNTKEFVWNSDLLTTKFILDF
                     NKKHNEHPHEEIDLRQLLAPKKHFMTYETK"
     gene            <626914..>627924
                     /locus_tag="PAS_chr2-1_0333"
                     /db_xref="GeneID:8199021"
     mRNA            <626914..>627924
                     /locus_tag="PAS_chr2-1_0333"
                     /product="Zeta-crystallin homolog, found in the cytoplasm
                     and nucleus"
                     /transcript_id="XM_002491187.1"
                     /db_xref="GeneID:8199021"
     CDS             626914..627924
                     /locus_tag="PAS_chr2-1_0333"
                     /codon_start=1
                     /product="Zeta-crystallin homolog, found in the cytoplasm
                     and nucleus"
                     /protein_id="XP_002491232.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0333"
                     /db_xref="EnsemblGenomes-Tr:CAY68952"
                     /db_xref="GeneID:8199021"
                     /db_xref="GOA:C4R0C8"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R0C8"
                     /translation="MTTIPKTQKVILFEETSQDLSVLQYKDFPVPEISADEILIKNKY
                     AGVNFIEAYFRSGLYPSKTPYVLGREASGVVVAKGDNVTKFKVGDKVAYLSPSTFAQY
                     TKVDGTTGIRILKLKDDASEEDLKLFGSVLVQALTALTFVYEPYNVKSGDFILIHAAA
                     GGVGQLLTQLAASKGAKVIATASTDAKLQIAKELGASFLINSSTEDIVEKVKEFTNGV
                     GVNAVYDGIGKATFEASFESLAPKGTFVSFGNASGAVPPFSISRLAPKNIAILRPQLF
                     GYTNTPETWEKYSKELLGLLSDGKLKFSITKVYSLKDYPKAAQELESRATTGKLTLEI
                     PQ"
     gene            <628025..>628909
                     /locus_tag="PAS_chr2-1_0334"
                     /db_xref="GeneID:8199022"
     mRNA            <628025..>628909
                     /locus_tag="PAS_chr2-1_0334"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491188.1"
                     /db_xref="GeneID:8199022"
     CDS             628025..628909
                     /locus_tag="PAS_chr2-1_0334"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491233.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0334"
                     /db_xref="EnsemblGenomes-Tr:CAY68953"
                     /db_xref="GeneID:8199022"
                     /db_xref="UniProtKB/TrEMBL:C4R0C9"
                     /translation="MRLSYECLFSVFLVLAYHLKGTKATPPACVFECVSVVSNSCPKR
                     ETDTECLCAQKDSIIGCLVDICKPLDFSGARDHINETCLNLKEGNQHREKCQLSHEHD
                     DSCGGNLWDCELNHKHNNTCARNNPWNCDLEHQHNEFCGKKDPQCELNEDGICRNNST
                     YTENNLEVSLQLEDWNSDPDNESLEDVSEDSSSDEESTCSDEADSDCDSEYDPYEYEP
                     YGYRKRDMDKPISKSERPLLTRSKKQLDKQLRPSAKAAHANPIYPFKDKIPIQSLPKL
                     NKLNSVSNSVENSLESLL"
     gene            complement(<628940..>630862)
                     /locus_tag="PAS_chr2-1_0335"
                     /db_xref="GeneID:8199023"
     mRNA            complement(<628940..>630862)
                     /locus_tag="PAS_chr2-1_0335"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491189.1"
                     /db_xref="GeneID:8199023"
     CDS             complement(628940..630862)
                     /locus_tag="PAS_chr2-1_0335"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491234.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0335"
                     /db_xref="EnsemblGenomes-Tr:CAY68954"
                     /db_xref="GeneID:8199023"
                     /db_xref="UniProtKB/TrEMBL:C4R0D0"
                     /translation="MPLDPEIDPKVTEVGLNQSEAEQIQLAAMAAAAAGSPGRPDDYA
                     SFIEQAVAHQQAEQQHNQQQRHQDSQEPSNIVTLPSNLHQPMTTTELALKALNGSSNV
                     TERTPGPFNDVKNDIPIPSRYDAESNDSHLDFVSMDPGTSKDQSINRPNLSSVSSPLE
                     SSSDHNYSESIISKFRLDSLPVIGPGSRGGKVRLRGGKNPQLIRDRRTNHQLKGFKTI
                     FENPSSREIVTVIDDRNENYKDKSDTSKNTEEFIPSDPANHPRIILEDYNSIVTRGIT
                     TARDDAPKRGRGPSKKRLLEMGISVTPVVKKLRGRPKGSKNRATKSSFHLGTKEDLNL
                     NPWDPAILSIAESVESGLEHHPIALGYPIRPTSIARDILYISGVIKQIRPDLPLSPQD
                     FEAGLQLNNKLTVDEPSSLANIAQLSLAQSYPLGNASETMKIVYGVLVGSILDMPQST
                     LDSGDYSKYFQLLSERISVSGLELNGFNLDKPFLNQGLDDLSANERLKLLTSLAQLAA
                     GKNFGDDFDPVQQFEILRLGTVGTFYLAKSAGHFKMYTKLPAAVRVENIWASTVIVTE
                     SLTRKNDLWYEVCENKEELSTFIAYLSFRLSPYSKQNMKEFSSLIPKRTIRNSALAGA
                     LTKFVEHLKDFRKQLL"
     gene            <631130..>632167
                     /locus_tag="PAS_chr2-1_0336"
                     /db_xref="GeneID:8199024"
     mRNA            <631130..>632167
                     /locus_tag="PAS_chr2-1_0336"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491190.1"
                     /db_xref="GeneID:8199024"
     CDS             631130..632167
                     /locus_tag="PAS_chr2-1_0336"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491235.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0336"
                     /db_xref="EnsemblGenomes-Tr:CAY68955"
                     /db_xref="GeneID:8199024"
                     /db_xref="UniProtKB/TrEMBL:C4R0D1"
                     /translation="MDHLSSTKQFIDEALKTAEQGTLPKGESGHISGHDSDHLLVPEH
                     MNLHQFLPMGDVGEEESHLTAETIGCTRCKKQFEQGPRKYKLCPYCRKLQRERSRRWQ
                     QKTKEKVGVCRRCGITMDPGESEQFVLCGKCRGSLRTKKRHRAEEGRCVHCSGENENS
                     AYKVCSRCRSNDKERRISLEKRGLCNRCATLLTDLERDHKVCLKCRNKKRYCKGAGRK
                     SLHEQVDVAEAAAVALANGTKNLSPSNSNLSSNSGAASLHLPDGMTVQEFLLSAQQHL
                     GGGTGHLHLLHPRSTHDPLSMGDANKVCLKCGIGISIDDVNNNGSSNFCGKCLESESN
                     LFMNSESSAQH"
     gene            <632469..>632744
                     /locus_tag="PAS_chr2-1_0337"
                     /db_xref="GeneID:8199025"
     mRNA            <632469..>632744
                     /locus_tag="PAS_chr2-1_0337"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491191.1"
                     /db_xref="GeneID:8199025"
     CDS             632469..632744
                     /locus_tag="PAS_chr2-1_0337"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491236.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0337"
                     /db_xref="EnsemblGenomes-Tr:CAY68956"
                     /db_xref="GeneID:8199025"
                     /db_xref="UniProtKB/TrEMBL:C4R0D2"
                     /translation="MMNVKRRNDACYSQGGDHSPLLSSVKSAFSRAMREYYLMYYYMC
                     PFEVMSTDEAVILHIIMTCLFLLVGYSLVHLLDLVVALTRRLVTHLV"
     gene            complement(<632841..>633431)
                     /locus_tag="PAS_chr2-1_0338"
                     /db_xref="GeneID:8199026"
     mRNA            complement(<632841..>633431)
                     /locus_tag="PAS_chr2-1_0338"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491192.1"
                     /db_xref="GeneID:8199026"
     CDS             complement(632841..633431)
                     /locus_tag="PAS_chr2-1_0338"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491237.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0338"
                     /db_xref="EnsemblGenomes-Tr:CAY68957"
                     /db_xref="GeneID:8199026"
                     /db_xref="InterPro:IPR019560"
                     /db_xref="UniProtKB/TrEMBL:C4R0D3"
                     /translation="MNNDKETTDTGLRYAAYANRVRTILLAAHRYVAYTSDIGESFRP
                     VAHPYLVKSCYAISWSYILGDVAYEGWKANLKQNGQYSSHLKPWSSPSDYPEPDPTSA
                     KIYTEKPDFLDWKVLMVKRGLFQSIASMGLPAFTIHSSVRYSSYIFKNSKIHALRTYG
                     PVGIGLAVVPLLPYLFDEPVEHAIDYAFSEGKLLLA"
     gene            complement(<633615..>634349)
                     /locus_tag="PAS_chr2-1_0339"
                     /db_xref="GeneID:8199027"
     mRNA            complement(<633615..>634349)
                     /locus_tag="PAS_chr2-1_0339"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491193.1"
                     /db_xref="GeneID:8199027"
     CDS             complement(633615..634349)
                     /locus_tag="PAS_chr2-1_0339"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491238.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0339"
                     /db_xref="EnsemblGenomes-Tr:CAY68958"
                     /db_xref="GeneID:8199027"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:C4R0D4"
                     /translation="MTLRIKIRFSNELPDLEVPSNFQVSLKELRSYVRSQYNQISNKR
                     LKFIYQGKVILANTDFDSLPHTNEEIFIHCLVGETLTADELADEGQWDTKQPIKSTEE
                     AAVGFDRLLSQGFSRQDVDELRSTFHSMYGSGENEDLRELEDNWIDSTVNNEFDEFSN
                     VLNNRNQNTQLANAPAGAAVNVNNHVPDTNRDLLIGTLLGCFLGVFALFLMRLDLGGI
                     VNKRTKTAIIAGVCINFSLGIIRMFS"
     gene            <635048..>635344
                     /locus_tag="PAS_chr2-1_0340"
                     /db_xref="GeneID:8199028"
     mRNA            <635048..>635344
                     /locus_tag="PAS_chr2-1_0340"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491194.1"
                     /db_xref="GeneID:8199028"
     CDS             635048..635344
                     /locus_tag="PAS_chr2-1_0340"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491239.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0340"
                     /db_xref="EnsemblGenomes-Tr:CAY68959"
                     /db_xref="GeneID:8199028"
                     /db_xref="InterPro:IPR019034"
                     /db_xref="UniProtKB/TrEMBL:C4R0D5"
                     /translation="MVQGAQKLAVKKKARVTKQQMNPRKAAPRIIKARNQTKGIKLTQ
                     KLNRIHSASLVAQTERLVASRVGHLELVKGSRRQLEKAQKEKDKKKPNAAKASK"
     gene            <635802..>636761
                     /locus_tag="PAS_chr2-1_0341"
                     /db_xref="GeneID:8199029"
     mRNA            <635802..>636761
                     /locus_tag="PAS_chr2-1_0341"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491195.1"
                     /db_xref="GeneID:8199029"
     CDS             635802..636761
                     /locus_tag="PAS_chr2-1_0341"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491240.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0341"
                     /db_xref="EnsemblGenomes-Tr:CAY68960"
                     /db_xref="GeneID:8199029"
                     /db_xref="InterPro:IPR024382"
                     /db_xref="UniProtKB/TrEMBL:C4R0D6"
                     /translation="MFSLAVGALLLTQAFGYSNPAISQLNGDLHSNKISAESAILNLA
                     DYLDIDEDYRLEPDTVLLPELQRSPIDDELVIIISGVDDYADILPLQSSVDVGSGEIS
                     TFIQFVNGISNKFDETVSRLIKQDVAKRDSVINHDLNGLKHVLASNANAIFRVDALSD
                     FARTAGVDSESYKAAKEAITNVLRSTGREVLVVTTPPFDFAQEITKREVKGTFNSFSC
                     FKTQDACIQNTNTCSNHGICSKVGDCYKCLCTPSKDAKGSTISWSGFNCAKKDYAVEF
                     NLFLWSGIILVALLVAGVKLLISIGNEPMPGVLLAATSAKKAN"
     gene            complement(<636802..>637986)
                     /locus_tag="PAS_chr2-1_0342"
                     /db_xref="GeneID:8199030"
     mRNA            complement(<636802..>637986)
                     /locus_tag="PAS_chr2-1_0342"
                     /product="ER localized integral membrane protein that may
                     promote secretion of certain hexose transporters"
                     /transcript_id="XM_002491196.1"
                     /db_xref="GeneID:8199030"
     CDS             complement(636802..637986)
                     /locus_tag="PAS_chr2-1_0342"
                     /codon_start=1
                     /product="ER localized integral membrane protein that may
                     promote secretion of certain hexose transporters"
                     /protein_id="XP_002491241.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0342"
                     /db_xref="EnsemblGenomes-Tr:CAY68961"
                     /db_xref="GeneID:8199030"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:C4R0D7"
                     /translation="MSTEDEDIINNLEETEVEGLVEIFIRMNDEEDKDYCFQVSTNST
                     FKDLLKIFDSLPLTLAPTCFQNLRPIGFQVSTSPGFLTASGGLLFDDDATNKKYLVNV
                     ALSDKIGDKVWPGQLIVPKWEFNSTAFLVIQSIFLLWLYTDLPDFISPTPGISLTSQA
                     LKAGAYIAKLLHYDDFADLLLNELLTEESKFTQSLFFVFHVAKIGFLELLLYFGFYRP
                     YSFDILHIFTPAPAPIDKETLRKIGWTGARKVSVQDYKSRYRDHQTKKVGSLLKAKEL
                     GLFEKIIYGGVQLKDGEGWNTPLPTEDDKGAKSNTLDKLLQANGKFILNYDYIAHIGE
                     YWETNELDVLLAKKDQCENEEELRQLDQQLNKAARDFRSYGPLECSEKVTKIVDNRMA
                     LK"
     gene            <638596..>640089
                     /locus_tag="PAS_chr2-1_0343"
                     /db_xref="GeneID:8199031"
     mRNA            <638596..>640089
                     /locus_tag="PAS_chr2-1_0343"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491197.1"
                     /db_xref="GeneID:8199031"
     CDS             638596..640089
                     /locus_tag="PAS_chr2-1_0343"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491242.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0343"
                     /db_xref="EnsemblGenomes-Tr:CAY68962"
                     /db_xref="GeneID:8199031"
                     /db_xref="GOA:C4R0D8"
                     /db_xref="InterPro:IPR002129"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R0D8"
                     /translation="MTPIKTDLEADRVTELETLLRPAVELIAQHIKDTDENDKPIGPY
                     YPNPRDLYQSLKLEADFNGGGKDDELVIQTVKKVLDSSVNTWNAGFMDKLYASTNVIG
                     LVSDLLLSALNTNSHVFTVSPAVTIIEKYTARQYAGLFGFLGPRAGGLTFPGGSWSNV
                     TSLQMARSSLYPDTKVKGNGNHHFAVFASSHSHYSVEKACILLGIGAENLFKCKVDKN
                     GCMDVTDLRVNIEKSIAEGYTPLYINATAGTTVFGSYDSFEDIHKIAKEYKCWFHIDG
                     SWGGNVIFSDREKHKMKGSHLADSITANPHKMLGVPCTCSFLLVPDVSIFQQANSLNA
                     PYLFHNKHEDDDENYDLADGTMGCGRRADSLKFYLSWLYYGSEGYKERVDHAFSIARY
                     FTSKIVNRKGFKLVGSPEPACLQVCFYYNPKNDFENGSENTNATRYIATELHKHGKFL
                     VDYSPNPDDVDNQHGEFFRVVFNSPILDDKTIDSLIDLIEQTGEEIV"
     gene            complement(<640139..>640530)
                     /locus_tag="PAS_chr2-1_0344"
                     /db_xref="GeneID:8199032"
     mRNA            complement(join(<640139..640454,640520..>640530))
                     /locus_tag="PAS_chr2-1_0344"
                     /product="Protein required for assembly of cytochrome c
                     oxidase"
                     /transcript_id="XM_002491198.1"
                     /db_xref="GeneID:8199032"
     CDS             complement(join(640139..640454,640520..640530))
                     /locus_tag="PAS_chr2-1_0344"
                     /codon_start=1
                     /product="Protein required for assembly of cytochrome c
                     oxidase"
                     /protein_id="XP_002491243.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0344"
                     /db_xref="EnsemblGenomes-Tr:CAY68963"
                     /db_xref="GeneID:8199032"
                     /db_xref="InterPro:IPR018793"
                     /db_xref="UniProtKB/TrEMBL:C4R0D9"
                     /translation="MVASCKDQLKQVAICLQRSPCVMIERNTPKDCITDPVKAKDLPE
                     LCKAQLSTFLECKRGIVDMRKRIRGNAPLSTGKYDEQYEKLSTGDFDPREEMQKLDSL
                     NTHNER"
     gene            <640879..>645082
                     /locus_tag="PAS_chr2-1_0345"
                     /db_xref="GeneID:8199033"
     mRNA            join(<640879..643977,644045..>645082)
                     /locus_tag="PAS_chr2-1_0345"
                     /product="Subunit of the RAVE complex (Rav1p, Rav2p,
                     Skp1p), which promotes assembly of the V-ATPase holoenzym"
                     /transcript_id="XM_002491199.1"
                     /db_xref="GeneID:8199033"
     CDS             join(640879..643977,644045..645082)
                     /locus_tag="PAS_chr2-1_0345"
                     /codon_start=1
                     /product="Subunit of the RAVE complex (Rav1p, Rav2p,
                     Skp1p), which promotes assembly of the V-ATPase holoenzym"
                     /protein_id="XP_002491244.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0345"
                     /db_xref="EnsemblGenomes-Tr:CAY68964"
                     /db_xref="GeneID:8199033"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022033"
                     /db_xref="UniProtKB/TrEMBL:C4R0E0"
                     /translation="MNFLPGEPNRSIEAVRSCNWNDVPIISYCSGNNLIILTNNCARV
                     QTIYLDKDPYSVDINKLNGKIAITLDNELHIYKPVISNYFQYKRSKNLADLRIEYQHE
                     LTVTNDEDSSRINSICWSDHIDPTDDEDSSNRFLDLPDDLNTETSCEIVVGSMESLTL
                     WRLYYKNKRDHAHMTISARKLWFKVQPSPIYLCKVSPSSDLIVSCGIYDSFIKVWFRV
                     SYGIVKSEFDLTYLNNQVHVSQLRWKQEVTEASSNRDHMHTLYSIGVDSKMRVWSIFE
                     IDGIHSFYYSGSVDFKAEDEPSFILNIDGSITKRMIADLKRKKKQVSELLLEEDLELC
                     MVIYSSGKAELYSMEHLNSLPARPLSIEKLPIINGGILKFGENCLPKPFLLIYFQELT
                     ISSDNNLKLVLHDLNKSTIRDVSLGNDFLLDVARSTDQPTSHTEKETLVPVGKLDHKF
                     TGHMKSIRRLIRSIDGSSVLSITRFNESYLWYPIRLSNGVTLSKKCTIRANIVVAVIL
                     AKSDIVIGISAGEISVWSTALVPTKTATKLTSLPIDEDLTPVSFFLLPEFNRGNKNLF
                     HIIAIYDVNNVKCWKFDLSSKELSKITIANIPFSSPNNSEIHLIQQIDPVGHSNRFTR
                     TPKDILSIVDKDGYVNIFGIKFEEGRYHWIRKFFFHSNTPNMTYIKGSSLHKVAIVNS
                     SKKVLSIWDCKRKFLEYQETFSEDLEIKDIDWTCTDYSQSILAIGFNKHVLLFTQLRY
                     DYTNETPSYKPIKNIDLSSMTTHDIGDSVWLEDGTIAIGCSNQFYVCDKSLDMNDAVT
                     QDLIGSYNDAHVEDIFELCAFVNGPLPLYHPQFVIQSFFWGKYTFVEKLLVQMYNKLR
                     ELDLNPELDASIELSRNFGSEKISDYVRDQENFSTDNTPQVSRTPSAVFDQNDLGEAT
                     RLKPDVSKVLLSKLVKYRLPFLTGHQQITLASTIEILTDILEKYQDVLDPNGLRFFLG
                     YKLFLLNSTKVNQVYDSITMRDVNFALHSDNKDVLLNMILDQQTNSKNKLTWKLARKI
                     QTFYSIDNDGKRDPSTCSIFYLALRKKQILIGLWKNSIGHPEQSKMLRFLSQNFKEQR
                     WKSAALKNAFVLMSKHRYLDAAIFFLLGDSLKDCVNVLVKKLEDVPLAIAVARVYEGN
                     DHGPVLKELLTNTILVSSAVKGDRWTTSWVFWKLSDRNRSIQALIKNCSELIEDDQIL
                     SEISKSQRSVTIKDTIIERVMDDPVMMIVYDGLRKKHIDYFKGLTNINPRLEFEFILR
                     VVAIYERMGCDLISLYIVKNFNFMKRTEIITHIIEKDQKVIKNGNTTHVDNGHAQLEQ
                     ATKNGNVEVSPKIEENNSAISSTSSDHTRRKSVGFSKKLQPPPTEFQEPDMSSFNFGF
                     "
     gene            <645192..>645668
                     /locus_tag="PAS_chr2-1_0893"
                     /db_xref="GeneID:8199034"
     mRNA            join(<645192..645204,645256..>645668)
                     /locus_tag="PAS_chr2-1_0893"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491200.1"
                     /db_xref="GeneID:8199034"
     CDS             join(645192..645204,645256..645668)
                     /locus_tag="PAS_chr2-1_0893"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491245.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0893"
                     /db_xref="EnsemblGenomes-Tr:CAY68965"
                     /db_xref="GeneID:8199034"
                     /db_xref="UniProtKB/TrEMBL:C4R0E1"
                     /translation="MSQDSDPILSRLPLVAIPGKYTQPKPITLPYEFIKLPDQLNKNM
                     FNSKKDRLKSLVSDCNDLEEKLKLLTRSFNDDISEDHKGYNPVAYDQWVKETNSLAPG
                     YFDDQHHLLQPKKPKQIHDNTSTMDNLSQHFATTTLSPK"
     gene            <645915..>648149
                     /locus_tag="PAS_chr2-1_0346"
                     /db_xref="GeneID:8198962"
     mRNA            <645915..>648149
                     /locus_tag="PAS_chr2-1_0346"
                     /product="Methionyl-tRNA synthetase, forms a complex with
                     glutamyl-tRNA synthetase (Gus1p) and Arc1p"
                     /transcript_id="XM_002491201.1"
                     /db_xref="GeneID:8198962"
     CDS             645915..648149
                     /locus_tag="PAS_chr2-1_0346"
                     /codon_start=1
                     /product="Methionyl-tRNA synthetase, forms a complex with
                     glutamyl-tRNA synthetase (Gus1p) and Arc1p"
                     /protein_id="XP_002491246.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0346"
                     /db_xref="EnsemblGenomes-Tr:CAY68966"
                     /db_xref="GeneID:8198962"
                     /db_xref="GOA:C4R0E2"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:C4R0E2"
                     /translation="MTEQVYGSLGSGLLDLSDNLKLSIATSLFSKACVLQDKDVTETV
                     LLKTKSGFELFEPNAIVRYLASSRIGLDAFKRSNLSHFEEVVLYNVLKSGKSLTEPLL
                     ELPPINTSSPEQVILFSSLYPIKDSLPKSANTWISEFASKVEKAVAHAISITKLERAK
                     EENTGASHVEAEFVKPQDASIKPKPNERNILITSALPYVNNVPHLGNIVGSVLSADIY
                     ARFCKARNYNTLFICGTDEYGTATETKALEENVTPRELCTKYHKIHSDVYKWFQIGFD
                     YFGRTTTELQTEIAQDIFMKLYNNGYLEEQSMRQLYCPVHNGFLADRYVEGECPKCHY
                     EDARGDQCDKCGTLLDPFELINPRCKLDNASPEPKNSDHIFLSLDKLEPPLREWVAKA
                     SEEGKWSKNSRTITDSWIKEGLLPRCITRDLVWGTPVPLDGFEKKVLYVWFDATIGYI
                     SITANYTKHWKEWWKNPDHVDLYQFMGKDNVPFHTVVFPASEIGTGDKWTMLHHLSTT
                     EYLQYEGGKFSKSRGIGVFGNNAQDSGIPPSVWRYYLASIRPESSDSQFSWGEFVSKN
                     NNELLANLGNFVNRLTKFVNAKYNGVVPDYDVSNCENYEVLVRDVNAILKQYLIDLEG
                     VHLRKGLEVAMQLSARGNQFLQDNKLDNSLYNDKPAKSDAVVAIGLNLIYLVGSVIYP
                     YMPETTTQINQILNTASLRIPDEFGLFIKAGHCINKAQYLFKRIDEKKVDEWRALYGG
                     KQVK"
     gene            complement(<648239..>649051)
                     /locus_tag="PAS_chr2-1_0347"
                     /db_xref="GeneID:8199035"
     mRNA            complement(<648239..>649051)
                     /locus_tag="PAS_chr2-1_0347"
                     /product="Protein kinase"
                     /transcript_id="XM_002491202.1"
                     /db_xref="GeneID:8199035"
     CDS             complement(648239..649051)
                     /locus_tag="PAS_chr2-1_0347"
                     /codon_start=1
                     /product="Protein kinase"
                     /protein_id="XP_002491247.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0347"
                     /db_xref="EnsemblGenomes-Tr:CAY68967"
                     /db_xref="GeneID:8199035"
                     /db_xref="GOA:C4R0E3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /db_xref="UniProtKB/TrEMBL:C4R0E3"
                     /translation="MSVQLITTAQELLNNIPLNVISQGAEAIVFETQTHPFLPKSNQS
                     PTTKFIIKYRPRKPYRHPTLDLQIVSSRTQSEARLLHKLYQLGIKAPKLIAVDGPNGI
                     IWMESVGGTLPNGETSSLKNMLWFKEKSQEEREDQRNEPNIALDDEVKDIMSKVGGAV
                     AKLHLANIVHGDLTSSNIILDQHNDKWEPMLIDFGLSSYSLLAEDEAVDLYVLERALI
                     STHPIYSKSYNEWLLQGYERTFREAAASKKFTEISRRLQDVRLRGRKRSMLG"
     gene            <649270..>649977
                     /locus_tag="PAS_chr2-1_0348"
                     /db_xref="GeneID:8199036"
     mRNA            <649270..>649977
                     /locus_tag="PAS_chr2-1_0348"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491203.1"
                     /db_xref="GeneID:8199036"
     CDS             649270..649977
                     /locus_tag="PAS_chr2-1_0348"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491248.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0348"
                     /db_xref="EnsemblGenomes-Tr:CAY68968"
                     /db_xref="GeneID:8199036"
                     /db_xref="GOA:C4R0E4"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="UniProtKB/TrEMBL:C4R0E4"
                     /translation="MAFLTKDFILTTNKEEYPKALKAKAQTKKDQAKLLQLDNWKEEV
                     ISKTLDHRYQKESHLFLTKEELIKLVEWKLEKGKFRPTLRKLVSSNDETVVKQVTGRG
                     YDIFIAYIQGKEEFLTSVKKSLDEFCKLKGVGPATATLILSLFPSVGDKKVVPFFSDE
                     SFMYFNDIKIKYTLREYLDIYLPKVEAIGEETGINDLSIIEKFTWTLFMNGKTDSNTS
                     NSKRASEDTAAPTKRRK"
     gene            complement(<650011..>650985)
                     /locus_tag="PAS_chr2-1_0349"
                     /db_xref="GeneID:8199037"
     mRNA            complement(<650011..>650985)
                     /locus_tag="PAS_chr2-1_0349"
                     /product="Mitochondrial integral inner membrane protein
                     required for membrane insertion of C-terminus of Cox2p"
                     /transcript_id="XM_002491204.1"
                     /db_xref="GeneID:8199037"
     CDS             complement(650011..650985)
                     /locus_tag="PAS_chr2-1_0349"
                     /codon_start=1
                     /product="Mitochondrial integral inner membrane protein
                     required for membrane insertion of C-terminus of Cox2p"
                     /protein_id="XP_002491249.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0349"
                     /db_xref="EnsemblGenomes-Tr:CAY68969"
                     /db_xref="GeneID:8199037"
                     /db_xref="GOA:C4R0E5"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:C4R0E5"
                     /translation="MFRRIPHLKQRIGPNVVRLIPRRCMSLQVVQQTLEFTTTNLQLI
                     HQYSGLPWWALIPITTFTLRSLFTLPIAVLQRKRLQKQSVLRPLVTAMGPLLRLKLAQ
                     QASISQKLQRESIDFFPTEATKLNYEKIMILAAKESRKRQKKLFRDHGVQIWKNAILP
                     VFQVPLWVTLSWTFRNLTGWHSFEQGNKPLDSSLIHEGFFWLHDLTVPDPYMILPVVL
                     GSVALINLEWNNKTLQMRSSSAQGKKVSLRPTMMDAIMNLSRFSIAFLMVISTQAPVG
                     LSLYWISSNLYSLSQNMILDKYLPISYTPNERHTQGISYNKHNLISDN"
     gene            complement(<651310..>651654)
                     /locus_tag="PAS_chr2-1_0350"
                     /db_xref="GeneID:8199038"
     mRNA            complement(<651310..>651654)
                     /locus_tag="PAS_chr2-1_0350"
                     /product="Protein that forms a complex with Spt5p and
                     mediates both activation and inhibition of transcription"
                     /transcript_id="XM_002491205.1"
                     /db_xref="GeneID:8199038"
     CDS             complement(651310..651654)
                     /locus_tag="PAS_chr2-1_0350"
                     /codon_start=1
                     /product="Protein that forms a complex with Spt5p and
                     mediates both activation and inhibition of transcription"
                     /protein_id="XP_002491250.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0350"
                     /db_xref="EnsemblGenomes-Tr:CAY68970"
                     /db_xref="GeneID:8199038"
                     /db_xref="GOA:C4R0E6"
                     /db_xref="InterPro:IPR009287"
                     /db_xref="InterPro:IPR016046"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:C4R0E6"
                     /translation="MSTNKGVRERACMLCGIVLPGRVFMQNGCPNCDSVLNLRDSDQA
                     TVNECTSSSFEGLVAVGDNEHSWVAKWLRVDRFQPGLYAVRVDGRLPSDIVAALEQYG
                     VYYRPRDGSVID"
     gene            complement(<651824..>653512)
                     /locus_tag="PAS_chr2-1_0351"
                     /db_xref="GeneID:8199039"
     mRNA            complement(<651824..>653512)
                     /locus_tag="PAS_chr2-1_0351"
                     /product="High affinity methionine permease"
                     /transcript_id="XM_002491206.1"
                     /db_xref="GeneID:8199039"
     CDS             complement(651824..653512)
                     /locus_tag="PAS_chr2-1_0351"
                     /codon_start=1
                     /product="High affinity methionine permease"
                     /protein_id="XP_002491251.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0351"
                     /db_xref="EnsemblGenomes-Tr:CAY68971"
                     /db_xref="GeneID:8199039"
                     /db_xref="GOA:C4R0E7"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C4R0E7"
                     /translation="MVGLGKFSLSSNSNDSKGETLDNKESKDVNAVAPIDTDSESVNA
                     GELVVLDKGDRRIGLISAAFLITNRILGTGIFSVTSTILTLSGSVGVTLILWVVGMII
                     ALAGLYVYAEFGSYPSRLLQRNGGEKNYLEYVYKNPKFLVTCMYAMYVVLLGWASGNS
                     VVFGEYILNAANVEPTEWAARGIGIACVSFAFLINTLNVKAGLFVMNTLGFFKVAIVL
                     LISVTGWVALGGGINNSEFEPTGAFSNAFDGDSPSGYGIVMSLYNVIWAFVGYSNVNY
                     SLSEVRNPVKALKISAPIAVISLGVIYMFVNIAYFAVVPGDVIRSSGRIIAAHFFRIA
                     FGETAERACSVFVALSALGNVISVIFSQGRIVQQLGREGVLPFSSFFASQRPFNSPFT
                     GLFEHWVICVITIVAPPAGDAYNFVMNLISYPLNIINFFVAIGLLWLHYEARKGRREW
                     TPVIKSPIVVTFFFALASLYLVVAPYIPPTGGQNVYNDMPYWIHCVAAWGVFFAGGVY
                     WVIWAKILPRYGKYKLVSRDVLEDDGFWRNKFFKIPYGSELSEEEFIEEHQKNL"
     gene            <653722..>653862
                     /locus_tag="PAS_chr2-1_0352"
                     /db_xref="GeneID:8199040"
     mRNA            <653722..>653862
                     /locus_tag="PAS_chr2-1_0352"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491207.1"
                     /db_xref="GeneID:8199040"
     CDS             653722..653862
                     /locus_tag="PAS_chr2-1_0352"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491252.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0352"
                     /db_xref="EnsemblGenomes-Tr:CAY68972"
                     /db_xref="GeneID:8199040"
                     /db_xref="UniProtKB/TrEMBL:C4R0E8"
                     /translation="MASQMKTTIQKLGQSNENCNLQVQYKESTNDSSLTYQLEIIGEY
                     LK"
     gene            <655271..>655654
                     /locus_tag="PAS_chr2-1_0353"
                     /db_xref="GeneID:8199041"
     mRNA            <655271..>655654
                     /locus_tag="PAS_chr2-1_0353"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491208.1"
                     /db_xref="GeneID:8199041"
     CDS             655271..655654
                     /locus_tag="PAS_chr2-1_0353"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491253.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0353"
                     /db_xref="EnsemblGenomes-Tr:CAY68973"
                     /db_xref="GeneID:8199041"
                     /db_xref="InterPro:IPR024368"
                     /db_xref="UniProtKB/TrEMBL:C4R0E9"
                     /translation="MSAFQDYCIVCDRLCVHNEIYCSAKCQELDSTPITLQGKDDIPH
                     DHYRTKLEEKNNFNYLSPLLSGAVVSNDINHLDLNDINSKSNQRSINISTPSSRHVNL
                     ISQYLASSASVNYKKWLNNTNLISH"
     gene            complement(<655934..>658237)
                     /locus_tag="PAS_chr2-1_0354"
                     /db_xref="GeneID:8199042"
     mRNA            complement(<655934..>658237)
                     /locus_tag="PAS_chr2-1_0354"
                     /product="Ubiquitin-protein ligase involved in
                     ubiquitin-mediated protein degradation"
                     /transcript_id="XM_002491209.1"
                     /db_xref="GeneID:8199042"
     CDS             complement(655934..658237)
                     /locus_tag="PAS_chr2-1_0354"
                     /codon_start=1
                     /product="Ubiquitin-protein ligase involved in
                     ubiquitin-mediated protein degradation"
                     /protein_id="XP_002491254.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0354"
                     /db_xref="EnsemblGenomes-Tr:CAY68974"
                     /db_xref="GeneID:8199042"
                     /db_xref="GOA:C4R0F0"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR024928"
                     /db_xref="UniProtKB/TrEMBL:C4R0F0"
                     /translation="MSALQPMKITVQVVGADGLYKRDVFRSPDPFAVITVDGAQTKST
                     STAKRTLHPFWNESFEFNCTQNSILAIQIFDQKKFKKKDQGFLGVINLRIGDVIDLEN
                     DISQSETLTRPLKKSNDNLIVSGEVFITLSHKGRGRQGGAASHMSPPNGPPAELLTPG
                     PSANDAGSNPPGLISASNRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNSRTTTWT
                     RPALDQSEADRTNQRVNATEAERRQHMDRSLPGENSSSTTVGNLSSSGSVNASNNQTA
                     LSMASNGYTTFGLGELPPGWEQRLTAEGRPYFVDHNTRTTTWVDPRRQQYIRSVGPNT
                     TVQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRD
                     FRRKVIYFRSQPALRILPGQCHIKVRRSHIFEDSYQEIMRQSPEDLKKRLMIKFDGEE
                     GLDYGGVSREFFFLLSHDMFNPFYCLFEYSTHDNYTLQINPNSGINPEHLNYFKFIGR
                     VVGLGIFHRRFLDAFFVGALYKMILHKKVILQDMEGVDAEFYRSLKWILENDITDVLD
                     LTFSAEDERFGEIVTVDLKEGGRDIEVTEENKMEYVELITEWKIHRRVEQQFKAFMDG
                     FNELIPQELINVFDERELELLIGGIADVDVEDWKKHTDYRGYQESDEVIQWFWKCVTE
                     WDKEQKARLLQFTTGTSRIPVNGFKDLQGSDGPRRFTIEKAGESNQLPKSHTCFNRVD
