GenomeNet

Database: RefSeq
Entry: NC_012965
LinkDB: NC_012965
Original site: NC_012965 
LOCUS       NC_012965            2245428 bp    DNA     linear   CON 11-OCT-2017
DEFINITION  Komagataella phaffii GS115 chromosome 3, complete sequence.
ACCESSION   NC_012965
VERSION     NC_012965.1
DBLINK      BioProject: PRJNA39439
            BioSample: SAMEA2272385
            Assembly: GCF_000027005.1
KEYWORDS    RefSeq.
SOURCE      Komagataella phaffii GS115
  ORGANISM  Komagataella phaffii GS115
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
REFERENCE   1
  AUTHORS   De Schutter,K., Lin,Y.C., Tiels,P., Van Hecke,A., Glinka,S.,
            Weber-Lehmann,J., Rouze,P., Van de Peer,Y. and Callewaert,N.
  TITLE     Genome sequence of the recombinant protein production host Pichia
            pastoris
  JOURNAL   Nat. Biotechnol. 27 (6), 561-566 (2009)
   PUBMED   19465926
REFERENCE   2  (bases 1 to 2245428)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2245428)
  AUTHORS   Callewaert,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2009) Callewaert N., Department for Molecular
            Biomedical Research, Flanders Institute for Biotechnology (VIB) /
            Gent University, Technologiepark 927, Ghent, 9052, BELGIUM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FN392321.
            Contact: Nico Callewaert
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent Technologiepark
            927, B-9052 Gent, Belgium
            Tel: (32)93313630
            Fax: (32)93313609
            Email: nico.callewaert@dmbr.vib-UGent.be
            ----------- sequencing/assembly
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent -----------
            annotation
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent
            
            Laboratory for Bioinformatics and Evolutionary Genomics VIB
            Department of Plant Systems Biology, UGent
            Web site: http://bioinformatics.psb.ugent.be/
            Bioinformatics Online Genome Annotation System (BOGAS):
            http://bioinformatics.psb.ugent.be/webtools/bogas/ -----------
            * NOTE: finishing of chromosomes in process
            * Final curation of the annotation in progress.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2245428
                     /organism="Komagataella phaffii GS115"
                     /mol_type="genomic DNA"
                     /strain="GS115"
                     /db_xref="taxon:644223"
                     /chromosome="3"
     gene            <1805..>2812
                     /locus_tag="PAS_chr3_0001"
                     /db_xref="GeneID:8199698"
     mRNA            join(<1805..1858,2282..>2812)
                     /locus_tag="PAS_chr3_0001"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492169.1"
                     /db_xref="GeneID:8199698"
     CDS             join(1805..1858,2282..2812)
                     /locus_tag="PAS_chr3_0001"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492214.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0001"
                     /db_xref="EnsemblGenomes-Tr:CAY69934"
                     /db_xref="GeneID:8199698"
                     /db_xref="UniProtKB/TrEMBL:C4R399"
                     /translation="MFLTSKNMVFLNAMEDFYEITYSSTLNPHSGCKGLVAAKSFTFL
                     RRNYDCGDVLTVGQVASSKSNSKENVILPKIARPRPDVRQKKDQALRTNALGDVIFVP
                     FIYVFKPSILRNELPASIIYFLLVGLMHTAILFALIAFRACKYYLKPAESSRFHFASQ
                     LVLSVSPALQGFEQPCKSKVTLELKLKVFATLAK"
     gene            complement(<4131..>5918)
                     /locus_tag="PAS_chr3_0002"
                     /db_xref="GeneID:8199632"
     mRNA            complement(<4131..>5918)
                     /locus_tag="PAS_chr3_0002"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492170.1"
                     /db_xref="GeneID:8199632"
     CDS             complement(4131..5918)
                     /locus_tag="PAS_chr3_0002"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492215.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0002"
                     /db_xref="EnsemblGenomes-Tr:CAY69935"
                     /db_xref="GeneID:8199632"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:C4R3A0"
                     /translation="MSLLLFLVLGAFLLSSVKAADIGAFRLRVYTPGRFTNGALNFNN
                     WGYQYLDASSSNGQLFAGYATVTSVTTFLAPDDEGFVWGSSLGGYPGFLGIGAGATAF
                     HLTGIPGDALSWYIEDNILKTSSPTYVCSRNDGDVVVGIEANTRWLAMHDTSQLPPNY
                     YCFQADYEIVALWYIPDTTSTWTGTETSTTTDDDGSVIELVPTPLPDTTSTWTGTFTT
                     FTTDDDGSVIELVPTPLPDSTSTWTGTYTTFTTDEDGSTIAVVPSSTIDSTSTWTGTY
                     TTFTTDEDGSTIAVVPSSTIDSTSTWTGTYTTFTTDEDGSTIAVVPSSTIDSTSTWTG
                     TFTTFTTDEDGSTIVVVPSSTSDHHDKPGASETILTNGGISTTVVTVTSCDIEKCTKT
                     TALTGVTETTLTTGGTTTVVTTYCPLPTDIVTVKTTSISGSEVLQTIYTAKPSNDVPD
                     VQTLTVTITREVCDASTCTQATIVTGEILKTTTLADTHSTTVVPVYVPLDTDQPLVEL
                     STLETVLKSSEFASGPAVTAGSAQQPSYQSGGVAESSLTVSEFEAHSTSDTVSQPSTI
                     SPQTGEANALRWSSFFGAALVPLVNVFFV"
     gene            <11166..>12779
                     /locus_tag="PAS_chr3_0005"
                     /db_xref="GeneID:8199633"
     mRNA            <11166..>12779
                     /locus_tag="PAS_chr3_0005"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492171.1"
                     /db_xref="GeneID:8199633"
     CDS             11166..12779
                     /locus_tag="PAS_chr3_0005"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492216.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0005"
                     /db_xref="EnsemblGenomes-Tr:CAY69936"
                     /db_xref="GeneID:8199633"
                     /db_xref="UniProtKB/TrEMBL:C4R3A1"
                     /translation="MQLFLATLGIPFTGTLPAIAGNEDHSSANNNNGNGFSYDWHGND
                     TLFAELLETDFFDHPIDDAMLCSLLSPPRAAETEQQQDTEWEQQKHTNLFGCCQKHKV
                     EMAKQQELYLLPDKLTKNIFNSESPVFICTKIPQTSSVQSFVDVDASLLATDSSLSKD
                     SFSADSTVDVLFEQSVQEPYFYRSNSAETAPPSTACSSATLDLVSTLEATTTLFEEAA
                     NSKKQMIGLKQQSKIEDLSFSCKLNFSASMFLDHSCIPLVRGRSFGGNSRPPKTPLIP
                     GTRYVTARLRLENSTSEDMCFPHWSERELSDSRRIIRIERSYQSNEIVASFFIVGSAI
                     DHPETKPSSELDVKVLEVSCLRCFINDNESEEERFVSEYTSDEARAQHALTEPLTSGL
                     NKEPNGHNPKTAGNSIGCRYYITSVEVIKIIELLIGSYSTSDPVQRRKERGRMRSNLV
                     QFWSKHLVSSSKDTMKRRSVPTCNDDYLSELEHRINTYDVRKPRKFDKSVKILEWSKL
                     GPALQRAIQSYYMVRLDNSSNKTAATNSS"
     gene            complement(<14281..>15345)
                     /locus_tag="PAS_chr3_0006"
                     /db_xref="GeneID:8199634"
     mRNA            complement(<14281..>15345)
                     /locus_tag="PAS_chr3_0006"
                     /product="NADPH-dependent medium chain alcohol
                     dehydrogenase"
                     /transcript_id="XM_002492172.1"
                     /db_xref="GeneID:8199634"
     CDS             complement(14281..15345)
                     /locus_tag="PAS_chr3_0006"
                     /codon_start=1
                     /product="NADPH-dependent medium chain alcohol
                     dehydrogenase"