                     LPPYKDYGSLKQKLTLAVEETVGFGQE"
     gene            <659263..>660846
                     /locus_tag="PAS_chr2-1_0355"
                     /db_xref="GeneID:8199043"
     mRNA            <659263..>660846
                     /locus_tag="PAS_chr2-1_0355"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491210.1"
                     /db_xref="GeneID:8199043"
     CDS             659263..660846
                     /locus_tag="PAS_chr2-1_0355"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491255.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0355"
                     /db_xref="EnsemblGenomes-Tr:CAY68975"
                     /db_xref="GeneID:8199043"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R0F1"
                     /translation="MSKTFHDKQSYLDNWTFQNPSSDSLGSSSSESLLDRACSTGNLK
                     LLSNYWKVPSSDDNYNYLTAFDVHNDKPTVAIASGLGNSNLLIGSMKENTGISSKYHL
                     NHHQSITLPNIHSLKWLNNSSPGDFDFLLSGHVSGYVNLTIIPDKEDCDFKSAEIIKR
                     FNHEKHMTTKDQIQSNIISSLELSPKAWKSCNLNSMFTVYKDKIFMWDCSRSRAPILM
                     NHSAGSASLHPSPFRDGILGVAGKFGIALNDLRIGKDSNPSYFVPKIADRQIPESQLV
                     KWSDTDSNILASSHGNVVMLWDVRMNDTQLAILEGHNDEVTSLEWGSNQDLYSGSKDG
                     GIVHWGLDLDLLQPVTKPATCTLKDGLSSIRLKQTEDRSIVEDLVSSINCGTFIPASN
                     SNIVELAQIKLNGRKRLLSIDDSLFLGMHDTLELTERMPVISEQEEDEISSSNTVFSN
                     PNTPQTFFSSSDTLVSAKNEQLNFDFKDRAFSKPTTNTEDTLSLKQLPDLPKSLYTVP
                     QQKQRDTLPQVNSMIPEVV"
     gene            complement(<660898..>661896)
                     /locus_tag="PAS_chr2-1_0356"
                     /db_xref="GeneID:8199044"
     mRNA            complement(<660898..>661896)
                     /locus_tag="PAS_chr2-1_0356"
                     /product="Esa1p-associated factor, nonessential component
                     of the NuA4 acetyltransferase complex"
                     /transcript_id="XM_002491211.1"
                     /db_xref="GeneID:8199044"
     CDS             complement(660898..661896)
                     /locus_tag="PAS_chr2-1_0356"
                     /codon_start=1
                     /product="Esa1p-associated factor, nonessential component
                     of the NuA4 acetyltransferase complex"
                     /protein_id="XP_002491256.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0356"
                     /db_xref="EnsemblGenomes-Tr:CAY68976"
                     /db_xref="GeneID:8199044"
                     /db_xref="GOA:C4R0F2"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR008676"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="InterPro:IPR026541"
                     /db_xref="UniProtKB/TrEMBL:C4R0F2"
                     /translation="MEEPNPPKLEINGKCLAYHGPLLYEAKILKTHQANSTSIVGPEG
                     KEEIDSKGFSNFPEAFMGKTCFYVHYKGWKPKWDEWVTVERLLVLSTDNLQLQKDLRN
                     RTMQKLKKPQKAVTPKLKAKLIATPAASSEEKNANGKAKPKRIKDCVLPELLKQETKD
                     AGFEISVSVALKELLVDDWERITKENKLVDIPSRHPVKDICNTYQSFVLEGVAKHSAF
                     YDNTLDFFQGLRVYFNTTLASILLYQFERKQLKELMNTSTEPLDYSSIYGPTHLLRLL
                     VTLPSLISQTKIDSQSLDFFKTTLNQLLLWLHKNIEQYFVDDYINTSPSYEALARI"
     gene            complement(<662140..>663417)
                     /locus_tag="PAS_chr2-1_0357"
                     /db_xref="GeneID:8199045"
     mRNA            complement(<662140..>663417)
                     /locus_tag="PAS_chr2-1_0357"
                     /product="Palmitoylated, plasma membrane-bound casein
                     kinase I isoform"
                     /transcript_id="XM_002491212.1"
                     /db_xref="GeneID:8199045"
     CDS             complement(662140..663417)
                     /locus_tag="PAS_chr2-1_0357"
                     /codon_start=1
                     /product="Palmitoylated, plasma membrane-bound casein
                     kinase I isoform"
                     /protein_id="XP_002491257.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0357"
                     /db_xref="EnsemblGenomes-Tr:CAY68977"
                     /db_xref="GeneID:8199045"
                     /db_xref="GOA:C4R0F3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R0F3"
                     /translation="MSAQSPNIVASHYRIDVKIGEGSFGVIFKGYDLLRNNQPVAIKF
                     ESRKTKVPQLKDEFTAYKQLNSRIEYHRRYQQGQTSLGGQDTDDENLDVVKYEGIPKV
                     YYFGNEGLYNILIIQLLGPSLEDLFDWCGRQFSNLTVAMIARQMIERIRLVHDNLLIY
                     RDIKPDNFLIGDYEGTGQDNLIYLVDFGMVKQYRNPNTGKHIPYREKKALSGTARYMS
                     INTHLGREQSRRDDLESLGHVFLYFLKGELPWQGLKANSNKEKYEKIGEKKRNTPLEE
                     ICAGFPPQFRRYMEYVRSLKFEDTPDYAYLIGLMNEVVRIETEGIEPITPAPASSSSQ
                     APSVDLRYDWMRLNDGKGWNWATNKKTNLNGYSQPKKNRPTPVSNLPQRKRTDKKLTD
                     SKFPNYGSNYGSNNYARQQAETTERSHSYCCCW"
     gene            complement(<663798..>664970)
                     /locus_tag="PAS_chr2-1_0358"
                     /db_xref="GeneID:8199046"
     mRNA            complement(<663798..>664970)
                     /locus_tag="PAS_chr2-1_0358"
                     /product="Cystathionine beta-lyase, converts cystathionine
                     into homocysteine"
                     /transcript_id="XM_002491213.1"
                     /db_xref="GeneID:8199046"
     CDS             complement(663798..664970)
                     /locus_tag="PAS_chr2-1_0358"
                     /codon_start=1
                     /product="Cystathionine beta-lyase, converts cystathionine
                     into homocysteine"
                     /protein_id="XP_002491258.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0358"
                     /db_xref="EnsemblGenomes-Tr:CAY68978"
                     /db_xref="GeneID:8199046"
                     /db_xref="GOA:C4R0F4"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006238"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R0F4"
                     /translation="MEEKFDIETELVRLGFEDQYNSCNPPLYQTATFRQDSLSNMGAY
                     DYTRSGNPTRTTLQNYLSRIMGAKATFAVSSGMSALDVIVRLLDPGDEVIAGDDLYGG
                     THRLLTFLKNKKQLIVNHYDTTDTELMKQKITKNTRMIFLESPTNPLIKVVDVRSITA
                     HAHEINPNCIVVFDNTMMSPVLMSPLTDLGVDIQYESATKYLNGHHDIMSGVLATNSE
                     KLAQDLYFVINSTGCGLAPFDCWLLLRGLKTLALRIERQQENAIKIAQFLITVPGLKV
                     RSVALPDHPQYELHKSMAKGPGAVLSFETGSVETSSKIIEACKIWSITVSFGCVNSLI
                     SLPCQMSHASIDPDTRAERDLPEDLVRLCVGIENVNDLIKDLAAALRVGGISVPAQ"
     gene            <665380..>666105
                     /locus_tag="PAS_chr2-1_0359"
                     /db_xref="GeneID:8199047"
     mRNA            <665380..>666105
                     /locus_tag="PAS_chr2-1_0359"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491214.1"
                     /db_xref="GeneID:8199047"
     CDS             665380..666105
                     /locus_tag="PAS_chr2-1_0359"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491259.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0359"
                     /db_xref="EnsemblGenomes-Tr:CAY68979"
                     /db_xref="GeneID:8199047"
                     /db_xref="GOA:C4R0F5"
                     /db_xref="InterPro:IPR002023"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C4R0F5"
                     /translation="MSLLRLLPKATKPLQQRIVTVTPKRFSHMISVHRDTPKDNPEIP
                     FEFTKENLERAKEIIAKYPPQYKKGAVMPLLDLGQRQLGFTSISVMNYVAKYLDMPPM
                     RVYEVATFYTMYNRKPMGKYNVQVCTTTPCQLCGSDGIMKAITEHLQIRPGQTTPDNL
                     FTLQEVECLGACVNAPMIAVNDDFYEDLTPERTVEILKGFQSGDIPKPGPADRHSCEP
                     HSGPKVLTNETPYHVKDFIRDDL"
     gene            complement(<666916..>668013)
                     /locus_tag="PAS_chr2-1_0360"
                     /db_xref="GeneID:8199048"
     mRNA            complement(<666916..>668013)
                     /locus_tag="PAS_chr2-1_0360"
                     /product="Putative protein with sequence similarity to
                     hydroxyacid dehydrogenases"
                     /transcript_id="XM_002491215.1"
                     /db_xref="GeneID:8199048"
     CDS             complement(666916..668013)
                     /locus_tag="PAS_chr2-1_0360"
                     /codon_start=1
                     /product="Putative protein with sequence similarity to
                     hydroxyacid dehydrogenases"
                     /protein_id="XP_002491260.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0360"
                     /db_xref="EnsemblGenomes-Tr:CAY68980"
                     /db_xref="GeneID:8199048"
                     /db_xref="GOA:C4R0F6"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R0F6"
                     /translation="MSKPQVLFIGEPNRDLPEFHEFSAQFECIHYKITSKETLLEDLQ
                     GKLSKVVAIYGSWLGFHPVGGLTEDIVQALPDSLKLVTSCSVGLDGWGSEQLAKRGIK
                     LYNCPSLGAEQVADLVLYHTLQSFRYFKVFEDNFRESGHTVKTRSLLQSASLDKQTGK
                     VVLNSTDSSDYAFGHRLGDSLPILTPFGKNAVVVGFGSIGSRIAKRLHAIGMNISYVK
                     RTRLSSEQEAQLLFPVKYYASLKEAAPVADLVVLSLPGTSETENLYNKEIIDLVPHRS
                     RVINVGRGTIVNEDDLLAGLRSGKLSFAGLDVYAKEPAVSRELIERQDVILTPHIGSS
                     TVENFNDTSIFCLRNIQDVILYGKEGLSRVN"
     gene            complement(<668216..>668889)
                     /locus_tag="PAS_chr2-1_0361"
                     /db_xref="GeneID:8199049"
     mRNA            complement(join(<668216..668676,668865..>668889))
                     /locus_tag="PAS_chr2-1_0361"
                     /product="Subunit IV of cytochrome c oxidase"
                     /transcript_id="XM_002491216.1"
                     /db_xref="GeneID:8199049"
     CDS             complement(join(668216..668676,668865..668889))
                     /locus_tag="PAS_chr2-1_0361"
                     /codon_start=1
                     /product="Subunit IV of cytochrome c oxidase"
                     /protein_id="XP_002491261.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0361"
                     /db_xref="EnsemblGenomes-Tr:CAY68981"
                     /db_xref="GeneID:8199049"
                     /db_xref="GOA:C4R0F7"
                     /db_xref="InterPro:IPR002124"
                     /db_xref="UniProtKB/TrEMBL:C4R0F7"
                     /translation="MRKRDIHTMLRQCLPRVRPASRLFSTASILRQQTPKQFKTATSI
                     AEVEGLENLVGPGAKTGTVPTDLEQATGLERYELLGKLEGIEVFDETPLEAVRKGTMK
                     DPILIDSYDDYRYVGCTGVPADSHNIEWLKPTTEKNARCWECGSVYKLNFLGSGKPHH
                     H"
     gene            <669261..>669620
                     /locus_tag="PAS_chr2-1_0362"
                     /db_xref="GeneID:8199050"
     mRNA            <669261..>669620
                     /locus_tag="PAS_chr2-1_0362"
                     /product="40S ribosomal protein S26"
                     /transcript_id="XM_002491217.1"
                     /db_xref="GeneID:8199050"
     CDS             669261..669620
                     /locus_tag="PAS_chr2-1_0362"
                     /codon_start=1
                     /product="40S ribosomal protein S26"
                     /protein_id="XP_002491262.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0362"
                     /db_xref="EnsemblGenomes-Tr:CAY68982"
                     /db_xref="GeneID:8199050"
                     /db_xref="GOA:C4R0F8"
                     /db_xref="InterPro:IPR000892"
                     /db_xref="UniProtKB/TrEMBL:C4R0F8"
                     /translation="MPKKRASNGRNKKGRGHVKFVRCLNCARCVPKDKAIKRVTIRNM
                     VEAAAVRDLSEASVYEEYALPKLYNKLHYCVSCAIHTRIVRVRSRSDRRIRAPPQRQR
                     FSNDRRVNPAEAAKKAL"
     gene            <670022..>671401
                     /locus_tag="PAS_chr2-1_0831"
                     /db_xref="GeneID:8199051"
     mRNA            <670022..>671401
                     /locus_tag="PAS_chr2-1_0831"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491218.1"
                     /db_xref="GeneID:8199051"
     CDS             670022..671401
                     /locus_tag="PAS_chr2-1_0831"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491263.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0831"
                     /db_xref="EnsemblGenomes-Tr:CAY68983"
                     /db_xref="GeneID:8199051"
                     /db_xref="GOA:C4R0F9"
                     /db_xref="InterPro:IPR000009"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018067"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C4R0F9"
                     /translation="MEEHNWKFSQCFGDKGDVETITEADIISTVEFDHTGDFLATGDR
                     GGRIVLFERNESKNNCEYRFYTEFQSHDAEFDYLKSLEIEEKINKIKWLKRSNTSNML
                     LSTNDKTIKLWKIFEKQIKMVSENNLSENSNLMNTGNETLSAANISSKLLSINNLKLP
                     RLTLHDTITSAQPKKIYANAHAYHINSISVNSDGETFISADDLRINLWNLGIADQSFN
                     IVDIKPVNMEELTEVITSAEFHPENCNLFMYSSSKGTIKLADMRVSSLCDNYSKVFEE
                     CIDPTNHNFFTEITSSISDVKFSPNGKYIVSRDYMTVKIWDVAMESEPLKTINIHEQL
                     RDRLCDTYENDAIFDKFEVQFSGDNDSIMTGSYNNNFMIYPNAVSSSSKTVSENEIVL
                     QADKSAFKAKKLNSRRKEPSNGLSMMRKEMQFDDIDFKKSILNLSWHPRENSVAIAAT
                     NNLYIFSTL"
     gene            complement(<671502..>671867)
                     /locus_tag="PAS_chr2-1_0363"
                     /db_xref="GeneID:8198106"
     mRNA            complement(<671502..>671867)
                     /locus_tag="PAS_chr2-1_0363"
                     /product="Subunit VIa of cytochrome c oxidase, which is
                     the terminal member of the mitochondrial inner membran"
                     /transcript_id="XM_002491219.1"
                     /db_xref="GeneID:8198106"
     CDS             complement(671502..671867)
                     /locus_tag="PAS_chr2-1_0363"
                     /codon_start=1
                     /product="Subunit VIa of cytochrome c oxidase, which is
                     the terminal member of the mitochondrial inner membran"
                     /protein_id="XP_002491264.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0363"
                     /db_xref="EnsemblGenomes-Tr:CAY68984"
                     /db_xref="GeneID:8198106"
                     /db_xref="GOA:C4R0G0"
                     /db_xref="InterPro:IPR001349"
                     /db_xref="UniProtKB/TrEMBL:C4R0G0"
                     /translation="MFRTAASSIGRRGFTTVKGDPAKAQAFKKHLDDVYHHSKGTTAL
                     WKKISYFVALPAIALTAVNTYFVEAEHAEHRAHNRHLSDEEWPKAYPYQNVRRVDFFW
                     GDGDKTLFWNPDVNRHVKE"
     gene            complement(<672021..>673438)
                     /locus_tag="PAS_chr2-1_0364"
                     /db_xref="GeneID:8199052"
     mRNA            complement(join(<672021..672997,673096..>673438))
                     /locus_tag="PAS_chr2-1_0364"
                     /product="Probable mRNA N6-adenosine methyltransferase"
                     /transcript_id="XM_002491220.1"
                     /db_xref="GeneID:8199052"
     CDS             complement(join(672021..672997,673096..673438))
                     /locus_tag="PAS_chr2-1_0364"
                     /codon_start=1
                     /product="Probable mRNA N6-adenosine methyltransferase"
                     /protein_id="XP_002491265.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0364"
                     /db_xref="EnsemblGenomes-Tr:CAY68985"
                     /db_xref="GeneID:8199052"
                     /db_xref="GOA:C4R0G1"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R0G1"
                     /translation="METILPLLLGYGNSLLRFPVEGNVSSLFRLQSTLRWHEFLAGLI
                     RVNKLSNSLEFDTDIYKFYAEALTDVEDQSKSYNCSVRIKNINCLALEILEENLPGLN
                     VSTDLKENKKKPRALRLSNEKMKEETKEEPTFEICNQSKHAEILAGIDIDRCAESLKR
                     SRKTQLLKCLETKIHFVPIIKSHTDPKLGDCSYLDTCHKLKTCKYLHYYQTVPTLAAN
                     KPPPPNSPTLEVLASYTKGEPISKTLCKQLPAQWINCDVRKLNFNRLGKFAAIIADPP
                     WNIHTNSIESNETELLKIPVDQIQDEGIFLLWVTVRSTSIGRAWLLENGYTVSSELIW
                     VKTNQLGRNICTGRTGHWLNHSKEHLLVGIKGRCTWLQRGLFDDIILASTRETGRKPD
                     ELYVMVEKMVGEHARKLEIFGKQHNVRPGWLTIGNQLEGNNVVEDLI"
     gene            <673798..>674453
                     /locus_tag="PAS_chr2-1_0365"
                     /db_xref="GeneID:8199053"
     mRNA            join(<673798..673849,673909..>674453)
                     /locus_tag="PAS_chr2-1_0365"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491221.1"
                     /db_xref="GeneID:8199053"
     CDS             join(673798..673849,673909..674453)
                     /locus_tag="PAS_chr2-1_0365"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491266.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0365"
                     /db_xref="EnsemblGenomes-Tr:CAY68986"
                     /db_xref="GeneID:8199053"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:C4R0G2"
                     /translation="MGLLDLEQQLAFYRAYHFNKVNVAIHLVFVPTILFSTVGFLSAI
                     PLNQITPFDLSGVPFFGKLYNLGAFLIASFSIYYILLDRLGLVLTPLLLLISYSISTL
                     YDFYDKSEVVKGSLVLFGIGWAVQFVGHALFERRAPALFDNLVQALVLAPYFVAFEVV
                     FALGFRKDLQKKMNNHAGKLMLEFRTREKGHPVVEKTD"
     gene            <674845..>678396
                     /locus_tag="PAS_chr2-1_0366"
                     /db_xref="GeneID:8199054"
     mRNA            <674845..>678396
                     /locus_tag="PAS_chr2-1_0366"
                     /product="Cytoskeletal protein binding protein required
                     for assembly of the cortical actin cytoskeleton"
                     /transcript_id="XM_002491222.1"
                     /db_xref="GeneID:8199054"
     CDS             674845..678396
                     /locus_tag="PAS_chr2-1_0366"
                     /codon_start=1
                     /product="Cytoskeletal protein binding protein required
                     for assembly of the cortical actin cytoskeleton"
                     /protein_id="XP_002491267.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0366"
                     /db_xref="EnsemblGenomes-Tr:CAY68987"
                     /db_xref="GeneID:8199054"
                     /db_xref="GOA:C4R0G3"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007131"
                     /db_xref="UniProtKB/TrEMBL:C4R0G3"
                     /translation="MTSVFLGVYRALFDYQAQNDEELTVHENDLLYVLEKSEIDDWWK
                     VKQRVIGVNVEEPIGLVPSTYIEPATPIGSAVALYDYDRQTEEEITFKENDTFDVYDT
                     DDQEWILVGLNNIHFGFVPANYIQISLGTTAPASNNPPILSPASFPPPPQRINNSSVP
                     SLKDAEPARNLEDDNAYEEEEDVPPPMPTRPTATTATSNISAPQDSESEEEPSSSSRR
                     PSGRSRADDDFVKGDYFTWDVQEINGRKKRKAVLGIGNGSIYVQAEGHSSKKWDIRNL
                     TNFSNEKKHVFFDFTNPSASYELHAGSKDAADAILSIVGDLKGASSMRALKEVKAASS
                     APKTKTGKVSYNFDAESPDELSIREGDVVYILNDKESSEWWIVQDVNTNKKGVVPASY
                     IELISGGGSTLASIGSSISKGSKKAFGSSRKRKEKERKHLEEQRAAKRETERERQRLR
                     SKEERDRLRKLDEKERRKKQKATPQDEDQPETSKPNPHRVRTWIDSSGSFKVEAEYLG
                     VVDGKIHLHKTNGVKIAVAAPKLSLEDLEYVERITGMSLEKYKPKPKSSGSYSRPSKK
                     PSSRESSPKESSRSGVKQSVPKIDPPKDPDYDWFQFFLGCDIDPNNCQRYSVVFINEQ
                     LDESSLQDLTPSLLRSLGLREGDILRVQKFLDNKFGRTKAQESATNGGLFTKSDGTLK
                     NNRSTDVLTSTVVTRETLSPTKAEAKSKRIDDEAWALKPAAESSSQMDQFSRPVSAMS
                     KQLTGSIQDLVNLKPLGDNANNASVAHKAETPNTTQDKPSAPVLEPVKTGAARGPVQA
                     QPTSGGFVTAQPTGALVAMPTGFMPITMVPVKTGGTIALQPTGGFVSLQRTGGVLPQV
                     TGGLVPVQTGGLVMPQTSFGVTPTLQPTGGILPAQRTGGLVPVQRTGGLIPVQQTGRL
                     VPVQQTGGLIPVQRTGGLVPVQRTGNLQPVPTTSFGSQPTGTFVPQSSFGNQLATNLN
                     NPQTTFGSQPTGGFPQTSFAQNQFRQSTGGFQQTPIVQQTGGFPQYSAGQQTVGFPQN
                     SFGQQTGGIAQNSFGQQTGGYQTGFQGNGSIPMPQSSFGASNLGFNGATQQNYNIGMG
                     QSLPAASIPPLQPSYTSSLNGMSNMLQNVSISQQPQQAQPMTTFGAPVAQPPLQAQPT
                     GFGFGNSPYGGQNPLQSQPTGKRANLSAATADNPFGF"
     gene            <678663..>680777
                     /locus_tag="PAS_chr2-1_0367"
                     /db_xref="GeneID:8199055"
     mRNA            <678663..>680777
                     /locus_tag="PAS_chr2-1_0367"
                     /product="Essential protein required for chromosome
                     condensation"
                     /transcript_id="XM_002491223.1"
                     /db_xref="GeneID:8199055"
     CDS             678663..680777
                     /locus_tag="PAS_chr2-1_0367"
                     /codon_start=1
                     /product="Essential protein required for chromosome
                     condensation"
                     /protein_id="XP_002491268.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0367"
                     /db_xref="EnsemblGenomes-Tr:CAY68988"
                     /db_xref="GeneID:8199055"
                     /db_xref="GOA:C4R0G4"
                     /db_xref="InterPro:IPR022816"
                     /db_xref="UniProtKB/TrEMBL:C4R0G4"
                     /translation="MSQVAPQSGTQPTEQENFDFWIRMATDNKITSTNSWNFALIDYF
                     HDLTVLKEGNSINFQKASATLDGCVKIYSSRVDSIATETGKLLSGLTVNKLNEKQNEE
                     NDSESDEDPIENTQGGDDRNENRPKAKKRNTAAVNTLVEFSKLQTKSIDTELTVDPLF
                     KKALTDFDEGGAKSLLLNILKIDRDCRIVFDTSSERTIQTNEETQPLDMNSNDSIENK
                     EIDVNLLRRFLPDNLDKLHLCPSAPEIEKVLDEGAAPTTLLQRIEEDNAPDENEDNCF
                     SGPLMDMDDNFNEIPTIVHNNITSKYSLFSGNEESGPNITLNRLFDENFVSRTVDSED
                     TSNVHEHNVLDHFDNMLRKTWMGPQNFKIAQLQLRHERTPQPVNTGIPTEDSNDLHGT
                     VKRRKNEFTIDFSTEDDIEDIFESSDNLLMPKSNWFSETHNLLPDDKNFTTKRMIHLF
                     TKSDKVINSALFPKKKKMQQRSYEDEYQPADEEYFASKYAEAKNNRVKNLIQDDLKEI
                     QESFDDQYVGSPHGDRQYQEGENFDNEPDDYADNNFNDMDEAAEDDFNPSNLSYSKKG
                     GFGSQLVTSVGRFRPSSINFAKVSKRVDVKLLKDNLWETLTWAKSNIFQKPSQPSQPS
                     QENDDPDDEEERVISEAENEPTHSELKFTDVVKQMTQKYSNEEKNEISTSFCFICLLH
                     LANENGLTIENSGDQSDLIIKN"
     gene            complement(<680824..>683175)
                     /locus_tag="PAS_chr2-1_0368"
                     /db_xref="GeneID:8199056"
     mRNA            complement(<680824..>683175)
                     /locus_tag="PAS_chr2-1_0368"
                     /product="Isopropylmalate isomerase, catalyzes the second
                     step in the leucine biosynthesis pathway"
                     /transcript_id="XM_002491224.1"
                     /db_xref="GeneID:8199056"
     CDS             complement(680824..683175)
                     /locus_tag="PAS_chr2-1_0368"
                     /codon_start=1
                     /product="Isopropylmalate isomerase, catalyzes the second
                     step in the leucine biosynthesis pathway"
                     /protein_id="XP_002491269.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0368"
                     /db_xref="EnsemblGenomes-Tr:CAY68989"
                     /db_xref="GeneID:8199056"
                     /db_xref="GOA:C4R0G5"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="InterPro:IPR012235"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:C4R0G5"
                     /translation="MPSTGEIKNPKTLYDKVFEDHVVHKDESGSYLLYIDRHLVHEVT
                     SPQAFEGLKNAGRVVRRKDCTLATVDHNIPTDSRKNLTTLDKFIKQDDSRLQVKTLEQ
                     NVKDFDVTYFGMKDSRQGIVHVVGPEQGFTLPGTTVVCGDSHTSTHGAFGSLAFGIGT
                     SEVEHVLATQTIIQAKSKNMRITIEGELDEGITSKDLVLHVIGVIGTAGGTGSVIEFA
                     GKAIEDLTMEARMSICNMAIEAGARAGMIRPDETTFKYIEGRPLAPKGEQWTKALNYW
                     KTLYSDEGAKFDYEIVIKAKDIVPTITWGTSPQDALPITASVPDPEKVEDPIKKSGME
                     RALSYMGLTPNVPLKDIKIDKVFIGSCTNSRLEDLRAAAKVVKGHKKSDNVKLALVVP
                     GSGLIKLQAEKEGLDKIFEEAGFSWREAGCSMCLGMNPDILDPEERCASTSNRNFEGR
                     QGARSRTHLMSPAMAAAAGIAGHFVDIREFEYKEDKSQPKIAIQSEEDAELQDAVYEH
                     EKKPLAEGESKDELEEDEIKDIPPPDHTVQETPLKTSAPAVAAAMEKFLTVEGIAAPL
                     DKANVDTDAIIPKQFLKTIKRTGLKAGLFYELRFVKDDQGKDVETDFVLNVEPYRSAS
                     ILCVTGDNFGCGSSREHAPWALKDFGIRSIIAPSFGDIFYNNSFKNGLLPIRIDQDII
                     LSKLYPVATSGKKLTIDLPNQQILGPDKEVLVEHFEVEDFRKHCLINGLDDIGITLQK
                     EEFINKYEEMRRDRFSFLEGGSKLIVPARGTKRSRYGNKAQEW"
     gene            complement(<683375..>685749)
                     /locus_tag="PAS_chr2-1_0369"
                     /db_xref="GeneID:8199057"
     mRNA            complement(join(<683375..685636,685699..>685749))
                     /locus_tag="PAS_chr2-1_0369"
                     /product="Ubiquitin-protein ligase, member of the cullin
                     family with similarity to Cdc53p and human CUL3"
                     /transcript_id="XM_002491225.1"
                     /db_xref="GeneID:8199057"
     CDS             complement(join(683375..685636,685699..685749))
                     /locus_tag="PAS_chr2-1_0369"
                     /codon_start=1
                     /product="Ubiquitin-protein ligase, member of the cullin
                     family with similarity to Cdc53p and human CUL3"
                     /protein_id="XP_002491270.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0369"
                     /db_xref="EnsemblGenomes-Tr:CAY68990"
                     /db_xref="GeneID:8199057"
                     /db_xref="GOA:C4R0G6"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016157"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:C4R0G6"
                     /translation="MLGGNEIRKSKIRTPKKAFLSQVDYEKSWEQLDEAIKQIYQKNA
                     STLSFEELYRKTYNLVLRKQGKFLYDNIYNSIKSHLENDVRPRMTQFMEDDKIDKAVL
                     LQNMSTEWNDHLLSMRMISDFAMYLDRVYVKEAHLPLIYDIGLQLFRDYVILPNDNIV
                     GKKIIGLLLQSIDEIRSNKIVDKFLIKNIIFMFESLPDEAGNYYDTYVEPDFLEDSRL
                     YFEKVSSELLLEQNGSLFINNIIRLIEEEQNRTALYLPLSTLPKLVELMDKALIATNI
                     EAVLAFENEGLSKWVAAESVFELNSLYKLIGRIDEEYHILRTHLKRLLISFGEALDES
                     TSKTIADGPDTPKKKATTHFVTIWIESILTQRDVYERILQNCFNRDIHIAKTIDASFA
                     LILNANKRISEYLSLYIDHFIKQSLKEKSENESEEILTKAVAIFSFIHDKDVFEKYYK
                     NHLAKRLLNPKSNSYDIERNLISKFKSIAGETFVSKLSSMFRDINISKEESKQFQVQL
                     QQDDILPLNNNKKVSMDVNVLTHLIWPLPLTETNVQFPEILFNLKEQYAAFYAQKHQN
                     RKFNWAPNFGTVDMRMTYGRKTYEVNMPTYSAIIILALFSTDYKAQYTYAQIHQELQI
                     PENDLKRQLLSISVAPKTRLLVKRPMSKEINPEDIFQINEKFQSPQIKIKVLTVSTAS
                     KLENDQQRSSTLTEVNKDRKFETDAAIVRIMKARKTLTHNNLMNETIKQLANRFSPPP
                     SLIKQRIESLLEKEYMERDSKERNLYHYLA"
     gene            <685937..>687634
                     /locus_tag="PAS_chr2-1_0370"
                     /db_xref="GeneID:8199058"
     mRNA            <685937..>687634
                     /locus_tag="PAS_chr2-1_0370"
                     /product="Component of the Swr1p complex that incorporates
                     Htz1p into chromatin"
                     /transcript_id="XM_002491226.1"
                     /db_xref="GeneID:8199058"
     CDS             685937..687634
                     /locus_tag="PAS_chr2-1_0370"
                     /codon_start=1
                     /product="Component of the Swr1p complex that incorporates
                     Htz1p into chromatin"
                     /protein_id="XP_002491271.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0370"
                     /db_xref="EnsemblGenomes-Tr:CAY68991"
                     /db_xref="GeneID:8199058"
                     /db_xref="GOA:C4R0G7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR027109"
                     /db_xref="UniProtKB/TrEMBL:C4R0G7"
                     /translation="MSSDILDVLSISGRSNLSNQKKKITKDGPTKKKKQTAMSRELFN
                     LIGQNTPPLAVEKTVKFKEKLNVNNKPTPWSYVEFSNDARESKDGLKLHHWIKGSSEL
                     AKNSPYLFEKYNQKIQIPSFTKEEYDEFLKDLDLECREREKRDKALKEQEAKEAEKLE
                     KEKENDKERVNGDELGKEEDNASDFVPKKENVNDQILPKIDEPQTNKKDDMESTEDVS
                     KSDSQEVSKDVNPSEEVEASWDYDETVHLFQLCEKWDLRWPIIVDRYEYDERSMEELK
                     ERFYKVSERILRHKYRNVTMDDKTSLLVQTLSSFDKRRETERKQYLRRLLSRSPTEIA
                     EEESLVIEARKFELAAKKMLTERASLLRLLDSPQSTGSISQYLTSQGLTQLYNTLMSA
                     DRSKRRKVETPTPPQIPPGASSSLHRTSMDLKRKAAKKIGPNALLENIKATGNSVPPS
                     GNAPQSAAIELINTKMTPEEKEAYGIKIHQEKLQPGVSLRSARLPTFKPATQAKIVVV
                     LNELEVSPKPTIPTAKVVAQYDNLLQTINVLLETKKQVNKLEVELNLLEGKEEDKES"
     gene            complement(<687712..>692589)
                     /locus_tag="PAS_chr2-1_0371"
                     /db_xref="GeneID:8199059"
     mRNA            complement(<687712..>692589)
                     /locus_tag="PAS_chr2-1_0371"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491227.1"
                     /db_xref="GeneID:8199059"
     CDS             complement(687712..692589)
                     /locus_tag="PAS_chr2-1_0371"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491272.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0371"
                     /db_xref="EnsemblGenomes-Tr:CAY68992"
                     /db_xref="GeneID:8199059"
                     /db_xref="UniProtKB/TrEMBL:C4R0G8"
                     /translation="MEVIPDSDIEIERIQLPTNVSQPKLRRRNLRRRTFSQRHVFTKD
                     LAELLGLATEEDFEKWEDDGLDDEEITQKLSRNYDRMRIKFEAKQVKRHPFKKSSFDQ
                     YVVDFRNYQANNKSSRGFYELLQTIDTHKKQHDIPRLTSDEEEDGHDSKEKQDYPTTR
                     SPQRDTLKVDLNVPIINLDTSSPIQHRNSINQPRLEATEENCSAPRDRNTLEHDTYEL
                     PPDEPSEYTEPIDLDLHRVPSSPEVAKSTSTSRFRSRKFSQTHIYTTYNSVLLHLLTG
                     DQLDELYEGGKSVKEINDILDHMYQQKYQRMEREDNLPKLYRQRPTFFDWLSNNERPT
                     QHLVSESENDSEYSQNETDQSSLIGNDSEFESDTEQMDSSPKAVFRGREYRSLNDMTK
                     GVLPASYFKTSFYHDSIKRATTKSIQMNSKKRKINQTETNQPSISTFINDAYISDNSD
                     LELNTNPFVDSNDYNDHLTPAVDLTHYNTQDNVDVLEDNRPEIDFMLTRSSNGHNTAN
                     KTKSRNSTSRHSPRITNRRSRKTKSFPAQHSVTTTVKQRSFINSRKKQSAITKSFKNQ
                     GQSVLECSAGHLKKFVKDDRFEYNREPLITMNPFVSDVVYLPQPTRDIMAPIVLNDIT
                     NTGQSDLFLNSKVMRSTLEIGEPTFYYGPDSDKLELKIQGNILVLSLLDKEGSISNIN
                     SFINSVLSIVKRGHLMEIDYLCFVEGLKRLLEWTLYLSNSKTDTKPLLKTFLRLSELA
                     DKLPPTTGSITTLGYLSLLFWQTFKLYSKFNGSESGATLSLQITFKKIVQCYFEAIIA
                     FGIHKFHQHIKMDDTHLETLKIVHTILTKDDPFGFWMEINRALSSRLRSSPQETLDIS
                     SDITLLFVTYLDLPENWSLLFQLCKSFAILKWFSGDTPSNLLRQFHMLHQVKGWKITF
                     DVVSVAYKIISANKFDNFDCDDLNLELLNEVVSPEALVKDSTMVLYLRLLKLFKDTSP
                     GKLELNSLDRIVPIGMIKHDNHQILQNRINLLLTMTWLFGEHIDFTQNWLSILDASFD
                     FKTQNSIQMITQAITRVTEHNLTLGKPLSFDLISQFFKRFTDASRVTKFVYPKSLINE
                     LSAIVRKGYFSLTKNSLRYRVIESIESIFLFPDHVFISLGVELFLTFLEPYFSSDEYD
                     EGDMSFKLRDRIKRKFYGLISNDITEALKLGETKEEYFLLTQLYVKISVLLEIDSGKL
                     LYLDWKCKGSVEELRKYELVFYTSLLRYGDSKEVFQTGSQEFLKCIAYHVPRNDSMLF
                     PFVNEINPFLHIPEADIFLVSSIVFDNLRSQFGRAFLNHVFLQKVNKDDIMDILIDSI
                     YQLHSTNHESDIATVSMHRDLISFLNRKASLQLRYNSRFCFLRNAFGIKAPDLNVVEF
                     EQSFLEQNSDLKKIIFLEKELIHSMGQADMHGLLRKMKKLFANYESPHKDYRNSRYYF
                     LSLLICIHVKLIPKMTLNWVIVSLLLEFLHEIILQKCTLTQPDVWCLCKLQYSFSELS
                     NFRNSKYQYYEFSSLRYIAEILHVVLGVFAGYQDQKDYCDLIKYAVRREYLYERIQVE
                     NTYLFASSDMISETSDLLSQSKDSMKFDTRELLIDDQKIECEMAFARLEIALGELDQN
                     VDVDVSPPSEITQFI"
     gene            <692741..>694888
                     /locus_tag="PAS_chr2-1_0372"
                     /db_xref="GeneID:8199060"
     mRNA            <692741..>694888
                     /locus_tag="PAS_chr2-1_0372"
                     /product="Actin-and formin-interacting protein, involved
                     in actin cable nucleation and polarized cell growth"
                     /transcript_id="XM_002491228.1"
                     /db_xref="GeneID:8199060"
     CDS             692741..694888
                     /locus_tag="PAS_chr2-1_0372"
                     /codon_start=1
                     /product="Actin-and formin-interacting protein, involved
                     in actin cable nucleation and polarized cell growth"
                     /protein_id="XP_002491273.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0372"
                     /db_xref="EnsemblGenomes-Tr:CAY68993"
                     /db_xref="GeneID:8199060"
                     /db_xref="InterPro:IPR005613"
                     /db_xref="InterPro:IPR022782"
                     /db_xref="UniProtKB/TrEMBL:C4R0G9"
                     /translation="MHILASSRSASPTGSTTMSDTSNGQRHSSHYSATSVLVNTKRLV
                     ETLTRWAKGTSSAADVSDAYVQLGNVFKLACRTFQQAGVDITNIGDIPRDLRVILQAA
                     IYEEQSQQTLDKYLPDIRKIITNLITKLKEKQQQMREIEDSKNLGRNLSAHSSQRSVS
                     GPPVSKAYSQRSSSSADNSPQSKDPLAKLQKEESLKRRASRRFSAYQYAKLANFVPER
                     EYPVPNPTGSKSPYQELSNPNSAARSLSKSPESVKSSSRFASSNVPALTSEVGQTNSP
                     SGSKSSHAPDGERVHIYLKLHQETKKANISIPTSLTSLRLLFIQKFSYSPGTDAFPDI
                     YIEDPKVSVRYELEESYLGDIQEGTILSLNVPDPTTILIKGLEAQLSSLKLQVSEVQT
                     NVLSEVKDIVATNNRNPSIAATDDSSSSKTMVNGAALSNADLDELVSIRQDLSKAKQV
                     YSDNKNNFTKTVHSLLEKLQQFQSANVSSSHSANRTIMINSQERLSVECETLLTKTDD
                     LQDIIEGLRKDVSTRRARPSKKNLQYVSKEIEEAKADLKKVSEYIANEKETWKKIWES
                     ELNTVCEEQKFLNLQEELVEDLNEDLARAYETFSLVEECCEQLEKTPASKITPNLPIP
                     EPGENLNNVRTALMSEVELLQPDHQNRVEAIERAERLREKQKQLTMVNEFQEELGGFV
                     EGQKLKKSGGIEETEKIRKLKDEQNLKGNYGYL"
     gene            complement(<694896..>697181)
                     /locus_tag="PAS_chr2-1_0373"
                     /db_xref="GeneID:8199061"
     mRNA            complement(<694896..>697181)
                     /locus_tag="PAS_chr2-1_0373"
                     /product="Reverse transcriptase subunit of the telomerase
                     holoenzyme"
                     /transcript_id="XM_002491229.1"
                     /db_xref="GeneID:8199061"
     CDS             complement(694896..697181)
                     /locus_tag="PAS_chr2-1_0373"
                     /codon_start=1
                     /product="Reverse transcriptase subunit of the telomerase
                     holoenzyme"
                     /protein_id="XP_002491274.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0373"
                     /db_xref="EnsemblGenomes-Tr:CAY68994"
                     /db_xref="GeneID:8199061"
                     /db_xref="GOA:C4R0H0"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR003545"
                     /db_xref="InterPro:IPR021891"
                     /db_xref="UniProtKB/TrEMBL:C4R0H0"
                     /translation="MLLKRWLDERDIVLRGFQSSQLKRFLNVEVEHCPVDINVRLDNE
                     LDQLSHNEIIDYVIKQLIKANKQHCVSIGYKAGESVGAEYYCEASSFQVNVLKSSEWR
                     ILHESMGSPLFIDLLINYKGCMPHDSTFIQLFGPLDEVPSNKNSRNSQTFRLRNLLRF
                     RQKLSPIPETPLQLIRIMLVRGSEFDPNLEKARELCNRIYYKHSRCKYMYIYDSICSP
                     KRERCSDNFDYALEKKKVVKFVLVICDTIFPLELFGDKFNKRMAFKNISKFLLSSKED
                     SFSVNDFANRIKLNSITWLRNNPQTGNRPCNKQEFRLKQNVFFHFIEWLFKTFLRNLV
                     ASFFYVVERASSSEILYYDPRVWRKISKPYADSLFSKTFAKMQATNPNPSCQKSILRI
                     LPKKHDFRPIAASASRDIHFILDMMARLRPTSKILQDLRPDFLKISPSQIPKTVYTFK
                     QKLLRHHECLPQVYAIKFDIKNCFDSLPRQKILQCCQKILPERTFFLSSSYNYNETPN
                     RLYSTQKLFTDVNLSSDRTPDGLIHRNKVTKLNRTALLEIIKESLDQPLVSKAGTYQR
                     KIGVFQGHSLSSTFCDVVYDQLVLEYFANILDDENSLLMRFADDFLILSTSWTTIDDV
                     RKRASLGFPDYNAFTNKDKTIAHHNSQTFELMYCGVSINLQELTTSRISTDFPISNLP
                     PFYSEKLFSKLLTLFRFRVSPKIIFYNPPEAQWKTVQCAWDNIMLLLKKNKVRKFPVK
                     RFCKDCNEYLRSLNIEGSLQI"
     gene            <697325..>698242
                     /locus_tag="PAS_chr2-1_0374"
                     /db_xref="GeneID:8199062"
     mRNA            <697325..>698242
                     /locus_tag="PAS_chr2-1_0374"
                     /product="Subunit of tRNA-specific adenosine-34 deaminase"
                     /transcript_id="XM_002491230.1"
                     /db_xref="GeneID:8199062"
     CDS             697325..698242
                     /locus_tag="PAS_chr2-1_0374"
                     /codon_start=1
                     /product="Subunit of tRNA-specific adenosine-34 deaminase"
                     /protein_id="XP_002491275.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0374"
                     /db_xref="EnsemblGenomes-Tr:CAY68995"
                     /db_xref="GeneID:8199062"
                     /db_xref="GOA:C4R0H1"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C4R0H1"
                     /translation="MKESPHKIDFKDGIFDNCLQKLIKDGIGQENMNMQEVWVMEINP
                     KDSSKVNGMLRELKNFHLLPFLKKFQKRTVESETGNSTVLDVLIGETSKLQSEEEVNA
                     LLKVDGKLRRVNVPSNYPPTKELCTEWSKIWPIVWKGNPIVQELNSIRLDIQEISENL
                     RKISELSVSPPLKDELPIFTMVADRKGKVLTIKQDERKNHQLHHSTMLAIRDVAKLQQ
                     NDPKSYLLLDCVIYTTHEPCPMCCMALLHSRIERLVFLKDMTTGGLKFHEGYGYGIQT
                     ACTLNWKFDAYRWCGDEIPVGIVDDLAYA"
     gene            complement(<698875..>699966)
                     /locus_tag="PAS_chr2-1_0375"
                     /db_xref="GeneID:8199063"
     mRNA            complement(<698875..>699966)
                     /locus_tag="PAS_chr2-1_0375"
                     /product="Component of the RSC chromatin remodeling
                     complex"
                     /transcript_id="XM_002491231.1"
                     /db_xref="GeneID:8199063"
     CDS             complement(698875..699966)
                     /locus_tag="PAS_chr2-1_0375"
                     /codon_start=1
                     /product="Component of the RSC chromatin remodeling
                     complex"
                     /protein_id="XP_002491276.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0375"
                     /db_xref="EnsemblGenomes-Tr:CAY68996"
                     /db_xref="GeneID:8199063"
                     /db_xref="GOA:C4R0H2"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:C4R0H2"
                     /translation="MAPVLEKPLFPQALSSSFASRTRNGETGIFISAAAPRSTKRNTA
                     VVNYAEFERDFEEDDKDEDFYDDLVDISLMANRSNNSNSHINVSSNFQGKEAVPTVGT
                     TFSDQQILYNSSLPELVIPIKINIEYNGNKIQDCFLWNINETLITPESFAAIFCNDME
                     LPNSCIQQIETQINNQIEEFSPFVTLQFPKDGVDSKHCVIQVSVNIGKQLYEDQIEWD
                     LNNDSYTPEQFAHDVVSDMGLAPEFKPAISVAIHEQLLKLKKEYVENPQLNIFQQHNL
                     PRYNQCYQKQPNIYDVSSDYQGLRYDKDAGEKWTPRVEFLSQWEIEKREIERERNIRR
                     MKRESMRHGEDRNKRRATRRKYDDDGLRL"
     gene            <700204..>701057
                     /locus_tag="PAS_chr2-1_0376"
                     /db_xref="GeneID:8199064"
     mRNA            join(<700204..700283,700502..>701057)
                     /locus_tag="PAS_chr2-1_0376"
                     /product="Putative GTPase, member of the Obg family"
                     /transcript_id="XM_002491232.1"
                     /db_xref="GeneID:8199064"
     CDS             join(700204..700283,700502..701057)
                     /locus_tag="PAS_chr2-1_0376"
                     /codon_start=1
                     /product="Putative GTPase, member of the Obg family"
                     /protein_id="XP_002491277.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0376"
                     /db_xref="EnsemblGenomes-Tr:CAY68997"
                     /db_xref="GeneID:8199064"
                     /db_xref="GOA:C4R0H3"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="InterPro:IPR018940"
                     /db_xref="UniProtKB/TrEMBL:C4R0H3"
                     /translation="MSFSDFSKVETISELNDLLADKSYIDGTSPTQIDVVVYKAFQKQ
                     APNFARWFNHIASFTDEFDTLPEGNAPAAAVAAELAEEEEDVDFFGSDDEEEDEAAEK
                     LKQERLAAYAAKKAAKGPGPAAKSLVTLDVKPWDDETNMQDLLDNVKAIKWDGLVWGA
                     HTFVPVGFGIKKLQINLVVEDEKVSLADLQQLIEEDEDHVQSTDIAAMSKL"
     gene            <701666..>703273
                     /locus_tag="PAS_chr2-1_0832"
                     /db_xref="GeneID:8199065"
     mRNA            <701666..>703273
                     /locus_tag="PAS_chr2-1_0832"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491233.1"
                     /db_xref="GeneID:8199065"
     CDS             701666..703273
                     /locus_tag="PAS_chr2-1_0832"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491278.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0832"
                     /db_xref="EnsemblGenomes-Tr:CAY68998"
                     /db_xref="GeneID:8199065"
                     /db_xref="GOA:C4R0H4"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006169"
                     /db_xref="InterPro:IPR014100"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0H4"
                     /translation="MFNRVFRRSFSNARYLRSSLESSVPDNAPTQKENMKWLGKVASM
                     SKKSDTELTNDQSTFTVEKFPNPTQESTTPEPYTIVKRPDSVEDPFFTISVPASNYFL
                     NSSAFSNLSYNQRPKAESSQPFSDIRVLKLRSGRGGNGAVSFLREANRSKGPPNGGDG
                     GTGGDIYVQTASHMHSLHKLSSRYLAEDGSSGEKNQLDGKRGRDVVIEVPVGTHIQWC
                     PDPLAIRKSQKQKRSLAFHIKAVGEDYLAYKPENIQFFRNSYQPGEGWIFKDRDQEYH
                     MARDFFVKLKKNMTAYDKEQTKAELHNDIFPLEGIDLDSPMKEPLLLLKGGKGGLGNM
                     HFLTDDIRNPRFSKVGRPGLEQTFVFELKLLADLGLVGLPNAGKSTLLRAISNARPRV
                     GHWEFTTLQPTIGTIPMGIDKEPFTVADIPGIIKGASENRGMGISFLRHVERSGGLVF
                     VISLVGQNPINDLEILLAEMTESRLHGKNILVVATKADVEGTKEKFQMLKEYTQEKKM
                     DIVPCCAMKNENIEMVIEMMAKCTGKY"
     gene            complement(<703305..>705768)
                     /locus_tag="PAS_chr2-1_0377"
                     /db_xref="GeneID:8198107"
     mRNA            complement(join(<703305..705572,705643..>705768))
                     /locus_tag="PAS_chr2-1_0377"
                     /product="Component of the microtubule-nucleating Tub4p
                     (gamma-tubulin) complex"
                     /transcript_id="XM_002491234.1"
                     /db_xref="GeneID:8198107"
     CDS             complement(join(703305..705572,705643..705768))
                     /locus_tag="PAS_chr2-1_0377"
                     /codon_start=1
                     /product="Component of the microtubule-nucleating Tub4p
                     (gamma-tubulin) complex"
                     /protein_id="XP_002491279.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0377"
                     /db_xref="EnsemblGenomes-Tr:CAY68999"
                     /db_xref="GeneID:8198107"
                     /db_xref="GOA:C4R0H5"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:C4R0H5"
                     /translation="MSFSRLRNSSQSRFFRSGNQADARYCIVSVFTSRPSINMTQMYD
                     VVKLVDQETKRIIPTTVNLTTAVNTKPYPLQDLSDLKEQEAFVVRDILYCLQGNEGDY
                     VRFSKNFNEQDLRSILEGPDYRIAKNLDVTLKDMTNRLLKYGKMYYSLTKFVEVYDSQ
                     FYGATMQRLCNEIRDFLKEHDQIVLELERRFMMDPHFSIGILNQLIEESGEKMRTLYE
                     IITSLNEVNRSNLATVDDVFKTMLKTIKEDLKHDDSLYMQTELNNKTRIIKGGIILRI
                     VQDKMERIRGDQTRFEALKKTFDRISLPYIEMLHKWLTFGKIDDPFDEFFIVEQSSKN
                     TLINYDSKFLLRKNYIIRQFEHRELQRKVLLTGKYLDVLRCLPVDIVENDTSNHKIES
                     LETDDLFFYVEQKYLRANKLVTELFMKGYKFLTILEALKSTLLFSNGVFLNDFLAHSM
                     SDMLRDKSKASLSKIERNFEKTFRPQLMATPRSKLVGNLVNINVQSDNLYTFLESILN
                     IQQIDAEEVFNSSDLNSLKRYLNKTLTKNTAEVVISPLDNYLVYYLSLNIEFPFPLNL
                     LLTNTIITQFQLVGRNVMITNVVEKLLESSWKEINYQRFWCFNFPNRSIRKWILRLRY
                     LHSNIKQFVSAFHLYLSFDVIEGSFSEMETQYQHFASTADSDFEKYFVSLQKWLNTMM
                     QNSLLMNETLVQISRRMFEFVLTFHTFVMSLRKNLILLDENLFDQYASKLGEKQFDPE
                     KNRERVIKMKHIINEYEKKFESSLNTFVQALNYYSRLESSSFSVLAGYLDSILKNRK"
     gene            <706001..>707305
                     /locus_tag="PAS_chr2-1_0378"
                     /db_xref="GeneID:8199066"
     mRNA            <706001..>707305
                     /locus_tag="PAS_chr2-1_0378"
                     /product="Putative ATP-dependent RNA helicase of the
                     DEAD-box family"
                     /transcript_id="XM_002491235.1"
                     /db_xref="GeneID:8199066"
     CDS             706001..707305
                     /locus_tag="PAS_chr2-1_0378"
                     /codon_start=1
                     /product="Putative ATP-dependent RNA helicase of the
                     DEAD-box family"
                     /protein_id="XP_002491280.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0378"
                     /db_xref="EnsemblGenomes-Tr:CAY69000"
                     /db_xref="GeneID:8199066"
                     /db_xref="GOA:C4R0H6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0H6"
                     /translation="MVKFEELGVSKWLCESLDAMKIYTPSKIQEATIPKILAGYDCIG
                     GAKTGSGKTIAFAAPMLTKWSEDPYGVFGLILTPTRELALQIAEQYAALGASMNIKVS
                     VILGGGDIVQQALELQRRPHFVVATPGRLADHILSSGEETIGGLRKIKFLVLDEADRL
                     LSNSFGSDLERCFKVLPPPEKRQTLLFTATVTDEVRALKEKPVPEGKLPVFVHEVESV
                     DKVAIPATLTTNYLFIPSYVKEAYLNAVLALEENADSTVIVFVNRTQTAELLRRTLRN
                     LEFRVASLHSEMPQIERINSLHRFKAGAARILIATDVASRGLDIPSVELVVNYDMPAD
                     PDDYIHRVGRTARAGRKGESLSFVTEQDVKRVLAIEERINKKMDKYELVTDNKVIETS
                     LHKTGAAKREALMAMEREGFGEKRKNNKIKNAKRKNSRLQSK"
     gene            complement(<707331..>709007)
                     /locus_tag="PAS_chr2-1_0379"
                     /db_xref="GeneID:8199067"
     mRNA            complement(<707331..>709007)
                     /locus_tag="PAS_chr2-1_0379"
                     /product="Signal recognition particle (SRP) receptor-alpha
                     subunit"
                     /transcript_id="XM_002491236.1"
                     /db_xref="GeneID:8199067"
     CDS             complement(707331..709007)
                     /locus_tag="PAS_chr2-1_0379"
                     /codon_start=1
                     /product="Signal recognition particle (SRP) receptor-alpha
                     subunit"
                     /protein_id="XP_002491281.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0379"
                     /db_xref="EnsemblGenomes-Tr:CAY69001"
                     /db_xref="GeneID:8199067"
                     /db_xref="GOA:C4R0H7"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0H7"
                     /translation="MSEQFLIFTPKGTVLFKDEDRKVPDRVVNGLISDIFISQRKTLT
                     GSVNNEEEFEDDDVGSYSLDGYTIKYVSSSQPTCYFTSCHSSLVNVPNEGQFLKDIQT
                     LWEELITADLDSGAFPDEQELRKFTSFYNLKKQELFKNVGVETAKSTSTSEPHSLSQN
                     KLKGKKPQLTQKKKARRWDTQGNPIEDDGLEESDLDFSSTTSEVGNQDVGHLVGDNYG
                     KTKDGKFLVSDMKEINDILSKQRDKSVSDESTGAFSFLSGLFSGKTVTEDNLTKTSKS
                     LSEHLINKNVAPEIAKKLVERINKSLVGTKVTTSIPKAARNALEKELLKLLTPETSIN
                     LLKEIQSKKAARKPYVISVVGVNGVGKSTNLSKLAFWLLSNKYRVLITACDTFRSGAV
                     EQLRVHVNNLKKLTEDESHVELFQGGYGGADLVSKIAKGAIQYAEENKFDIVLLDTAG
                     RRHNDAQLMAPLQGFVKAAKPDKIIMVGEALVGTDSVQQAKNFNGAFGPGRTLDFFII
                     SKCDTVGDLIGSMVNMVYATGIPILFVGTGQTYTDLRTLSVDWAVDTLMS"
     gene            complement(<709187..>710707)
                     /locus_tag="PAS_chr2-1_0380"
                     /db_xref="GeneID:8199068"
     mRNA            complement(<709187..>710707)
                     /locus_tag="PAS_chr2-1_0380"
                     /product="60S ribosomal export protein NMD3"
                     /transcript_id="XM_002491237.1"
                     /db_xref="GeneID:8199068"
     CDS             complement(709187..710707)
                     /locus_tag="PAS_chr2-1_0380"
                     /codon_start=1
                     /product="60S ribosomal export protein NMD3"
                     /protein_id="XP_002491282.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0380"
                     /db_xref="EnsemblGenomes-Tr:CAY69002"
                     /db_xref="GeneID:8199068"
                     /db_xref="InterPro:IPR007064"
                     /db_xref="UniProtKB/TrEMBL:C4R0H8"
                     /translation="MSNYTHLEPTEQQGVATVLCCNCGVPMDGTTGLVMCYDCIKLTV
                     DITEGIPREANVSFCRNCERFLQPPGQWIRAELESRELLALCLRRLKGLNKVRLIDAS
                     FIWTEPHSRRIKVKLTVQGEAMTNTIIQQSFEVEYVVMAMQCPDCAKSFTANTWRAAV
                     QVRQKVPHKRTFLHLEQLILKHNAHVDTISIKEAKDGLDFYYAQKNHAAKMIDFISSV
                     APVKSKKSEELVSADIHSGTSTYKFTFSVEIVPICRDDLIVLPKKLAHSLGTISRLVV
                     CSKVSNTVQFIDPNTLQIADINSNVYFRDPFPVLCNRTELIEFIVLDVEPTGETRGNY
                     ILADITVARAADMGNNDQEYYVRSHLGGLLNPGDSADGYFLANSNFNSDLFDELDSKN
                     VLDVVLIKKHFSRSARRAKKRAWRLRRMAKEHQDIVANDESRQAKQEQEKAERDYEIF
                     LQELEEDPELRQTVNLYKADEPPAPENEADMDEDDDAPEIGVDELLDELDEMTLDE"
     gene            <710882..>711304
                     /locus_tag="PAS_chr2-1_0381"
                     /db_xref="GeneID:8199069"
     mRNA            <710882..>711304
                     /locus_tag="PAS_chr2-1_0381"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491238.1"
                     /db_xref="GeneID:8199069"
     CDS             710882..711304
                     /locus_tag="PAS_chr2-1_0381"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491283.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0381"
                     /db_xref="EnsemblGenomes-Tr:CAY69003"
                     /db_xref="GeneID:8199069"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:C4R0H9"
                     /translation="MSERGQPGGPNPTIKDNRLVMNITTSEPRDLLMIERNCLSMVKF
                     GVVLSLTSIAMLVNFGFGKREKLEGDKKILFTIFGSIFMLLSLLSLVLGALNYYHSIG
                     RYTKEKVEVFNHIPITGFVFSCFVMIFTVSVVLLTQSL"
     gene            complement(<711267..>711914)
                     /locus_tag="PAS_chr2-1_0382"
                     /db_xref="GeneID:8199070"
     mRNA            complement(<711267..>711914)
                     /locus_tag="PAS_chr2-1_0382"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491239.1"
                     /db_xref="GeneID:8199070"
     CDS             complement(711267..711914)
                     /locus_tag="PAS_chr2-1_0382"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491284.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0382"
                     /db_xref="EnsemblGenomes-Tr:CAY69004"
                     /db_xref="GeneID:8199070"
                     /db_xref="UniProtKB/TrEMBL:C4R0I0"
                     /translation="MRGPSLSLFVPTKKFKGKDMTSEDRPTESLQFIEMLKSNDRKVN
                     DEKLARFGLPPKEKLFKYEIVPQHEAETIFASKTKLMPLNILFEGNESLSPEATSPFY
                     AESDPLTSYCSEGQNLPCKVRPCKTPFPSSPLPLSSSPSQQHNSDLISELEFSSEPQS
                     QFSELIHSETIYTAETTFDSKPNLNESTDPLDSSQEHLISTDTVISSESIIPHSL"
     gene            <712150..>713652
                     /locus_tag="PAS_chr2-1_0383"
                     /db_xref="GeneID:8199071"
     mRNA            <712150..>713652
                     /locus_tag="PAS_chr2-1_0383"
                     /product="L-homoserine-O-acetyltransferase, catalyzes the
                     conversion of homoserine to O-acetyl homoserine"
                     /transcript_id="XM_002491240.1"
                     /db_xref="GeneID:8199071"
     CDS             712150..713652
                     /locus_tag="PAS_chr2-1_0383"
                     /codon_start=1
                     /product="L-homoserine-O-acetyltransferase, catalyzes the
                     conversion of homoserine to O-acetyl homoserine"
                     /protein_id="XP_002491285.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0383"
                     /db_xref="EnsemblGenomes-Tr:CAY69005"
                     /db_xref="GeneID:8199071"
                     /db_xref="GOA:C4R0I1"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR008220"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R0I1"
                     /translation="MRNSMLRISRRCFNSSGLLLKPSPTRTRGAVQNLTDSLASNPQL
                     SFPCLDKQEKRSKTLLEDGPEPSYQSMKEHHVHKYKSEDPIFLDYGGYLPKFEIAYET
                     WGRLNEHRDNAILIHTGLSASSHAKSNALNLKKGWWEEFIGPGKYLDTTKYFIICTNV
                     IGGCYGSTGPSSIDPADGKRYATRFPIVSINDMVRAQNRLVSSHFGIKALHASVGASM
                     GGMQSLAYAHEFPDQVNKIVSISGCARSHPYSIAMRFCQRQVLMSDPNWNRGFYYDSL
                     PPHTGMKLARQIATITYRSGPEWEVRFGVERTDPSKQPALCPDFIIENYLDHQGEKFC
                     LQYDPNSLLYVSKAMDLFDLGAIERQKAELSRSQAEAKFKGAYVPFEELQFEPSGSNC
                     SLPSTPYEEKPRKGRRATPEESRRDLLEGLKTLAHKDVLVIGVESDILFPAWQQREIS
                     DLLTEGAKELGLEGSNIRHVELGSDVSIFGHDTFLLSLDHIGKPVSEFLN"
     gene            complement(<713722..>714618)
                     /locus_tag="PAS_chr2-1_0384"
                     /db_xref="GeneID:8198853"
     mRNA            complement(<713722..>714618)
                     /locus_tag="PAS_chr2-1_0384"
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /transcript_id="XM_002491241.1"
                     /db_xref="GeneID:8198853"
     CDS             complement(713722..714618)
                     /locus_tag="PAS_chr2-1_0384"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /protein_id="XP_002491286.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0384"
                     /db_xref="EnsemblGenomes-Tr:CAY69006"
                     /db_xref="GeneID:8198853"
                     /db_xref="GOA:C4R0I2"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:C4R0I2"
                     /translation="MSLINRLTLFRPIMSVSAQRMTFATSSVAFEFHVLSKAQRKIRS
                     ETKKKQNRARQLAKLDALEKVDPVLGRADNPFITRIRAEVTEKDVLGKGYDFEEVEKL
                     IYGINQARLSKLENDYVRSVSNSQTETIKEVVIRVLSMRNSNNQDRKNLAVAFARKEF
                     ERFPGDTGSSEVQAAVQTLKLYFLMDHIRQNPKDLDKIRNARMLAQQRQRILRYLKRD
                     DPQRYFWAIRKLGLTDEAVHMEFNFDKRYMQEYEIWPDRVLVKESKKQIEEKRRERRK
                     AKKAMRLAIIQDGVGESASKTV"
     gene            complement(<714707..>715444)
                     /locus_tag="PAS_chr2-1_0385"
                     /db_xref="GeneID:8198854"
     mRNA            complement(<714707..>715444)
                     /locus_tag="PAS_chr2-1_0385"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491242.1"
                     /db_xref="GeneID:8198854"
     CDS             complement(714707..715444)
                     /locus_tag="PAS_chr2-1_0385"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491287.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0385"
                     /db_xref="EnsemblGenomes-Tr:CAY69007"
                     /db_xref="GeneID:8198854"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:C4R0I3"
                     /translation="MDIPKASVLLFFPLTLALGLVTRNLLLLFGALPTGGYLLDPSNL
                     INGIFVGHAFEIFAALFGIVSYYTFQVYKMILPVSVDDKTNQKIISGQISKVVIITTW
                     LIVTKVWFFGDSLFDRLQEHTGATCQYPEGLEKLIARNDNYSSCERAGGLWTGGFRAS
                     GHLFILTTVLGSLAFEWRSVFVKDPSFSRWGLIPTAIVMAFWILMFWVTSIFFHTVIE
                     KVIGIAIALAFLSILYISKACAYVNIN"
     gene            complement(<715493..>716332)
                     /locus_tag="PAS_chr2-1_0386"
                     /db_xref="GeneID:8198855"
     mRNA            complement(<715493..>716332)
                     /locus_tag="PAS_chr2-1_0386"
                     /product="Protein involved in minichromosome maintenance"
                     /transcript_id="XM_002491243.1"
                     /db_xref="GeneID:8198855"
     CDS             complement(715493..716332)
                     /locus_tag="PAS_chr2-1_0386"
                     /codon_start=1
                     /product="Protein involved in minichromosome maintenance"
                     /protein_id="XP_002491288.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0386"
                     /db_xref="EnsemblGenomes-Tr:CAY69008"
                     /db_xref="GeneID:8198855"
                     /db_xref="GOA:C4R0I4"
                     /db_xref="InterPro:IPR018464"
                     /db_xref="UniProtKB/TrEMBL:C4R0I4"
                     /translation="MSFQDDIINDINSLKTEIAQLQAQYNSTSRELDDLRKGVPQQVQ
                     HEHFESLLGNFINEPPQSKSAIKLMSRKKAYKQIHLENLYRMVGVTMFPVSNRDELLG
                     IRFDIFDGEQKKFTVPHYIILQKHSKTEQWKIHRTTIPRYVPLQSIAKQWLNQDLNKF
                     AKLVRKHLVHIQNKKSIVERVNGKLQGIATLEWDLDFTKIRLHVKEKFSLLLLCDLTN
                     VVSVVEYQVKPEWVQAVGEQESEGIIRRMKTLLKTKVVYLEVLGELFDPENQNKSYRS
                     LLE"
     gene            <716629..>717216
                     /locus_tag="PAS_chr2-1_0387"
                     /db_xref="GeneID:8198856"
     mRNA            <716629..>717216
                     /locus_tag="PAS_chr2-1_0387"
                     /product="Subunit of RNase MRP"
                     /transcript_id="XM_002491244.1"
                     /db_xref="GeneID:8198856"
     CDS             716629..717216
                     /locus_tag="PAS_chr2-1_0387"
                     /codon_start=1
                     /product="Subunit of RNase MRP"
                     /protein_id="XP_002491289.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0387"
                     /db_xref="EnsemblGenomes-Tr:CAY69009"
                     /db_xref="GeneID:8198856"
                     /db_xref="UniProtKB/TrEMBL:C4R0I5"
                     /translation="MNEIISDENLQKLNTEFEVLYLLYHRNSNQHKTAAWWSNFNLLL
                     RKLRCILTLSLDVQDLSKKTKLANKEELIREKLYTIVQISQYLASKTIASSYRQFYSV
                     IALGQFITLGFTLIGLLARVYCILLSIRGVEGNVGFEKEIKMHVDNGDIIVHTQDLNL
                     KEPVAFDTLNEIKPKRTFKQEKRKKRKNAIDDIFG"
     gene            <717482..>718144
                     /locus_tag="PAS_chr2-1_0388"
                     /db_xref="GeneID:8198857"
     mRNA            <717482..>718144
                     /locus_tag="PAS_chr2-1_0388"
                     /product="Subunit of tRNA-specific adenosine-34 deaminase"
                     /transcript_id="XM_002491245.1"
                     /db_xref="GeneID:8198857"
     CDS             717482..718144
                     /locus_tag="PAS_chr2-1_0388"
                     /codon_start=1
                     /product="Subunit of tRNA-specific adenosine-34 deaminase"
                     /protein_id="XP_002491290.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0388"
                     /db_xref="EnsemblGenomes-Tr:CAY69010"
                     /db_xref="GeneID:8198857"
                     /db_xref="GOA:C4R0I6"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C4R0I6"
                     /translation="MGLETHFNFMKKALDAAQIALDELEVPIGCIFVYKNKIIAQGSN
                     KTNATSCGINHAEMEAIDEIIAKYPNYKEILPFADLYVTVEPCIMCASALRQLGIRRV
                     FFGCANDRFGGNGSVLTIHSDKLNNKLDSSIYPVYPGIYAKEAVTLLRKFYLNQNEKS
                     PNPQTKKLRQLDMENFPRLQFEKYLTKEQFVDMYGESQLDVYVGESDEIVLQRPTKIP
                     KI"
     gene            complement(<718203..>720188)
                     /locus_tag="PAS_chr2-1_0389"
                     /db_xref="GeneID:8198858"
     mRNA            complement(<718203..>720188)
                     /locus_tag="PAS_chr2-1_0389"
                     /product="Sorting nexin"
                     /transcript_id="XM_002491246.1"
                     /db_xref="GeneID:8198858"
     CDS             complement(718203..720188)
                     /locus_tag="PAS_chr2-1_0389"
                     /codon_start=1
                     /product="Sorting nexin"
                     /protein_id="XP_002491291.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0389"
                     /db_xref="EnsemblGenomes-Tr:CAY69011"
                     /db_xref="GeneID:8198858"
                     /db_xref="GOA:C4R0I7"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C4R0I7"
                     /translation="MSDQFTSIQWDRTEPEGDVPGDSNDHSQVQINSSINLIEEDQGQ
                     EQEQDDLVTTNTVVRGGNDSDSNPNEQIPPRDVYIRSKVSQPLKESDGQNFYISYLIE
                     TETNEPGLAKTKLKVRRRFSDFNFLYNCLANDFPTSIIPPLPNKQRLEYIKGDRFGEY
                     FTTKRSIALNNFLNRISKHPLLKQAKIYHIFLEDSVNWNTFKQNLKISSNPNSTVGGG
                     STTSANANGELDSFSDYIMNAFKKPTYESENAKEFQEITDKSNKLQENINKIDKIYQR
                     VVKRQSEISEDFRLFGDEFKKLNQILTEGSDTQFDKELSQQFTSFSENIYQISYDSFK
                     LTRQVDLHYLTSLKDLDHYISQIKNMIKFKDSKLLDYEMLQNYLNKAIAEKNHLMNGN
                     NVSGSDGAMNFISKKIGSLRGKTPGQTYSSGNETNDRINKLNEKIEFLEREVKETFEL
                     FHTFEKNLITEYQLFDRIKNDEITTNLHELSQYYLDYYNSVVNHWNDVEIPHSEHLTD
                     ELHVLQQSQLRKNLENISIDPKLDVNSKLFEHDDVRLNNDHIRSDLRSIKSQERKNEQ
                     VHKQDQEQGEEQEHEQDQVQNQEQEQEPEELSREEAEVLETPVQAQEQEQQEPEELHA
                     SQTESHTQSEPQNDNQHNFDDDGSDEGLVDVEGLEQW"
     gene            <721942..>724108
                     /locus_tag="PAS_chr2-1_0391"
                     /db_xref="GeneID:8198859"
     mRNA            join(<721942..723167,723229..>724108)
                     /locus_tag="PAS_chr2-1_0391"
                     /product="Lanosterol synthase, an essential enzyme that
                     catalyzes the cyclization of squalene 2,3-epoxide"
                     /transcript_id="XM_002491247.1"
                     /db_xref="GeneID:8198859"
     CDS             join(721942..723167,723229..724108)
                     /locus_tag="PAS_chr2-1_0391"
                     /codon_start=1
                     /product="Lanosterol synthase, an essential enzyme that
                     catalyzes the cyclization of squalene 2,3-epoxide"
                     /protein_id="XP_002491292.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0391"
                     /db_xref="EnsemblGenomes-Tr:CAY69012"
                     /db_xref="GeneID:8198859"
                     /db_xref="GOA:C4R0I8"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR002365"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="UniProtKB/TrEMBL:C4R0I8"
                     /translation="MTVYYSEKIGLPKTDPQRWRLRVNELGRQYWDYIEKEDLKNDPQ
                     TPYVQYLLKGDEFECPIPEKPQSAFESARNCADFLALIQDESGVFPCQYKGPMFMSIG
                     YVVACYFTNTPIPDHVRTEMIRYVVNTAHPVDGGWGLHEWDKSTCFGTCMNYVVLRLL
                     GLPKDNPVCIKARKVLHALGGALATPYWGKAWLSLLNVYKWEGVNPAPPEMWNLPYSL
                     KIHPCRWWVHTRAIALPLSYISSYKSQMPLTPLLKELRNEIFLQDFDTIDFSKHRNNV
                     CGIDLYYPHTSLLDFANSILVGYDKIRPTWLLKESNDAVYELIKKELANTEHLCIAPV
                     NAAFNTIVAYLEEGPESYNFKRLQERFKDVIFHGPQGMTTMGTNGTQVWDTSFCLQYF
                     FMAGLADLDEYEELIIRDKRIGCFPFSTKEQGYTVSDCTAEAIKAILMVKNHPKFAYL
                     GDYIDEDLLKKGIDGLLSLQNVGSYHFGSFSTYESTRANPALEKINPAEVFGNIMVEY
                     PYVECTDSSVLGLTYFREHWDYRRHDIDTAIERGVKFICDAQQEDGSWYGCWGVCFTY
                     AGMFALEALASVNQYYETNEVVRKGCDFLVSKQMADGGWSESIKSCETHTYVRGKRGM
                     VVQTSWVLIGLILAKYPHKEVIDRGVQLIMSRQKTRGDFDFEAVEGIFNHSCGIEYPN
                     YKFLFPIKALGLYSKEYEQ"
     gene            <724261..>724899
                     /locus_tag="PAS_chr2-1_0392"
                     /db_xref="GeneID:8198860"
     mRNA            <724261..>724899
                     /locus_tag="PAS_chr2-1_0392"
                     /product="Protein with similarity to the p27 subunit of
                     mammalian proteasome modulator"
                     /transcript_id="XM_002491248.1"
                     /db_xref="GeneID:8198860"
     CDS             724261..724899
                     /locus_tag="PAS_chr2-1_0392"
                     /codon_start=1
                     /product="Protein with similarity to the p27 subunit of
                     mammalian proteasome modulator"
                     /protein_id="XP_002491293.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0392"
                     /db_xref="EnsemblGenomes-Tr:CAY69013"
                     /db_xref="GeneID:8198860"
                     /db_xref="GOA:C4R0I9"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="UniProtKB/TrEMBL:C4R0I9"
                     /translation="MTSSYDINSLTLGVPDYDITDISTFDLTRLGDLKKLIESSLTHL
                     FDTLKDQNVDMDTSLLTEDGFPRDDIDIVKVRLTRTSIVRLRNDHKKILEALNLRLQE
                     HYSNNTISDSTSKDQGDVVESAIPFARISEVVRDSPADKAGLQSDDLIVTFEKLTTTS
                     ANLLQNISRIVLENENQPIKLTAKRHGELLELTLTPKKWEGGGLLGCRLNLL"
     gene            complement(<724955..>725304)
                     /locus_tag="PAS_chr2-1_0393"
                     /db_xref="GeneID:8198861"
     mRNA            complement(join(<724955..725222,725279..>725304))
                     /locus_tag="PAS_chr2-1_0393"
                     /product="Ubiquitin-like protein with weak sequence