                     /protein_id="XP_002492217.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0006"
                     /db_xref="EnsemblGenomes-Tr:CAY69937"
                     /db_xref="GeneID:8199634"
                     /db_xref="GOA:C4R3A2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R3A2"
                     /translation="MTTVFAYAAPSASGELGPFSYEPRNLRNDDVEIKILYCGVCHTD
                     LHKCRNHWGGSQYPLVPGHEIVGKVARVGTSVTKYKLGDVAAVGCLVDSCGNCRSCKD
                     GLENYCENAPTLTYDADDRKDGKRLYGGYSESITVRESFVLRVPSGLDVKSAAPLLCA
                     GITMWSPLRNWKVNSKSKVAVAGLGGLGHMGIKLAKGLGAHVTLLSRSPGKATDGRRL
                     GADDVLITTDEAAVARASNRFDIILDTVPYDHDVNPYLSLLRRDGNLVLLGLIGNIQA
                     TPLNTGPMLSARRSVSGSGIGGIQETQELLDFCAAKKILPDVEMIAIQEINDAYERLI
                     KGDVKYRFVIDIESLSKVRG"
     gene            complement(<20160..>21622)
                     /locus_tag="PAS_chr3_0008"
                     /db_xref="GeneID:8200151"
     mRNA            complement(join(<20160..20356,20397..21095,21127..>21622))
                     /locus_tag="PAS_chr3_0008"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492173.1"
                     /db_xref="GeneID:8200151"
     CDS             complement(join(20160..20356,20397..21095,21127..21622))
                     /locus_tag="PAS_chr3_0008"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492218.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0008"
                     /db_xref="EnsemblGenomes-Tr:CAY69938"
                     /db_xref="GeneID:8200151"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4R3A3"
                     /translation="MSNSSFKSDEKGGLKGSVQAQGIPVLLENDGVQNILETRFLLEV
                     FKRPMFAAFLVGVTAFACPGMFSALNGLGAGGTAEPTISNISNAVTFGTIAVGGFLTG
                     TITNQTGVKESLLIGAGFYSPYAAALYISTQGNSNYKWFMPVSGFILGVSAAFFWIAS
                     SGILLGKAMSMKKKISLQHVGGLVGGAISLGLNHTKPSSRSVTGGTLLALTFVMLIGI
                     PAALLLPTPRQINRGDGFKVDVFKQPSIWHEFALLKQIILRKDVLLLIPLFTYNQWYL
                     SYQWNFNYSYFSFRGRALNIFLFYLFGTIGAWILGLFLDLQRVRTITRARSGFTVFSI
                     IAGASWILGLVVEIQWKNTTRLYDWGDREFGLGCFLFCLWGFMDAMYNAFVYWVVGTL
                     SKKLMNCSALAFAVFTKKASGIAQCAINTGLFFFSLTFFSVVVWRIKEDISEKHPEEE
                     FPQTGIVSFEDRL"
     gene            <21714..>22675
                     /locus_tag="PAS_chr3_0010"
                     /db_xref="GeneID:8199854"
     mRNA            join(<21714..21760,21979..22421,22458..>22675)
                     /locus_tag="PAS_chr3_0010"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492174.1"
                     /db_xref="GeneID:8199854"
     CDS             join(21714..21760,21979..22421,22458..22675)
                     /locus_tag="PAS_chr3_0010"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492219.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0010"
                     /db_xref="EnsemblGenomes-Tr:CAY69939"
                     /db_xref="GeneID:8199854"
                     /db_xref="UniProtKB/TrEMBL:C4R3A4"
                     /translation="MPQLKSFGNLSLENKTIAVIGGGVTGLILGLAALRDGYRVDVFE
                     RSDSITDVGAGISFDINAAKVFESLGLGDVIDRISYRSKTSTYRTHDTNKLKLFLDYS
                     NTSGKVMCLRAEFVREVAGLLPKDQLHLGKKFESLQQHHKLVTIRFKDGSSYAADLVI
                     GADESTPVFSHQVMYRDVLNLSKVTDLDPELLNSTIIPAPGDKHVVLFPLKKGTLLAV
                     AAIIRIDHDEGWEESWL"
     gene            <22838..>23202
                     /locus_tag="PAS_chr3_1144"
                     /db_xref="GeneID:8199302"
     mRNA            join(<22838..22864,22900..>23202)
                     /locus_tag="PAS_chr3_1144"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492175.1"
                     /db_xref="GeneID:8199302"
     CDS             join(22838..22864,22900..23202)
                     /locus_tag="PAS_chr3_1144"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492220.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1144"
                     /db_xref="EnsemblGenomes-Tr:CAY69940"
                     /db_xref="GeneID:8199302"
                     /db_xref="UniProtKB/TrEMBL:C4R3A5"
                     /translation="MPCYPIRDKALTIGAAYRVDPKIKENFPIWLEVYESARKIHAEQ
                     VALTSRRMGYVLDRLRLSEKALSIYKTSFKWIHDSDPKVEIEKSVFAFFDPDTAFNLD
                     WPASAKA"
     gene            <23319..>24495
                     /locus_tag="PAS_chr3_0012"
                     /db_xref="GeneID:8200177"
     mRNA            join(<23319..23515,23572..23735,23765..>24495)
                     /locus_tag="PAS_chr3_0012"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492176.1"
                     /db_xref="GeneID:8200177"
     CDS             join(23319..23515,23572..23735,23765..24495)
                     /locus_tag="PAS_chr3_0012"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492221.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0012"
                     /db_xref="EnsemblGenomes-Tr:CAY69941"
                     /db_xref="GeneID:8200177"
                     /db_xref="GOA:C4R3A6"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R3A6"
                     /translation="MKRTRAHSACEHCRLKKTKCDEARPSCSQCKTRNLQCTYKDSVP
                     TKLERTLSLLFQRIENENSKLEQVKRASHHLEETEPYMIGGYEFDEVEVDLNEIKGST
                     TPDERNRIIYLEEQYSLKVEYNFNSALIKKLKDAYLRHIYPVFPLLCEQKLSELSQDV
                     SQKGLQADFETFILLLVLALGAISLAEENDSISKENFWNNPNYQVAHRQVDPQPGWSY
                     FWLVLGMKSRLVSSSTDNLSLVMIPLLCSLYFLKLGDIVSHCDYLQEACTKLNKQLFR
                     LKQSPSIGSYNQLYVDTLRRIFWVCLDLERNMANMASIPKSELSSLQQWLALPTGCKP
                     KFPFDSNESYAFCYMSSIICCQISVIRRP"
     gene            complement(<25147..>26417)
                     /locus_tag="PAS_chr3_0013"
                     /db_xref="GeneID:8199303"
     mRNA            complement(join(<25147..25504,25631..25878,26253..>26417))
                     /locus_tag="PAS_chr3_0013"
                     /product="Lectin-like protein with similarity to Flo1p,
                     thought to be expressed and involved in flocculation"
                     /transcript_id="XM_002492177.1"
                     /db_xref="GeneID:8199303"
     CDS             complement(join(25147..25504,25631..25878,26253..26417))
                     /locus_tag="PAS_chr3_0013"
                     /codon_start=1
                     /product="Lectin-like protein with similarity to Flo1p,
                     thought to be expressed and involved in flocculation"
                     /protein_id="XP_002492222.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0013"
                     /db_xref="EnsemblGenomes-Tr:CAY69942"
                     /db_xref="GeneID:8199303"
                     /db_xref="UniProtKB/TrEMBL:C4R3A7"
                     /translation="MTRAEYSNNSKPLKIATLGAGLVGAVAGIALSKLSNVNVTIYEL
                     SEKAREVDRGLFKGDIVQYKGAVAYRNVFPMELIMDIPNLPNDTSAWVKDGDIMFFSP
                     LGLTQYGVVALRRTQFLIPRVWQTNFVGMKILENGPSPSVCRRCSASKSGAFGAGAQF
                     GFGDVWALYRPLQETVSDAYVDTGLLADYDLHRALFLFNETRRHFLARVEKQLGYDAD
                     TYKSYFSTARNDKEWRARFRQVESPLEWMRENNVEADF"
     gene            complement(<27503..>29677)