                     similarity to ubiquitin"
                     /transcript_id="XM_002491249.1"
                     /db_xref="GeneID:8198861"
     CDS             complement(join(724955..725222,725279..725304))
                     /locus_tag="PAS_chr2-1_0393"
                     /codon_start=1
                     /product="Ubiquitin-like protein with weak sequence
                     similarity to ubiquitin"
                     /protein_id="XP_002491294.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0393"
                     /db_xref="EnsemblGenomes-Tr:CAY69014"
                     /db_xref="GeneID:8198861"
                     /db_xref="GOA:C4R0J0"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR015221"
                     /db_xref="InterPro:IPR016155"
                     /db_xref="UniProtKB/TrEMBL:C4R0J0"
                     /translation="MLTINVEFLGGLDAIFGHVREHTVQVEDGSNFRELTQHLVEHLL
                     KDRKDEDVFIEDGSIRPGILVLINDTDWELEGEDEYELQDKDLITFTSTLHGG"
     gene            <725446..>727152
                     /locus_tag="PAS_chr2-1_0394"
                     /db_xref="GeneID:8198862"
     mRNA            <725446..>727152
                     /locus_tag="PAS_chr2-1_0394"
                     /product="TFIIIB B-related factor"
                     /transcript_id="XM_002491250.1"
                     /db_xref="GeneID:8198862"
     CDS             725446..727152
                     /locus_tag="PAS_chr2-1_0394"
                     /codon_start=1
                     /product="TFIIIB B-related factor"
                     /protein_id="XP_002491295.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0394"
                     /db_xref="EnsemblGenomes-Tr:CAY69015"
                     /db_xref="GeneID:8198862"
                     /db_xref="GOA:C4R0J1"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR011665"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="InterPro:IPR029529"
                     /db_xref="UniProtKB/TrEMBL:C4R0J1"
                     /translation="MATLNKPRCKNCGGTEFTRDINTPASDLACVECGTVSEENPIVS
                     EVSFGETASGAATVQGAFVGSDQARANFGNNRGSLDSREQTLNKGKRRIKTVAAVLGI
                     ADYISDAAYLWFRLALTNNFVQGRRSQNVVAACLYIACRKVKTHHMLIDFSSRLQISV
                     YSVGATFLKMVKTLHISNLPLADPSLFIQHFAEQLNFGNSKIKVIKDAVKLAHRMADD
                     WIHEGRRPAGIAGACLMLAARMNNFRRTHLEIAAVAKIGESTIQKRLNEFKNTNASKL
                     SIDEFRKATNIESTAPPSYTSNRIKEKAIQQMINHNNKYSEEKETVMNFILKDSEISS
                     EEIRTYILKIQKQQREDLKRKVNQVVSPSPGEVGEIQRSIDEDEDDDDESEDESDKDG
                     NTANSIYNSFERQQQDQARLIELNRPKNLHKLPTTGDLLGKIKSDPENLEDVDDEELE
                     GFLLTEDESRIKERVWVGLNHDFLIEQEKRRLKEESDKLAGHTTIKRRRKKNIDDDGL
                     GIPKTELTEFASGLDPAALGLQSSINSIGEGSSALSSAKSMLQKKSYSKKLNYAAVEN
                     LF"
     gene            <727303..>728688
                     /locus_tag="PAS_chr2-1_0395"
                     /db_xref="GeneID:8198863"
     mRNA            <727303..>728688
                     /locus_tag="PAS_chr2-1_0395"
                     /product="DNA polymerase III (delta) subunit, essential
                     for cell viability"
                     /transcript_id="XM_002491251.1"
                     /db_xref="GeneID:8198863"
     CDS             727303..728688
                     /locus_tag="PAS_chr2-1_0395"
                     /codon_start=1
                     /product="DNA polymerase III (delta) subunit, essential
                     for cell viability"
                     /protein_id="XP_002491296.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0395"
                     /db_xref="EnsemblGenomes-Tr:CAY69016"
                     /db_xref="GeneID:8198863"
                     /db_xref="GOA:C4R0J2"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR024826"
                     /db_xref="UniProtKB/TrEMBL:C4R0J2"
                     /translation="MTMDQEVRRREVVRSSDSNKALLYTLNKNNRNYDRQYASIYTAR
                     ANKLKPRLIEKCSEKWKGEKINGIPVSHTEKVLNISSNKATWCVGTVFCDLKYKPNIL
                     KDVSESMYGGPVVKKVDGTYADRESDQLMLEDESGRIALDGELIDKILLVTGCIVGVL
                     GMEINPGVFTVVDIVYPEPGLQKPRLLSNHRIALVSGLGINGDNLDLSRLELLKEFLT
                     GELLENQAQESSIAKLIIAGNSIKVGDLNKIHQDKKNKFKATYASNYNATAVSQLDNF
                     IHDVIQTIPVDILPGAEDPAEIALPQQPLHKAFFNSSRQFVGNRLNTKTNPQWWDLAG
                     TEILGTSGENIDDIFKYVVPNDYHVDEDGCENSRIKIIESTIRWQHILPTAPDTLWCY
                     PYQDDDPFVLESTPHVYFVGNQARFESKDIILDNGFKVKLLSLPRFDQTGEVVILDLN
                     DLSTNLVSFSV"
     gene            complement(<728709..>730352)
                     /locus_tag="PAS_chr2-1_0396"
                     /db_xref="GeneID:8198864"
     mRNA            complement(<728709..>730352)
                     /locus_tag="PAS_chr2-1_0396"
                     /product="Mitochondrial methionyl-tRNA synthetase (MetRS)"
                     /transcript_id="XM_002491252.1"
                     /db_xref="GeneID:8198864"
     CDS             complement(728709..730352)
                     /locus_tag="PAS_chr2-1_0396"
                     /codon_start=1
                     /product="Mitochondrial methionyl-tRNA synthetase (MetRS)"
                     /protein_id="XP_002491297.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0396"
                     /db_xref="EnsemblGenomes-Tr:CAY69017"
                     /db_xref="GeneID:8198864"
                     /db_xref="GOA:C4R0J3"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="UniProtKB/TrEMBL:C4R0J3"
                     /translation="MVGAYLSSASKYFITTPIFYVNAAPHLGHLYSMLLCDFQKRWLD
                     LKETPNYFTTGTDEHGLKVQIAAELNKTDPRLFCDNLSNKFKHLAQISDIQYDRFIRT
                     TDADHLATVRQFWETVWKNGYIYKGKHSGWYSVSDETFYPESQVEQRDGKTVSTETGS
                     EVVYESEENYFFKLSAFQSQLIDLYKANPQFVIPANYYSDLLKELEREPLQDLSISRP
                     SSRLQWGISVPNDESQKIYVWFDALVNYLTSIGYPSSRYKEFWPGTHLIGKDISRFHC
                     IYWPAFLMAAKVSPPEKVVVHGHWLMGGSKMSKSKGNVADPLAIGDYYGVDSLRLFLG
                     ANSILSNDCDFTERKLNDHRDLFIDKICNVVTRCISKSFDPARSVMSFSNEDMNLVWK
                     RILERGWEGDLEKAAELKKSYDEIVDDAQQLFSKIDVLMSTFTTHKSVGEIFDLMLKV
                     NQFVNSTEPWNLKSNERLQDLSIFVALDVTRVCLILLQPFIPGLSNKLLDMIKVESSK
                     RTATYAAFQQDSSYGQGAKFLKGSTPPLIKVPLRAGAYE"
     gene            complement(<730531..>731373)
                     /locus_tag="PAS_chr2-1_0397"
                     /db_xref="GeneID:8198865"
     mRNA            complement(<730531..>731373)
                     /locus_tag="PAS_chr2-1_0397"
                     /product="Integral membrane protein required for the
                     biogenesis of ER-derived COPII transport vesicles"
                     /transcript_id="XM_002491253.1"
                     /db_xref="GeneID:8198865"
     CDS             complement(730531..731373)
                     /locus_tag="PAS_chr2-1_0397"
                     /codon_start=1
                     /product="Integral membrane protein required for the
                     biogenesis of ER-derived COPII transport vesicles"
                     /protein_id="XP_002491298.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0397"
                     /db_xref="EnsemblGenomes-Tr:CAY69018"
                     /db_xref="GeneID:8198865"
                     /db_xref="GOA:C4R0J4"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:C4R0J4"
                     /translation="MSFYQQPQQFGQYNPASLPQQQSYSAEQPFQQKQTPYHVSQSHS
                     PAPGFQIPAAQSQQQQQQQPPPFQSFPSGSMDFNNVSGSIGDQKLSQGFLAAFSTSGY
                     PGEPPLLEELGINFKHIKEKTAAVLNPRRGNISADIMTDSDLAGPILFCLAFATFLLL
                     SGKTHFGYIYGVALFGTICQHILFKLMSQDASIDLIRTASVIGYCLLPLVLLSAVAVF
                     VPLDNLPGYVAAILAILWCTTSASGFIVSVLRLQNVRMLIAYPLAMFYSVFALMAIFV
                     EKTQ"
     gene            <731547..>732296
                     /locus_tag="PAS_chr2-1_0398"
                     /db_xref="GeneID:8198866"
     mRNA            <731547..>732296
                     /locus_tag="PAS_chr2-1_0398"
                     /product="DNA repair protein Nse1"
                     /transcript_id="XM_002491254.1"
                     /db_xref="GeneID:8198866"
     CDS             731547..732296
                     /locus_tag="PAS_chr2-1_0398"
                     /codon_start=1
                     /product="DNA repair protein Nse1"
                     /protein_id="XP_002491299.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0398"
                     /db_xref="EnsemblGenomes-Tr:CAY69019"
                     /db_xref="GeneID:8198866"
                     /db_xref="GOA:C4R0J5"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="InterPro:IPR014857"
                     /db_xref="UniProtKB/TrEMBL:C4R0J5"
                     /translation="MEYTDTHRALVQVFMENKMLTIPDIKEVLQAVNESDREISVNDT
                     IKLINEKLHFLHLEIKSITLQDTTETVYCFVNTLPDKVMEFSTIFSVTEITILKKLIE
                     MIMLHRSNDSDEEYYISRKEAIILIREQSSLQVNQANDLLHKLVENKWFERRGDKYTL
                     SPLCLIELKDMLIEKYQTRKENGIVNICQLCEGIVTLGVRCTCYIRLHHDCFRKYNVI
                     NPQETCPNGHNLPQGMVGKIFYEVQENETNS"
     gene            complement(<732291..>733337)
                     /locus_tag="PAS_chr2-1_0399"
                     /db_xref="GeneID:8198867"
     mRNA            complement(<732291..>733337)
                     /locus_tag="PAS_chr2-1_0399"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491255.1"
                     /db_xref="GeneID:8198867"
     CDS             complement(732291..733337)
                     /locus_tag="PAS_chr2-1_0399"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491300.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0399"
                     /db_xref="EnsemblGenomes-Tr:CAY69020"
                     /db_xref="GeneID:8198867"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C4R0J6"
                     /translation="MSSKIPRLKPVPYKESDLYQPLLAPQLGPGCGTTEDIPYNKRDF
                     KYKPCRPNPFLLSKMYSTTDLPPYKGRFSYFDRSQRMCINEDCDQCTSEDCWRSVKGS
                     LPIRQGRVYVEFKILNSEGDSHVRLGFGRREASLEAPVGYDAYGYGFRDLTGQKVHLS
                     RPQDFMGSFGTGDTIGLLIQLADRIKIDDIDRDEIPIKYKNQLFFEQYDYVVTKPMDH
                     LLNPVTVFGEKAIPDKDRYKPPVIQGSFIKVFVNGEPKGTAFENLYEFLPPASELKKG
                     ARDDGSLGYYPMASCFRGGKVQLNTANKPEFAPQGEKEYLMYNELYDDSKIEEYVWDL
                     IDEVESAWLDELGL"
     gene            <733530..>734981
                     /locus_tag="PAS_chr2-1_0400"
                     /db_xref="GeneID:8198868"
     mRNA            <733530..>734981
                     /locus_tag="PAS_chr2-1_0400"
                     /product="Putative protein similar to bacterial
                     glutamyl-tRNA amidotransferases"
                     /transcript_id="XM_002491256.1"
                     /db_xref="GeneID:8198868"
     CDS             733530..734981
                     /locus_tag="PAS_chr2-1_0400"
                     /codon_start=1
                     /product="Putative protein similar to bacterial
                     glutamyl-tRNA amidotransferases"
                     /protein_id="XP_002491301.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0400"
                     /db_xref="EnsemblGenomes-Tr:CAY69021"
                     /db_xref="GeneID:8198868"
                     /db_xref="GOA:C4R0J7"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:C4R0J7"
                     /translation="MSSFPRINIPKVLEAQAKYNMFTCVRPVAMHIENPHSLLNMKLC
                     AIKDNICGIPEPTTCGSKMLKNYRSPFKATVLEMLENYGTVIVGKTNMDELGMGSTNT
                     NSVFGPVYNPSFDKTQKKLSKYTLSESQDIEETYDFPKHIAGGSSGGSAAAVASNVVD
                     FALGTDTGGSVRLPASYCGVVGFKPTYGRLSRWGVIQYAQSFDTVGILSRDVDTSKVV
                     FDYLNEFDEKDPTSLLPSHRERIDELVETRNKGLHKLRIGIPKQLNLDIDSNVRESWI
                     KLISQLFDQDHDIYPVDIPSVEHSIPSYYTLVPSEAASNLARYDGIRYGYRSKLDSKG
                     DVLFAPTRDEGFGEEVKRRILIGNFNLSHEAYIIHYLKAQNLRHQIKLDFDKVFRFPN
                     VLTSSQPSSEGVDILIAPTSLSTAPTVEEANSMTPLEVFVNDALTVPSSLAGLPTCSI
                     PMKTPEPIGMQVIGQFGDDNLVLNASRLIQQFM"
     gene            complement(<734985..>738857)
                     /locus_tag="PAS_chr2-1_0401"
                     /db_xref="GeneID:8198869"
     mRNA            complement(<734985..>738857)
                     /locus_tag="PAS_chr2-1_0401"
                     /product="Protein that localizes to chromatin and has a
                     role in regulation of histone gene expression"
                     /transcript_id="XM_002491257.1"
                     /db_xref="GeneID:8198869"
     CDS             complement(734985..738857)
                     /locus_tag="PAS_chr2-1_0401"
                     /codon_start=1
                     /product="Protein that localizes to chromatin and has a
                     role in regulation of histone gene expression"
                     /protein_id="XP_002491302.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0401"
                     /db_xref="EnsemblGenomes-Tr:CAY69022"
                     /db_xref="GeneID:8198869"
                     /db_xref="GOA:C4R0J8"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0J8"
                     /translation="MVRRRTPSQNNSVESSPRVRARHRRQTSDILTEEKHSNEEDEIL
                     PPRRKKQKVNYNEDAIFDQAYQDQDDDDGGDKLTNENVNENGHNDPTENTTVQVDQTD
                     NNVKNEHSDKESEYNDSEDYNGDDQADSEFDGLTSEEERFAKRKADEEFIVKDDFDYD
                     DSKSKGRRRARRTRSSRSKGSNSQSRKSRRQILDSEEEEDDANASQSVEVSDHAASSI
                     QQELEDLKDSPPNTPPSRKLNLRNRKNVDYTIPPPLANEITELVNPPTPKKRAYSSHA
                     NRLKRLFPTVGPFGGSDVTSIFGQNVPGLTALNNDSSSSSEDEIAPINSKSNRKDPNA
                     KFNTGPANMGKVIKSKKNSLADSDPLGVDMNIDFTSVGGLDNYINQLKEMVMLPLLYP
                     EVYTRFHITPPRGVLFHGPPGTGKTLMARALAASCSTGNTKVTFFMRKGADCLSKWVG
                     EAERQLRLLFEEAKNQQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMDNR
                     GQVIVIGATNRPDSVDPALRRPGRFDREFYFPLPDLRARKEILQIQTKNWSPPLEPTF
                     VEKLAELTKGYGGSDLRALCTEAALNSIQRKYPQVYQSQLKLQIDPSKIEVSSNDFML
                     ALEKIIPSSARSIASPSNPLPKSLESLLKKNLDNIIAELHQSLPTEKRVTLLEDSQYV
                     DYSSMGKNKFDRQELIQSLKRSRVYKPRLLISGGSGMGQIYLGPAILHHMEGYHVQSL
                     DLGTLYNDSSNSSSTLEAVIVQKFMEAKKHKPSIVIVPSLDIWFRSVPDTVISTISAL
                     LRSADANDQLLILGLLDSSRLVAEEKQILLDVFEFKNVIELKYPDKDERRDYFEQIFA
                     ALNLKPIEFNEIDTRPRRKLRDLPQVQQESTVEANDKSTVKQLEKLDMRLKNMLKIKL
                     SALMELFKQRYKRFRKPTIDDSYLVHLFHDYISNIHPEDQPYQRDGDMILEVATGKKF
                     YNMDLDVIEERIWNGFYSEPKQFLKDVEMIYRDAREFGERERLLKASEMFANAQVGIE
                     EIGDANFIKECKMMHARETERQRKYLQQSKNQLALDQAFINVHTDSKPEEAGQEDSTR
                     ILYESQQAETAEPGINPTSNSENLVPSLVEDTFMATSTQAPEGDQTVLVEDSELPGGS
                     QNQLQAQIKPPNGIAVSDIFESTELLQPPLAESTKDIGATSASNEESVLEAKGETNSN
                     ASEPPNLDPDSGPDIQEFHARFNVNLEYDQEYANRLKELLVNKTVKFNIDQLQEHNSQ
                     LTKIIWDDRKQLNKKGTLTKIEEYINRI"
     gene            <739529..>742498
                     /locus_tag="PAS_chr2-1_0402"
                     /db_xref="GeneID:8198870"
     mRNA            <739529..>742498
                     /locus_tag="PAS_chr2-1_0402"
                     /product="Alpha subunit of heterooctameric
                     phosphofructokinase involved in glycolysis"
                     /transcript_id="XM_002491258.1"
                     /db_xref="GeneID:8198870"
     CDS             739529..742498
                     /locus_tag="PAS_chr2-1_0402"
                     /codon_start=1
                     /product="Alpha subunit of heterooctameric
                     phosphofructokinase involved in glycolysis"
                     /protein_id="XP_002491303.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0402"
                     /db_xref="EnsemblGenomes-Tr:CAY69023"
                     /db_xref="GeneID:8198870"
                     /db_xref="GOA:Q92448"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /translation="MPEPSISALSFTSFVTNDDKLFEETFNFYTKLGFHATRSYVKDN
                     RSDFELTGISTDSIKEIWLESFPLSEVVETSAGRELRKPLQESVGYQSEALLGYSPYQ
                     SDGVVIKLRLSNHDLQKNKDLPGEVTFFTASIDKLRAKLIEIGAEIIPSEIDLVEFST
                     KDPMGDVISFSSYPSLSSKKITSPDFFLHPKKEVRSQESIVEQVKSEEGKKKIAIITS
                     GGDAPGMNAAVRAVTRAGIFYGCKVYACYEGYTGLVKGGDMLKELQWQDVRGLLSIGG
                     TIIGTARSKEFRERWGRLQACYNMVSNGIDALVVCGGDGSLTGADLFRNEWPELIKEL
                     LGEGKITKEQYETHRNLTIVGLVGSIDNDMCGTDSTIGAYSSLERIIELVDYIDATAA
                     SHSRAFVVEVMGRHCGWLGLMSGIATGADYIFIPERPPSETNWKDDLKKVCLRHREKG
                     RRKTTVIVAEGAIDDQLNPITSEEVKDVLVEIGLDTRITRLGHVQRGGAPCAFDRFLA
                     TVQGVDAVRAVLESTPAIPSPVISILENKIVRQPLVESVAQTKTVSDAIEAKDFDKAL
                     KLRDQEFATSYESFLSVSKYDDGSYLVPESSRLNIAIIHVGAPTSALNPATRVATLNS
                     LAKGHRVFAIRNGFAGLIRHGAVRELNWIDVEDWHNTGGSEIGTNRSLPSDDMGTVAY
                     YFQQYKFDGLIIIGGFEAFTALYQLDAARAQYPIFNIPMCCLPATVSNNVPGTEYSLG
                     SDTCLNTLSGYCDAVKQSASASRRRTFVVEVQGGYSGYLASYAGLITGALAVYTPENP
                     INLQTVQEDIELLTRTYEEDDGKNRSGKIFIHNEKASKVYTTDLIAAIIGEAGKGRFE
                     SRTAVPGHVQQGKSPSSIDRVNACRLAIKCCNFIEDANFQVKHNANLSADERHLRFFY
                     DDGVKTSAVSGKSSVIDDNTSVVIGIQGSEVTFTPVKQLWEKETHHKWRKGKNVHWEQ
                     LNIVSDLLSGRLSIRTT"
     gene            <742868..>743212
                     /locus_tag="PAS_chr2-1_0403"
                     /db_xref="GeneID:8198871"
     mRNA            <742868..>743212
                     /locus_tag="PAS_chr2-1_0403"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491259.1"
                     /db_xref="GeneID:8198871"
     CDS             742868..743212
                     /locus_tag="PAS_chr2-1_0403"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491304.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0403"
                     /db_xref="EnsemblGenomes-Tr:CAY69024"
                     /db_xref="GeneID:8198871"
                     /db_xref="UniProtKB/TrEMBL:C4R0K0"
                     /translation="MASTIESADYCSFSTVCKMWHFSYCGERYRCPSIGCILKRQVES
                     SPWKILPVAGKISQPRRSSQRKELHLVLRDGVLVNSKPQCKRSYRSAMAACWSHETHR
                     STGEVLLSCAVQ"
     gene            <744022..>745716
                     /locus_tag="PAS_chr2-1_0404"
                     /db_xref="GeneID:8198872"
     mRNA            <744022..>745716
                     /locus_tag="PAS_chr2-1_0404"
                     /product="Transcriptional repressor and activator"
                     /transcript_id="XM_002491260.1"
                     /db_xref="GeneID:8198872"
     CDS             744022..745716
                     /locus_tag="PAS_chr2-1_0404"
                     /codon_start=1
                     /product="Transcriptional repressor and activator"
                     /protein_id="XP_002491305.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0404"
                     /db_xref="EnsemblGenomes-Tr:CAY69025"
                     /db_xref="GeneID:8198872"
                     /db_xref="GOA:C4R0K1"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C4R0K1"
                     /translation="MPESRTSKGSIKSVPKKSAFVHKLYTMLSNEELNDLIWWTGPEE
                     SGTFALLPGAEFSKVLSTYFKHANVSSFVRQLHMYGFHKVSEQPLVQGDTIPKVTWEF
                     RHSNGKFRKGNEDSLPLIKRRSTSSSSKSITTDYVKFRVHDQYSYFPQDLQYPQNPQQ
                     SNQEGETEHTQQPVLYHPQPTVYYHPNVGVPPAPPAPALAPPPFSHLGQPMQPMSHQQ
                     PQQQIQQQHHHQPQSQHGQPQQPQQQYRQYTSHPPPALLPFTPMYNMRPMTASPTNME
                     PMVLPTYHSMRLIETELEVKQSHLQSKSDALIKQVHDYNKHIPSLVQLIPPHFEPKVD
                     RNIQHSRLSGIEASVRNRISKLSQPNPQPIHSAHSSFVSSKRNSSLVDPLQDLPLTAP
                     VPNTGSGFLSAHRGFYVPKTNSVSSSSSLPVTHDLPARRTPTPFKDRNPGDSSVESSH
                     SQLRPSIFRVHTKEEPVKAEKSSIFSNKDDSIFSNVHASSIFSQKTSIASQRSSLSMI
                     LNKPTVDSRDSITGSPLRKVSVHTIDEESTSSSNKRSHDDSNGFEDKRGKLMKLDS"
     gene            complement(<745815..>746777)
                     /locus_tag="PAS_chr2-1_0405"
                     /db_xref="GeneID:8198873"
     mRNA            complement(<745815..>746777)
                     /locus_tag="PAS_chr2-1_0405"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491261.1"
                     /db_xref="GeneID:8198873"
     CDS             complement(745815..746777)
                     /locus_tag="PAS_chr2-1_0405"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491306.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0405"
                     /db_xref="EnsemblGenomes-Tr:CAY69026"
                     /db_xref="GeneID:8198873"
                     /db_xref="UniProtKB/TrEMBL:C4R0K2"
                     /translation="MTWRSALFSSTIILLFEGLLYKSDEANRNKLVDYFRESPLEDIE
                     IRLSISLNPEQLKLPDLAESSQIQTNYELNRINQGLICQYKVDYYSFSPDCYFQMDLI
                     ISDNDAISIYENEPIIDLYHQLQSIRENDLPFFVSQAALYHLLESELESLAANHYTRK
                     FTGKKYVTIPNEPIDLETVCVNDTSVIRRLSKVTVLNSTICENRSVDSFLSTVTPNNL
                     KFQVDKAIRLKFLQQMMSFYGMLLQINQGENKYKEKHNLFRNVLQRRKEAVELFNSNH
                     WDEALTLLNQLSIDNLPATNYTDSGWWLRSGLYGLILMWQLIFQ"
     gene            <746887..>747582
                     /locus_tag="PAS_chr2-1_0406"
                     /db_xref="GeneID:8198874"
     mRNA            <746887..>747582
                     /locus_tag="PAS_chr2-1_0406"
                     /product="tRNA methyltransferase, catalyzes esterification
                     of modified uridine nucleotides in tRNAs"
                     /transcript_id="XM_002491262.1"
                     /db_xref="GeneID:8198874"
     CDS             746887..747582
                     /locus_tag="PAS_chr2-1_0406"
                     /codon_start=1
                     /product="tRNA methyltransferase, catalyzes esterification
                     of modified uridine nucleotides in tRNAs"
                     /protein_id="XP_002491307.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0406"
                     /db_xref="EnsemblGenomes-Tr:CAY69027"
                     /db_xref="GeneID:8198874"
                     /db_xref="GOA:C4R0K3"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R0K3"
                     /translation="MDQISIETEKDRFENVKDPALKEETYVHTVYNEIASHFSQTRYK
                     PWPIVEKFLNSRKNYSIGLDVGCGNGKYLGVNKNLMILGSDRSDGLIRCAYKNGHRGL
                     LVADGLQLPHHNDRFDFAVSIAVIHHFSTEERRIQAIKHILSKLRPQGEALIYCWALE
                     QENSRRGWKEGMDQDQLVPWVMKSQNEQQTKLRYYHLYKKGELIDNSVSAGGEIVEDG
                     YEKDNWWVIVRKV"
     gene            complement(<747724..>749379)
                     /locus_tag="PAS_chr2-1_0407"
                     /db_xref="GeneID:8198875"
     mRNA            complement(<747724..>749379)
                     /locus_tag="PAS_chr2-1_0407"
                     /product="Serine/threonine protein phosphatase Z, isoform
                     of Ppz2p"
                     /transcript_id="XM_002491263.1"
                     /db_xref="GeneID:8198875"
     CDS             complement(747724..749379)
                     /locus_tag="PAS_chr2-1_0407"
                     /codon_start=1
                     /product="Serine/threonine protein phosphatase Z, isoform
                     of Ppz2p"
                     /protein_id="XP_002491308.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0407"
                     /db_xref="EnsemblGenomes-Tr:CAY69028"
                     /db_xref="GeneID:8198875"
                     /db_xref="GOA:C4R0K4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011159"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R0K4"
                     /translation="MGNSTSKQPKGKEGALPRSDTMTSTRSVRSFRSRRSLSKDSSQH
                     LNDAGSFKPSQSFDNRSRKSSFRNDIKPTITPIMGASTDRLSGEFGSLSVGDDYNLQL
                     PPSMIQMEPRQPILKQQDITNGVSNTSPEQHSGFNNTGLSSYTSSPSSPINTPHLTVT
                     QGSSTSLTALSHSNNNNSSGANTPKSSHSNINSPANSDSVSTMSTSVPKTTLMTSRGV
                     VINIEDIIQRLLDAGYSGKRTKNICLKTSEISVICSKARELFLSQPPLLELSPPVKIV
                     GDIHGQFGDLIRMFTKCGFPPASNYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFL
                     LRGNHECANVTKAYGFYDECKRRANLKTWKMFVDTFNTLPITAVIASKIFCVHGGLSP
                     MLNSMDDIKRIQRPTDVPEFGLLNDLLWSDPADTSNEWVDNERGVSYCFNKIAINKFL
                     NKFQFDLVVRAHMVVEDGYEFFNNRSLVTVFSAPNYCGEFDNWGAVMSVSDELLCSFE
                     LLDPLDSVALKQVMKKGKTERRNATLQSQGPNSSVSNGASSIT"
     gene            <749794..>751530
                     /locus_tag="PAS_chr2-1_0408"
                     /db_xref="GeneID:8198876"
     mRNA            <749794..>751530
                     /locus_tag="PAS_chr2-1_0408"
                     /product="Putative transporter (DHA1 family) of multidrug
                     resistance transporter"
                     /transcript_id="XM_002491264.1"
                     /db_xref="GeneID:8198876"
     CDS             749794..751530
                     /locus_tag="PAS_chr2-1_0408"
                     /codon_start=1
                     /product="Putative transporter (DHA1 family) of multidrug
                     resistance transporter"
                     /protein_id="XP_002491309.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0408"
                     /db_xref="EnsemblGenomes-Tr:CAY69029"
                     /db_xref="GeneID:8198876"
                     /db_xref="GOA:C4R0K5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R0K5"
                     /translation="MEKYQDKYHPKFVPGTYSIRAVKNSKLWGGNGDSKVWKMRNGMI
                     LLPQPSNSINDPLNWGFLRKSVHFIQLVILAGFTAAISNNASAVQTDIHDEFNISYDS
                     MNTGAGVLFVAIALSCFLLGPICRVYGRKIVYLIGLVFAVLGCIWFTELRNQADAICS
                     QIFIGISQGSTSAQVQHSFSDMFFNHQLGASITIYVLSYCIGTYLGPLITRYITTSQG
                     WHWVGWYGAIIAGILLVVCILFLEDTSFDRSRYDALLDGETQKNFYETKLSRLNSRGQ
                     QKLQQIKELQNMLRNSLNATSTEEDNDSINLRPYNLYYPNGQGDEEEPKSYYQRMKLL
                     RKTPKIGDFSKLSSLLVHSLKVFSFPSVWLSGAFFGFQLSALSFYLTTEDTNYAEPPF
                     SYSDSEIARMNIPPLIGSIIGCLYAGSTLDYFVLWLSRKNDDKREAEFRLWFALLNAI
                     ISPAGLLMFGIGTARNLDWRVAYVGLGFIGFGFSVGSDLAFTYVMECYPEMILECMTG
                     VATIANFLGCIFTFACSPWLDASGVENTYIALAVINIVLMLASLPFIKWGKHFRARTR
                     EGYLSFVENIEN"
     gene            complement(<751705..>752892)
                     /locus_tag="PAS_chr2-1_0409"
                     /db_xref="GeneID:8198877"
     mRNA            complement(<751705..>752892)
                     /locus_tag="PAS_chr2-1_0409"
                     /product="Steryl ester hydrolase, catalyzes steryl ester
                     hydrolysis at the plasma membrane"
                     /transcript_id="XM_002491265.1"
                     /db_xref="GeneID:8198877"
     CDS             complement(751705..752892)
                     /locus_tag="PAS_chr2-1_0409"
                     /codon_start=1
                     /product="Steryl ester hydrolase, catalyzes steryl ester
                     hydrolysis at the plasma membrane"
                     /protein_id="XP_002491310.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0409"
                     /db_xref="EnsemblGenomes-Tr:CAY69030"
                     /db_xref="GeneID:8198877"
                     /db_xref="GOA:C4R0K6"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R0K6"
                     /translation="MLPIKETLRTLVAWSFATLLLTILMVLASVHNLFQKKNRKLMAV
                     KAFPRPLPKRDDLQFYAHMLGLDLLEYHILTPDGFEIVIQRLVNPNKEVSSKPILLLH
                     GLLQSSASFLSSGRKSIAYYLLMNGYDVWLGNNRCGFHPTHMVFKDNDPKMWDWEIHE
                     MATFDLKTMIEHVKNATNSQSINLCCHSQGGTQVFYLLANRNLEHIDKLVCLAPAVFG
                     GEMINDRLLFRFMRWLSPTGYDWLFGIQAFMPIMMKVRSVLYRYKLFDFCAYAMFNYL
                     FEWNDTLWDPEIRSIHFLFSPVYVSAKLMKWWLSDSVGYAHQKSVFDNGDWAKIEEEL
                     PRIFCVLGSIDLLVDGKKLMNCFQSPVVTYLELKEYAHLDVLWSDDVIQDIAEPMLDF
                     LKQ"
     gene            complement(<753433..>754305)
                     /locus_tag="PAS_chr2-1_0410"
                     /db_xref="GeneID:8198878"
     mRNA            complement(<753433..>754305)
                     /locus_tag="PAS_chr2-1_0410"
                     /product="Essential protein involved in 60S ribosome
                     maturation"
                     /transcript_id="XM_002491266.1"
                     /db_xref="GeneID:8198878"
     CDS             complement(753433..754305)
                     /locus_tag="PAS_chr2-1_0410"
                     /codon_start=1
                     /product="Essential protein involved in 60S ribosome
                     maturation"
                     /protein_id="XP_002491311.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0410"
                     /db_xref="EnsemblGenomes-Tr:CAY69031"
                     /db_xref="GeneID:8198878"
                     /db_xref="GOA:C4R0K7"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018023"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:C4R0K7"
                     /translation="MESGLNVWPADSPPCFILPRLSRDQVHTPFKKKNPVSSFCSSQT
                     LPKMPINQPMSQIKLTNVSLVRMRKNKKRFEIACYQNKIQDWRSGAEKDIDEVLQIPQ
                     VFVNVSKGQVAPHDDLKKCFGTTDTDTIIKEILNKGEIQLSEKERQANSSKYTAEVLQ
                     LVSAKCINPKTMKRYPTTMIHKALNELKFNLTSTKPAKSHALDAIRLLVSKQLIPIAR
                     AKMKVKIVMNSKDAKASKDKLHSLITEIESENWSSEWEAFAYIDPSNYRELFNMAKVE
                     LLEMAAINESSGTL"
     gene            <754716..>756200
                     /locus_tag="PAS_chr2-1_0411"
                     /db_xref="GeneID:8198879"
     mRNA            <754716..>756200
                     /locus_tag="PAS_chr2-1_0411"
                     /product="Membrane protein involved in zinc metabolism,
                     member of the four-protein IZH family"
                     /transcript_id="XM_002491267.1"
                     /db_xref="GeneID:8198879"
     CDS             754716..756200
                     /locus_tag="PAS_chr2-1_0411"
                     /codon_start=1
                     /product="Membrane protein involved in zinc metabolism,
                     member of the four-protein IZH family"
                     /protein_id="XP_002491312.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0411"
                     /db_xref="EnsemblGenomes-Tr:CAY69032"
                     /db_xref="GeneID:8198879"
                     /db_xref="GOA:C4R0K8"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:C4R0K8"
                     /translation="MTENSAELRKRSVKNDSGSFPYSDSVLMKRASSSSSELLGNLAD
                     ESTKEEYLLNKLDMFLSDLEFKLDNFEEYMSSSNHEHLEFISTLLSLKDKVVRKSKQF
                     HMDQILKIIEDNYGALLPSSLNVTEKLITAINFLDAKLSEFDKLLIEEQNQLMPIINQ
                     KLMNVDEAIEKGADNKLIHFYDLPFHWRENKYIVFGYRFNGTHKEATKSICQCHNETF
                     NIWSHLLGAMLLVYLSFCHLPSMELFQSFNMTDKFVLYQFMFCAFHCLMSSTFWHSFS
                     NIASFPLRNSYACVDYTGITVLITSSVVTTEHVALQHVNAWYRICLITFSVLSGVAGV
                     MFTWSPYFDKPENRHLRISFFVSLAFLGVSTFVLLWFLKGVSPTFAFYFPLLRSFASY
                     GIGVVFYATFIPEKWRTDVVVDNKEICDRTLLTLYKESRLEEELYNKTPELTSKGKKK
                     HLTSLYWCDYILSSHNIWHLFVLGGILGHYSAILEMFGNMKDFV"
     gene            <756448..>757545
                     /locus_tag="PAS_chr2-1_0412"
                     /db_xref="GeneID:8198880"
     mRNA            <756448..>757545
                     /locus_tag="PAS_chr2-1_0412"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002491268.1"
                     /db_xref="GeneID:8198880"
     CDS             756448..757545
                     /locus_tag="PAS_chr2-1_0412"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002491313.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0412"
                     /db_xref="EnsemblGenomes-Tr:CAY69033"
                     /db_xref="GeneID:8198880"
                     /db_xref="GOA:C4R0K9"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="UniProtKB/TrEMBL:C4R0K9"
                     /translation="MSLEGTSIEYDKLTFKDNASPLTFKKVTHKLPVSKDEIAVKVTA
                     AGLNPVDLGIYYTFHPWVSCLFPSYRTLGRDYSGTVVQVGSDLQNQYYVGDKVFGYVP
                     TLSTGTLAQYLFLKPKTKHDASIVRVDSSVTDEKLVDFAGIPLVFLTTVQSLSVAPLS
                     DKSRVVIIGGSTSLGWTAIQLLLNHYKVKPENLVSVNGSRSNSFVQELGVLQQNTINY