                     /locus_tag="PAS_chr3_1145"
                     /db_xref="GeneID:8199304"
     mRNA            complement(<27503..>29677)
                     /locus_tag="PAS_chr3_1145"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492178.1"
                     /db_xref="GeneID:8199304"
     CDS             complement(27503..29677)
                     /locus_tag="PAS_chr3_1145"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492223.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1145"
                     /db_xref="EnsemblGenomes-Tr:CAY69943"
                     /db_xref="GeneID:8199304"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:C4R3A8"
                     /translation="MKFPVPLLFLLQLFFIIATQGDESGNGDESDTAYGCDITSNAFD
                     GFDATIYEYNANDLKLIRDPVFMSTGYLGRNVLNKISGVTVPGFNIWNPRSRTATVYG
                     VQNVNYYNMVLELKGYFKAAVSGDYKLTLSNIDDSSMLFFGKNTAFQCCDTGSIPVDQ
                     APTDYSLFTIKPSNQVNSEVISSTQYLEAGKYYPVRIVFVNALERALFNFKLTIPSGT
                     VLDDFQDYIYQFGALDENSCYETTVSKITEWTTYTTPWTGTFETTRTITPTGTEGTVV
                     IETPESYVTTTQPWTGTYETTYTVPPTGTEPGTVIIETPEIIDCEAVCCGPFLTAFSF
                     RKREECQCENICCPGDTNCETYVTTTQPWTGTYETTYTVPPTGTEPGTVIIETPESYV
                     TTTQPWTGTYETTYTVPPTGTEPGTVIIETPESYVTTTQPWTGTYETTYSVPPSGTEP
                     GTVVIETPESYVTTTQPWTGTYETTYSVPPSGTEPGTVVIETPEASTARTKFTTVTSS
                     WTGVFTTTKTLPASGTEPATIVIQTPTGYFNTSSLVSTRTKTNVDTVTRVIPCPICTA
                     PKTITVVPEEPNESVSVIISQPQSSSTDTTLSKPDSVRVISQPETASQMDTSLSKTDS
                     AVISTETAGNNIIPLAGSHSYNTIVTTVTDSPQVAQSTTATSSSNVHLTISTQTTTPS
                     LVYSSSLSTVHQVSPSNGGFRSSITVHPLLSVIGAIFGALFM"
     gene            complement(<31546..>32607)
                     /locus_tag="PAS_chr3_0014"
                     /db_xref="GeneID:8200178"
     mRNA            complement(<31546..>32607)
                     /locus_tag="PAS_chr3_0014"
                     /product="Putative dihydrokaempferol 4-reductase"
                     /transcript_id="XM_002492179.1"
                     /db_xref="GeneID:8200178"
     CDS             complement(31546..32607)
                     /locus_tag="PAS_chr3_0014"
                     /codon_start=1
                     /product="Putative dihydrokaempferol 4-reductase"
                     /protein_id="XP_002492224.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0014"
                     /db_xref="EnsemblGenomes-Tr:CAY69944"
                     /db_xref="GeneID:8200178"
                     /db_xref="GOA:C4R3A9"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R3A9"
                     /translation="MLPKVLVTGATGFIGLHITGELLSRGYAVIGTVRTHKEGDQMLK
                     DFARAFPSTLDGQLLYVVIPDISASGSFDDVFRSNSDVTYAIHTACPTPPVGEGSLEE
                     TMLLPTVEGTLNLLRAIKRYANDSVKNVIYTSSLSACWNLDKVEDKSLVIDESTWNSY
                     EWEDINDDNRYLAYSVAKKKAEKAAWDFLENEKPFFKLTTIVPPFVFGPQRFDWKAKE
                     NVLSGSAEIILSLLSSGSTLQDLHDAPISLAVDVRDLAVYHVLPLTNPTLEQKRLLTI
                     AGKFSGQRVLNVINENFTELKGKVLLGDPDNVLQLEGLKAPEYNNKETLALGHLGLIS
                     VDRSIADTVAQILRVNTIQ"
     gene            complement(<33327..>35351)
                     /locus_tag="PAS_chr3_0015"
                     /db_xref="GeneID:8199305"
     mRNA            complement(<33327..>35351)
                     /locus_tag="PAS_chr3_0015"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492180.1"
                     /db_xref="GeneID:8199305"
     CDS             complement(33327..35351)
                     /locus_tag="PAS_chr3_0015"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492225.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0015"
                     /db_xref="EnsemblGenomes-Tr:CAY69945"
                     /db_xref="GeneID:8199305"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:C4R3B0"
                     /translation="MQTDLLSSRFQLRQLIQLRIWTGTYTTWTTDADGSVIEQIPTPS
                     ADTTSVWTGTYTTWTTDADGSVIEQIPTPSADTTSVWTGTYTTWTTDADGSVIEQIPT
                     PSADTTSVWTGTYTTWTTDADGSVIEQIPTPSADTTLAPSADTTSIWTGTYTTWTTDA
                     DGSVIEQIPTPSADTTSVWTGTYTTWTTDAAGTVIEVIPSGTSISSDVIPTPLPTSGV
                     DIDTIPYDAFNVAVYHYPADNYELANNLGFLTSGYEGLGQVTTATSVGNINFDTSSGW
                     PYYIESNALGNTGSYVNATIEYVGFFQAPANGNYELSFSNIDYNAILFLGSPATDSSL
                     AKREVQFLKPETSSEYVLFFDHGKDAGQTVSTTQYLSAGLYYPLRIVLAAVSERAQLD
                     FQITLPDGRVLDQYQGYVYNFAHEGIESATSSAHETSWSRFTNSTIYSHSSTIGIITS
                     STDAPHSVINPTAIETTSTDTSISTVAVTTSICDTKDCVKTTVITPNSPLPTQTVSLT
                     TTTIDRSEVVQTAHSAVPSQFAPDAHPSAVTITREQCDAYSCSQATIVSGKVLQTTTV
                     SDSTTVVPLDTPQLSVEASTLETRLKSTQSSRAPTVTVQTSQSSRHSEDVTESSVHVS
                     EFDAQSTSATSASALQAPSSISLQTGGANTLRLSAFLGTALLPMLNVLFI"
     gene            complement(<35451..>36590)
                     /locus_tag="PAS_chr3_0016"
                     /db_xref="GeneID:8199306"
     mRNA            complement(<35451..>36590)
                     /locus_tag="PAS_chr3_0016"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492181.1"
                     /db_xref="GeneID:8199306"
     CDS             complement(35451..36590)
                     /locus_tag="PAS_chr3_0016"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492226.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0016"
                     /db_xref="EnsemblGenomes-Tr:CAY69946"
                     /db_xref="GeneID:8199306"
                     /db_xref="UniProtKB/TrEMBL:C4R3B1"
                     /translation="MNLFTILAWGFLYVPLVLGEGYYSLNFDARVPIALGILGSSYQK
                     YTIMADRSLLGGSNIDLDVTFSGIIELLTNRVHIVVSLPDADGRVSVYDMYSGTSLGY
                     LSFVCSLTTCEVHAVSSSSGATTWTLDGNQLIPTSPSTVYACYRSLVGLLAQYTLNDR
                     TSITAQCEQTNLYVELAIPAFPETTAVWTGTYTTWTTDESGSVIEQMPTPSADTTTTW
                     TGTYTTWTTDADGSVIEQIPTPPADTTSVWTGTYTTRTTDADGSVIEQIPTPSADTTS
                     IWTGTYTTWTTDADGSVIEQIPTPSADTTSVWTGTYTTWTTDADGSVIEQIPTPSADT
                     TSVWTGTYTTWTTDADGSVIEQIPTPSAXPDQNFXMDWHLYHLDH"
     gene            complement(<39926..>40681)
                     /locus_tag="PAS_chr3_0017"
                     /db_xref="GeneID:8199307"
     mRNA            complement(<39926..>40681)
                     /locus_tag="PAS_chr3_0017"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492182.1"
                     /db_xref="GeneID:8199307"
     CDS             complement(39926..40681)
                     /locus_tag="PAS_chr3_0017"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492227.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0017"
                     /db_xref="EnsemblGenomes-Tr:CAY69947"
                     /db_xref="GeneID:8199307"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="UniProtKB/TrEMBL:C4R3B2"
                     /translation="MKIGIIGTGDIGATLARKFASRRHRVKVANSRGPQSISELAHEI
                     GADAVTKEEAVQDVEVIIISIPFAKNPDLAHLIRSVPSDVVVIDTSNYIPQRDGQIAE
                     IDNGKAESVWLSEMLGHSIVKAWNAVGATTLSDYGRQAGALDRIAIPVAGDDENAKSV
                     AMELVEQTGFDAVDSGSLAESWRQQAGTPVFCTEAKAEGMKKLLELADRKRASRNLEL
                     ILKELGERGGKRSHEESVRFTRSINIPDGQFEF"