                     DQVDSLQNPVLEKAKDGKFDLILDAAGNSDLFDHIKEILKSKEENGHYVTLVGDHKPV
                     YASSLLARFPSSFASFKRFIYWNLIGGGPIHYQFRNVHASKKDIDLAYRLYKEGNYKV
                     IVDSIYRSEEVTEAYKRLESNQARGKVIVKF"
     gene            complement(<757616..>760132)
                     /locus_tag="PAS_chr2-1_0413"
                     /db_xref="GeneID:8198881"
     mRNA            complement(<757616..>760132)
                     /locus_tag="PAS_chr2-1_0413"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491269.1"
                     /db_xref="GeneID:8198881"
     CDS             complement(757616..760132)
                     /locus_tag="PAS_chr2-1_0413"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491314.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0413"
                     /db_xref="EnsemblGenomes-Tr:CAY69034"
                     /db_xref="GeneID:8198881"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:C4R0L0"
                     /translation="MILANYVYSLLRAALAIAFIDQTPGVVADDFEHVPTTTVVDILS
                     SQVQFSKFLRVIQRNGLVPLLNQMDNFTLVAPINSAFLPSDLNAFDSEELKRYLIPYV
                     IYSDSFEGVRIFPNLVNNPTSFTSFDEYGEFKVSNISIVEPDLEAESQDAVVQGVEEL
                     LSPVDDLYATLSEKGDFGEILRASTIDSDFLNNVTCFLPRKLPYNEVEFSYLTSQYAN
                     EDQKTFLFHHLVPGIYGGDVNTSLVNLNGDIVDFSSVDHGLEISLNDTFLSTEANVLA
                     SNGIIHEFSTNLFKGFPHFTPLKVLYGLNESEFVDEIIFRKLSYLIDDPSLNQTIFIP
                     RVTDNDDDTENFQPYGVNKNNILYQFAEGQLSGNSELLDSKYCPSKIGGCQKLKLNLI
                     GHDLFINNLVVVDSSSYKIGNTSIFYIDEALTTPSSLGTAVGSYFHCSRSLQFLEDLD
                     LLHFPKSKGYTVLLPCFNSWNNLGLTLDYLRSNKTALALVLENLIIDGPIYSDFVGTV
                     ESTSIANEPVILTIEPDDDQDGITKLKVNDTELDLRKYTDILFDVGVVHPVSEIILPE
                     SLDIKLQQLLTVVDSTIFQDILSWSNLTEILEEDGYSILLPTKESLESSNITLFSNPS
                     YLKSFIALHILPPGSLDKLIDCENRIPTLLNNTNLSCRRVSKDSVTLQIVEGKDKEVR
                     VINKGCTKRTLHHESVHPGRYNKSSCLLILDRPIDPNWLFDDPNKVPMIHLPMVAVSI
                     GVLIGILFISAILSCCVLCIFRTDKNTDEEQPLIEETLEENEERRRLEAHHHNYHSTE
                     HGNIEDNTNSSGAEGQKTSPSTEFSEGNYSEHSKSKPIPV"
     gene            <760366..>760995
                     /locus_tag="PAS_chr2-1_0414"
                     /db_xref="GeneID:8198882"
     mRNA            <760366..>760995
                     /locus_tag="PAS_chr2-1_0414"
                     /product="Cytoplasmic RNA-binding protein, contains an RNA
                     recognition motif (RRM)"
                     /transcript_id="XM_002491270.1"
                     /db_xref="GeneID:8198882"
     CDS             760366..760995
                     /locus_tag="PAS_chr2-1_0414"
                     /codon_start=1
                     /product="Cytoplasmic RNA-binding protein, contains an RNA
                     recognition motif (RRM)"
                     /protein_id="XP_002491315.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0414"
                     /db_xref="EnsemblGenomes-Tr:CAY69035"
                     /db_xref="GeneID:8198882"
                     /db_xref="GOA:C4R0L1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R0L1"
                     /translation="MSEETQDNKEQPQQSQLDSNQTESQASQQELDQWKAKMAEMEAE
                     VNKLRELQGQQEVGSRPENGVGTANSDSDPKFLSIEERQEIDSKSIYVGNVDFSATPG
                     ELAEHFKTCGTVNRVTILMDKVTGRPKGFAYVEFSDPSSVSESLVLNDSEFHGRNLKV
                     VPKRTNMPSFMVRGRGRGRGGRGSFGPRGRGDRGGRGGRARGRARFVPY"
     gene            complement(<761083..>762798)
                     /locus_tag="PAS_chr2-1_0415"
                     /db_xref="GeneID:8198883"
     mRNA            complement(<761083..>762798)
                     /locus_tag="PAS_chr2-1_0415"
                     /product="Alpha-isopropylmalate synthase
                     (2-isopropylmalate synthase)"
                     /transcript_id="XM_002491271.1"
                     /db_xref="GeneID:8198883"
     CDS             complement(761083..762798)
                     /locus_tag="PAS_chr2-1_0415"
                     /codon_start=1
                     /product="Alpha-isopropylmalate synthase
                     (2-isopropylmalate synthase)"
                     /protein_id="XP_002491316.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0415"
                     /db_xref="EnsemblGenomes-Tr:CAY69036"
                     /db_xref="GeneID:8198883"
                     /db_xref="GOA:C4R0L2"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R0L2"
                     /translation="MPMLKDPSKKYVAFKPLNLPDRQWPSKTLQAPPRWLSTDLRDGN
                     QSLPDPMSVAEKKEYFNKLVQIGFKEIEVAFPSASQTDFDFTRYAVENAPADVAIQVL
                     SPCRPELIKRTVESLKGAKKAIVHIYLATSDCFRNIIFGLSQEESLEMAVNCTKLVRE
                     LTKDAPEMQDTVWGFEFSPETFSDTDPDYALRVCEAVKAAWGPSEENPIIFNLPATVE
                     MSTPNVYADQIEYFSRNISERKTVAISLHPHNDRGCAVAAAELGQMAGADRIEGCLFG
                     NGERTGNVDLVTLALNLYTQGVYPHLDFSDITSVIDIVERCNKIPVHPRAPYGGQLVV
                     CAFSGSHQDAIKKGFKKQEERQAKDPNARWQLPYLPLDPQDIGRTYEAIIRVNSQSGK
                     GGASWVILRNLELDLPRALQVSFSKIVQNESEVKGRELYNKEITNLFKNSYFVDDDDT
                     QHDLYFQLVDYSITNTSKSARLINVELQVGKDTVSLKGIGNGPISSFASAISSYLKKD
                     VLVLNYHEHSLGKDSNSKAATYLHCAIGDDCKVWGVGIHEDVSQASFLSFISLLNSAR
                     RDGKI"
     gene            complement(<762961..>764070)
                     /locus_tag="PAS_chr2-1_0834"
                     /db_xref="GeneID:8198884"
     mRNA            complement(<762961..>764070)
                     /locus_tag="PAS_chr2-1_0834"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491272.1"
                     /db_xref="GeneID:8198884"
     CDS             complement(762961..764070)
                     /locus_tag="PAS_chr2-1_0834"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491317.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0834"
                     /db_xref="EnsemblGenomes-Tr:CAY69037"
                     /db_xref="GeneID:8198884"
                     /db_xref="GOA:C4R0L3"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:C4R0L3"
                     /translation="MFIRHRIRLFSYSCGRLTQEYNKTLLSKSLGVKTDSGSITRCTV
                     YDATGNASSVSSRTLKNELLLKHELLPRDLRKIDKGYDDIVPAILIRPSSILINVLHI
                     RALIRSDRVILFNQGPSNSHTNTMFLNDLAAKLKTPTKEAGIPYEIRALEAIFISVVS
                     NLQSEMKVNTMVIKGILKELEDHIDRIKLRYLLVQSKKLKQFHQKAALIRNLLEELLE
                     QDDELAALYLSEKRSFHDHQEVEMLLESYLAHCDEIVQRVETYLSNVRTTEEIINIIL
                     DSNRNQLMLLGLRFSIGLLSFGGLIFVASLYGMNLENFVEESDYWFWIIVGGSTTLCI
                     LVFAKGVKALSKLERVSMLGDDLKPLTQVRRSRNN"
     gene            <764399..>766474
                     /locus_tag="PAS_chr2-1_0416"
                     /db_xref="GeneID:8198109"
     mRNA            <764399..>766474
                     /locus_tag="PAS_chr2-1_0416"
                     /product="Protein kinase that forms a complex with Mad1p
                     and Bub3p"
                     /transcript_id="XM_002491273.1"
                     /db_xref="GeneID:8198109"
     CDS             764399..766474
                     /locus_tag="PAS_chr2-1_0416"
                     /codon_start=1
                     /product="Protein kinase that forms a complex with Mad1p
                     and Bub3p"
                     /protein_id="XP_002491318.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0416"
                     /db_xref="EnsemblGenomes-Tr:CAY69038"
                     /db_xref="GeneID:8198109"
                     /db_xref="GOA:C4R0L4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012572"
                     /db_xref="InterPro:IPR013212"
                     /db_xref="InterPro:IPR015661"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R0L4"
                     /translation="MSQDGVTASLPGWFRDQISMIDELDDPLEPYINYLKECENSNVL
                     IQLLEDVTRKFKDDQLYSNDIRYLKLWLHYIKFSNSPRKIFLYLHKKQIGSKLTLFYE
                     SFARYLESEGEIIHADELYQMAISNNSKPINRLLKSYTLFKNRHQQLNERSHLFSEPT
                     QTAHIFVKNPNLEYPVRKLITNKNKKDELFDFNLDLIYRDNEEFCFEEILAISYNLYD
                     YTENNPQKNKENQNPAFLQQKLQDNPELPLEPSEIRQVRHDILHNKTLIKPIAISSSP
                     EQSPASSPFVENVDSSMEDQEPLTQPLIEKITLNPMSPDFHSELLKKLNPPLSHYSRI
                     SVYPKPLNKLSVLTSIFRADKNRMVLGNKNTMFQFGEKMYCITKLLGEGGYATVFLAE
                     SDLGELVAIKVQNPVSLWEFYVFKTIENRLASLNPNDKLVKSFVLCQSFQVYQDETYL
                     IMDYLNQDTLLEVINVYRSLGKSGVDEQLVLFLTIELLTCIEFLHDIGIIHGDLKPDN
                     CMVRFEKIADSKWSEFYDATGNNGWCKKGITLIDFGRSIDMTLFPNKGENVNFLCNWK
                     VDEQDCPEMRNGEPWTYQADYFGLASIVHFLLFGKSITLRKDENGNYRINESFKRYWQ
                     VDLWNEFFFDLLNSTKVGTRVLPNNDILSKNKIKLCHWLTHHSQGLKKSISDLELIYR
                     ERSKKVFKR"
     gene            complement(<766515..>768335)
                     /locus_tag="PAS_chr2-1_0417"
                     /db_xref="GeneID:8198885"
     mRNA            complement(<766515..>768335)
                     /locus_tag="PAS_chr2-1_0417"
                     /product="Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex"
                     /transcript_id="XM_002491274.1"
                     /db_xref="GeneID:8198885"
     CDS             complement(766515..768335)
                     /locus_tag="PAS_chr2-1_0417"
                     /codon_start=1
                     /product="Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex"
                     /protein_id="XP_002491319.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0417"
                     /db_xref="EnsemblGenomes-Tr:CAY69039"
                     /db_xref="GeneID:8198885"
                     /db_xref="GOA:C4R0L5"
                     /db_xref="InterPro:IPR007245"
                     /db_xref="UniProtKB/TrEMBL:C4R0L5"
                     /translation="MLRNWGFWLIVSQFSLVFCNQKGSFKERLDFTPLPKNNLLASFN
                     FEIKSDTVNWYDTSSTYSHYTVFPKSLGPILEDTKTRELHLRFSQGWWDSELWGSLPQ
                     NGSQSGGTGVEVWAVIEADNKTEAEGEWIHLVNSLSGLFCASLNFIDNVITTNPVYSL
                     QPTSNFINELPTEGDLFLFRSALPREPVCTENLTPFLDLLPSKGKNGLSSLLNGHKVY
                     DSQWNSMSIDVETNCDDELNCHYDLKQNIHMIVNTKRVLSKLRDPLPVPTPGNELRCD
                     RTKKHDAYYCFPLVDSTDIKIDMREIFGNIINGENTVTTEKSRVCAHTVPEVWKVLAK
                     VNDYDSVFAYSEVQEPCYEISGTDTLNIELKTDRSDITLPLKEPPLVVSRSLTGYSQD
                     SGGLRIDFRNPSDSEEVNFVYYQSTPWYMKTYLHTLKMTLTNNTSGESFVIPITDRSI
                     VSYLPEFYYEPMIDRVRPSHLELKLVLPPNFSMRLAYKFDKLMLKYAEYPPDANHGFE
                     IEPAIVTVVDKFNKVIYEARTTPALLTLPTPDFSMPYNVIILTSTVMALAFGGIFNLI
                     VKRVVTEEQAEYYYQQNSPKLRLRRLIARISAKFQKKKAD"
     gene            <768523..>771636
                     /locus_tag="PAS_chr2-1_0418"
                     /db_xref="GeneID:8198886"
     mRNA            <768523..>771636
                     /locus_tag="PAS_chr2-1_0418"
                     /product="U2-snRNP associated splicing factor"
                     /transcript_id="XM_002491275.1"
                     /db_xref="GeneID:8198886"
     CDS             768523..771636
                     /locus_tag="PAS_chr2-1_0418"
                     /codon_start=1
                     /product="U2-snRNP associated splicing factor"
                     /protein_id="XP_002491320.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0418"
                     /db_xref="EnsemblGenomes-Tr:CAY69040"
                     /db_xref="GeneID:8198886"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R0L6"
                     /translation="MSHHNDSGLIPFDPKGSNGVQAAPQYTIPKEYEEEMIDNAEDID
                     PLEGSIVSSKPKESDYHKRKYDNLMNINLTQQERTYKDRMKERQLDRQEEDIQKLLKQ
                     KQEQADQKFNDAKPENQPTRKRKKRWDVKSSEGDSVTVNILPVINGIELNNSILDKIL
                     PNGYTIVEPPLSYKPLNDLPPDYKQEDQGYLLPEESTLALENKAVETAQELAIENLGE
                     KEKKVHTLISNIIEGASNMRKPALRQLTENARTFGAQAIFDQLLPLFMKRNLDEHQRH
                     LLVKIVGRVLYQLDDLIRPYTYKILVVIMPLLIDEDYYTRIEGREIVANLSKAAGLAH
                     MISTLRPDIDHSDEYVRNTVSRTFAVMSCALGIPVVLPFLKAVCNSKKSWQARHTGMK
                     IVQQIAILAGSGVLPHLNGLVAAISKGLSDEHVHVRTIAAQAASALAESSAPYGAESF
                     QQILDELYKGIRRHRGKGLAAFLKAIGYIIPLLDPDYADYYAKMVFKVLIREFESPDE
                     EMKRTCLKVLQQCCDTEGIEKQYLIIEVIGSFFKSFWNRRTALDRRTAKLCCETTFHL
                     SKRVGAGLVLDNILVHLKDESEPFRRMTAETCYKVVQSYGTAELSDKSVDQLLDGILI
                     AFQEQVIQDNVILKSFSVIISSLGLRIGVHLPSIVSIILYRLKNREPEPRRQAASLIT
                     VVAPVIKKCGNEDMLLKLGSVIYESLGEVYPDVLASILEAMKAVIAVVGVESMNPPMS
                     QILPTLSPILRNRNEMVQETAIGLIGMIAQRAPEYVNAREWMRICFSLVEMVKSQRKS
                     IRKAANRTVGYIAVAIGPQDVLVTLLNNLRVQDRQLRVCTAVAIGIVAESCAPFTVLP
                     ALMNEYQTVENNVQNGVLKALAFMFESIGSMGKDYIYATLPLIEDALTDRDLVHRQTA
                     ANVVKHMALNNVGFGLEDAFIHFLNLLWPNIFETSPHVIARILEGIEGCRNVIGCGIV
                     MNYTLTGLFHPARKVRDSYWKVYNPMYVQSCDSMVPYYPDFKDQILTKDTEQVTPTVI
                     EELDIWV"
     gene            <771924..>773024
                     /locus_tag="PAS_chr2-1_0419"
                     /db_xref="GeneID:8198887"
     mRNA            <771924..>773024
                     /locus_tag="PAS_chr2-1_0419"
                     /product="Mitochondrial NAD+ transporter, involved in the
                     transport of NAD+ into the mitochondria"
                     /transcript_id="XM_002491276.1"
                     /db_xref="GeneID:8198887"
     CDS             771924..773024
                     /locus_tag="PAS_chr2-1_0419"
                     /codon_start=1
                     /product="Mitochondrial NAD+ transporter, involved in the
                     transport of NAD+ into the mitochondria"
                     /protein_id="XP_002491321.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0419"
                     /db_xref="EnsemblGenomes-Tr:CAY69041"
                     /db_xref="GeneID:8198887"
                     /db_xref="GOA:C4R0L7"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R0L7"
                     /translation="MKLKGGDGAQNPSQPTAGPRYSFITKENVTPISGALAGLIAGIA
                     VCPLDVAKTRLQAQGAFLQSKNVDHKLHQVFENKRYQGLVQTIKTITREEGIRGLYRG
                     LVPISIGYLPTWMIYFTMYETCQKFLDRTSFISQGNNLSYFISAIGAGLASSTLTNPI
                     WVVKTRLMLQTGSGSTIYDRFDGKHGINDMIEDKLKHSYYKGTIDAFRKMFKEEGILS
                     FYSGLLPSYFGLIHVAIHFPLYENFKIIFNCTQKDINEARKNNVNGSLPKSIVFKLAF
                     VSCASKMFASAITYPHEILRTRLQIDGHDLGRKKSGLIKTIKSIYLKEGIRGFYSGFV
                     INLTRTLPSSAVTLVSFEYIKNYLDKIASPAL"
     gene            complement(<773392..>773769)
                     /locus_tag="PAS_chr2-1_0420"
                     /db_xref="GeneID:8198888"
     mRNA            complement(<773392..>773769)
                     /locus_tag="PAS_chr2-1_0420"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491277.1"
                     /db_xref="GeneID:8198888"
     CDS             complement(773392..773769)
                     /locus_tag="PAS_chr2-1_0420"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491322.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0420"
                     /db_xref="EnsemblGenomes-Tr:CAY69042"
                     /db_xref="GeneID:8198888"
                     /db_xref="UniProtKB/TrEMBL:C4R0L8"
                     /translation="MITVGRKNSTKWIPWARVSLKVSGVKSSGSWMELILMTVGPFST
                     PITGALGWIGCFSKSYCQKTGHDRFCNFHGDCCQNETVCAMLSLSRVCNCRTVVIYGR
                     QSQSRTDRCLVSSFSCLVLVLCI"
     gene            <773845..>775749
                     /locus_tag="PAS_chr2-1_0421"
                     /db_xref="GeneID:8198889"
     mRNA            <773845..>775749
                     /locus_tag="PAS_chr2-1_0421"
                     /product="ER protein with chaperone and co-chaperone
                     activity, involved in retention of resident ER proteins"
                     /transcript_id="XM_002491278.1"
                     /db_xref="GeneID:8198889"
     CDS             773845..775749
                     /locus_tag="PAS_chr2-1_0421"
                     /codon_start=1
                     /product="ER protein with chaperone and co-chaperone
                     activity, involved in retention of resident ER proteins"
                     /protein_id="XP_002491323.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0421"
                     /db_xref="EnsemblGenomes-Tr:CAY69043"
                     /db_xref="GeneID:8198889"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C4R0L9"
                     /translation="MRQVDCAANGDFCGKQSINSYPTLRLYGPSEDNTSYKLITTYPS
                     GGKRTPQNFLKFLRSQYDDLKNDRFNLPVKGEVLTEEKMLKLMNGDIEEPVLVSFWPT
                     TDKETTLKYFEDVHSNPISFKNCYSCFNLAVLWSRITNRLPDLETAVFNCGGTNSRVC
                     QALNLPFNVNRAQVSPEIYMFLPNSHGGIRVKYNHDLVISDIVDWSERLLANAQAEEV
                     TLDSLAEKMTLLNPAKGLDFFKGPDPNQKQVFVYYYEEGSDAPEDFEIWPHLLQPIMD
                     LTTNTYIYRSKDSQLEDLLDKKYKKLIDYINQPDFEPERPLNRETYLARTITSVPTFL
                     VFKDNNMIPTVYQNFSPNEIRDVKKVVNFIEQNQFPLVDRLTTDNYESYFPKFNPQIH
                     DKDEKIVISFFSSDNKTQTTNDYNQLLFVQHSYDYIKHQNRFDLIEKARADKTDKSEQ
                     LKGEGMDPKEIIKVLSKKIDHLNNVGNVLTVYVDLADDRKLLEKTGWISSRTKYKPGE
                     SIIVTRFGKHYWDRDVFGHKLMTTAQSLRETLSYLLFPSTYIPPEKKTTVRPSPRVAG
                     SPYPDAFAFVDIIHQYGLFGYLLIITSVIGVYMLIKSHRRRSRKAKFLSHRSHKEGFQ
                     DAYIELSKHD"
     gene            <775912..>776439
                     /locus_tag="PAS_chr2-1_0422"
                     /db_xref="GeneID:8198890"
     mRNA            <775912..>776439
                     /locus_tag="PAS_chr2-1_0422"
                     /product="Acireductone dioxygenease involved in the
                     methionine salvage pathway"
                     /transcript_id="XM_002491279.1"
                     /db_xref="GeneID:8198890"
     CDS             775912..776439
                     /locus_tag="PAS_chr2-1_0422"
                     /codon_start=1
                     /product="Acireductone dioxygenease involved in the
                     methionine salvage pathway"
                     /protein_id="XP_002491324.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0422"
                     /db_xref="EnsemblGenomes-Tr:CAY69044"
                     /db_xref="GeneID:8198890"
                     /db_xref="GOA:C4R0M0"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR027496"
                     /db_xref="UniProtKB/TrEMBL:C4R0M0"
                     /translation="MQLYYHDGLDTPDNFCEDHNSGEEVSVEELSKIGVIYYHLDEES
                     QVEKIARERDYKNRDFVVLSDETFPGGPDALQEKLKVFYKEHLHEDEEIRFILDGEGY
                     FDVRSQNDRWIRSKLFKGDLLILPAGIYHRFTLSTKKYVKTMRLFKEEPKWQAYNRPA
                     DDKGARLEYLKSIQV"
     gene            <776747..>777157
                     /locus_tag="PAS_chr2-1_0833"
                     /db_xref="GeneID:8198891"
     mRNA            join(<776747..776780,776835..>777157)
                     /locus_tag="PAS_chr2-1_0833"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491280.1"
                     /db_xref="GeneID:8198891"
     CDS             join(776747..776780,776835..777157)
                     /locus_tag="PAS_chr2-1_0833"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491325.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0833"
                     /db_xref="EnsemblGenomes-Tr:CAY69045"
                     /db_xref="GeneID:8198891"
                     /db_xref="GOA:C4R0M1"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="UniProtKB/TrEMBL:C4R0M1"
                     /translation="MSEGKPNPNQELFQKQYDEFQETLEALNNKIGQLQGDIEEHNIV
                     LKTITTAPKDRKCFHMIGGVLIEKTAGEVEPTLKTNVTKMNDAVENLKNEIQNTHKQF
                     EDWKKKTGVKIVSANE"
     gene            complement(<777240..>778535)
                     /locus_tag="PAS_chr2-1_0423"
                     /db_xref="GeneID:8198108"
     mRNA            complement(<777240..>778535)
                     /locus_tag="PAS_chr2-1_0423"
                     /product="Beta subunit of the oligosaccharyl transferase
                     (OST) glycoprotein complex"
                     /transcript_id="XM_002491281.1"
                     /db_xref="GeneID:8198108"
     CDS             complement(777240..778535)
                     /locus_tag="PAS_chr2-1_0423"
                     /codon_start=1
                     /product="Beta subunit of the oligosaccharyl transferase
                     (OST) glycoprotein complex"
                     /protein_id="XP_002491326.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0423"
                     /db_xref="EnsemblGenomes-Tr:CAY69046"
                     /db_xref="GeneID:8198108"
                     /db_xref="GOA:C4R0M2"
                     /db_xref="InterPro:IPR005013"
                     /db_xref="UniProtKB/TrEMBL:C4R0M2"
                     /translation="MNHFKGLIVLIWSFCTAVMALSPIASDTLVVYDSSVLEFGEFSS
                     LVDHLNGEFSRVDIVDLNDKASEVQLFYNQKRIYQNLFVFPISGQSNQGDLNALKLIE
                     FVNEGGDIISITNQVGSNSEIVAFNTELGIYPSPKNYKLIDHFNGVNEQHDEIRLSLE
                     ESVVPNSIVAFNKAIVYSGAASLLSNNEYLIPLLKAPKTSFAYDINEGVVNEQSTWTS
                     GDQGFLAVAFQGLNNARSLWLGSTLFFDNEHFDQSAKDLVDWTFQSRNLLKSTFAKHY
                     LTDAPESTEEYKVKDEVSYEIGLSEWNGKEWVPFKANDVQLELIMLDPYYRITLEQVK
                     TEDESVQVYTSGPFKLPDQHGMFTFSTKYFRPGYTFIEEEDIVPVRHLANDEYPRSWE
                     ITNSWVYVASAGAVVIAWIIFVIFFLYSTEDATEIKKNI"
     gene            complement(<778979..>781939)
                     /locus_tag="PAS_chr2-1_0424"
                     /db_xref="GeneID:8198892"
     mRNA            complement(<778979..>781939)
                     /locus_tag="PAS_chr2-1_0424"
                     /product="Phosphatidylinositol 4,5-bisphosphate
                     5-phosphatase, synaptojanin-like protein with an
                     N-terminal Sa"
                     /transcript_id="XM_002491282.1"
                     /db_xref="GeneID:8198892"
     CDS             complement(778979..781939)
                     /locus_tag="PAS_chr2-1_0424"
                     /codon_start=1
                     /product="Phosphatidylinositol 4,5-bisphosphate
                     5-phosphatase, synaptojanin-like protein with an
                     N-terminal Sa"
                     /protein_id="XP_002491327.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0424"
                     /db_xref="EnsemblGenomes-Tr:CAY69047"
                     /db_xref="GeneID:8198892"
                     /db_xref="GOA:C4R0M3"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C4R0M3"
                     /translation="MKVLLRKNPRSVALVSGDYCLLFKTVRTQNHVNSKPKSIIEFVS
                     LKHLSSQHYYELNMECYGLLGLIHLKGNTFVCVITGKQEVGSIRPQERINVIKNVNFI
                     CLENDSFEYIETKYNTQALTAEKNIEIYEKEVPYSSLKRLLSSNSFYYSNDFDIITSL
                     QHRESSYLRKEKKFRMILEYSKNFLWNNFMVGELINFKDHLTPQERFLFEERGEFLVC
                     IMRGYVQSVNCSIETNGDSLMTIISKQNCVKTGKGHLFGPWGLDDNGNTSNFVQSTVC
                     LYTKNTIFFYNQIRGNVPLFWSLENQLLSTKIDFPRSSESSQAAFDKYFDILCQNFGN
                     VHILDGLSERGYQRELTEKYKESFRNLDDVLRQQVTYNEINFPLDSLKNHTADSKLLK
                     AIEDRIIDIGAYCYNLKDQTSIGKQSGIFLTNTFNSLEKANYIQQLISSTVFHACLSD
                     LDLNFSNEIAAKHNELWHENGQRLQKITLHAMSSKHTKNKQGGLVGVVAGVSKKYVSN
                     VVQDNKIKEHNVDKLLGRLNGQIEVQLIDPIHDFVTNELRKKKNEFTSQRTLKIFTGT
                     FNINGELYEGDIRSWIYPLDDSAKENYDVIAIGFQEIISLSAGKMINVDSKNRQFWEK
                     KLLLTVNRDDPNKYTMLWVSQLGGICLFLLVKTTAKTRITDIEGTLKKTGLAGIAANK
                     GAVAISFTYSSTTKFAIVSSHLAAGFHNVVERHQDYKTIAKGMSFARKRTLKDHDIVI
                     WMGDFNYRIELSNEDCKRLIGEKNYRKLYEYDQLNNQMAEGHAFPYYDEMELNFAPTY
                     KFDNGTSRYDTSEKQRVPAWTDRILSISRGKSLNQISYGSVPSIKFSDHRPVYGVFKA
                     TVDVIDEEIKNRLTAELYEEMKHKIGDANDILFYGDIINEQDTANMAPSNPGASNYVD
                     NEITLAHGLPPPSSEHTKWWIDGRQSVRVHFPELDDGKMMVNPNLPRNPFEKTKEADF
                     VTIEEGLKEYPSES"
     gene            <782340..>783869
                     /locus_tag="PAS_chr2-1_0425"
                     /db_xref="GeneID:8198893"
     mRNA            <782340..>783869
                     /locus_tag="PAS_chr2-1_0425"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491283.1"
                     /db_xref="GeneID:8198893"
     CDS             782340..783869
                     /locus_tag="PAS_chr2-1_0425"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491328.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0425"
                     /db_xref="EnsemblGenomes-Tr:CAY69048"
                     /db_xref="GeneID:8198893"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C4R0M4"
                     /translation="MTEKEHYEQLCYACRIADVEQVEMLVSSGIDVNRVDEWDYSPLI
                     LASLCGHLNVVKLLLKVGAICDRDTFQGERCIYGALNDEIRNVLLSYDISKSVNESQP
                     FSAHIHKLISGKATVNTKDMLLNNCVPVHRWYISSQQVGISIDHSNVTLNYDTKIVEQ
                     LIKFLYLSPQFQVNESDLKPLVQCSKDFGIACFQQLCNEYLELSAQNDIKRLSKLRHK
                     IQFSQSLHTRDLLKEFVETQVLGAKIELGSSTDISPVKEKLFNLESCPDIILRLGNAF
                     YPAHRSMMVRSGYFDLMLQSSFAEASSYNELTDVIYHRDQVDPKVDIQVISLTEEIAD
                     ERLFEILLRYVYYDETSVPANLSLETLYMSDQLMVDKLKTMAAIAITNDWESTGYSLY
                     EILEAAWVTRVHRLETFVAHEFAKHFDHYVTQPEFKEVIMESANRIDARQAVDSIELI
                     DDIRFYLTRVYSIDFEKPYHPEVDYEKWEIQQMNSDNVIQYNRCLQEIENLLAECGFD
                     A"
     gene            complement(<783887..>784558)
                     /locus_tag="PAS_chr2-1_0426"
                     /db_xref="GeneID:8198894"
     mRNA            complement(<783887..>784558)
                     /locus_tag="PAS_chr2-1_0426"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491284.1"
                     /db_xref="GeneID:8198894"
     CDS             complement(783887..784558)
                     /locus_tag="PAS_chr2-1_0426"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491329.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0426"
                     /db_xref="EnsemblGenomes-Tr:CAY69049"
                     /db_xref="GeneID:8198894"
                     /db_xref="GOA:C4R0M5"
                     /translation="MKFLRLSTLALVGLGFLTQTTLCDPDTDEEFVPTEQKPFNIRVT
                     YEIDEHPQSFESTKLIELVNGEEISVTYNIKNGEDESVSVVGVAGSFNDPVTGLTKRN
                     LTASSVGPLKLLKDMTFEFTQKIGIDLEPENYLFVPSIYVLKDDQLMLLGSKNQLITV
                     SDPQISVFQPQMLFLELVLLASFGGLIYALYATFGASYFQKPATAPKNKKVGSSNVRK
                     TKKNK"
     gene            <785091..>786227
                     /locus_tag="PAS_chr2-1_0427"
                     /db_xref="GeneID:8198895"
     mRNA            <785091..>786227
                     /locus_tag="PAS_chr2-1_0427"
                     /product="Putative high affinity iron transporter involved
                     in transport of intravacuolar stores of iron"
                     /transcript_id="XM_002491285.1"
                     /db_xref="GeneID:8198895"
     CDS             785091..786227
                     /locus_tag="PAS_chr2-1_0427"
                     /codon_start=1
                     /product="Putative high affinity iron transporter involved
                     in transport of intravacuolar stores of iron"
                     /protein_id="XP_002491330.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0427"
                     /db_xref="EnsemblGenomes-Tr:CAY69050"
                     /db_xref="GeneID:8198895"
                     /db_xref="GOA:C4R0M6"
                     /db_xref="InterPro:IPR004923"
                     /db_xref="UniProtKB/TrEMBL:C4R0M6"
                     /translation="MGIDISDYFSPQIFFIILRETLEAAIIISVLLAFLDRSFHTSSG
                     YQELPTEPATSQESDNTAAEIVGGEKLYKRLRLQVWVGSFLGLLLCLFIGGIFIVVFN
                     VAGSDLWAYTEHYWEGAFSILAAVIISVMGLAMLRLNQMKSKWHLKLNNLILNQTLQK
                     ENQTEKYAMFFLPFITTLREGMEAVVFIGGVGLDQPLSTIPASLLLGLAIGVSVGIAL
                     YKTGHTMSLRLFLIGSTGFLYLVAAGLFSKGVWQFELQKYIDRCGGQDMSEVGSGPGS
                     YDIGNSVWHVNCCNGEMDGGWMLFTALFGWTNSATYGSVTSYIVFWVILVASLRMLRF
                     EEKNGYLPFIPLSWQAKRCKKRILLLRSNHTLSQEPSNNQGSSE"
     gene            complement(<786382..>786780)
                     /locus_tag="PAS_chr2-1_0428"
                     /db_xref="GeneID:8198896"
     mRNA            complement(<786382..>786780)
                     /locus_tag="PAS_chr2-1_0428"
                     /product="One of two nearly identical (see HTB1) histone
                     H2B subtypes"
                     /transcript_id="XM_002491286.1"
                     /db_xref="GeneID:8198896"
     CDS             complement(786382..786780)
                     /locus_tag="PAS_chr2-1_0428"
                     /codon_start=1
                     /product="One of two nearly identical (see HTB1) histone
                     H2B subtypes"
                     /protein_id="XP_002491331.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0428"
                     /db_xref="EnsemblGenomes-Tr:CAY69051"
                     /db_xref="GeneID:8198896"
                     /db_xref="GOA:C4R0M7"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4R0M7"
                     /translation="MAPKAEKKPASKAPAEKKPTAGKKTSSSSEPKKRSKVRKESYAS
                     YIYKVLKQTHPDTGISQKAMSIMNSFVNDIFERIASEASKLASYNKKSTISAREIQTA
                     VRLILPGELSKHAVSEGTRAVTKYTSSTQA"
     gene            <787331..>787723
                     /locus_tag="PAS_chr2-1_0429"
                     /db_xref="GeneID:8198897"
     mRNA            <787331..>787723
                     /locus_tag="PAS_chr2-1_0429"
                     /product="One of two nearly identical (see also HTA1)
                     histone H2A subtypes"
                     /transcript_id="XM_002491287.1"
                     /db_xref="GeneID:8198897"
     CDS             787331..787723
                     /locus_tag="PAS_chr2-1_0429"
                     /codon_start=1
                     /product="One of two nearly identical (see also HTA1)
                     histone H2A subtypes"
                     /protein_id="XP_002491332.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0429"
                     /db_xref="EnsemblGenomes-Tr:CAY69052"
                     /db_xref="GeneID:8198897"
                     /db_xref="GOA:C4R0M8"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4R0M8"
                     /translation="MSGGKGKASSAEKASTSRSSKAGLTFPVGRVHRLLRRGNYAQRI
                     GSGAPVYLTAVLEYLAAEILELAGNAARDNKKSRIIPRHLQLAIRNDEELNKLLGHVT
                     IAQGGVLPNIQSELLPKKSAKAKASQEL"
     gene            complement(<788398..>789351)
                     /locus_tag="PAS_chr2-1_0430"
                     /db_xref="GeneID:8198898"
     mRNA            complement(<788398..>789351)
                     /locus_tag="PAS_chr2-1_0430"
                     /product="Essential subunit of the COMPASS (Set1C)
                     complex"
                     /transcript_id="XM_002491288.1"
                     /db_xref="GeneID:8198898"
     CDS             complement(788398..789351)
                     /locus_tag="PAS_chr2-1_0430"
                     /codon_start=1
                     /product="Essential subunit of the COMPASS (Set1C)
                     complex"
                     /protein_id="XP_002491333.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0430"
                     /db_xref="EnsemblGenomes-Tr:CAY69053"
                     /db_xref="GeneID:8198898"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4R0M9"
                     /translation="MVQKVDYELVLDIQLGSGYTTCAKFNPEGSLIAVSFANGTIQIL
                     DQEGHRVKELKGHTLGVSDLSWSEDGRYLASASDDTTVKIWSIESFKCVKTLVGHTYH
                     VNCVKFNHKGNLLISGSSDEAIRVWDINNSKCLKTLCAHSDPISAVDLSWDGTIIVSA
                     SYDGLIRLFDTQSGQCLKTLIYDGGDVSYPVSYVRFSPNGKYILASTLDGAVRLWDYM
                     DNKVVKTFFAHKQGIGEVSKIEMGKYNCNTDFFIDEKDPSRIIVVSGSDFGSVFLWDV
                     KSRKLLSLLQASEGSPILHVQVNNGKLLTLSRVGECKVYQL"
     gene            <789530..>790083
                     /locus_tag="PAS_chr2-1_0431"
                     /db_xref="GeneID:8198899"
     mRNA            join(<789530..789532,789587..789965,790022..>790083)
                     /locus_tag="PAS_chr2-1_0431"
                     /product="Short-lived chaperone required for correct
                     maturation of the 20S proteasome"
                     /transcript_id="XM_002491289.1"
                     /db_xref="GeneID:8198899"
     CDS             join(789530..789532,789587..789965,790022..790083)
                     /locus_tag="PAS_chr2-1_0431"
                     /codon_start=1
                     /product="Short-lived chaperone required for correct
                     maturation of the 20S proteasome"
                     /protein_id="XP_002491334.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0431"
                     /db_xref="EnsemblGenomes-Tr:CAY69054"
                     /db_xref="GeneID:8198899"
                     /db_xref="GOA:C4R0N0"
                     /db_xref="InterPro:IPR008012"
                     /db_xref="UniProtKB/TrEMBL:C4R0N0"
                     /translation="MAPLTVIPLNDKTSKVDSTSFATPSVAIPSLPDTLREQKGPLSI
                     ASEINGKHPLEARLRNWEENEHNNRLETYRRIFGAGEPIKRQMELGIVDATDFKPTIL
                     GGPSNLHRNILLNKDTSIDWEDVYTGFDSVACPDMHTEMERKVGI"
     gene            <790555..>792825
                     /locus_tag="PAS_chr2-1_0432"
                     /db_xref="GeneID:8198900"
     mRNA            <790555..>792825
                     /locus_tag="PAS_chr2-1_0432"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491290.1"
                     /db_xref="GeneID:8198900"
     CDS             790555..792825
                     /locus_tag="PAS_chr2-1_0432"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491335.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0432"
                     /db_xref="EnsemblGenomes-Tr:CAY69055"
                     /db_xref="GeneID:8198900"
                     /db_xref="InterPro:IPR003169"
                     /db_xref="UniProtKB/TrEMBL:C4R0N1"
                     /translation="MPYSYDSSGTSQTNFQEASTTVNAQEVPPRPKNSYSVSEMFEIR
                     QRMVDANQLLPVESQLPYRLSEINRTIHVDLKEARLQDSTKKSSPTVNGFSNTDHDSQ
                     FLVDKMEKLSTNDQGSNWSSPLVSHPLLTRQTSSRISSNMTPPPGITPLGSVPPTLEP
                     SQIQWIYLDAQGQEQGPFDGLMMQGWFEANYLTPELRLRRKEESSFRTLAELVQSLGD
                     FRYPFLKRLPPITQSTDPIFFPNHAEVPQWGANSSNSKSSSPWISHQNLSMDYGGQRL
                     NSPSTFLPQFDLTSQIRAATPLSAPIVSTPDFSAEILGASTAPLGESNQKELSATLTK
                     EAEPENIDDFPIKSISFDDEPSQGSTPVSTAKDEPEPSKPATISSVFASSSVTVPTSA
                     PAPAPVPAPTTVRTLPSLREIQQEELTKAKLRRQAEEARLQESLRLQRLKEQEKSKNE
                     VSTSQKASDIAPWANTKVSGPPLSLRQIQELEAKQLQERKKKQLNNVQNQPIAQRLSE
                     GAASTSLPASATWAKTPVAPVLATKSLTEIQKEQAEAQAQRLQSQALKNNAVSFANVA
                     SSSSTPVEPEDGWTVISKKVVAKPKPSAAAVAGALAPKQPLAPSALRALSAQGTVGTT
                     ANTATRSSQSAPPSRQFLDWCRSQLVQLNKSVNKEDLLSILLQLSGGSESQEIIADTI
                     YSNSSIMDGRRFASEFLKRKQVVEAWIEKNGFEFDWYEAQTKTLNDVNDSSKDQDDEW
                     DMAFTKVVSKKPKKRV"
     gene            complement(<792882..>793460)
                     /locus_tag="PAS_chr2-1_0433"
                     /db_xref="GeneID:8198901"
     mRNA            complement(<792882..>793460)
                     /locus_tag="PAS_chr2-1_0433"
                     /product="Non-essential subunit of Sec63 complex (Sec63p,
                     Sec62p, Sec66p and Sec72p)"
                     /transcript_id="XM_002491291.1"
                     /db_xref="GeneID:8198901"
     CDS             complement(792882..793460)
                     /locus_tag="PAS_chr2-1_0433"
                     /codon_start=1
                     /product="Non-essential subunit of Sec63 complex (Sec63p,
                     Sec62p, Sec66p and Sec72p)"
                     /protein_id="XP_002491336.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0433"
                     /db_xref="EnsemblGenomes-Tr:CAY69056"
                     /db_xref="GeneID:8198901"
                     /db_xref="InterPro:IPR018624"
                     /db_xref="UniProtKB/TrEMBL:C4R0N2"
                     /translation="MAEEEPIIEDMPLQKISVFTPIIYVSIVIGALILFSIFYRRKRI
                     AKLQVMKPFFPPDLPKEIYLQLKDQDPKPDEKVLKAALIRRGAEAIRRLLKLRENNQY
                     ITLLYQKGSIGDEFFDRFKLALKIQELEIQELVQEAETYKQGWAPTFMPVCQEVTLNE
                     ALRRRVNAIEDRKEQLAKEWELYQEIEASITN"
     gene            complement(<793591..>794451)
                     /locus_tag="PAS_chr2-1_0835"
                     /db_xref="GeneID:8198902"
     mRNA            complement(<793591..>794451)
                     /locus_tag="PAS_chr2-1_0835"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491292.1"
                     /db_xref="GeneID:8198902"
     CDS             complement(793591..794451)
                     /locus_tag="PAS_chr2-1_0835"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491337.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0835"
                     /db_xref="EnsemblGenomes-Tr:CAY69057"
                     /db_xref="GeneID:8198902"
                     /db_xref="GOA:C4R0N3"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:C4R0N3"
                     /translation="MEKYTTYRDKGTGISPFLPLNKPKVNIFLRLVGVVLGVLKLLVL
                     LIVGLLYPVVPLLSTKAVLFLLNVDVDVSVDNIKKANKPLIQLNLPQKGDFVISNYQS
                     PLDPLVLSLITNNRLKNIVWLIPDIEGNLYEYSLFGVVVHALSSPNLHAQKNGKKIQL
                     SSISESKTVFLFPEGTTSNNKSILPFLVTTDTVSVPKLFKKFKVKALSIKNENPYTTT
                     PIPQALASYLLTNLFTRNSSHYRLKEFILDKDHTWPEIRDLLSNSGRLKLVGKDLSLE
                     KKVEFIEKFR"
     gene            <794666..>795667
                     /locus_tag="PAS_chr2-1_0434"
                     /db_xref="GeneID:8198110"
     mRNA            <794666..>795667
                     /locus_tag="PAS_chr2-1_0434"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491293.1"
                     /db_xref="GeneID:8198110"
     CDS             794666..795667
                     /locus_tag="PAS_chr2-1_0434"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491338.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0434"
                     /db_xref="EnsemblGenomes-Tr:CAY69058"
                     /db_xref="GeneID:8198110"
                     /db_xref="UniProtKB/TrEMBL:C4R0N4"
                     /translation="MSQSASTTSRQSSLPQLTSSQASSTITSSASSSSNSESQNSTGS
                     SSANSSASSSGRPRLSSSTTSSGMPQLTTTSQTSSTSSFSTPAISVPPSNNNPFIWRS
                     SQPSGTVFISIGAVMGLGIICFIIYITWKSLKFKRQAKTGGFYDSDDSYSHKYDTKYY
                     GNDLTTTPSRVPFMAPDLRSTTDNTYYSSSNSEPGVNAGAFDSISTFHHKSKQPLDTT
                     RMYVSPTGDAIKHSRNSVLLPSVNNGKFGSDTSILSPSIKQSYQYKSPTGHHRSNSSQ
                     QLFMSPMLSTTSLADSKIQQQQQSPSEKKSKRNAKRKTVPSMYLDQLMDGEGTDDLV"
     gene            complement(<795783..>796550)
                     /locus_tag="PAS_chr2-1_0840"
                     /db_xref="GeneID:8198903"
     mRNA            complement(join(<795783..796459,796520..>796550))
                     /locus_tag="PAS_chr2-1_0840"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491294.1"
                     /db_xref="GeneID:8198903"
     CDS             complement(join(795783..796459,796520..796550))
                     /locus_tag="PAS_chr2-1_0840"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491339.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0840"
                     /db_xref="EnsemblGenomes-Tr:CAY69059"
                     /db_xref="GeneID:8198903"
                     /db_xref="GOA:C4R0N5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0N5"
                     /translation="MVFCSGSHKPIQRKIVILGDGACGKTSLLNVFTRGYFPQVYEPT
                     VFENYIHDIFIDRKQLQLSLWDTAGQEEFDRLRSLSYTDTDTIMLCFSIDSYDSLENV
                     ENKWVGEILEHCQGVKLVLVALKCDLRNTEDGDTQTQSGFPQQQDQDDSQQNQQLSQQ
                     NNLSSDNGGIQSSSKGRSLVTYEKGLAVAKRIGALRYLECSAMKGRGVNEVFTEAARC
                     ALSVKHEEDNKTSCTIM"
     gene            complement(<797118..>799319)
                     /locus_tag="PAS_chr2-1_0845"
                     /db_xref="GeneID:8198112"
     mRNA            complement(<797118..>799319)
                     /locus_tag="PAS_chr2-1_0845"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491295.1"
                     /db_xref="GeneID:8198112"
     CDS             complement(797118..799319)
                     /locus_tag="PAS_chr2-1_0845"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491340.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0845"
                     /db_xref="EnsemblGenomes-Tr:CAY69060"
                     /db_xref="GeneID:8198112"
                     /db_xref="GOA:C4R0N6"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011947"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4R0N6"
                     /translation="MNNIIELRLPSSVPFPVHITGIAIKEGDELGKHNTVLKYKYSEF
                     RDVTEDRNEYDEDYSYKPPKKEKLELIGSYECPVDGIVKDVLVSIGDVVENKESVIAT
                     VIEPCSHSVQYGGLCALCGSAVEGNDYTGFSYDKQAPVVMSHGSADLKISLTEAEKIE
                     QTSSKRLLKEKKLSLVVDLDQTVIHATVDPTVGEWMKDPNNANYPAVKDVRSFSLKEE
                     VILPENYVGQKPPATVCWYYVKLRPHLREFLEHVSERYELHIYTMATRQYAKEIAKII
                     DPDEKYFGDRILSRDESGSLTQKSLQRLFPVDTSMVVVIDDRGDVWNWSSNLIKVVPY
                     DFFVGIGDINSSFLPRQHALLGPSKRRKSLASLEDQINAEKDLRDQSFQIDPEEQDKE
                     LSEELVVSDENISDSSKENGEERGDSKETASTVDALLTMNDANGKTLREQSTEHNLEI
                     EQQQSERPLAKLQENLEKIVQTESDHESANLLFDDDNELETLEQALIRIHNEFYFEYD
                     DSKVGNPDVKDILNSMKQLVFKEYTFLLSGILPLGTKLNSADIVIWARSFGATVVADY
                     DKSVTHVITRNTGTFKVKLAKTLDPNVKIVDPNWLFKCISFWDKVDEDEYLLEVPEDY
                     LLPDHIVEKYVNENNIEKGQDGNDASFDLNVDDMQWIDKELEDFLSGDEIDDDEDDND
                     DDEANGTKKRHAEAGIADDEDTSKRLKLDEEETDSSEDELAKEIMLDMEKE"
     gene            complement(<799520..>801073)
                     /locus_tag="PAS_chr2-1_0838"
                     /db_xref="GeneID:8198113"
     mRNA            complement(<799520..>801073)
                     /locus_tag="PAS_chr2-1_0838"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491296.1"
                     /db_xref="GeneID:8198113"
     CDS             complement(799520..801073)
                     /locus_tag="PAS_chr2-1_0838"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491341.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0838"
                     /db_xref="EnsemblGenomes-Tr:CAY69061"
                     /db_xref="GeneID:8198113"
                     /db_xref="InterPro:IPR019473"
                     /db_xref="UniProtKB/TrEMBL:C4R0N7"
                     /translation="MADKSDDNQSLVSVSSASSGKENPNSVGQRSMNPTLSHEEQHDQ
                     EVQERYNTGKDLNITSQPECVPAMEVALKASVLLILSSLGVQASSLSIDHLTYITTKY
                     IDRLVSELHRSTEIQRRRTIAKRDVQLVVDRGILDLEDVTLEYERLKLTRKRVKPSIE
                     KLSKYASELKESASSVQVSENDKDAFFFFDIAEKISEFMPLRMKRKNYIPKWMPVLPP
                     EHTYVATPQFTEVISDPKELREQLTAESRLGEKALQHLIGTKIVEDKKEDVGNENDND
                     IDKEIHHGEIDVESDHNLEKGPNGETNGVQSQPPKSMVSSKRFDIVAHAKHRLSVLEK
                     RKRHQEQLLENRRKEIDGLVGQYLGYYATKKIEPPVSDIIVNIMNTEYYHVSREISKS
                     EHRKQKIQESQQLKRRKLEDELQQELEHQTEDIDFEFNFDEDDVDMNKNLNENLNENE
                     NDDEQVLIEEDTSFDITNGDIEKTNQETPFTNGSSKQWDSNNAILDSTNSEPEPEPPI
                     ADLFNVDSS"
     gene            complement(<801278..>802485)
                     /locus_tag="PAS_chr2-1_0892"
                     /db_xref="GeneID:8198111"
     mRNA            complement(join(<801278..802400,802457..>802485))
                     /locus_tag="PAS_chr2-1_0892"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491297.1"
                     /db_xref="GeneID:8198111"
     CDS             complement(join(801278..802400,802457..802485))
                     /locus_tag="PAS_chr2-1_0892"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491342.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0892"
                     /db_xref="EnsemblGenomes-Tr:CAY69062"
                     /db_xref="GeneID:8198111"
                     /db_xref="GOA:C4R0N8"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015496"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4R0N8"
                     /translation="MSQEIQVFIKASGNQEYELTVDPSITVEEFKGKIAEVSDIPADR
                     QRLIYSGRALKDADTLNFYKVQSGHTIHLVKSAPKNDGGSASVANANNSTSTSTGAAN
                     NTSSAPSNIAAGQGAFNPLAGLTGARYAGMDVPMPSASMFGPDGGMGPMPDENQIAEM
                     MESPMVQESMRNMLSDPQMVEFMIQQSPQLQQLGPYAREMLQSEQFRQMMTNPQLMRQ
                     MSSMRHMFGGAEAGAASFPAPGANPTLERNTSENNAGSATDSEANAAPTNDNTNNNNS
                     TTTNATGINPFSALLNSSNPYAAMLNQSGGNAPPLPNTGNMQLFNSLFSGGAAPPAET
                     DTRPPEERYETQLRQLNDMGFTDFESNVAALRRAGGSVQGAVNNLLNGS"
     gene            complement(<802606..>804975)
                     /locus_tag="PAS_chr2-1_0435"
                     /db_xref="GeneID:8198961"
     mRNA            complement(<802606..>804975)
                     /locus_tag="PAS_chr2-1_0435"
                     /product="Mitochondrial intermediate peptidase"
                     /transcript_id="XM_002491298.1"
                     /db_xref="GeneID:8198961"
     CDS             complement(802606..804975)
                     /locus_tag="PAS_chr2-1_0435"
                     /codon_start=1
                     /product="Mitochondrial intermediate peptidase"
                     /protein_id="XP_002491343.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0435"
                     /db_xref="EnsemblGenomes-Tr:CAY69063"
                     /db_xref="GeneID:8198961"
                     /db_xref="GOA:C4R0N9"
                     /db_xref="InterPro:IPR001567"
                     /db_xref="InterPro:IPR024077"
                     /db_xref="InterPro:IPR024079"
                     /db_xref="InterPro:IPR024080"
                     /db_xref="UniProtKB/TrEMBL:C4R0N9"
                     /translation="MKASSIQRLAVITRSCHKRTFTTHSALLQKIQPLVHEQNPIPDY
                     LNFQQKHTHHNELIREIFDNPVKWKEFNKSFIPHTKVSLTGKTYIPQVEGSIGLFQNP
                     YLTSPEGLLEFCEKSLSAAKNLVSHVIIDDSEQGKLNYIRNLDRLSDTLCRVIDLAEF
                     IRVAHPDEYFVEAAQKCHEIMFEYMNVLNTTSDLFNKLESVLGDEKIIAKLSPEEISV
                     GNLLLTDFLKSGISMDDSTKDNFIQLSQLISMNGQQFNKNLHELEHDSIKVDKKELTS
                     YDSSTENSLIYSLSNKKKIPLNSRVSTDILRLTNNESLRKKIWLGLHQPAKGQITLLE
                     NFLKYRGLLAHFMGKSSFAEYQLSEKMAKTPENVMTFLKKNLKDIEEDVISELRTLIK
                     FKVENSDKLSDEQVIEMVKPWDRDYLTTLYLSSKRSSNTEDISQYLSVGVVLQGLSDL
                     FQSIYGIQFKAVPLKPGEAWHNGVRKFHVTSETEGFVGIIYLDLFHRESKTLNPAHFT
                     VCCSRKIYPEELDENDPFKVEIPGKEGQLVQVSTAPDGTTSQLPVISLVCSFNQEEGG
                     VSLLSLSQVETLFHEMGHAMHSMLGKTKLHNVSGTRCATDFVELPSILMEHFANDTRV
                     LMSFAKHYRTNEPLPLKLLQNYSCFNSFLNNCETFGQIKMAILDQVLHSNVVFDKDFD
                     SIDLYHKLETQLKIFADTESKWPGKFGHLFSYGAVYYSYLFDRAIAKKIWEHLFAKDP
                     LSRENGEKFRNKVLKWGGSRDPWELVADVLDEPELKKGDIKAMEFIGRR"
     gene            complement(<805214..>807100)
                     /locus_tag="PAS_chr2-1_0436"
                     /db_xref="GeneID:8198904"
     mRNA            complement(<805214..>807100)
                     /locus_tag="PAS_chr2-1_0436"
                     /product="Putative RNA binding protein"
                     /transcript_id="XM_002491299.1"
                     /db_xref="GeneID:8198904"
     CDS             complement(805214..807100)
                     /locus_tag="PAS_chr2-1_0436"
                     /codon_start=1
                     /product="Putative RNA binding protein"
                     /protein_id="XP_002491344.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0436"
                     /db_xref="EnsemblGenomes-Tr:CAY69064"
                     /db_xref="GeneID:8198904"
                     /db_xref="GOA:C4R0P0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018835"
                     /db_xref="UniProtKB/TrEMBL:C4R0P0"
                     /translation="MKNFSYTSQPGTPLDYNYGRSMLPSHLLTPFLATPVLPSQPSTP
                     YIDQHMSNLDQKYLTEHYQLLHEVNHSRSLLFEKLPKELSLKEFLDAFKSSQFLENVK
                     IKEDSGEGTSVLVQFVNDESALVFLQNFDWRDFVSSTGFDNLKISWCFNNSSDDYLVD
                     GTYMDRILNLNATRSLAVRTLTQNKTGDQLYDLVISILKADLPEAIPLIVDYQYRYET
                     IQINFSNISTSIEVFELLNDTHQKLLLLSSFCSDPCLFHHQMTTPQISSNAPPINSSY
                     SNLQNRTIYLGGLHPDTTVESVCNVVKGGILQNVKLIPEKRICFVTFIDAFAAEQFYM
                     NSQLRGLTIKQKRVRVGWGRPIGPVPNNIPLAVTAGASRNIYISESKTKKTQSLPSAD
                     ILRHDFEYFGELEQINFFNGDKCVFLNFCNIAAAIELIDCLNLFKNKNLDPENPAFSL
                     LSKYEEFKINFAKDRCGNLPKEIKRDRKPHHRSKDGKEPHEPKNHHNSQSDPPKASES
                     ASPEQIQDVQEIFASMGISTNGRPATAPISAQQKTDEEKSQSPPSGLSSISPTSSSTS
                     KPTTASGGAVNFKDQQRPGRTYAMSGSQIMAQYLASVQHNNIYYANAVLNVESERNSE
                     DDYN"
     gene            complement(<807591..>808592)
                     /locus_tag="PAS_chr2-1_0437"
                     /db_xref="GeneID:8198905"
     mRNA            complement(<807591..>808592)
                     /locus_tag="PAS_chr2-1_0437"
                     /product="Glyceraldehyde-3-phosphate dehydrogenase,
                     isozyme 3, involved in glycolysis and gluconeogenesis"
                     /transcript_id="XM_002491300.1"
                     /db_xref="GeneID:8198905"
     CDS             complement(807591..808592)
                     /locus_tag="PAS_chr2-1_0437"
                     /codon_start=1
                     /product="Glyceraldehyde-3-phosphate dehydrogenase,
                     isozyme 3, involved in glycolysis and gluconeogenesis"
                     /protein_id="XP_002491345.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0437"
                     /db_xref="EnsemblGenomes-Tr:CAY69065"
                     /db_xref="GeneID:8198905"
                     /db_xref="GOA:C4R0P1"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:C4R0P1"
                     /translation="MAITVGINGFGRIGRLVLRVALSRADIKVVAINDPFIAPEYAAY
                     MFKYDSTHKAYKGEVSASGNKINIDGNEITVFQERDPVNIPWGKAGVDYVIESTGVFT
                     TLEGAQKHIDAGAKKVVITAPSKDAPMFVVGVNEEKYTSDLNIVSNASCTTNCLAPLA
                     KVVNDTFGIESGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGK
                     VIPELNGKLTGLAFRVPTVDVSVVDLTVNLKKETTYEEIKSVIKAASEGKLKGVLGYT
                     EDAVVSSDFLGDERSSIFDASAGIQLTPSFVKLISWYDNEYGYSTRVVDLLQHVAKA"
     gene            <810169..>812562
                     /locus_tag="PAS_chr2-1_0439"
                     /db_xref="GeneID:8198906"
     mRNA            <810169..>812562
                     /locus_tag="PAS_chr2-1_0439"
                     /product="DNA helicase involved in telomere formation and
                     elongation"
                     /transcript_id="XM_002491301.1"
                     /db_xref="GeneID:8198906"
     CDS             810169..812562
                     /locus_tag="PAS_chr2-1_0439"
                     /codon_start=1
                     /product="DNA helicase involved in telomere formation and
                     elongation"
                     /protein_id="XP_002491346.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0439"
                     /db_xref="EnsemblGenomes-Tr:CAY69066"
                     /db_xref="GeneID:8198906"
                     /db_xref="GOA:C4R0P2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010285"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0P2"
                     /translation="MRRMSVLGRPVLSQADIEALEVSFTDDDKSEPSFDIDDDDLILL
                     TLKNVHRSPLRKEQALHPSILETQRSEKITITQTPSPDWHLFETTCIKKRKIHFPDPV
                     SFDIEAQISTFSSSPIKADKKNNKVIEKQLTEPASKESPVIDLTSNEDKPELTTSTQK
                     PSTPPRSTSAPVVTTSIGVRNIHTVTASNAQPLNSRIHLLTQIPKRPDVFQFTQKDSQ
                     EIDDAQPKLVKPLVLSLEQEKVIQLAKQGLGIFYTGSAGTGKSVLLRNLIKELKEIHP
                     QGTVGVAASTGLAACNIGGQTLHSFTGIGLGDADVTKLLTKIRRNKKVRSRWLDLEVL
                     IIDEISMIDGNLLDKLNLIAQRLRKNKKPFGGIQLIVCGDFYQLPPVSKTQSAKFAFE
                     ADCWDEVVPITLKLSKIFRQRGDLEFIDMLNEVRNGRISPRVEAEFQKLNRPLPVDQG
                     ITPTELYPTREEVERSNKRRLDSIPNEPLIFKSYDTGSLKDEEQIQHMLSNFMAPKTL
                     TLKKGAQVMMIKNVDATLVNGSVGKVLDFIDPDTYLFYKKVSGENSELELDTIEQEIE
                     AKILSNGKKLDASLKPSEKLISNASNLAKLDLDDSVFSFMKCIKSKKKTVSEDLRRKL
                     ELINTLYKNSSGRRLPLVRFLTTDGETRDVLVEPEQFSINDIDEKPLASRVQLPLILA
                     WSLSIHKSQGQTLNHARIDLRRVFEAGQAYVALSRATSRKGIQVLNFNKEKIRTNPQV
                     EMFYQKIYTVDDAVEKAKIQQKQKPLDDASAHNEAKENSNYERMAPNDIIKHLTRRR"
     gene            complement(<812607..>815135)
                     /locus_tag="PAS_chr2-1_0440"
                     /db_xref="GeneID:8198907"
     mRNA            complement(<812607..>815135)
                     /locus_tag="PAS_chr2-1_0440"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491302.1"
                     /db_xref="GeneID:8198907"
     CDS             complement(812607..815135)
                     /locus_tag="PAS_chr2-1_0440"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491347.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0440"
                     /db_xref="EnsemblGenomes-Tr:CAY69067"
                     /db_xref="GeneID:8198907"
                     /db_xref="InterPro:IPR013244"
                     /db_xref="UniProtKB/TrEMBL:C4R0P3"
                     /translation="MLDTSEHSPLFESSIPIAYYSLLRSVVPTMITNQVYLLIGLLAS
                     EGKTLQLKSLVDLIADFVYFKTKEIEELSKQGYPHDRILDLTLYNVTSLLLVFLPDHL
                     DPHLLTFILDLLDGYKPEDVVVSDDTSGTKLELELEETLERFQASHPDYQTYLNLDPS
                     TISNRATKLCKQVTKKSMALSYSSSLDPTKLTVSFIKARTIKVNEVIPDLTFNFPLFV
                     DEVSDWRINYVQVAHKLFPYLSPDMTLSKWNTLTIRTQLKLIYDCINQDSAEKVTHEI
                     LLPYITYINCWGEYIEFLQTVFEQTLQDSQLLASNLSKLKTNDFEVLKVFQQNDSNCY
                     NRLVSLIIGTGYLTSSVDLSLCLMFKEILSFILNVSDDNTVSTNSADETIELNDWKEK
                     NLSEVIKFSTMVPTKNNILKLRTLLECCEKLYASNLSVFQLLNLQFTSDSQIQLLELN
                     KFLANEIQYCSSERDWTSLLNTLNWFLNDTQIFSQVSKEEVNILFFKLFFSQSHDYHV
                     FFRLIIPQLVGVHEFNKNPKYASIILEHAWSLYGAASNINHLKTLLSHFHDPSIVTNP
                     DIIPKNTNNVSQNSQLQSLISAFESISQRFHLSFSRNFQPKNLLLLNNGEDPIHVIVR
                     ILESEESSYKDPGYLVDIYENLIIGFSDSSESSQLLKAQFADLQILVQLKCIEFSLVR
                     NDFNYSYQHGLELLDSPSSIIQQNWIVFFQISKYIDEDSSENSKILIEKQLSILGKLL
                     LHVPTEFNVPIVEQWSLLNKDLERIKGDLKLRNKRVVRESNARANESLESRFTRALTS
                     SATEVLKNQTAQNLKVDLGQAQDKFSNMLVNGLGWAIGATPNNR"
     gene            <815178..>815870
                     /locus_tag="PAS_chr2-1_0441"
                     /db_xref="GeneID:8198908"
     mRNA            <815178..>815870
                     /locus_tag="PAS_chr2-1_0441"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491303.1"
                     /db_xref="GeneID:8198908"
     CDS             815178..815870
                     /locus_tag="PAS_chr2-1_0441"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491348.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0441"
                     /db_xref="EnsemblGenomes-Tr:CAY69068"
                     /db_xref="GeneID:8198908"
                     /db_xref="UniProtKB/TrEMBL:C4R0P4"
                     /translation="MSTEEAGIRTQAQLLDTELNKYMSTRTQVWDLANVVKLGNKLTE
                     DQIQKIQSLKADINRSEAFLKLNLRSQQLEFRTIYEQNKDVEEIVNEKLQSKLSEIEA
                     QNAKLQSQVDTVSELIDKRNQITDLLNLFISGNQDLELSKDELEKTFQGYDMEPVYKM
                     AKRSGKIYRFRKLHLKESVQQLNAKIKDKEAQIQKLKANIREKKARWDRLSKIIASNL
                     ESLKEDLVTELR"
     gene            complement(<815920..>816783)
                     /locus_tag="PAS_chr2-1_0442"
                     /db_xref="GeneID:8198909"
     mRNA            complement(<815920..>816783)
                     /locus_tag="PAS_chr2-1_0442"
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /transcript_id="XM_002491304.1"
                     /db_xref="GeneID:8198909"
     CDS             complement(815920..816783)
                     /locus_tag="PAS_chr2-1_0442"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /protein_id="XP_002491349.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0442"
                     /db_xref="EnsemblGenomes-Tr:CAY69069"
                     /db_xref="GeneID:8198909"
                     /db_xref="GOA:C4R0P5"
                     /db_xref="InterPro:IPR010729"
                     /db_xref="UniProtKB/TrEMBL:C4R0P5"
                     /translation="MNRSTVARFSTTSMAAARNRLPTNIKLRRPIPPTIDNITVPENH
                     PLWQFFDNKNFLRKPQEIQTTGRPWTIQELRRKKFDDLHKLWYVCLKERNVLGREHRL
                     LESVDSQSAIIYEEQSEQIRTTMWRIKHVLRERQLAETKSREKLLKSSELQDYLQDFK
                     QEYLDSQDVETQEWYDKLERLQYAIFGIPNYLSADTVVDEHFLEGVKFIGELKFAKFS
                     ESVPELQDLGKLSSIVENYALFEETSNKEGVTLAVKRIEEYRANDIQIPQEKELEVIQ
                     ELVRDRLEVAE"
     gene            <817104..>817610
                     /locus_tag="PAS_chr2-1_0443"
                     /db_xref="GeneID:8198910"
     mRNA            <817104..>817610
                     /locus_tag="PAS_chr2-1_0443"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491305.1"
                     /db_xref="GeneID:8198910"
     CDS             817104..817610
                     /locus_tag="PAS_chr2-1_0443"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491350.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0443"
                     /db_xref="EnsemblGenomes-Tr:CAY69070"
                     /db_xref="GeneID:8198910"
                     /db_xref="GOA:C4R0P6"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:C4R0P6"
                     /translation="MLRLIRLSSSLPKVNIPKANKMPARPTIAEGDIKEKFIKGGSGK
                     GGQKINKTNSKVQLTHIATGIVVTSQATRSREQNRKIAREILALKLQDLEDPANSRQR
                     IVIERQKMVKARKNKRTKAKYETLEKNKQEKEDLLEGIDEIVFIDENSEPIQIDTKQS
                     KQKLLKQL"
     gene            complement(<817636..>819201)
                     /locus_tag="PAS_chr2-1_0444"
                     /db_xref="GeneID:8198911"
     mRNA            complement(<817636..>819201)
                     /locus_tag="PAS_chr2-1_0444"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491306.1"
                     /db_xref="GeneID:8198911"
     CDS             complement(817636..819201)
                     /locus_tag="PAS_chr2-1_0444"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491351.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0444"
                     /db_xref="EnsemblGenomes-Tr:CAY69071"
                     /db_xref="GeneID:8198911"
                     /db_xref="GOA:C4R0P7"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="InterPro:IPR021661"
                     /db_xref="UniProtKB/TrEMBL:C4R0P7"
                     /translation="MNNFEDIQVNQVTPPIAHNRKTEAIFVTPIGTPYKFFLVGKDDS
                     GKEVEAVYKERITQHGGTLIDSTDDPLTLFLAESQEILNRNLQTVPNNRQVYRLSFID
                     DCITEGIVLPLENYTLLVDTNAQVYKMTPVRSYFTKEEDNIIAETYRLLIPTHRPVEI
                     NTHIHKKYLPHRTVYSIKSRYNEKIRKSLKYYYQSDPDSKELLRDVEGNYVRVYINDA
                     DASTADDKTSEEPLTSSTLPGRVRYSAKDDFQLCSQILKYNVRESNINDVNDEDLKVN
                     SSIFQELADSFPHHSKKSWSERYAKWVSAYGVGSYYRYYQARLENHEVPEPVSNLVLE
                     KGKYAASTALRQVRNIDSDDEVLHDVLVNAKKRKHSSSVIPISSTTSKSDLSRVFLQS
                     LQRDSPPIDPEKIEKIGKDAYTKLLKDVLAEVKIFDSHQEWKSTFKNALGVKDYYLTF
                     LLDVTSGNLKLIVQIISNYLEDNTQYLTNFPGVFLPRHDIILLANENKDEIDQLIKYH
                     SLENVEKRRKYLF"
     gene            <820142..>822631
                     /locus_tag="PAS_chr2-1_0445"
                     /db_xref="GeneID:8198912"
     mRNA            <820142..>822631
                     /locus_tag="PAS_chr2-1_0445"
                     /product="Zinc-cluster protein"
                     /transcript_id="XM_002491307.1"
                     /db_xref="GeneID:8198912"
     CDS             820142..822631
                     /locus_tag="PAS_chr2-1_0445"
                     /codon_start=1
                     /product="Zinc-cluster protein"
                     /protein_id="XP_002491352.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0445"
                     /db_xref="EnsemblGenomes-Tr:CAY69072"
                     /db_xref="GeneID:8198912"
                     /db_xref="GOA:C4R0P8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R0P8"
                     /translation="MPKATKKSIKKELEVPDVVIKDKKGRSTSCYLCQRRKQKCDHRL
                     PACTACLKAKVKCIQPAKYGGKCPEKDEYTVWLEKRLQFLESVVDANDSIKRTVIPTG
                     PWTQSSSLVPINGSNNAENGVSNGIAAGITAASVGNTTSEFQLPLPTTSAMSALSSKV
                     DRNHLKILNLDSFENQSEADFIKRYNLQEFLKHDPVFQIDEHISRQLFDIFFTLLQYK
                     FPILDETEVFEFHNAYFSNNLKGYMNNISYFYFCLARMFLVCAISALLHKTTGRYHGT
                     RPASFFSAALKYAAKCQKSISKLHRVELLILLVFYLIRTDKDSTGLFDVIRDAMSVCM
                     ELKLHKKESYVGIPINVKDRQLRCFWSAYLLEKVITLSLSKPYVLNESEMDSDIPMFD
                     DSLSKGNNFLNQFIKIRRLEARFVEQLDIINTKSSPKSTQLAKVEQYFQELQQWRREC
                     QGFSKGIENETLQSYYYRSVRTLIQPFLELLDPEDRLFQECQAAAAQICQSFKTYHQK
                     TVSGHSTIHVHTTFIAGVTLIYCLWLARNTDDMRRKLLGDDSKHTRPTISAALFQHMD
                     DLRACSISLYVMAERTKFALSFRDTFEEIMAATIGNLKIRCGPDSSEIIYNKEPGMPP
                     AVVRKPPKHYTSTTELDIKATDAEELEEKARKEKRGQLQRNAIPKGLSHLLVDPVPMK
                     SQNSSGKSSNSLLNNNIDNNHAGTNGSSTFLAGSSSNNGNTNVVVDNSINGSSFLSLP
                     QTEFTPFVGRTNTMISNISVWTGESGQFVPNSMNQSLTQQGLSNDFTKTSSFTHNTTN
                     NNGTTNSNVDFLQSWGNVRMDELFNVNEFVP"
     gene            complement(<822641..>823381)
                     /locus_tag="PAS_chr2-1_0446"
                     /db_xref="GeneID:8198913"
     mRNA            complement(<822641..>823381)
                     /locus_tag="PAS_chr2-1_0446"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491308.1"
                     /db_xref="GeneID:8198913"
     CDS             complement(822641..823381)
                     /locus_tag="PAS_chr2-1_0446"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491353.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0446"
                     /db_xref="EnsemblGenomes-Tr:CAY69073"
                     /db_xref="GeneID:8198913"
                     /db_xref="UniProtKB/TrEMBL:C4R0P9"
                     /translation="MDIFSARISIQWGNDEPIEKTSTWVIQTAGGRFVDLRPFLPGYV
                     DETKFPMEFCNFGSTIELEGSKKQFTQELSLAKFVDGKYVENDGGLPDIGEFEELPNG
                     DFKEVGEMANPDRNNKIEPYIEIWRDLDPYKDGPQVEKLDPKSAPNVHFSYCFDLSSE
                     GVKGRFVRIGNWFQGLLGHLNNPKRTDSPPLSAIRGYYDTNGDVKILLSVGENTDDFP
                     IKNYKPSQLTVNKSQPVNQLIWKCVELN"
     gene            complement(<823510..>826932)
                     /locus_tag="PAS_chr2-1_0447"
                     /db_xref="GeneID:8198914"
     mRNA            complement(<823510..>826932)
                     /locus_tag="PAS_chr2-1_0447"
                     /product="RING finger protein involved in proteolytic
                     control of sumoylated substrates"
                     /transcript_id="XM_002491309.1"
                     /db_xref="GeneID:8198914"
     CDS             complement(823510..826932)
                     /locus_tag="PAS_chr2-1_0447"
                     /codon_start=1
                     /product="RING finger protein involved in proteolytic
                     control of sumoylated substrates"
                     /protein_id="XP_002491354.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0447"
                     /db_xref="EnsemblGenomes-Tr:CAY69074"
                     /db_xref="GeneID:8198914"
                     /db_xref="GOA:C4R0Q0"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q0"
                     /translation="MTDSVNSDDSDLEIIEVTEPTPKVDLLAPNPAFNFTAPISNSNG
                     TTPIRRKLDDQSNSNSFARLESLRESSVKPQASTFNSSRFIPQADQFSNNQNNELDNN
                     NGFADWISKSQPEFPFPLNDGPKKSSNQPTNSNFEEIIDLTEDIEINTSVPASTSSST
                     PVPSSTQNQSHHIANNNTAQDAHIFQGKRPLQSYSDDEDEDLQIVGSNIVQQPLGIMP
                     GTFNAPANILHFDGSNQNEQARWLDLRIKDLLDNLHNLRVHAQSNIMEINRFISTLGH
                     LNREVSELNLRYQSIVNNPQATANNQGYLTQLLNRIQELTNEKAHIFREMDTSKIKQQ
                     EIHRRIHALSSTIDKLKKDRELIFRNAQNAFHGDMKNEVLEGQSFMDAIHRANSLGYA