     gene            complement(<41112..>42821)
                     /locus_tag="PAS_chr3_0018"
                     /db_xref="GeneID:8199308"
     mRNA            complement(<41112..>42821)
                     /locus_tag="PAS_chr3_0018"
                     /product="High affinity methionine permease, integral
                     membrane protein with 13 putative membrane-spanning regi"
                     /transcript_id="XM_002492183.1"
                     /db_xref="GeneID:8199308"
     CDS             complement(41112..42821)
                     /locus_tag="PAS_chr3_0018"
                     /codon_start=1
                     /product="High affinity methionine permease, integral
                     membrane protein with 13 putative membrane-spanning regi"
                     /protein_id="XP_002492228.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0018"
                     /db_xref="EnsemblGenomes-Tr:CAY69948"
                     /db_xref="GeneID:8199308"
                     /db_xref="GOA:C4R3B3"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C4R3B3"
                     /translation="MAFLTLPKNVFTSTKSEHSTEEFQENVEKSSSLEKETVGEQTIE
                     LDTGDRRIGLVTAAFLITNRILGAGIFATPSTILLMSGSVGTALMLWVLGMLIALSGL
                     FVYAEFGSYPSRLLQRNGGEKNYLEYAYSRPKYLVTCMYALYILLTGGSAGICVVFGE
                     YILRAAQVEPTEWAARGLGIASVCFAFLVNTLNVKVGIFVLNVLGTFKIVIVLLIAVT
                     GWVALGGGIKNEEFTPTHAFSNAFQGTSPTAYGVVISLYNVIWSFMGYSNVNYNLSEV
                     KNPIKALKYSAPIAVVSLGIIYILVNIAYFAVVPFDVMTNSGRILAADFFRIAFGTRA
                     ERACSVFIALSALGNVIAATFSQGRIVQQFGREGILPYSAFWASQKPFNSPFTGLLEH
                     CIIIIITIVAPPAGDAYDFVLNLISYPMNIINFFVAGALLWLRYEARKGRREWIPNIK
                     TPVPVIVFFLLSSLYLIIAPYIPPAKGQSSVYNHMPYWIHCVAAWGIFALGVLYWIIW
                     GRVIPKVGKYRLISRDVHDTDGYWRNKFFKIPYSYQQSDEEFIAQELQKQADKETFSE
                     KPI"
     gene            complement(<43577..>44929)
                     /locus_tag="PAS_chr3_0019"
                     /db_xref="GeneID:8199309"
     mRNA            complement(<43577..>44929)
                     /locus_tag="PAS_chr3_0019"
                     /product="Flavin-containing monooxygenase, localized to
                     the cytoplasmic face of the ER membrane"
                     /transcript_id="XM_002492184.1"
                     /db_xref="GeneID:8199309"
     CDS             complement(43577..44929)
                     /locus_tag="PAS_chr3_0019"
                     /codon_start=1
                     /product="Flavin-containing monooxygenase, localized to
                     the cytoplasmic face of the ER membrane"
                     /protein_id="XP_002492229.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0019"
                     /db_xref="EnsemblGenomes-Tr:CAY69949"
                     /db_xref="GeneID:8199309"
                     /db_xref="GOA:C4R3B4"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:C4R3B4"
                     /translation="MCAKSVAIIGGGPSGIAAAKALSEENAFDRIVIFEQQEQLGGVW
                     NHSSKKPGAAFVPSDSPARTREWNRNQSTYFSAMYEKLETNIVKDLMPYNNYPFPEVS
                     DTLPPRQDVLEYLLNYAKGLNPSVIVRLNTVVTHLEKVGTQWRISYRQSSQAEREDTY
                     QYIVIASGHYNFPYIPTVPGLEEWVKVDADSISHSMYYINNEKFRGKKVLVIGNAISG
                     VDISLQLTEVTWPVYRSKRHEPLLKPVEIEDIIEVSEIAKYDVSTRSATTIDGKIIDG
                     IDHILFCTGYLYDFPFLKTYMSGEDAIITDGRITRRLYRQIFYIPDPTLSFSGVVKNV
                     VPFPLAESQAAVIARVFSGRLSLPNEAEMRESEIADVKARGSEYKFHVYEAPADVEYI
                     NTLQQWVNQAEPTELGFKAEVWTEEKKQRRVDCINVKNAHHLKYYAHIKKLRDETRKD
                     "
     gene            complement(<47774..>48733)
                     /locus_tag="PAS_chr3_0020"
                     /db_xref="GeneID:8199310"
     mRNA            complement(<47774..>48733)
                     /locus_tag="PAS_chr3_0020"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492185.1"
                     /db_xref="GeneID:8199310"
     CDS             complement(47774..48733)
                     /locus_tag="PAS_chr3_0020"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492230.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0020"
                     /db_xref="EnsemblGenomes-Tr:CAY69950"
                     /db_xref="GeneID:8199310"
                     /db_xref="GOA:C4R3B5"
                     /db_xref="InterPro:IPR003691"
                     /db_xref="UniProtKB/TrEMBL:C4R3B5"
                     /translation="MLSILANLLLWSILGCLGRIALIELTNYPHSYINTGINIGTCLW
                     VNFAACLIISAINRNRIPNKNDNSKGPLYIGLTVGFCGTLSTFSSLIMEASLKAFDIS
                     DGTHDMRYKNSAYGIMEWLSVILVQFGVSSLGFLIGQTINIQEYLGYVTKYRTPENDR
                     YFRYAVIIGSILLLLLILFLAIFLPDSNFFRHWATSICFAPVGCFLRYFLSQQLNGTL
                     KRTGIFLGTLICNLVAVLVESICFLLLRISLITRKTDITVLNSIIVGFCGTLSTTSTL
                     MVELASLTPVHRYKYFTASVFLSFLFPVLIIGVYNWTRGLSPD"
     gene            <50808..>52613
                     /locus_tag="PAS_chr3_0022"
                     /db_xref="GeneID:8199311"
     mRNA            <50808..>52613
                     /locus_tag="PAS_chr3_0022"
                     /product="Allantoin permease"
                     /transcript_id="XM_002492186.1"
                     /db_xref="GeneID:8199311"
     CDS             50808..52613
                     /locus_tag="PAS_chr3_0022"
                     /codon_start=1
                     /product="Allantoin permease"
                     /protein_id="XP_002492231.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0022"
                     /db_xref="EnsemblGenomes-Tr:CAY69951"
                     /db_xref="GeneID:8199311"
                     /db_xref="GOA:C4R3B6"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:C4R3B6"
                     /translation="MALRDKLTQRSKSPGAVTNTVSAPGSLNSSSPLGSLSAEQNTSG
                     RSPIGKLLDKLVVQEEKELSASQSFLFNFDLRPVERRRRLWSWFNYVFFWISDSFNIN
                     TWQIAATGIQAGLSWWTCWLSVWLGYSLTGIFVTVSARVGIYYHISFPVSCRSSFGVF
                     GSIWPVFNRVVMACVWYGVQGYIGGTTMALMLRSIFGNDLNTRIPDGISSPNVTTFEF
                     LSFFLFWLFSLPFIWLAPHTVRHLFTVKSYVVPVAGIAFLIWSIKKADGIGPVVKQPS
                     TISGSEFGWAFIRSVMNSLANFATLIVNAPDFSRFSKTKASAKWAQLFSIPLCFSITS
                     LIGILVSSASTIIYGETYWSPIDVLGRFLDNYTSGNRAGVFFISFAFALAQLGTNISA
                     NSLSAGTDATALLPRYITIRRGGYICAAVGLCICPWELLSSSNKFTTYLSAYSVFLSA
                     IFGVLFADYYIVRRGWLVLNDLYNAEKTSAYTYWHGINYRAFVAYICGILPNIVGFVG
                     ATGAGSVPQGAMYVYDFNFFAGFGVSVFIYVLLCYIHPLPGVPYEIKKDLFKKGWYEE
                     YAEVENFDVTGGAASGEVWEVVEEPIEYYDEEKKV"
     gene            complement(<53672..>55294)
                     /locus_tag="PAS_chr3_0023"
                     /db_xref="GeneID:8199312"
     mRNA            complement(<53672..>55294)
                     /locus_tag="PAS_chr3_0023"
                     /product="Putative transporter, member of the sugar porter
                     family"
                     /transcript_id="XM_002492187.1"
                     /db_xref="GeneID:8199312"
     CDS             complement(53672..55294)
                     /locus_tag="PAS_chr3_0023"
                     /codon_start=1