                     SNIYSRSDEDAGSLQRLLENIQPDMEDKDDDELAKTPKEFNIQLLKHQRVGLDWLLRM
                     EKSTNKGGILADAMGLGKTIQAISIIYANKWKTQEEAEEEAKLEEKVRSEKSTSETNG
                     EVSKTSTAKSEKKPIQGDEGYFKTTLIIAPVSLLHQWESEILLKTKPEYRLKVFIYHK
                     QKMSSFEELQQYDIVLTSYGTLSSQMKKHFEEAIKEADLQPNSSSIPAEDSGGISFKS
                     PFFAKETKFLRVILDEAHKIKGKNTITSKAVALVKSKYRWCLTGTPLQNKIEELWPLL
                     RFLRIKPYYDEKRFRTGIVLPIKSSMSGKYDSTDKKIAMRKLHALLKAILLKRNKDSK
                     IDGEPILKLPKKHIIDTFIEMEAKELDFYKDLEGQTAKKAEKMLNAGKGQGNHYSGIL
                     ILLLRLRQTCCHHFLVKLSEMKQEAKLKQEVATKMPQLATQLSPAVVRRINIEAEAGF
                     TCPICLDNIINENACILYKCGHVVCQDCKDDFFTNYQENETDDGLRVSKCVTCRLPVN
                     ESNVISFPVYDKIVNQHISVMDIVKSESPVLSKIEMIQQLIRENKGVFESSAKIDKAV
                     EMIQELLRDNPGEKIIVFSQFTTLFDVIEVILKENNIKFIRYDGSMSLSNRDAAIQEF
                     YESTEKNVMLLSLKAGNVGLTLTCASRVIIMDPFWNPYVEDQAMDRAHRIGQLREVFV
                     YRMLIKNTVEDRILTIQNTKREIVENALDNQSLNTISKLGRNELAFLFGIGN"
     gene            complement(<827202..>827789)
                     /locus_tag="PAS_chr2-1_0448"
                     /db_xref="GeneID:8198915"
     mRNA            complement(<827202..>827789)
                     /locus_tag="PAS_chr2-1_0448"
                     /product="Non-essential subunit of Sec63 complex (Sec63p,
                     Sec62p, Sec66p and Sec72p)"
                     /transcript_id="XM_002491310.1"
                     /db_xref="GeneID:8198915"
     CDS             complement(827202..827789)
                     /locus_tag="PAS_chr2-1_0448"
                     /codon_start=1
                     /product="Non-essential subunit of Sec63 complex (Sec63p,
                     Sec62p, Sec66p and Sec72p)"
                     /protein_id="XP_002491355.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0448"
                     /db_xref="EnsemblGenomes-Tr:CAY69075"
                     /db_xref="GeneID:8198915"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q1"
                     /translation="MLPFSYDVSSKKLKVTGDYADLEYDIQQLNTLSGEILANKADVP
                     SPPSKESFDKKLSHMAQKLHESAVSNIKTGKYPEAIKLLTTGLEMVNRRPKYESFQMT
                     LSEMTIFIVTRADAYMMNGDFEGAFNDADLLVTLLPSIPDNYIRRGVALFKMGRYVDA
                     KNNFERGLSFDPDNAKLKKELDFVLKKIDEENGEL"
     gene            complement(<827978..>828696)
                     /locus_tag="PAS_chr2-1_0449"
                     /db_xref="GeneID:8198916"
     mRNA            complement(join(<827978..828562,828640..>828696))
                     /locus_tag="PAS_chr2-1_0449"
                     /product="GTP binding protein (mammalian Ranp homolog)"
                     /transcript_id="XM_002491311.1"
                     /db_xref="GeneID:8198916"
     CDS             complement(join(827978..828562,828640..828696))
                     /locus_tag="PAS_chr2-1_0449"
                     /codon_start=1
                     /product="GTP binding protein (mammalian Ranp homolog)"
                     /protein_id="XP_002491356.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0449"
                     /db_xref="EnsemblGenomes-Tr:CAY69076"
                     /db_xref="GeneID:8198916"
                     /db_xref="GOA:C4R0Q2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR002041"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q2"
                     /translation="MSTEPTFKLVLVGDGGTGKTTFVKRHLTGEFRKKYIATLGVEVH
                     PLSFHTNCGPITFNVWDTAGQEKFGGLRDGYYINGDCGIIMFDVTSRITYKNVPNWHR
                     DLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYFDISAKSNYNFEKPFLWL
                     ARKLSGEPQLEFVAAPDLQAPEVQIDADLIKKYEQENAEAAAMPLPDEDDADL"
     gene            complement(<828847..>829334)
                     /locus_tag="PAS_chr2-1_0450"
                     /db_xref="GeneID:8198917"
     mRNA            complement(join(<828847..829097,829163..829249,
                     829304..>829334))
                     /locus_tag="PAS_chr2-1_0450"
                     /product="Component of the U1 snRNP complex required for
                     pre-mRNA splicing"
                     /transcript_id="XM_002491312.1"
                     /db_xref="GeneID:8198917"
     CDS             complement(join(828847..829097,829163..829249,
                     829304..829334))
                     /locus_tag="PAS_chr2-1_0450"
                     /codon_start=1
                     /product="Component of the U1 snRNP complex required for
                     pre-mRNA splicing"
                     /protein_id="XP_002491357.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0450"
                     /db_xref="EnsemblGenomes-Tr:CAY69077"
                     /db_xref="GeneID:8198917"
                     /db_xref="GOA:C4R0Q3"
                     /db_xref="InterPro:IPR000690"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR013085"
                     /db_xref="InterPro:IPR017340"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q3"
                     /translation="MAKYYCEYCNSYLTHDSLSVRKSHLIGRNHLRKYCDYYEEKAKE
                     LGIWDSNDLPYEITESDLYANIPGRPLSLETPLETFPPPPSLPNLPNPPPAIYHYNTT
                     EEKELISSVMREYQHRNTVK"
     gene            <829439..>829964
                     /locus_tag="PAS_chr2-1_0451"
                     /db_xref="GeneID:8198918"
     mRNA            join(<829439..829541,829702..>829964)
                     /locus_tag="PAS_chr2-1_0451"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491313.1"
                     /db_xref="GeneID:8198918"
     CDS             join(829439..829541,829702..829964)
                     /locus_tag="PAS_chr2-1_0451"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491358.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0451"
                     /db_xref="EnsemblGenomes-Tr:CAY69078"
                     /db_xref="GeneID:8198918"
                     /db_xref="InterPro:IPR019711"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q4"
                     /translation="MSKSRRNHLNQPLDTHTMFAVIRSSVSLAFTTQFDLISDLYVKE
                     LKGFKPTPLSAADAEGATKPWAKPASPKVPSLEGETAEALQQYETSDVETVQAASSES
                     ASEVTEDWFVFPEEETAHH"
     gene            <830337..>831479
                     /locus_tag="PAS_chr2-1_0452"
                     /db_xref="GeneID:8198919"
     mRNA            <830337..>831479
                     /locus_tag="PAS_chr2-1_0452"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491314.1"
                     /db_xref="GeneID:8198919"
     CDS             830337..831479
                     /locus_tag="PAS_chr2-1_0452"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491359.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0452"
                     /db_xref="EnsemblGenomes-Tr:CAY69079"
                     /db_xref="GeneID:8198919"
                     /db_xref="InterPro:IPR021622"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q5"
                     /translation="MSGLSVYKELNQSLINRGYLSEGVIFEDENTVRNQKVAQVIERL
                     LDSIDNNRTIRDDLLLREKDHLQVIDSLKTDQSLLKKRISTLEAKSTSQERHINQLTA
                     QIDELTSSVQTNIKQHNKTKSQLQTVLQSSNAEFRRKDLQIDQLQEKLVAKQLGIKGK
                     VFSLYSLPIMPDDQPKKRQKIAESSTETQKLTPVERFPVAQKETMTLLSDLYDIIYSL
                     IQDNNSKTRYLTIYNNFIKNLVRFISKIANYDGKISYDLREEYAQLTSMEINSPPGSA
                     STVHETKEELVKSLQLSKTESENILRQFSSQMNELYNSLGNAFELNELSADSEVASRN
                     GLKQQLHERETQIESLRKELESVTHNWKAAIETMEKWKKYRTKKGI"
     gene            complement(<831497..>832984)
                     /locus_tag="PAS_chr2-1_0453"
                     /db_xref="GeneID:8198920"
     mRNA            complement(<831497..>832984)
                     /locus_tag="PAS_chr2-1_0453"
                     /product="Cytoplasmic aldehyde dehydrogenase, involved in
                     ethanol oxidation and beta-alanine biosynthesis"
                     /transcript_id="XM_002491315.1"
                     /db_xref="GeneID:8198920"
     CDS             complement(831497..832984)
                     /locus_tag="PAS_chr2-1_0453"
                     /codon_start=1
                     /product="Cytoplasmic aldehyde dehydrogenase, involved in
                     ethanol oxidation and beta-alanine biosynthesis"
                     /protein_id="XP_002491360.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0453"
                     /db_xref="EnsemblGenomes-Tr:CAY69080"
                     /db_xref="GeneID:8198920"
                     /db_xref="GOA:C4R0Q6"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q6"
                     /translation="MASPLSKSIAFPTGQKYDQPIGLYINGEWRESKDTIDVINPSNG
                     EVITSVYAAQESDVDNAVSSARKAFKTWKKLAGEERATLMNRLADLLEKNAETVAGIE
                     ALDAGKPQFSNALPDIEGSVSILRYCAGWADKIYGNVIPSGPDKLLTSKRIPYGVVSQ
                     IVPWNYPLNMAMWKIAPALCAGNCIVIKSSESSPLSLLYFAELVNDAGFPPGVLNIIS
                     GLGSVAGARMASHPDVDKIAFTGSTKTGKEIQKLASSNLKTVTLECGGKSPLIVFDDA
                     KLDQAIYWAAFGIMYNTGQICTANSRVLVQDTIYDEFIQKFKAHVQENWFIGSPFDKK
                     STMGPVINKSQFEKVKGYIQKGKDEGAKLVIGDEPVTFESGYWIHPTIFVDCTQDMSI
                     VKDEIFGPVVAISKFHSQEEAIELANDTEYGLAAMVFSKDIVTANTVASQLEAGTVYI
                     NSSNDDNIRVPFGGFKMSGTGSELGMEGVLAYTKIQAIHTNLTRD"
     gene            complement(<833240..>834484)
                     /locus_tag="PAS_chr2-1_0454"
                     /db_xref="GeneID:8198921"
     mRNA            complement(<833240..>834484)
                     /locus_tag="PAS_chr2-1_0454"
                     /product="Major exo-1,3-beta-glucanase of the cell wall,
                     involved in cell wall beta-glucan assembly"
                     /transcript_id="XM_002491316.1"
                     /db_xref="GeneID:8198921"
     CDS             complement(833240..834484)
                     /locus_tag="PAS_chr2-1_0454"
                     /codon_start=1
                     /product="Major exo-1,3-beta-glucanase of the cell wall,
                     involved in cell wall beta-glucan assembly"
                     /protein_id="XP_002491361.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0454"
                     /db_xref="EnsemblGenomes-Tr:CAY69081"
                     /db_xref="GeneID:8198921"
                     /db_xref="GOA:C4R0Q7"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q7"
                     /translation="MNLYLITLLFASLCSAITLPKRDIIWDYSSEKIMGVNLGGWLVL
                     EPYITPSLFEAFGDDVPVDEYRYTERLGKSLALDRLQQHWSTFYDEKDFQDIAAYGLN
                     FVRIPIGYWAFQLLDDDPYVQGQEEYLDKALEWSRKHGLKVWIDLHGAPGSQNGFDNS
                     GKRDSWDFQNGNNVQVTLDVLKYISKKYGTTDYYDVVIGIQLLNEPLGPILDMDNLRQ
                     FYADGYDLVRDVGNNFVVIHDAFYQAPEYWGDDFTSAEGYWNVVLDHHHYQVFDADEL
                     QRSIDEHIEAACDWGRDANKEYHWNLCGEWSAALTDCTPWLNGVGKGTRYEGQLDNSP
                     WIGSCENSQDPSKLSSERICEYRRYVEAQLDAFLHGKSAGFIFWCFKTEASLEWDFKR
                     LVNAGIMPQPLDDRQYPNQCGF"
     gene            <836411..>837700
                     /locus_tag="PAS_chr2-1_0455"
                     /db_xref="GeneID:8198922"
     mRNA            <836411..>837700
                     /locus_tag="PAS_chr2-1_0455"
                     /product="Protein required for assembly of U2 snRNP into
                     the spliceosome, forms a complex with Hsh49p and Hsh1"
                     /transcript_id="XM_002491317.1"
                     /db_xref="GeneID:8198922"
     CDS             836411..837700
                     /locus_tag="PAS_chr2-1_0455"
                     /codon_start=1
                     /product="Protein required for assembly of U2 snRNP into
                     the spliceosome, forms a complex with Hsh49p and Hsh1"
                     /protein_id="XP_002491362.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0455"
                     /db_xref="EnsemblGenomes-Tr:CAY69082"
                     /db_xref="GeneID:8198922"
                     /db_xref="GOA:C4R0Q8"
                     /db_xref="InterPro:IPR006568"
                     /db_xref="InterPro:IPR007180"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q8"
                     /translation="MAKRSKNQQRRLRAKLRKTKGVPDQENGFSVKKSDSSEPIPVSD
                     DNDEVTIAQPDTGGLEGPLAQEFQNIFAKFVPVEEKLNFEPTPLESRKEEIIYSSSSE
                     DEADSDKERTQTQTHLSKKEKKRLYGISLTELKKYAARPDLVEWYDADAEDPTLNVYL
                     KCLLRAVKVPVHWQSKRDYLSSKRGFEKPPFRLPDFIRDTGIMEMRDVSQEDESTLKQ
                     RTRDKVQPKMGKLDIDFQRLHDAFTKFQTKPPMLAFGDVYYEGRGSETFELENFVPGK
                     VSSRLRTALGIANHEKPPWVAQMAKLGPPPSYPNMDADGVFKEPLMKNLGPPIERDSW
                     GSIHPDSEEEEDNDEEEEEEEEEEEQFIPRYDKESTDYIPIKSVSNEIPTMRHDTTNE
                     TEDDSTNAPLYQVLSQKKESGGFMGEKINYELPSSKR"
     gene            <838937..>841117
                     /locus_tag="PAS_chr2-1_0456"
                     /db_xref="GeneID:8198923"
     mRNA            <838937..>841117
                     /locus_tag="PAS_chr2-1_0456"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491318.1"
                     /db_xref="GeneID:8198923"
     CDS             838937..841117
                     /locus_tag="PAS_chr2-1_0456"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491363.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0456"
                     /db_xref="EnsemblGenomes-Tr:CAY69083"
                     /db_xref="GeneID:8198923"
                     /db_xref="GOA:C4R0Q9"
                     /db_xref="InterPro:IPR000283"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006963"
                     /db_xref="InterPro:IPR010228"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR015405"
                     /db_xref="InterPro:IPR019574"
                     /db_xref="UniProtKB/TrEMBL:C4R0Q9"
                     /translation="MLSVKRSISRIPTARLFSTTRRQLKEVELTVDGVKVSIEAGSSI
                     IQAAEKAGVTIPRYCYHEKLAVAGNCRMCLVEIERSPKLAASCAMPVQNGMSVLTNTP
                     KIKKAREGVTEMLLENHPLDCPVCDQGGECDLQEQSLRYGSDRGRFHEIVGKRAVENK
                     AIGPLIKTSMNRCIHCTRCVRFLNDVAGAPEFGTAGRGNDMQIGTYVERNVNSELSAN
                     VIDLCPVGALTSKPYAFRARPWELKRTETIDVHDALGSNVRVDTRGIEVMRVLPRLND
                     EINEEWISDKTRFACDGLKTQRLTKPLIRQGNTFVDATWEEALATIAEGFQKVQPKEN
                     EIKAIVGSLTDLESIVALKDLVNKLGSENVSTDGDATTVPPAHGADFRSNYIFNSTID
                     NIEEADQILLVGTNPRHEAAVLNARIRKVWLRSDLEVHHVGEEFDSTFELNHLGSDVN
                     ALAKALTGEVGKKLSEASKPLIIIGSGVTETQDAEAVYATVAKFVTSNANIVTPEWNG
                     FNLLHREASRVGALDVGFTTQSPEVANTKAKFIYLLGADEIVNKDIPKDAFVVYQGHH
                     GDLGASFADVILPGSAYTEKTATYVNTEGRVQSTRAATNPPGVAREDWMIIRALSEYL
                     GATLPYDNLYEMRSRLADVAPHLLRHEVVEPVSEGIAKVGFQSLVKPGIQSKGVLLKN
                     PIENFYFTDVISKSSPTMAKCVGSFGSKIEKIKDEKANSYLSFA"
     gene            <841897..>843246
                     /locus_tag="PAS_chr2-1_0457"
                     /db_xref="GeneID:8198924"
     mRNA            <841897..>843246
                     /locus_tag="PAS_chr2-1_0457"
                     /product="Protein involved in ER-to-Golgi transport"
                     /transcript_id="XM_002491319.1"
                     /db_xref="GeneID:8198924"
     CDS             841897..843246
                     /locus_tag="PAS_chr2-1_0457"
                     /codon_start=1
                     /product="Protein involved in ER-to-Golgi transport"
                     /protein_id="XP_002491364.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0457"
                     /db_xref="EnsemblGenomes-Tr:CAY69084"
                     /db_xref="GeneID:8198924"
                     /db_xref="GOA:C4R0R0"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:C4R0R0"
                     /translation="MIITQNLVSYSGSSLNHDGKGNSRILLSSTNFQHRTPSEPLNGT
                     AYNHESDFVVRKTRSNSSSHSNVSFHGYNLRSLLPYVNFKLCGMCFLWYSSSVVSNNS
                     TKQILRQFSYPVTLTEFQFLLNAFFCLVTIIAVNQHDSRVYKTSSKMSKRFPPGTFPK
                     DIDSAFFTLKDSFLTIKRNILSTTIPMGMFQFLGHITGHKATSIIPVSLVHTIKALSP
                     IVTVFAYRLIFHKHYPIKTYLTLIPLVSGVMLSCLKNNLSINNDLFFQGCLFAFLSML
                     IFVSQNIFAKKALTFKENQLNGDVDSKLKGDDDTILPQYKNSENNKAEKFDKLTILFY
                     CSIIGFSLTLPLYVILESNVFVQQKTLSLLQLTPGLLFLLILNGFAHFCQSLVAFQIL
                     GMISPINYSIANIMKRITIIGFSIFWEATKLNNVQWCGLVLTIIGLYSYDKWGAVKN"
     gene            complement(<843267..>844238)
                     /locus_tag="PAS_chr2-1_0458"
                     /db_xref="GeneID:8198925"
     mRNA            complement(<843267..>844238)
                     /locus_tag="PAS_chr2-1_0458"
                     /product="Peroxin 20"
                     /transcript_id="XM_002491320.1"
                     /db_xref="GeneID:8198925"
     CDS             complement(843267..844238)
                     /locus_tag="PAS_chr2-1_0458"
                     /codon_start=1
                     /product="Peroxin 20"
                     /protein_id="XP_002491365.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0458"
                     /db_xref="EnsemblGenomes-Tr:CAY69085"
                     /db_xref="GeneID:8198925"
                     /db_xref="UniProtKB/TrEMBL:C4R0R1"
                     /translation="MFTSNGSCGPATALDNLSKRVGQDRTLENDHVARFRDQNSSQNR
                     AFRAESSFNTTAGAEFGQFQNTSVQRNYFPSAELIRKNTRFGDNWSSEFRQQQENNKW
                     VEDFGAMNLENVRMEQEQSFQTMDQRTNMQAMSSTANAWTQEFNHMQHNKEMEYEMRI
                     RETQRLVNAPAREVFSMVNQHSQQHNQNFTHNQTQLGDQSHYMTNLAFERQFETVQNE
                     IDGMDMFSDSEQVEQQKELQKEDDNNDIETTKFAEIAQQVFNQMNNVDTTVSQNTEHK
                     FKQSNFLRLMDKVAQREVEINGSGDRFIDKTGNDIRDYLPDPLSDLR"
     gene            complement(<844395..>848588)
                     /locus_tag="PAS_chr2-1_0459"
                     /db_xref="GeneID:8198926"
     mRNA            complement(<844395..>848588)
                     /locus_tag="PAS_chr2-1_0459"
                     /product="Subunit of TORC1, a rapamycin-sensitive complex
                     involved in growth control"
                     /transcript_id="XM_002491321.1"
                     /db_xref="GeneID:8198926"
     CDS             complement(844395..848588)
                     /locus_tag="PAS_chr2-1_0459"
                     /codon_start=1
                     /product="Subunit of TORC1, a rapamycin-sensitive complex
                     involved in growth control"
                     /protein_id="XP_002491366.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0459"
                     /db_xref="EnsemblGenomes-Tr:CAY69086"
                     /db_xref="GeneID:8198926"
                     /db_xref="GOA:C4R0R2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="UniProtKB/TrEMBL:C4R0R2"
                     /translation="MRHGFQDEYTSQQYMDMLANTFYIYYDDKRHETAGNPTTEEEKE
                     KNYKKYQPIVDWKIMKDRQKTVSAAIVLCLNIGVDPPDILKTQPSAKTEAWVDPLSFT
                     DNKKAIESIGRALQTQYETLSLRTRYKQSLDPCVEDVKRFCNTLRKTAKDERILFHYN
                     GHGVPQPTQSGEIWVFNRGYTQYIPISLYDLQTWLGAPCIFVYDCSSAGNIVTNFKKF
                     VQKRIDDDNDGNHDISAPSPTAAYIDCIQLAACKSSEILPMNPDLPADLFTCCLTCPI
                     EISVKWFLLQSPLKFHGYYDLLLDQNGQIQIPGKLTDRRTPLGELNWIFTAITDTIAW
                     SSLPRAVFKKLFRQDLMVAALFRNFLLAKKIMTANGCNPISDPPLPDITDHTMWDSWD
                     LAIDQVLSQLVKNHEKLSRDPTASANTLLRTEPNSVAPTPVSTTTSLSDSQDGNQTPQ
                     KPPAPAPSQSQGQIINNYQHSTFFEHHLTAFEIWLKYGSSSKDPPDQLPIVLQVLLSQ
                     VHRLRALILLSRFLDLGPWAVYLALSIGIFPYILKLLQSPAQELKPVLTFIWARIMSI
                     DHKNTQQELCKDKGYNYFIQILVAPKPTTAASGNHFLVNDVNYEEHKAMSAFILSLFV
                     KEYKPGQRLCFSSDLVGTCLYYLEKSGHPLLRQWCALFTGQLWANYPDGRWISYKDGH
                     VERLTKLLNDPIPEVRASIVISLTNFLTTLSDDEEPSTMMMGKEESNQQEVKVALSML
                     FLLADGSPIVRREVVVFFSKFVMKYIHFFIVSACGQLEEEITLIDDPSMIDEVRRRSI
                     NYGTIYSSVFKTLLIMSSDPDDGVKDYAQSLVDFIMIKLNQSPLGEIVCDMEQYLLQR
                     SSTNDTTQLKSDQASLHGLGMVSNGNQLKIHKTRDPSHSKTGSRSQSLKITSNKNSTT
                     ITPLFEGNQQNGHNQRSVSNVSTSSLTDRMSNLALNWLRNFSGASNRNIQDHDSQLAP
                     VDLSHLYLGYGIEPIPPTPRFVPLKQLSPISEPTMPLHSKFFEYSMEYFQEPQIGVND
                     VDEPGSFEYTRRLWRRNRNESIINETQPQKDLAISGDWNNNIATFNNTTQPKLLKFTQ
                     FDSYLVSADEKDNITCFNWETNEQLSRFSNNNPFGTKITDMKFINEDDNAMLLTGSSD
                     GVVRIYKNFQSMEDIRLATAWRALTDLLLTSRTTGLVSEWQQSTGSLLVSGDVKIIRI
                     WDAPRELCVVDIPARSTSSITSLTSDQVAGNIFVGGFGDGTIRVYDRRLDSRDSMVKI
                     WQNRESRGMIKNVHMQRGGHRELMSASNNMVNLWDIRLDKPIESFPHRSITASLIHEH
                     APVILTASKIVNVATTTGEHVSTIRDPSPYLSNKTAGYVSSMMLHPHRMMVATSHTQD
                     SHIQLYKCTDKLVQEHDGY"
     gene            complement(<848853..>851091)
                     /locus_tag="PAS_chr2-1_0460"
                     /db_xref="GeneID:8198687"
     mRNA            complement(join(<848853..850930,850986..>851091))
                     /locus_tag="PAS_chr2-1_0460"
                     /product="Protein serine/threonine kinase"
                     /transcript_id="XM_002491322.1"
                     /db_xref="GeneID:8198687"
     CDS             complement(join(848853..850930,850986..851091))
                     /locus_tag="PAS_chr2-1_0460"
                     /codon_start=1
                     /product="Protein serine/threonine kinase"
                     /protein_id="XP_002491367.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0460"
                     /db_xref="EnsemblGenomes-Tr:CAY69087"
                     /db_xref="GeneID:8198687"
                     /db_xref="GOA:C4R0R3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4R0R3"
                     /translation="MASNPSITPPNAKLPPGTPLTVGTHSVTVIKYISAGGFSHVYTV
                     ECSPPFEGSSIACLKRVSVPDKAQLNILRAEVDAMRRLKGHKFIVSYIDSHASRMDNG
                     VGYEVFVLMEYCANGTLIDFMNTRLHNKLKEDEVLKIMSDVSEGIAIMHSLQPPLVHR
                     DIKIENVLISSDWTYKLCDFGSASSPLRPPKNIEEFKILQDDILRHTTPQYRSPEMLD
                     LYRGHPINEKADMWALGIFLYKLCYYCTPFERFNPDHTPNYKAEEMAIVNGSFQFPDR
                     PPFSPRLKNVISKLLVSDPQKRPHIYHLLEEICKMRNVPVPIENFYKQRKRISQPDVN
                     VSKVLNLTTNVQNAPISTTSSRTSSEKRDKDPFAKLDKSRFISNSEASLKSHQHHHNK
                     HKSIGSQASKFSGPSSSSSSSSSSESVPSLPPRRTLRPVSLYASDDFSSPKILDQEKR
                     PSLEAANKIIDSVAKEQTIELSPGNKNHIDSNVDFLRGLSKSENLKSRRAQLTGEGLG
                     HSKKSSIGGLKNLLTGGRDRERQDKWSSVAPSRSRTPTHENHYASRSTSSESLDLQTE
                     ESSKSKVKRSSSIQRRIKMLLNKPEDPAPHTAEGYGKYTEAERKNNNASRADNIIRNV
                     SKSLEKAKTPPRIVPQKYSVVDPVKTAVPYSSSKKSEADNGQHHHKKPPPKPKKPEHL
                     TTSLNLSKSKKVQNNSDVWDEFDEITDKELTDLQIDFHKRFPSSL"
     gene            <851343..>852165
                     /locus_tag="PAS_chr2-1_0461"
                     /db_xref="GeneID:8198384"
     mRNA            join(<851343..851363,851422..>852165)
                     /locus_tag="PAS_chr2-1_0461"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491323.1"
                     /db_xref="GeneID:8198384"
     CDS             join(851343..851363,851422..852165)
                     /locus_tag="PAS_chr2-1_0461"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491368.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0461"
                     /db_xref="EnsemblGenomes-Tr:CAY69088"
                     /db_xref="GeneID:8198384"
                     /db_xref="InterPro:IPR019166"
                     /db_xref="UniProtKB/TrEMBL:C4R0R4"
                     /translation="MKSFRAALGVSGLSLGAFFWGTNSSVILNESKRQFYQDDASVVP
                     IPGTIVPAAGTEIEALGKNKIVNGISIRSPSPLEATFSSVRKTINDVYKQAEDKFYNV
                     STKYYETESKVASQVAQLHEKREDLLPNGIYVIVGTLAGSIFARRRNILLRAITPVAF
                     GLVTFKIFLPETFGNTVGFAWKLEQEKIPKVAETQRNVVSKAEELYKDVESTTESSRA
                     AAQSLLHKSRDYVSQVTGLNLDQKVINGDATTTKNR"
     gene            <852462..>853565
                     /locus_tag="PAS_chr2-1_0848"
                     /db_xref="GeneID:8198385"
     mRNA            <852462..>853565
                     /locus_tag="PAS_chr2-1_0848"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491324.1"
                     /db_xref="GeneID:8198385"
     CDS             852462..853565
                     /locus_tag="PAS_chr2-1_0848"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491369.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0848"
                     /db_xref="EnsemblGenomes-Tr:CAY69089"
                     /db_xref="GeneID:8198385"
                     /db_xref="UniProtKB/TrEMBL:C4R0R5"
                     /translation="MSIPGTVSGSRSSPATGTGTGMNQLLSLASSSQVNSLQDLCSAS
                     NGSAYTVINNPVSLNNPSLGRLLEYLGGNAPSSSNSVKAKLSKVLKTKKKEIQSEAEL
                     IKELNSWINVLPNKESAKLIFEYARSLEVMVKLQEEMLQKYENISLQLGYVDKRERKA
                     NALKAQRKKELRSLRQKESRTTENQTIIFYRESIECLNTSIEVVQEQYVRTINNALKG
                     SFIDFHIFLRNMSTEIKNSSIGFFKFLNDGSSRNYQRYITANDMKPALRMASTSSSIV
                     QGEKTVSPNPSPLHHNLEIKRNSNNNPTLLTLQNNSVENILKDPLVERPQARAVSSIY
                     HNLVPDLRKLSHNREKRKVPESKDSVSNDNHWL"
     gene            complement(<853636..>854826)
                     /locus_tag="PAS_chr2-1_0462"
                     /db_xref="GeneID:8198114"
     mRNA            complement(<853636..>854826)
                     /locus_tag="PAS_chr2-1_0462"
                     /product="Mitochondrial protein of the mitochondrial
                     carrier family"
                     /transcript_id="XM_002491325.1"
                     /db_xref="GeneID:8198114"
     CDS             complement(853636..854826)
                     /locus_tag="PAS_chr2-1_0462"
                     /codon_start=1
                     /product="Mitochondrial protein of the mitochondrial
                     carrier family"
                     /protein_id="XP_002491370.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0462"
                     /db_xref="EnsemblGenomes-Tr:CAY69090"
                     /db_xref="GeneID:8198114"
                     /db_xref="GOA:C4R0R6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R0R6"
                     /translation="MSMASEIAGTVEEYEVDLNTRFKAGKEGLVTNSVVASNDISLNQ
                     RMLSACVGSVLTSLVVTPFDVVRIRQQQQYLITPPAVTNAGECCRKVFWLDTVKEEAR
                     SVAINEFCVSHSCSQDVKFESTSEGLSKIIRNEGFASLYRGLSFTLLMGVPANIVYFS
                     GYEYLRDRSPFRTSSPTLNPLICGSVARVLAATCVAPLELLKTRLQSIPSSLKNNPTH
                     INANRKLFWKVLKRSGEEMSSRGLRSLFTGLQLTLWRDVPFSGIYWASYEFFSKRANF
                     WNLPSLNDDDALRQHKGLDLGVFARSFLSGSISGVIAAVITNPFDVGKTRLQISEESV
                     SSLNVRKPEKSMFQFLYSIVKAEGVRALYVGLFPRCLKVAPSCAIMISTYEMSKTLFL
                     NQKL"
     gene            complement(<854992..>856332)
                     /locus_tag="PAS_chr2-1_0463"
                     /db_xref="GeneID:8198386"
     mRNA            complement(<854992..>856332)
                     /locus_tag="PAS_chr2-1_0463"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491326.1"
                     /db_xref="GeneID:8198386"
     CDS             complement(854992..856332)
                     /locus_tag="PAS_chr2-1_0463"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491371.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0463"
                     /db_xref="EnsemblGenomes-Tr:CAY69091"
                     /db_xref="GeneID:8198386"
                     /db_xref="UniProtKB/TrEMBL:C4R0R7"
                     /translation="MVNTTGLAVGLAVGVPCLMAIVVCVALSIRASRKFKKEVKDEID
                     VDHDDVSFYGAPTDSPENSQAKELGNPVDSKTRLDENQYRRPDFLPSSRTNSEFSGLE
                     QDHSRVRSGNNYLDYYDTVVPMLPPNVNPESVSVKSSEKTESGLSFLKHGRLHSHSNE
                     KLTGPNGVSPSTGIAANGNENGSTNSNSVSSVAVDYVRRLHRNDSSGFPSTAQRVASL
                     TPEAINQNNHRYTRGNFPQSPKVQTETEPKVEIGKPLDIEPDKSTVNHTNRQSKPLSD
                     YSARNKSDESLKRPVSPNKTELKTKAFYSKNNYTQSESSDIVSYKTALSEYQRDSVVS
                     VIEPEHDLSENITAFSSHSTLNQADDTSVVTNTTNKSSAQQQKNSIAFGEPSPFDTPP
                     KKHQTFNNTPSPRQSQFMGHFDDEEPLSPQEAIDDGYTNYEKNKNKFLERYRQS"
     gene            complement(<856533..>857486)
                     /locus_tag="PAS_chr2-1_0464"
                     /db_xref="GeneID:8198387"
     mRNA            complement(<856533..>857486)
                     /locus_tag="PAS_chr2-1_0464"
                     /product="Metalloendopeptidase of the mitochondrial inner
                     membrane"
                     /transcript_id="XM_002491327.1"
                     /db_xref="GeneID:8198387"
     CDS             complement(856533..857486)
                     /locus_tag="PAS_chr2-1_0464"
                     /codon_start=1
                     /product="Metalloendopeptidase of the mitochondrial inner
                     membrane"
                     /protein_id="XP_002491372.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0464"
                     /db_xref="EnsemblGenomes-Tr:CAY69092"
                     /db_xref="GeneID:8198387"
                     /db_xref="GOA:C4R0R8"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="UniProtKB/TrEMBL:C4R0R8"
                     /translation="MFLRNIRRFATYHRFQNTTVPIWNNKRKLKYLGVAVAGTGIFVV
                     SHIEEAPITKRKRLLWINPKWETIIGEQSYSQLIAENRDKILPENHPTVIRVKKIMNK
                     IIKAGSAVAHDSQLSEDTSSLKPMANRSTTDNMNWKVHVIHDSTQPPNAFVLPGGKVF
                     VISSILPICANDDGLATVLAHEYAHQLARHTGENLSKMPFYALLNLVLFTITGSSSLN
                     RILLQTAVQMPASREMETEADYIGLMLMSQSCYDPQEAPRLWQRMAEHEKSGAARGMG
                     SVPEFLSTHPASRRRIQNMSNWLPEAERLRELHCLGQVSWW"
     gene            <857749..>858516
                     /locus_tag="PAS_chr2-1_0465"
                     /db_xref="GeneID:8198388"
     mRNA            <857749..>858516
                     /locus_tag="PAS_chr2-1_0465"
                     /product="Basic zinc-finger protein"
                     /transcript_id="XM_002491328.1"
                     /db_xref="GeneID:8198388"
     CDS             857749..858516
                     /locus_tag="PAS_chr2-1_0465"
                     /codon_start=1
                     /product="Basic zinc-finger protein"
                     /protein_id="XP_002491373.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0465"
                     /db_xref="EnsemblGenomes-Tr:CAY69093"
                     /db_xref="GeneID:8198388"
                     /db_xref="GOA:C4R0R9"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR019447"
                     /db_xref="UniProtKB/TrEMBL:C4R0R9"
                     /translation="MAKAEFGTPKYVANQMKARGLQKLRHYCQVCEKQCRDDNGFKCH
                     VQSESHTKKVQQLSLEGGDNKKRGKIAEFSSQFVKDFIHLLRSGHGDKFVGANRFYQE
                     YIQDKQHIHMNATRWSSLTVFVSYLGQEGLCRVKQDDAEGLMIAYIDRSAAAERRRKE
                     AQKQMRKHTDEELAMRQLEEKIRAKRPREEAPLVPLGAKNTGEDKRVSVSLKPATETT
                     SVKLNMKSSHKKIANVKPINVFKRKKTDQEVGNVQLG"
     gene            <858759..>860813
                     /locus_tag="PAS_chr2-1_0466"
                     /db_xref="GeneID:8198389"
     mRNA            <858759..>860813
                     /locus_tag="PAS_chr2-1_0466"
                     /product="Triacylglycerol lipase involved in
                     triacylglycerol mobilization and degradation"
                     /transcript_id="XM_002491329.1"
                     /db_xref="GeneID:8198389"
     CDS             858759..860813
                     /locus_tag="PAS_chr2-1_0466"
                     /codon_start=1
                     /product="Triacylglycerol lipase involved in
                     triacylglycerol mobilization and degradation"
                     /protein_id="XP_002491374.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0466"
                     /db_xref="EnsemblGenomes-Tr:CAY69094"
                     /db_xref="GeneID:8198389"
                     /db_xref="GOA:C4R0S0"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:C4R0S0"
                     /translation="MNLFGAVTDTLFAQRELLKSRQEPSEVHSPSRLFQVVESVASVL
                     RKIPFLKHCIGPPVEGEELIRQLLAQQKVSTSYEEWYEVSQKLDILQNLEIWKYEKEF
                     SLYDYQLVERRLAELRETINNKDYPKLLYLVRTTWSRNLGNMGNDVLYAYSHVGTKKL
                     IEEYVAECVKGLNILASEDNGLDDTHVLGTLIQTRKAIGRTALVLSGGGCFGLIHIGV
                     MATLLEQNMFPKVIAGSSAGAILASILSVQTPEETLQLLSTIATRKFEIFEENNHREG
                     ILVCLSRFLKYGTWFDNCYLQRTMQTFLGDLTFKESYNRTGRILNITVSPAAVHEQPT
                     LLNYLTAPNVLLWSAVCVSCSLPGVFPSSTILEKDPRTGEISEWNKAATVKFVDGSVH
                     NDLPIARLSEMFNVDHIIACQVNPHVVPFLKMAGDGVNTGNTFLRKSLQMVNNLASDE
                     ITHYLTIAGELGIAPNVCTKLKSVLAQQYSGDITILPDLRLTELNLLLTNPTPEFLLD
                     ASIRGARATWPQISMIQNHCSVEFELDRVIGLLRSRLVGRPVLIERNRPRSRTIAGGR
                     RSDTATSTAITTTTNTRTPFGSAHDSSFTPVYHSGYSYYLETPAPAPAPPAYTRRASA
                     YERRTATQPPSPLQSPLKSRNNSMENLVRRNSLREINALLYRDNSPKTSRKRIGGPKN
                     HK"
     gene            complement(<860910..>861195)
                     /locus_tag="PAS_chr2-1_0467"
                     /db_xref="GeneID:8198390"
     mRNA            complement(join(<860910..861122,861187..>861195))
                     /locus_tag="PAS_chr2-1_0467"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491330.1"
                     /db_xref="GeneID:8198390"
     CDS             complement(join(860910..861122,861187..861195))
                     /locus_tag="PAS_chr2-1_0467"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491375.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0467"
                     /db_xref="EnsemblGenomes-Tr:CAY69095"
                     /db_xref="GeneID:8198390"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:C4R0S1"
                     /translation="MGVIGKVVHFGADLALLSGFLAGVHRSTGLTPNIEKIGNKDAEG
                     LVKRYLDAGEWAFDSSVAYFGASDWFKRN"
     gene            <862186..>864123
                     /locus_tag="PAS_chr2-1_0468"
                     /db_xref="GeneID:8198391"
     mRNA            <862186..>864123
                     /locus_tag="PAS_chr2-1_0468"
                     /product="Catalytic (alpha) subunit of C-terminal domain
                     kinase I (CTDK-I), which phosphorylates the C-termina"
                     /transcript_id="XM_002491331.1"
                     /db_xref="GeneID:8198391"
     CDS             862186..864123
                     /locus_tag="PAS_chr2-1_0468"
                     /codon_start=1
                     /product="Catalytic (alpha) subunit of C-terminal domain
                     kinase I (CTDK-I), which phosphorylates the C-termina"
                     /protein_id="XP_002491376.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0468"
                     /db_xref="EnsemblGenomes-Tr:CAY69096"
                     /db_xref="GeneID:8198391"
                     /db_xref="GOA:C4R0S2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R0S2"
                     /translation="MSNRRERIASQDDHGEAFFDSREPRQGGFRGRGGFRNGGSKQEQ
                     QRENPRRDIENDERDLLPSFPKASNREKNGPRDFKPQNNKNKNRPRELPKHPSETFTS
                     ERERTNYARERGDGYGKPRGSRYQNTRGGRGQNYPRARDTYNQRGDNYSRESEYRERD
                     DDYSREGYRNRRTDPRNRERELDPRDREREREIDSRDRDRDSNYRGYPKGPEREASFS
                     RYSRYGGTQLPSGPKASLRDPRDRDNGVRRPNESTRPARGSTRGRGNFRGRLPTGPRS
                     AGSRYDNHSESDVDEDVFLHKKEPTQFMYNHETDQLIFERIQQVGEGTYGKVYKARNL
                     LTKNFVALKKLRLEGEKEGFPITSVREIALIQSFDHVNIVSLTEMMVEKNFIYMILPY
                     MNHDLSGILTHPTLQFTDGHRKNIFKQLLQGMEYLHSKRVIHRDIKASNILLDNDGVL
                     KITDFGLARKMKDLNKDAQSPDYTNRVITLWYRPPELLLGSTSYGREVDIWGIGCLLL
                     ELFTRKAIFQGNNEITQLQSIFNIMGTPTTASWPDMDNLPWYEMVKPRSRIVSQFADK
                     YGTVLKDPDCFHLAVQLLCMNPADRITAKEALAHPYFKSDPRTEPLTFLKELGSEWHE
                     YESKKRRRKEKEEKRKATVSK"
     gene            <864751..>865905
                     /locus_tag="PAS_chr2-1_0849"
                     /db_xref="GeneID:8198392"
     mRNA            <864751..>865905
                     /locus_tag="PAS_chr2-1_0849"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491332.1"
                     /db_xref="GeneID:8198392"
     CDS             864751..865905
                     /locus_tag="PAS_chr2-1_0849"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491377.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0849"
                     /db_xref="EnsemblGenomes-Tr:CAY69097"
                     /db_xref="GeneID:8198392"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4R0S3"
                     /translation="MESSSEWDKRRYVPQKGDPALPPQLADYSSKTTEEVMKDINRLP
                     LFMTELDETDGEGGENEGLEALKALAYEGEPDEVASNFKNQGNDCYKSKQYQDAVQYY
                     TKALEVKCDDAAINASLYLNRAACNLELKNYRRCINDCKLALLLTPDNVKAYYRSAKA
                     YLALGKLDEASELVDFALKQQEEHEVKQDTKALEILGTQIKHQKEKLEEQERQRNERE
                     NAKKAKEAALAVALTLRGYTIIHTKEPFGILQDKKITLEAETDVESQMIFPGMVLYPT
                     LDEWDFVEQISELNTPKEIIGMLMDRPPEYFAQPGHGNFQPKNLQAYMQTQGGGLVKV
                     GKNLSFKEILSSKQPIIPLMDNSLRIYVVPKQDGDFLSQWNKTKALSERM"
     gene            <866221..>868857
                     /locus_tag="PAS_chr2-1_0469"
                     /db_xref="GeneID:8198115"
     mRNA            <866221..>868857
                     /locus_tag="PAS_chr2-1_0469"
                     /product="Protein with similarity to hect domain E3
                     ubiquitin-protein ligases"
                     /transcript_id="XM_002491333.1"
                     /db_xref="GeneID:8198115"
     CDS             866221..868857
                     /locus_tag="PAS_chr2-1_0469"
                     /codon_start=1
                     /product="Protein with similarity to hect domain E3
                     ubiquitin-protein ligases"
                     /protein_id="XP_002491378.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0469"
                     /db_xref="EnsemblGenomes-Tr:CAY69098"
                     /db_xref="GeneID:8198115"
                     /db_xref="GOA:C4R0S4"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR005735"
                     /db_xref="UniProtKB/TrEMBL:C4R0S4"
                     /translation="MTGSASSGQRNWFQKLLKKNRTSTSRPESVISSRDIMHYIQEHE
                     AIIDPDCILSIEPEHCPEISNDAVEDYEESPEPEVQGDVLSNCRCCGTILKYPTFVKR
                     IKCTICDTITIVENGDPKNADRNGLNSDSGQTQLLSLEYLEEFIQNNSSPKALGVMLY
                     ESFSSFRVLNNSFRVPNYRLSHRTPGLDFPQIKRFYKRILKLPSINSYYKMLLGMSDL
                     LKRSPELEEPQNILWLLIILELPTFQHVLIHKANIPELRSVQYDILKRTIGLIANLNK
                     TPLQYLCNWLHRSPEFLIKVDLINLYITFHVTKCINYQLKPTNTTDTATHSEDENVNY
                     KDTLFKDMNATSPAQALDALPQNATMNRQDEFTSKIGLSQYGNNWHIRTGARALSIFF
                     TANSHNGKFKVPVSNFYNTLVDYVNIKEDFDAWQLNNRKMSNGASSTGDSVQSVIDYL
                     QNNTISAYYGILSNDPTQMRKLSFTFCQFPFLISLGSKISILEHEAKRKMERKAEEAF
                     INSLNQKQPFGIYFKVRVRRGLIANDSLKCIKNHTNDLQKSLKVEFVDEPGVDAGGLK
                     KEWFVLLTRELFHPNKGLFSYDETSKLAWFTISNIDHEELYYLVGVVLGLAIYNSTIL
                     DLRLPFVLFKKLLNKKPSLEDFCELYPENGGSLRKLLKLQDDEIWDNMEIYFDVTYSD
                     LLGAIKTEELVPGGSSIKVNNSNKNEYVSRYLDFYLNKVISNSFNSFYKGFYSVIGGN
                     ALSLFSPHEIQLIVLGDDNDGKKVDTEILKSVTNYNGWDSREAAVTSKQVAWFWEFFD
                     SISYKQQKKLLLFITGSDRIPATGIQNLPFKITRLKGNKERFPIAHTCFNELCIYEYP
                     DKNTMWRKLEYGMNESEGFGIK"
     gene            <869035..>869878
                     /locus_tag="PAS_chr2-1_0850"
                     /db_xref="GeneID:8198393"
     mRNA            join(<869035..869080,869280..>869878)
                     /locus_tag="PAS_chr2-1_0850"
                     /product="hypothetical protein"
                     /transcript_id="XM_002491334.1"
                     /db_xref="GeneID:8198393"
     CDS             join(869035..869080,869280..869878)
                     /locus_tag="PAS_chr2-1_0850"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002491379.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0850"
                     /db_xref="EnsemblGenomes-Tr:CAY69099"
                     /db_xref="GeneID:8198393"
                     /db_xref="GOA:C4R0S5"
                     /db_xref="InterPro:IPR004192"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR006317"
                     /db_xref="InterPro:IPR014349"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:C4R0S5"
                     /translation="MLRSLARNSVGLKSLGQARTLSSSVTALKSNYDSPDFSHYLKKD
                     RNADKTRDFTYFMVGSFGLLSAAGAKSTVESFLSTMSASADVLAMAKVEVKLANIPEG
                     KNVIVKWQGKPVFIRHRTQAEIEEANDIDISTLRDPQKDADRVKNPEWLIMLGICTHL
                     GCVPIGEAGDFGGWFCPCHGSHYDISGRIRRGPAPLNLEIPEYDFADPDTLVVG"
     gene            complement(<870048..>871679)
                     /locus_tag="PAS_chr2-1_0470"
                     /db_xref="GeneID:8198116"
     mRNA            complement(join(<870048..871290,871360..>871679))
                     /locus_tag="PAS_chr2-1_0470"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002491335.1"
                     /db_xref="GeneID:8198116"
     CDS             complement(join(870048..871290,871360..871679))
                     /locus_tag="PAS_chr2-1_0470"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002491380.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0470"
                     /db_xref="EnsemblGenomes-Tr:CAY69100"
                     /db_xref="GeneID:8198116"
                     /db_xref="InterPro:IPR018712"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R0S6"
                     /translation="MPKTIILCVDGTKNQFQTQPFTNVMKFYRMLYKEDPSTQLCYYQ
                     PGIGSVEAEFMDLQGYVRKIPVTINAEIDSMVAHRMDQHIVAAYKFLVQYYSQGDKIF
                     LFGFSRGAFTVRILAGMIEKVGLLSVGSTHMALTAWSIYRNWETCGQPKAPKDLANSL
                     AVEFKRTFSRNTVNIEFMGLWDSVNSVGVIRDRMFPFSSKADHIKHIRHAISIDERRT
                     KFKQNLFCPIPSDFAFTETADELPDSPQIDLQEIWFPGSHSDVGGGWLSDDQGHCLSN
                     IPLRWMIAQALKYGVLFSSGSVSEFDLTYPTMDSLFSYHHDPLQLIPKRYSHNLPSPH
                     HSSSTATSLLYDILEKDFAAMASSLTRFQFQRKLRQIFPNTLLLDEVPPPPVYRFDNR
                     GEDSIIRCLKWWLLELLPIGVYQNDPETNRWVRSYRPNLGKRRVLPRYARFHWSLFWR
                     LYHIEDYNPSNLTDMASTLFEILKQNSTNETGTHVNQINEFGELVPNTQINWKQFPND
                     LQLQLSATSIVI"
     gene            complement(<871761..>873980)
                     /locus_tag="PAS_chr2-1_0471"
                     /db_xref="GeneID:8198394"
     mRNA            complement(<871761..>873980)
                     /locus_tag="PAS_chr2-1_0471"
                     /product="Chloride channel localized to late-or post-Golgi
                     vesicles, involved in iron metabolism"
                     /transcript_id="XM_002491336.1"
                     /db_xref="GeneID:8198394"
     CDS             complement(871761..873980)
                     /locus_tag="PAS_chr2-1_0471"
                     /codon_start=1
                     /product="Chloride channel localized to late-or post-Golgi
                     vesicles, involved in iron metabolism"
                     /protein_id="XP_002491381.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0471"
                     /db_xref="EnsemblGenomes-Tr:CAY69101"
                     /db_xref="GeneID:8198394"
                     /db_xref="GOA:C4R0S7"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:C4R0S7"
                     /translation="MYWKNSENSRYLRSIARFDQFDTIDWINETLKSNQHRFSSWIID
                     WLCLASIGVFVGIIAGCLNIITEWLTSIKNGYCSTAWYLNREFCCMGLSHDDCPFWNP
                     WPASYLLYIGWSVLFASIGAILVKTYSKTAAGSGISEIKIIVSGFDFKAFLNQATLFI
                     KSLTLPLVIASGLSVGKEGPSVHYAACVGSVVPSVLFSKYFNGLAFNRRHFITAATAA
                     GVGVAFGSPIGGVLFAIEEISNFPLLSTFWKCYFCALCATATLASIDPFRNGQLVLFQ
                     ITYNQTWYSFEIPVFMLLGLFGGLYGIVVSKLNIKVVHFRNRFLIPHAIKEVVYLTLL
                     TSLICYNNVFLKDEMTKTMQLLFKECSPDSHSLLCTNDNSHKSWLVLSLLVATLIRSV
                     LVIISYGCKVPAGIFVPSMAVGATFGRSVGLIMEILYASRETSWLFASCPKDGSSCIT
                     GGSYALIGAASALSGITHLTVTVVIVMFELTGAVNYIIPIMIAIAVTKTINDRYGAGG
                     IADQMIKFNGMPFIDSKEEHEFFQDNATHKAMTLETVYFPLRLSYHDLEVILADTDYK
                     AYPVLDQEGFCSGLVQREQLVAEIGRLKGQDRLQLETMCMFSEDSSTNPFIEDLQDSE
                     TCYLDHLIKRDPVSVMTSTPLEISLDIFVKLGPRLILVKNSGGKLAGLLSRKDIIKYE
                     NYLHSTTHSIDENEQILLDEEQNYIEDRVWSFFCLIGSKFPKIGRKEYEPLETPNTR"
     gene            <875193..>876245
                     /locus_tag="PAS_chr2-1_0472"
                     /db_xref="GeneID:8198395"
     mRNA            <875193..>876245
                     /locus_tag="PAS_chr2-1_0472"
                     /product="Mitochondrial alcohol dehydrogenase isozyme III"
                     /transcript_id="XM_002491337.1"
                     /db_xref="GeneID:8198395"
     CDS             875193..876245
                     /locus_tag="PAS_chr2-1_0472"
                     /codon_start=1
                     /product="Mitochondrial alcohol dehydrogenase isozyme III"
                     /protein_id="XP_002491382.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0472"
                     /db_xref="EnsemblGenomes-Tr:CAY69102"
                     /db_xref="GeneID:8198395"
                     /db_xref="GOA:C4R0S8"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R0S8"
                     /translation="MSPTIPTTQKAVIFETNGGPLEYKDIPVPKPKSNELLINVKYSG
                     VCHTDLHAWKGDWPLDNKLPLVGGHEGAGVVVAYGENVTGWEIGDYAGIKWLNGSCLN
                     CEYCIQGAESSCAKADLSGFTHDGSFQQYATADATQAARIPKEADLAEVAPILCAGIT
                     VYKALKTADLRIGQWVAISGAGGGLGSLAVQYAKALGLRVLGIDGGADKGEFVKSLGA
                     EVFVDFTKTKDVVAEVQKLTNGGPHGVINVSVSPHAINQSVQYVRTLGKVVLVGLPSG
                     AVVNSDVFWHVLKSIEIKGSYVGNREDSAEAIDLFTRGLVKAPIKIIGLSELAKVYEQ
                     MEAGAIIGRYVVDTSK"
     gene            complement(<876267..>877664)
                     /locus_tag="PAS_chr2-1_0473"
                     /db_xref="GeneID:8198396"
     mRNA            complement(<876267..>877664)
                     /locus_tag="PAS_chr2-1_0473"
                     /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
                     (DAHP) synthase"
                     /transcript_id="XM_002491338.1"
                     /db_xref="GeneID:8198396"
     CDS             complement(876267..877664)
                     /locus_tag="PAS_chr2-1_0473"
                     /codon_start=1
                     /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
                     (DAHP) synthase"
                     /protein_id="XP_002491383.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0473"
                     /db_xref="EnsemblGenomes-Tr:CAY69103"
                     /db_xref="GeneID:8198396"
                     /db_xref="GOA:C4R0S9"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R0S9"
                     /translation="MTVQEVDPKRSRTPPVWDYGLNKQSTNSRPPSSQGSGLLLSEKF
                     GHSVVPQPEVLQQVLYPTNEELKQKILTYRNYINSLIKTDSNDSAQPNILPDTEIVEN
                     KPLLVITGPEYIKDGTQAKRCAQWIAALTGKRNYKVVGEMDGVLEKEITPLFNPLTST
                     DRKDLLVTMRTNLSEYGNGDNDQAIMSYEIQYGIPICRVLLTELAQYCPLVGELSDTL
                     TPQYVSDLYCIGLLSHTYTESQLHRELASGVSYPVGFQVYGDTENAFNHKLQSSIDAI
                     YSTSQEHHFLSVTKLGSVAVIGTTGNSDTFLILKLNGDQQDSYLEDIAPLVQLLQKHI
                     VEKFVKIGRPDIKIMLDIGSIDNEGTYKYKELLLSQILANSEVSRYILGVIIDSGDSY
                     LPESLDLEEESQSISGPPQRFDHRELRQSLFKNVGKTHEKLDKFFFANRLLQRLVELS
                     QKGEVKISNSLKLIT"
     gene            <878057..>878465
                     /locus_tag="PAS_chr2-1_0474"
                     /db_xref="GeneID:8198397"
     mRNA            join(<878057..878084,878143..>878465)
                     /locus_tag="PAS_chr2-1_0474"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491339.1"
                     /db_xref="GeneID:8198397"
     CDS             join(878057..878084,878143..878465)
                     /locus_tag="PAS_chr2-1_0474"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491384.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0474"
                     /db_xref="EnsemblGenomes-Tr:CAY69104"
                     /db_xref="GeneID:8198397"
                     /db_xref="GOA:C4R0T0"
                     /db_xref="InterPro:IPR009332"
                     /db_xref="UniProtKB/TrEMBL:C4R0T0"
                     /translation="MQKKSQQLMDKLDSNVTLMVQKYQSILELVTSSDKSIGTQSVET
                     LQIESNASTIIRLSEELLSMTRTLKESWVLGQLPKINEDSDLSNEHLREKMNQLLELV
                     SDETKQPKEEESDL"
     gene            <878787..>879890
                     /locus_tag="PAS_chr2-1_0475"
                     /db_xref="GeneID:8198398"
     mRNA            <878787..>879890
                     /locus_tag="PAS_chr2-1_0475"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491340.1"
                     /db_xref="GeneID:8198398"
     CDS             878787..879890
                     /locus_tag="PAS_chr2-1_0475"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491385.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0475"
                     /db_xref="EnsemblGenomes-Tr:CAY69105"
                     /db_xref="GeneID:8198398"
                     /db_xref="GOA:C4R0T1"
                     /db_xref="InterPro:IPR013218"
                     /db_xref="UniProtKB/TrEMBL:C4R0T1"
                     /translation="MPPKRKGSKKKPKADSGTKTNGRVNLTSNASSILKKAKQANSSL
                     SQLLQNSHPLLDNIDELNEHTRHSQRFEEDEGFVFKRLKKDSDDDVEYTEASRSMILP
                     LNESPVKRNPKQKRRSSLSNRGKRVSSIGNGFTGTPHDDVEIKHFHKHLDESLPEPHR
                     MRQLLIWTGKRLLKKKQTHKDNTIVNIAKVIKEELIRDLIDGKLNTSWWNRVDSDEED
                     EFDVTTFLPNQQNETNKKNLALLQHSLEQLKEEEKVWEEKLRQLTGTLALSPDISSVD
                     VSNNETCSKTQETVSRLEKKVEEIGESIDIPLEKKLDLFADYTHKLRSIERTSRIYID
                     NKSNEIASLLSKKQEMKELPQDLLKAISRIDRS"
     gene            complement(<880081..>880479)
                     /locus_tag="PAS_chr2-1_0476"
                     /db_xref="GeneID:8198399"
     mRNA            complement(<880081..>880479)
                     /locus_tag="PAS_chr2-1_0476"
                     /product="One of 10 subunits of the transport protein
                     particle (TRAPP) complex of the cis-Golgi which mediates"
                     /transcript_id="XM_002491341.1"
                     /db_xref="GeneID:8198399"
     CDS             complement(880081..880479)
                     /locus_tag="PAS_chr2-1_0476"
                     /codon_start=1
                     /product="One of 10 subunits of the transport protein
                     particle (TRAPP) complex of the cis-Golgi which mediates"
                     /protein_id="XP_002491386.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0476"
                     /db_xref="EnsemblGenomes-Tr:CAY69106"
                     /db_xref="GeneID:8198399"
                     /db_xref="GOA:C4R0T2"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:C4R0T2"
                     /translation="MSLYLALIGTRDNPLYEMEIKMDPIRDFCPFIVHSALDIIEDLQ
                     WKTNQLYFKNIDNYDNYSISGYVTPGNIKFMILYQNLRSDEAIRQFFGELNDLYVKTL
                     LSPFYTINEAIRSKAFDQKVRMLSRKYFNL"
     gene            <880717..>882738
                     /locus_tag="PAS_chr2-1_0477"
                     /db_xref="GeneID:8198400"
     mRNA            <880717..>882738
                     /locus_tag="PAS_chr2-1_0477"
                     /product="Protein of unknown function, required for normal
                     growth rate at 15 degrees C"
                     /transcript_id="XM_002491342.1"
                     /db_xref="GeneID:8198400"
     CDS             880717..882738
                     /locus_tag="PAS_chr2-1_0477"
                     /codon_start=1
                     /product="Protein of unknown function, required for normal
                     growth rate at 15 degrees C"
                     /protein_id="XP_002491387.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0477"
                     /db_xref="EnsemblGenomes-Tr:CAY69107"
                     /db_xref="GeneID:8198400"
                     /db_xref="UniProtKB/TrEMBL:C4R0T3"
                     /translation="MLKKYSNYSQEVPDIPLKQNEDQASDLAPPSLDRTVELTSLFLG
                     LRKSLLLDSHIEPASTMPKKVPMTCVKEGGRNSLDMESNSAYSKEDLNQLAKSLNFGI
                     NRESYEYNQDTAGQINLRSFSPQILERAKRVKLMFSLFYWNLERSLEIHMPLEDNPNK
                     SQLPGIDGVFNPLQTIRNRSIRRKQHYKIQDLGFKALPLPSQAFSRKGKKHKSGNKST
                     RYFKWEIPLKELIIDMNWKLENWHLLIDPSGELWFEHSELPDGRLHHRLHYKRPHLRN
                     HKRYKKLFEDYKEDLDDDLADPFNLSLDKVHTNGSVSMLTTGSYDDGDSIRTTRTNDE
                     LKKKTSELEKSASDTASSYMPSRLAKMPGRFFKKKQQPNVAVANATNPDTSPSFDSES
                     THQPEPYYAELPKVVIEEASIGDEAPRSDFGSYSWNRTKFEPLKVGSEEDLQTSSSTS
                     MIERHFTNVDEKKDSTVSLEQHFSSDSLPRRTSLVDDQEEQILKTCYQRLRKMDILIV
                     LGEVHMSHKASSLTQFIQTRADQLQEKTVNLNTSFSRLENVELKEYDDRFHPIYQKAI
                     EYRNFVDNDYFNKLDQMMALSDRMIGEINTSVTLDIRKLNDRIDKLNQSTSLMATKSR
                     FDLRKIGYKLLENLIVLLFWLIWVIVSAYRIVKIVLIMGIRFISWVLSD"
     gene            <882818..>883285
                     /locus_tag="PAS_chr2-1_0478"
                     /db_xref="GeneID:8198401"
     mRNA            <882818..>883285
                     /locus_tag="PAS_chr2-1_0478"
                     /product="dUTPase, catalyzes hydrolysis of dUTP to dUMP
                     and PPi"
                     /transcript_id="XM_002491343.1"
                     /db_xref="GeneID:8198401"
     CDS             882818..883285
                     /locus_tag="PAS_chr2-1_0478"
                     /codon_start=1
                     /product="dUTPase, catalyzes hydrolysis of dUTP to dUMP
                     and PPi"
                     /protein_id="XP_002491388.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0478"
                     /db_xref="EnsemblGenomes-Tr:CAY69108"
                     /db_xref="GeneID:8198401"
                     /db_xref="GOA:C4R0T4"
                     /db_xref="InterPro:IPR008180"
                     /db_xref="InterPro:IPR008181"
                     /db_xref="InterPro:IPR029054"
                     /db_xref="UniProtKB/TrEMBL:C4R0T4"
                     /translation="MTDQESKRIKQSEQLKVFLRSDKAKTPTRGSPLSAGYDIYSAEQ
                     TIIPAKGQAVVSTDLTVIVPIGTYGRVAPRSGLAVKHGIQTGAGVIDADYRGEVRVLL
                     FNHGDKDFQIEAGDRIAQLVLEKIVLADIVAITREELDVTERGEGGFGSTGKN"
     gene            complement(<883356..>885707)
                     /locus_tag="PAS_chr2-1_0479"
                     /db_xref="GeneID:8198402"
     mRNA            complement(<883356..>885707)
                     /locus_tag="PAS_chr2-1_0479"
                     /product="Pleckstrin homology domain containing protein
                     proposed to function as a glycerol channel activator"
                     /transcript_id="XM_002491344.1"
                     /db_xref="GeneID:8198402"
     CDS             complement(883356..885707)
                     /locus_tag="PAS_chr2-1_0479"
                     /codon_start=1
                     /product="Pleckstrin homology domain containing protein
                     proposed to function as a glycerol channel activator"
                     /protein_id="XP_002491389.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0479"
                     /db_xref="EnsemblGenomes-Tr:CAY69109"
                     /db_xref="GeneID:8198402"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C4R0T5"
                     /translation="MSRAPSPTGSYFSHSSKPSGSSFAGSRPALHGKESNESVFSSND
                     SLTTDPLRNGSQNLSLPPPSDPSSPYHIALPLNPHPVEQLVNRFTIWKKLIKELIFYF
                     KELSSLKQHYYELNIHMLNNIKLLTKPSAKSVAPLDHNDDPTGELAAFTGTTEEKFMK
                     TAFLPPSGSSITSVRNTLHNYHRALAEKELVTYNQLTLKVIPRLENFKRSLNSKIKEI
                     LTLKNDFKLQKIKSQVAMTGQLLSDYVNVIELFNRGSTTTPSGLDTSEKYNSKLTSSG
                     KYDPYVLKLRFDLQLRQQLLEENMVRESFLSIQKAGLLLEEVVYKEVQNAFGKFANLI
                     DAEVNTVKKNLVEDLKEGFLKNVPSSDWDYFILNDKANFLNISSKEILNPSPGRKLSN
                     IVYPYQKKLAARCIRSGHLEKKNKLLKSYAKGYYVLTLNFLHEFKTPDRKKEYMPQSS
                     LPLDRVVLKESDRESRKFVLHDTSTKTNHIFKCVDAVDAGKWYTDLKELTKYASSIER
                     NTVMEFRYANSVAKQPVQGHSKNSSESSIYLPERTTSPLPAELKDTEELRKNSSSFAL
                     PTFKNLSTSKLDEVLSAPLHESPNSDSSSTPSTIHQPVPSISITRHQSKKKPSKVPVR
                     SDTPPINTQQLRNNGSVKTGDIHSSFALSGNHIADQREVSSSSQSNLAETNLTTPDVK
                     GYEYNLDTPGKTPDLDYFSFKGQNAKSMANSSSGLNTPTESISDSANSSTSKFHGTLE
                     LPTANFSDVIRNNASIPATPGELPSSSIKDMIKQYGLDEHLQE"
     gene            <886085..>887611
                     /locus_tag="PAS_chr2-1_0480"
                     /db_xref="GeneID:8198403"
     mRNA            <886085..>887611
                     /locus_tag="PAS_chr2-1_0480"
                     /product="Mitochondrial inner membrane protein"
                     /transcript_id="XM_002491345.1"
                     /db_xref="GeneID:8198403"
     CDS             886085..887611
                     /locus_tag="PAS_chr2-1_0480"
                     /codon_start=1
                     /product="Mitochondrial inner membrane protein"
                     /protein_id="XP_002491390.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0480"
                     /db_xref="EnsemblGenomes-Tr:CAY69110"
                     /db_xref="GeneID:8198403"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:C4R0T6"
                     /translation="MVKILRGPVFRTTVLVGRGLLRSNIRPVHVLGLRFQTSLKPNPP
                     VSTIKDVEAQKPKDPSLAGQSKDIKHVTETAIVETEKKLTLWEKVKHEANHYWDGTKL
                     LGYEIKISFKLLCKLAGGYELSRREHSQLTRTTTDLLRLIPFSVFVLIPFAELLLPVA
                     LKLFPNLLPSTYESKAERNKKRKSLLDTRNKTSKFIRKTVQESGINLPKQVTEDEKKD
                     FVSFFKSIQEPGERPSTEQIIRIARRFKNDQVLDNLSRPQLMAMARYMNLRPFGTDEI
                     LRYQIRYKLLQIIKDDRAIDYEGVESLSIQELQSACASRGIKTVGASPARLRDDLKIW
                     LDLRLRQKIPSTLLILSSTFTYGDHADDLDNYYDALLAVLSSIPDEVYNVAKLELADQ
                     DNKLKLNVLKEQDELIKEERQQSKSQRRSTPIKDDIKLDEYEEVKEDEVKDDVTKDTV
                     EEKREDTNEHVKEEPKVDASEEVKDETPAQSEEEVKEPSKDGTVIESKDQPQTTDKKE
                     "
     gene            complement(<887744..>888178)
                     /locus_tag="PAS_chr2-1_0481"
                     /db_xref="GeneID:8198404"
     mRNA            complement(<887744..>888178)
                     /locus_tag="PAS_chr2-1_0481"
                     /product="40S ribosomal protein S14"
                     /transcript_id="XM_002491346.1"
                     /db_xref="GeneID:8198404"
     CDS             complement(887744..888178)
                     /locus_tag="PAS_chr2-1_0481"
                     /codon_start=1
                     /product="40S ribosomal protein S14"
                     /protein_id="XP_002491391.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0481"
                     /db_xref="EnsemblGenomes-Tr:CAY69111"
                     /db_xref="GeneID:8198404"
                     /db_xref="GOA:C4R0T7"
                     /db_xref="InterPro:IPR001971"
                     /db_xref="InterPro:IPR018102"
                     /db_xref="UniProtKB/TrEMBL:C4R0T7"
                     /translation="MASKTENVTLGPQVRDGSQVFGVARIFASFNDTFVHVTDLSGKE
                     TIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHVKLRATGGTSTKTPG
                     PGGQSALRALARSGLRIGRIEDVTPVPSDSTRRKGGRRGRRR"
     gene            complement(<888546..>888938)
                     /locus_tag="PAS_chr2-1_0482"
                     /db_xref="GeneID:8198405"
     mRNA            complement(<888546..>888938)
                     /locus_tag="PAS_chr2-1_0482"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_002491347.1"
                     /db_xref="GeneID:8198405"
     CDS             complement(888546..888938)
                     /locus_tag="PAS_chr2-1_0482"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_002491392.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0482"
                     /db_xref="EnsemblGenomes-Tr:CAY69112"
                     /db_xref="GeneID:8198405"
                     /db_xref="GOA:C4R0T8"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:C4R0T8"
                     /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPASKVIVKFLTVMQNH
                     GYIGEFEFIDDHRSGKIVIQLNGRLNKCGVISPRFNVKIGDIERWTDNLLPARQFGFV
                     ILTTSAGIMDHEEARKKHVSGKILGFVY"
     gene            <889198..>889353
                     /locus_tag="PAS_chr2-1_0483"
                     /db_xref="GeneID:8198406"
     mRNA            <889198..>889353
                     /locus_tag="PAS_chr2-1_0483"
                     /product="60S ribosomal protein L39"
                     /transcript_id="XM_002491348.1"
                     /db_xref="GeneID:8198406"
     CDS             889198..889353
                     /locus_tag="PAS_chr2-1_0483"
                     /codon_start=1
                     /product="60S ribosomal protein L39"
                     /protein_id="XP_002491393.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0483"
                     /db_xref="EnsemblGenomes-Tr:CAY69113"
                     /db_xref="GeneID:8198406"
                     /db_xref="GOA:C4R0T9"
                     /db_xref="InterPro:IPR000077"
                     /db_xref="InterPro:IPR023626"
                     /db_xref="UniProtKB/TrEMBL:C4R0T9"
                     /translation="MPSLKTFKTKQKLGKAQKQNRPLPQWVRLRTNNKNRYNAKRRHW
                     KRTKLGI"
     gene            complement(<889514..>890101)
                     /locus_tag="PAS_chr2-1_0484"
                     /db_xref="GeneID:8198407"
     mRNA            complement(join(<889514..890014,890072..>890101))
                     /locus_tag="PAS_chr2-1_0484"
                     /product="Protein localized to COPII vesicles, proposed to
                     be involved in ER to Golgi transport"
                     /transcript_id="XM_002491349.1"
                     /db_xref="GeneID:8198407"
     CDS             complement(join(889514..890014,890072..890101))
                     /locus_tag="PAS_chr2-1_0484"
                     /codon_start=1
                     /product="Protein localized to COPII vesicles, proposed to
                     be involved in ER to Golgi transport"
                     /protein_id="XP_002491394.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0484"
                     /db_xref="EnsemblGenomes-Tr:CAY69114"
                     /db_xref="GeneID:8198407"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:C4R0U0"
                     /translation="MSMSQFANFQFSQLSENMSVDRVRQEAQNISNKFANMKPPQEFF
                     DFRRVSKPANFGEVQQRVAYNLGYFQANYIAIVALLSTYSLLTNLLLLFVIVFTIAGV
                     YGIAALQGQELELGFTRLNTSQLYTGLFIVAVPLGFLASPISTLLWLIGASSVTVLSH
                     ASLMEKPIETVFEEAV"
     gene            complement(<890338..>891480)
                     /locus_tag="PAS_chr2-1_0485"
                     /db_xref="GeneID:8198408"
     mRNA            complement(<890338..>891480)
                     /locus_tag="PAS_chr2-1_0485"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002491350.1"
                     /db_xref="GeneID:8198408"
     CDS             complement(890338..891480)
                     /locus_tag="PAS_chr2-1_0485"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002491395.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr2-1_0485"
                     /db_xref="EnsemblGenomes-Tr:CAY69115"
                     /db_xref="GeneID:8198408"
                     /db_xref="UniProtKB/TrEMBL:C4R0U1"
                     /translation="MSFLARRVGSSVRWYSRYLQTTYNPASKLLKRPEFEPRSLFVIA
                     TPQHIDNLLTELGSISSEYEQLQIIAASTDSIPSGGTHRDGVSQMWLDEYITVNDSVR
                     LEERDDNLEDNTGEESNGVIPVRANRPWKKMQTRLQVNLHNSDNGISTITTSLANSAF
                     YFRDLCFMFYTRSHGADQLINANHNLAELTLTLPKQIRPTGFRSWNKLEQLSFDEDLA
                     VTEHNHNLIKRINGQSAAGYLENCKRIMNLGSKDTKIFIELSNSSVQSEPRLYEVVAG
                     GGGWGEKGKMLAISAGCEINTGDSVKFFMLHPEERYKGLAVPLDVQNASGLFVETTVE
                     EKEYRDAQHEEERVIQNQFGFGSELGYTINGLQYNAGGSLTWIELE"
     gene            complement(<891636..>892022)
                     /locus_tag="PAS_chr2-1_0486"
                     /db_xref="GeneID:8198409"
     mRNA            complement(<891636..>892022)
                     /locus_tag="PAS_chr2-1_0486"
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /transcript_id="XM_002491351.1"