                     /product="Putative transporter, member of the sugar porter
                     family"
                     /protein_id="XP_002492232.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0023"
                     /db_xref="EnsemblGenomes-Tr:CAY69952"
                     /db_xref="GeneID:8199312"
                     /db_xref="GOA:C4R3B7"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R3B7"
                     /translation="MSLLGRARSLNYQGKLYDKFPTIYNIHVIAITATVSGLMFGFDI
                     SSVSSFVSQEHYRNYFNRPDSLTQGGITASMAGGSFVGSLVSSDFQDIFGRRVALHVC
                     SALWITGAIIQSASQNQGMLIAGRFISGLGIGFGSASAPVYCSEVSPAKIRGLIGGLF
                     QLSVTVGIMVMFYIGYGCHFIDGVASFRLAWGLQMIPGFILLVGVFFIPESPRWLANH
                     ERWDDAVEIIANVVADGDREDPDVHLQLDELQEQVLIDKDAANFGYADLFKKDCRKRT
                     FIGVSAQIWQQLCGMNVMMYYIVYIFEMAGYSGNVNLVSSSIQYVLNVVMTIPALFLM
                     DRVGRRPLLIGGGIFMFIWLFGVAGLLATYSEPIENFGGDDTVRILIPDEHKAAARGV
                     IACSYLFVCSFAPTWGICIWVYVSEIFNNRQRAKGAALATSANWIFNFALAMFVPSAF
                     RNITWRTYIIFGVFSVCLTVHVIVQFPETRGKTLEEIDKMFKDNIPAWRTSSYVPEMP
                     IVHKEKIGSTEHIENASNLSEKPIMVHEEESV"
     gene            complement(<55790..>57841)
                     /locus_tag="PAS_chr3_0024"
                     /db_xref="GeneID:8199313"
     mRNA            complement(<55790..>57841)
                     /locus_tag="PAS_chr3_0024"
                     /product="Plasma membrane transporter for both urea and
                     polyamines, expression is highly sensitive to nitrogen"
                     /transcript_id="XM_002492188.1"
                     /db_xref="GeneID:8199313"
     CDS             complement(55790..57841)
                     /locus_tag="PAS_chr3_0024"
                     /codon_start=1
                     /product="Plasma membrane transporter for both urea and
                     polyamines, expression is highly sensitive to nitrogen"
                     /protein_id="XP_002492233.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0024"
                     /db_xref="EnsemblGenomes-Tr:CAY69953"
                     /db_xref="GeneID:8199313"
                     /db_xref="GOA:C4R3B8"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:C4R3B8"
                     /translation="MSDAETTVHLLGKSVGYGVLIGVGAAFALAVVIATRLIARYLNE
                     NNNSTETFMVSNRTVGIGLTTSAIFSSWFWATELLWTVTMTQFYGVSVGFYYYWGLIV
                     PVSIMGVLGIEAKRKVPKGHTCLEVVELRYGKAAHILYMCFCLANNLLSCAAMILGAA
                     GAISIIADNLSIVASSLLIPFGVLCYTFSGGLRATFLGDWGHSVIAIIVLLYVNTAAL
                     VKIGSIDKLYELIFTGPNEGTIEGNYDGSLMTFRSQGAVFFGIIHLLGDMGLTVLDSS
                     FYQKAFSANLKSGVPSYMIGGVCIMAITWPLGTIIGMATTFLENDPSFPTYPRKMTTF
                     EIESGFGLPYTLKALLGDGACGAILLVIYLACTSTVSAQMISVSSILSFDVYKTYINP
                     QAKNKQMIRASHITVVFFSFFAAGFAIMLHYVGANMTWVGYFYPILICNPVCPMILLF
                     TWDRQTKFAFIASPIIGIGASVGVWLGTAYHYYGEITMETTSRQLPCLWAGLTALFLP
                     LVLTVTFSLFQKEHFDWNVFKKAELIEMEGSEASSPSEVDVVYESGSVSSPTEDSEKR
                     SVDKSENVQLQETELGVSSGDEYDEEEQKLIKRYIKIAYAWCILVVLVTSVLFPMSLY
                     RNWIISLSFFRGYTGLSMFWLYGVFLVIAVYPLYDGRHSLGRIGQGLWKDFKRIFKSK
                     R"
     gene            complement(<58856..>59245)
                     /locus_tag="PAS_chr3_0025"
                     /db_xref="GeneID:8199314"
     mRNA            complement(<58856..>59245)
                     /locus_tag="PAS_chr3_0025"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492189.1"
                     /db_xref="GeneID:8199314"
     CDS             complement(58856..59245)
                     /locus_tag="PAS_chr3_0025"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492234.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0025"
                     /db_xref="EnsemblGenomes-Tr:CAY69954"
                     /db_xref="GeneID:8199314"
                     /db_xref="UniProtKB/TrEMBL:C4R3B9"
                     /translation="MSASDRRSSHYIVNKWVIKILIQRMKLLFHIWRSKTLPKACHYP
                     FAGNFGIHIVGSYLLFGCLKSRKRRPPVTLKLMWRRRAVQKVTHLVPLKLSSYQMKPS
                     ELIFYAIQTDQKSLGCKSNQISGELTI"
     gene            complement(<60021..>60917)
                     /locus_tag="PAS_chr3_0026"
                     /db_xref="GeneID:8199315"
     mRNA            complement(<60021..>60917)
                     /locus_tag="PAS_chr3_0026"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492190.1"
                     /db_xref="GeneID:8199315"
     CDS             complement(60021..60917)
                     /locus_tag="PAS_chr3_0026"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492235.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0026"
                     /db_xref="EnsemblGenomes-Tr:CAY69955"
                     /db_xref="GeneID:8199315"
                     /db_xref="UniProtKB/TrEMBL:C4R3C0"
                     /translation="MAFEFEGEGIAASIFLALYVIYTLFTIGIIWHKGTLRTIYSGLL
                     FFGLIRMGAQLCGIAFASLGYEHWQWLVAYLVLGAEGYFVLILTSFYMVSHAHIAARK
                     ESWLKSRLVDTSNWGFLKKLNINGMRIFYYLAIVANVLVIVGGTMLTGLDADEYDDNV
                     SRINTSKGLRGTGQALFLIFTLVVAGLAAYTVIHDNIRSYLLTSVFMATPFLFVRGIY
                     GLLSCFIQQMNYFSMANYTATGMSVHFVATEYVLATTMEFIAACIFMSTYYVVYIPKK
                     ALNEDETSLIEVGGKHEDKPNE"
     gene            <61903..>63876
                     /locus_tag="PAS_chr3_0027"
                     /db_xref="GeneID:8199316"
     mRNA            <61903..>63876
                     /locus_tag="PAS_chr3_0027"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492191.1"
                     /db_xref="GeneID:8199316"
     CDS             61903..63876
                     /locus_tag="PAS_chr3_0027"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492236.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0027"
                     /db_xref="EnsemblGenomes-Tr:CAY69956"
                     /db_xref="GeneID:8199316"
                     /db_xref="GOA:C4R3C1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R3C1"
                     /translation="MKTEKKLKRTFLACDICRSKKLKCINNGSTKEPCHRCSRLSHEC
                     SYTPTQSHLRKHVNKDNWAKQSDYKVSKPIVPSHEVVIPEKDVVLEVIELFFSHQYQG
                     VFLFLHRPSLLAFIKSSEFNPSTYINDYYNSESPAPYHLLHRPDPVVLLSIFALSARF
                     HPSMVSSYGAFDLSQDPDLFTPSSSNGSGVFRSPVHASEYFAYHARKLLQPLFDRPSI
                     QRIQALTMLSSHDWGERNVARAFIYVGLACRMAFVLGLNDSTSLCYNETNPLISEVKR
                     RTLWAVYLQDRCISSGRNRSSCIKIEDIHIEMPALEAEFVLGKLSSPRLTFEEFQSIL
                     FESHGSSPTGVENRLTNVSTYCFTIFLFEVWASLARWVGESGPRSNNLPTTGSGSSSK
                     FSETDKKLDVLESTIPVHLYNNTVNFQNQASEGTLMSFVYMHALLYLSRIFLHREYFF
                     INPETLPANQWYNATRKFLQSVERSTKLISAAESINMMVIAPFTGFELFTNAATSLYF
                     LTSPLSLLKKNYEVQNKTAYQSLKSEVKTYVKTNIELLKKWSSVWPITSSWFLWTLDL
                     QTSLKSFSTDEQGIMFRNLMIDYGTTIVAEEANDNPSTTSSLSEQDNQSAQHFQNLVS
                     TEDNVLTPDINNIVLGWRELFDVGPDLQLQSEW"
     gene            complement(<63929..>65554)
                     /locus_tag="PAS_chr3_0028"
                     /db_xref="GeneID:8199317"
     mRNA            complement(<63929..>65554)
                     /locus_tag="PAS_chr3_0028"
                     /product="Putative protein with similarity to the
                     allantoate permease (Dal5p) subfamily of the major
                     facilitat"
                     /transcript_id="XM_002492192.1"
                     /db_xref="GeneID:8199317"
     CDS             complement(63929..65554)
                     /locus_tag="PAS_chr3_0028"
                     /codon_start=1
                     /product="Putative protein with similarity to the
                     allantoate permease (Dal5p) subfamily of the major
                     facilitat"
                     /protein_id="XP_002492237.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0028"
                     /db_xref="EnsemblGenomes-Tr:CAY69957"
                     /db_xref="GeneID:8199317"
                     /db_xref="GOA:C4R3C2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4R3C2"
                     /translation="MASKTEKIRYSVNNNSVDSASSIEEPNDNPFADPQIAAYWRKIY
                     EDVGYENLHRFDPDFTWNKEEEKKLVRRLDLKVFSWTFVMFCALDLVRRNINRAVSDN
                     LVSGDIPGLDTNGYNLGQTIYLISFLCAELPLNLLSKKFGPNVVVSAECLVWSIICIS
                     QSAMRTRAQFLALRALLGFAQGGFIPDQILYLSYYYTNTELPLRLAIFWTAIPLFQIL
                     GSLLASGLLEMRGIHGKTGWQWLFIIEGLMSLGVAIPSFYVMRSGPTQTKNILFKSRP
                     AWFNEHEEKILVNRLLRDDPAKGDMNNRQALNIRQILRTVLSEYDFWPLYIQGLMAFI
                     PFQPVTAYMSLILRSMGYSVFLSNVLAIPGQFWFLINLPLVVYFSHKVKEKSICVGIA
                     NYFIFPFVVALVAYPATGSDWVKYFLLTGIVALPYTHAILASWVSHISNNVASRSVAT
                     PLYNMMYQVGSIAASNIYRESDKPYYIRGNKIILGITVFNCVFPFFTKAYYIMRNKQK
                     EKKWNSMTKEEQIEYTTNTTDSGVKRLDFRFVH"
     gene            <65883..>67502
                     /locus_tag="PAS_chr3_0029"
                     /db_xref="GeneID:8199318"
     mRNA            <65883..>67502
                     /locus_tag="PAS_chr3_0029"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492193.1"
                     /db_xref="GeneID:8199318"
     CDS             65883..67502
                     /locus_tag="PAS_chr3_0029"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492238.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0029"
                     /db_xref="EnsemblGenomes-Tr:CAY69958"
                     /db_xref="GeneID:8199318"
                     /db_xref="InterPro:IPR011048"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C4R3C3"
                     /translation="MKFLTLISVASTIATSYADWQYRTRPDLSPIELNITIPATDDKV
                     SPGFLFAAPFSGYDQDNTHGPRQPGAYIFTDKGELVWSGFSYFANWQANFQASRINGE
                     NVLFAFEGTHNPGYGHGHGHITILNNRYETIKELRAGNHRISDKHEFHVKDEKTGLIQ
                     IYHPVPKDLSDYGASADQQWIVDAKFQELDLRTRKVLFEWSSLDHVSPHDSVLPINPW
                     QAGSGYNSSDAWDYFHINSVDKDENGDYLISARNAAAIYKINGTDGSIIWKLGGLPGK
                     TSSNFKVKGKPLTFSFQHHARFLSTSDDGSKQVFSFYDNSAHGTEDHRGHEVHYSDQS
                     SGKIVEVNTETNEATLLAQYDPPRGHNLLSKSQGSTQVLSNGNVLVNWGSEGAVTEYT
                     ADGTPVFHAYFGTGELGKHVENYRAFKFDWHGYPAEAIALHSDISPEGDTIAYVSWNG
                     DTETSYWKFYSIDKVSERQLLGKVPRQGFETKFKIEGETHSKLVVEAYNDQHRFLASS
                     DVVVSEEQVEEKRVDTKAKFQHYFAWLANKD"
     gene            complement(<68405..>70168)
                     /locus_tag="PAS_chr3_0030"
                     /db_xref="GeneID:8199319"
     mRNA            complement(<68405..>70168)
                     /locus_tag="PAS_chr3_0030"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492194.1"
                     /db_xref="GeneID:8199319"
     CDS             complement(68405..70168)
                     /locus_tag="PAS_chr3_0030"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492239.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0030"
                     /db_xref="EnsemblGenomes-Tr:CAY69959"
                     /db_xref="GeneID:8199319"
                     /db_xref="UniProtKB/TrEMBL:C4R3C4"
                     /translation="MKFAISTLLIILQAAAVFAAFPISDITVVSERTDASTAYLSDWF
                     VVSFVFSTAGSDETIAGDATIEVSIPNELEFVQYPDSVDPSVSEFFTTAGVQVLSTAF
                     DYDSHVLTFTFSDPGQVITDLEGVVFFTLKLSEQFTESASPGQHTFDFETSDQTYSPS
                     VDLVALDRSQPIKLSNAVTGGVEWFVDIPGAFGDITNIDISTVQTPGTFDCSEVKYAV
                     GSSLNEFGDFTPQDRTTFFSNSSSGEWIPITPASGLPVESFECGDGTISLSFAGELAD
                     DEVLRVSFLSNLADDVLEVQNVVNVDLTTADSRKRALTSFVLDEPFYRASRTDTAAFE
                     AFAAVPADGDITSTSTAITSVTATVTHTTVTSVCYVCAETPVTVTYTAPVITNPIYYT
                     TKVHVCNVCAETPITYTVTIPCETDEYAPAKPTGTEGEKIVTVITKEGGDKYTKTYEE
                     VTYTKTYPKGGHEDHIVTVKTKEGGEKVTKTYEEVTYTKGPEIVTVVTKEGGEKVTTT
                     YHDVPEVVTVITKEGGEKVTTTYPATYPATYTEGHSAGVPTSASTPPQATYTVSEAQV
                     NLGSKSAVGLLAIVPMLFLAI"
     gene            complement(<73945..>78369)
                     /locus_tag="PAS_chr3_0032"
                     /db_xref="GeneID:8199320"
     mRNA            complement(<73945..>78369)
                     /locus_tag="PAS_chr3_0032"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492195.1"
                     /db_xref="GeneID:8199320"
     CDS             complement(73945..78369)
                     /locus_tag="PAS_chr3_0032"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492240.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0032"
                     /db_xref="EnsemblGenomes-Tr:CAY69960"
                     /db_xref="GeneID:8199320"
                     /db_xref="InterPro:IPR006970"
                     /db_xref="UniProtKB/TrEMBL:C4R3C5"
                     /translation="MFSTKYIAVLLSAFAAVEAIALPSYEQALDHAARGLVPQAFADA
                     LNPALEKRADFMCHAACGLAIYGAWECGPEAGPFDEECLCAADSSFSTQIDACLDCGW
                     CIYMSYFGNLAGPLDACGLPVTPTGTTCIETASTLTPTLGPFTDYTPTHPNNVPTSTE
                     EPTEEPSEDVTSTEDATSTEDSTEEPSSEPTPDYSDLTLGEAITDIKVVSERTSTESG
                     YYNDWFVVYITFDTTGRDIVLPPYAVVQVALPEEIIFIEHPQFSAFSDPSLINFYTTG
                     GSGVMSSKVDWNTNVLNFTFSNRAQVITEVKGTISVTMRLKDNFVSTLSPGEYDFKFY
                     TGVSEIVSTFDFLPLDRTAPQKLILGGADAVNWVVDIPGAPYPEITNINVGSVIIENG
                     WRYKYIYDCENLKYIIASDFDEWNNVTTPVGDYLPLSSADSSIADLECGLGGVSFSFT
                     ESLGENEVLRIFVPSEAMVSGTLYMENIFTVDITTGSDSVEITKREEFSYTFDETYYG
                     DTRAETNVFEVFALDDPPASSEPTEEPTSEEPTSEEPTSEEPTEESTEEPTEEPTSEE
                     PTEESTEEPTEEPTEEPTSEEPTEEPTSEEPTEEPTSEEPTEEPTSEEPTEDATSTTD
                     DDETSTETSTEEPSVEPTGSYTDLTLGEAITKVEVTSERTNEASGYTSDWLIVSFTFS
                     TTGRDIILPPNSVVQVAIPDALQFIAHPQYAAFLEPSLKNFYTKNENLIMRSRFNYDT
                     NVIDFTFDNRGQVITRLEGVVYFTMKLEQDFIATLSPGEYDFEFHTSVDTHTSTFNFL
                     PLVRSEPIKLIAGAADEVEWFIDIPGAYNDLATIDISSDIDTNADWQNYFYDCSKLKY
                     TIGKEFDQWGNFTAGSDGNQYSNTTNGYVPITDSTGSPVAEVQCLLESISLSFTNPLA
                     EDEVLRVVLHSSAFRSGSLYMANTVNVDITTGALVKRELFSYALDETYYAETRSERLA
                     FDVFELADPVEETSEEPTSEPTSEPTEEPTSEPTEEPTEEPTSEEPTEEPTEEPTEEP
                     TSEEPTEEPTEEPTSEEPTEEPTSEEPTSEPTEEPTEEPTSEEPTSEPTEEPTEEPTS
                     EEPTSEEPTSEPTSEPTEEPTEEPTSDDLSINPTGVPTEEPTEEPTSETTEEPTSDDL
                     SINPTGVPTEEPTEEPTSETTEEPTSDDSTIDPTGQPTEEPTTDDPSIAPTAVPTSES
                     SSGQSVVTQITTATQTTITSVCNVCAETPVTITYTAPVVTDPVSYTTVTSVCHVCAET
                     PITVTLTLPCETEEVKKTDGPKTVTYTEVCNSCADKPITYTYTAPESTEGVECTTVTS
                     VCNVCAETPVTVTYTAPKDTSAPKTVTYTEVCNSCADKPITYTYTAPESTEGAKSTTV
                     TSVCHDCAETPVTVTYTVPKASTVPVENTTVPSKPTNPGQQDTTITTHVTQTTSLVTA
                     SSSSTAPPAISSAGPENLAVRFSAAGLFAMLPMILLAL"
     gene            <80882..>82606
                     /locus_tag="PAS_chr3_0035"
                     /db_xref="GeneID:8199321"
     mRNA            <80882..>82606
                     /locus_tag="PAS_chr3_0035"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492196.1"
                     /db_xref="GeneID:8199321"
     CDS             80882..82606
                     /locus_tag="PAS_chr3_0035"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492241.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0035"
                     /db_xref="EnsemblGenomes-Tr:CAY69961"
                     /db_xref="GeneID:8199321"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:C4R3C6"
                     /translation="MTQSEPEPKKRKTALPDHSKAAHVKWLPKRVHTSSVVPRHPLGV
                     KPSGNRLLASHDSNYPDKSQRRGFWTLMASNEQLMTRILHFIDSPLDLMKLGHTSRMM
                     YAYTWNEELWRQLYMHKAAKSVESHYPLGIKEWKGSWRRTLLGIERDQEALIQVKENQ
                     ICSDLLYRPYQCSQIDYSEICREIIEDERVYHDHPEAYAKHNSLKGHVVRIPEEKMTL
                     ENFETNFTDLPFIITNLNRSRWPSWSMESLLERFSNVQFRQESVRWPLSFYCEYSLDN
                     CDESPLYLFDCNSDAMKELVNELTVPDCFKKDLFTVFDENDILCRPDHTWLIMGPKNS
                     GSTFHKDPNFTSAWNTAISGRKLWIMLPPDIKPPGIGTDKTESEVTAPVGIAEWTLSG
                     FMQDALNLTKSDQCLVGITYPGECMHVPAGWWHSVINLDNSIAMTGNFIPEPKLPHVL
                     DFVKNKNNQISGFHSLDVKKSLINICKRMNQNTERYQRFQDYIREAKDDNEDCGEIAF
                     VPMPIYDMFLELLEQSEQFNSIDLNNVVDVLTTIEKKNRPAKVRESKTWNQLVSQNGF
                     SFGFSEDD"
     gene            complement(<82715..>83601)
                     /locus_tag="PAS_chr3_0036"
                     /db_xref="GeneID:8199322"
     mRNA            complement(join(<82715..83527,83575..>83601))
                     /locus_tag="PAS_chr3_0036"
                     /product="S-adenosylmethionine transporter of the
                     mitochondrial inner membrane, member of the mitochondrial
                     ca"
                     /transcript_id="XM_002492197.1"
                     /db_xref="GeneID:8199322"
     CDS             complement(join(82715..83527,83575..83601))
                     /locus_tag="PAS_chr3_0036"
                     /codon_start=1
                     /product="S-adenosylmethionine transporter of the
                     mitochondrial inner membrane, member of the mitochondrial
                     ca"
                     /protein_id="XP_002492242.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0036"
                     /db_xref="EnsemblGenomes-Tr:CAY69962"
                     /db_xref="GeneID:8199322"
                     /db_xref="GOA:C4R3C7"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R3C7"
                     /translation="MNEFLVSLISGGCAGTATDLAFFPIDTLKTRLQAKGGFFQNGGW
                     KGVYRGLGSALIASAPSASLFFVTYDGCKKFFKAELMPLLKNENLTLNVSHMAAASLG
                     EIAACLVRVPAEVIKQRTQTSKFSSSLESLKYILRNENGEGVIRGLYRGWTSTIVREI
                     PFTTIQYPLYEYMKLRWAAHQQIEKVSPLQGALCGSVAGGFAAAVTTPLDVLKTRIML
                     SSHKISLGQVASQLYKEEGFAVFWSGVGPRTMWISAGGAIFLGVYETVSSFLTAEEKT
                     KLG"
     gene            <84001..>85398
                     /locus_tag="PAS_chr3_0037"
                     /db_xref="GeneID:8199323"
     mRNA            <84001..>85398
                     /locus_tag="PAS_chr3_0037"
                     /product="Cysteine desulfurase involved in iron-sulfur
                     cluster (Fe/S) biogenesis"
                     /transcript_id="XM_002492198.1"
                     /db_xref="GeneID:8199323"
     CDS             84001..85398
                     /locus_tag="PAS_chr3_0037"
                     /codon_start=1
                     /product="Cysteine desulfurase involved in iron-sulfur
                     cluster (Fe/S) biogenesis"
                     /protein_id="XP_002492243.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0037"
                     /db_xref="EnsemblGenomes-Tr:CAY69963"
                     /db_xref="GeneID:8199323"
                     /db_xref="GOA:C4R3C8"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010240"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR016454"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:C4R3C8"
                     /translation="MFGVRRSCNKASAFGKVVRNISGASSARTPMPTSVSNASLNDAV
                     PPKGSAVSLGNSKRDDSLYGTRPIYLDMQATTPTDPRVLDKMLEFYTGLYGNPHSSTH
                     SYGWETEKEIEKARKYIADVIGADPKEIVFTSGATESNNMSVKGVARFYKKTKKHIIT
                     TQTEHKCLLESARRLQDDGFDITYLPVNEDGLVNLEQLEKSIRKDTCLVSVMAVNNEI
                     GVIQPLEEIGRICRNHKVFFHTDAAQAFGKIPLDVNKLNIDLMSISSHKIYGPKGMGA
                     CYVRRRPRVRLDPIISGGGQERGLRSGTLATPLVAGFGEAARLAVQEYEYDTKYISRL
                     SQKLMNGILSMEHTQLNGSKTSRYPGCLNISFAYVEGESLLMALKDIALSSGSACTSA
                     SLEPSYVLHALGADDALAHSSIRFGIGRFTTEQEIDYVIDAINQRVQFLRELSPLWEM
                     VQEGIDLNSIEWSGH"
     gene            <85601..>86503
                     /locus_tag="PAS_chr3_0038"
                     /db_xref="GeneID:8199324"
     mRNA            <85601..>86503
                     /locus_tag="PAS_chr3_0038"
                     /product="Nucleolar protein with similarity to large
                     ribosomal subunit L7 proteins"
                     /transcript_id="XM_002492199.1"
                     /db_xref="GeneID:8199324"
     CDS             85601..86503
                     /locus_tag="PAS_chr3_0038"
                     /codon_start=1
                     /product="Nucleolar protein with similarity to large
                     ribosomal subunit L7 proteins"
                     /protein_id="XP_002492244.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0038"
                     /db_xref="EnsemblGenomes-Tr:CAY69964"
                     /db_xref="GeneID:8199324"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:C4R3C9"
                     /translation="MLQLIAPDEIFFLNFLREKEKIIPPNQSMSSTQTETEVLLKKRK
                     NDEVARMEKAESLRQAEEERQIQKRKKQNTFVPPEYLALRHLASEREQHRIDRVLKVE
                     KELKQKAISSDKTQQEQDQGKLVFVVRVQGPKRAHLPQQVDLILKLLRLTEMNTGVFV
                     RETSSVIPLLKVIRAHVVIGEPSLYTVRSLVQKRAKITIEGENGPRSVELNDNNVIED
                     KLGDYGIVCMEDIIHEIFSLEENFKVVNKFLNPFQLSPPESGWGPESKLRKLVAEESK
                     SKVSNSGRAELEYVDIDKYIEEQN"
     gene            <86733..>87860
                     /locus_tag="PAS_chr3_0039"
                     /db_xref="GeneID:8199325"
     mRNA            <86733..>87860
                     /locus_tag="PAS_chr3_0039"
                     /product="Beta-isopropylmalate dehydrogenase (IMDH),
                     catalyzes the third step in the leucine biosynthesis path"
                     /transcript_id="XM_002492200.1"
                     /db_xref="GeneID:8199325"
     CDS             86733..87860
                     /locus_tag="PAS_chr3_0039"
                     /codon_start=1
                     /product="Beta-isopropylmalate dehydrogenase (IMDH),
                     catalyzes the third step in the leucine biosynthesis path"
                     /protein_id="XP_002492245.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0039"
                     /db_xref="EnsemblGenomes-Tr:CAY69965"
                     /db_xref="GeneID:8199325"
                     /db_xref="GOA:C4R3D0"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C4R3D0"
                     /translation="MSEPITKKPKSVIPKKIVLLPGDHVGAEIIDEAVKVLKAISSVS
                     PNADFEFQTQLIGGAAIDATGSPLPDETLEAARGANAVLLGAVGGPKWGTGDVRPEQG
                     LLKIRKELNLYANLRPCNFASDSLLKLSPLKEDIVRGTNFTVVRELVGGIYFGERTED
                     DGSGVAWDTEKYSVPEVQRITRMGAFLALQSDPPLPIWSLDKANVLASSRLWRKTVTE
                     TLEKEFPQLTLNHQLIDSAAMILVKSPSKLNGIVLTNNMFGDIISDEASMIPGSLGLL
                     PSASLASLPDSNEAFGLYEPCHGSAPDLDKGKVNPVATILSAAMMLRLSLNLTEEADA
                     LEKAVGQVLDSGIMTGDLGGSNSTTEVGDAISKAVVDILKN"
     gene            complement(<87922..>88806)
                     /locus_tag="PAS_chr3_0040"
                     /db_xref="GeneID:8199326"
     mRNA            complement(<87922..>88806)
                     /locus_tag="PAS_chr3_0040"
                     /product="Mitochondrial inner membrane transporter,
                     exports 2-oxoadipate and 2-oxoglutarate from the
                     mitochond"
                     /transcript_id="XM_002492201.1"
                     /db_xref="GeneID:8199326"
     CDS             complement(87922..88806)
                     /locus_tag="PAS_chr3_0040"
                     /codon_start=1
                     /product="Mitochondrial inner membrane transporter,
                     exports 2-oxoadipate and 2-oxoglutarate from the
                     mitochond"
                     /protein_id="XP_002492246.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0040"
                     /db_xref="EnsemblGenomes-Tr:CAY69966"
                     /db_xref="GeneID:8199326"
                     /db_xref="GOA:C4R3D1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R3D1"
                     /translation="MSDPKPLPFVYQFLSGAIAGVSEILVMYPLDVVKTRIQLQVGSG
                     ANAEYTGIVDCVTKIVKNEGFSRLYRGISAPILMEAPKRATKFAANDEWGKFYRNAFG
                     VQSMTQSLAVLTGATAGATESFVVVPFELVKIRLQDKSSKYSGMGDVVKQIVKKEGVL
                     SLYNGLEATLWRHIWWNAGYFGVIFQVRSLLPKTESSTQKTANDLLSGAIGGTVGTIL
                     NTPFDVVKSRIQNTVKVPGVVPKYNWTLPSLLLVTKEEGFSALYKGFLPKVLRLGPGG
                     GILLVVFTTCMDFFRTLQ"
     gene            complement(<89146..>90312)
                     /locus_tag="PAS_chr3_0041"
                     /db_xref="GeneID:8199327"
     mRNA            complement(<89146..>90312)
                     /locus_tag="PAS_chr3_0041"
                     /product="Middle sporulation-specific mitogen-activated
                     protein kinase (MAPK) required for production of the o"
                     /transcript_id="XM_002492202.1"
                     /db_xref="GeneID:8199327"
     CDS             complement(89146..90312)
                     /locus_tag="PAS_chr3_0041"
                     /codon_start=1
                     /product="Middle sporulation-specific mitogen-activated
                     protein kinase (MAPK) required for production of the o"
                     /protein_id="XP_002492247.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0041"
                     /db_xref="EnsemblGenomes-Tr:CAY69967"
                     /db_xref="GeneID:8199327"
                     /db_xref="GOA:C4R3D2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R3D2"
                     /translation="MISSQKPIGNKKADIEVAVKKEYSVYSKANFYLNSRYQVQQVLG
                     KGSYGVVCSVLDLKSENPVPLAVKKVSNIFTREVLLRRAIRELKLMKFFRGHRNIINL
                     VNLDIVYIKPYDGLYCFQELVDYDLARVIHSNVQFSEFHIQSFLYQILCGVKYIHSAD
                     VIHRDLKPGNILVTVLGNLKICDFGLARGINHQFMQGSSRPRDNAITNYVATRWYRAP
                     ELIFSRKEYGKAVDMWAVGCIFGELYGRKPLFIGDSQMSQIAEIVKVLGSPSKEVIMA
                     YGSHLAWDYFQPPKPQYRPLKWAHVYPYASGSALDLLSSLVCWEAKRRLDVEAALSHE
                     FLSAVRNKSQEPKCKSIFDFRWEKENTSLEDLKILLHEEVTQFKNERENNSQPN"
     gene            complement(<90461..>94483)
                     /locus_tag="PAS_chr3_0042"
                     /db_xref="GeneID:8199328"
     mRNA            complement(<90461..>94483)
                     /locus_tag="PAS_chr3_0042"
                     /product="Myristoylated serine/threonine protein kinase
                     involved in vacuolar protein sorting"
                     /transcript_id="XM_002492203.1"
                     /db_xref="GeneID:8199328"
     CDS             complement(90461..94483)
                     /locus_tag="PAS_chr3_0042"
                     /codon_start=1
                     /product="Myristoylated serine/threonine protein kinase
                     involved in vacuolar protein sorting"
                     /protein_id="XP_002492248.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0042"
                     /db_xref="EnsemblGenomes-Tr:CAY69968"
                     /db_xref="GeneID:8199328"
                     /db_xref="GOA:C4R3D3"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R3D3"
                     /translation="MGAELSLLAPTAQPIALSAYVDFLSNIQYNKPLGTSRFLKTVKG
                     LNDQGSIVVKVLVKPNSGLDLSEWVEKLEFLRLKLLDVPNVIPYNLVIDSVRAGYLIR
                     PFQQRTLYERVSIQPYLEPIEKKWIAFQLIHAVMECHERGQYHGDIKSENVLLTSWDM
                     VFLTDFAPFKPIYLPGNNPSQFSFYFDTSRRNVCYVAPERFLGEGTPTQYQEVDKLTS
                     SMDIFSLGCTVAELFLEGSVLFTLPQLFKYKKGEYTPSLSGIVDNDLRNMIQEMIDLD
                     PRKRISAHDCLRKHRGKVFPEYFYSFLYDYMLELSTPSDHSVGNWRFDECDRRIERIY
                     NDMGMICDKLDVNLDLNIVHSFTEEPSQNVIPMTLRLPGVEPHIPQSSKTPYDSALII
                     LNILLHSMRNTTHSSYRIKSCDLILMISEMLSDEQKLDRCLPYLVHLLNDPSIDVQAA
                     ALKYMTQLLLLVDYLTPVNVLIFPEYILPKLASFLSTTKGSYMRMIFATILPHLAKTA
                     LKFYEMAILLGSHVEKFELLKNFENLTIQLLIDPDSSAKISLLKNILPLASVFGKDKT
                     NDIILSHMITYLNDPDENLRVAFIESILGLSIFVGITSLENYILPLLVQTLTDNSEIV
                     VVNVLRSFAELNNLGLIKKRYKFDLIKVSSKLLLHPNSWIRLGTLRLLISVVKDLSLT
                     DFYCLLYPLVRPFFEYEVTNFDWATLYPCIIKPIPRSIYTLSITWALKAEKTLFWQQV
                     KLAKPDPFGSRNSTFLLNRNSKIGESGVVSNNQIPTSPEDIGWLGKLKASGFDEKDLW
                     KIATLRDYIFRVARSRSNIPTQENNEVTMQQMGIYPRIVFFEKGSMYETEGFVTGSSM
                     MANYRILVNSEYSPESLTKRKTVGGVNTNHTYSGANPYILKFLECIKFRHVLDDSEEF
                     GPSIPSATVEEGHWKFEGVLVSHLTEHTGSITSLALSPDQQYFLTGDSKGIIRLWDVL
                     QLERNGYATSHVTVSMSSSVKDIKFIENRNSFCAVTADGEIKIFRVEINSTSSSVRSN
                     GSPHRHESISLLREHSLEGEHISDMKFIGPNLAVTTLSCKLILFDLRDMQIAEEIQNP
                     VSHGFITSFDLDSSQSWLLIGTSKGILDFYDLRFELLVKSWKLKSTSYPIKHITVPPA
                     GFTCNRKSERFALINGGTNDSVTIVFDVSKGQCSELYFTETVNLNTAIDNYEVLEVDN
                     GEERTRTSVLATEVEDRSITSLTMLGSNQFLTATFDKRVILWDTGNKANSSALISKLD
                     DFTSSFSSVQVRPHLMAINEKIVEKDPQNIGGPKRNMASANSSTFDLHSDIITGIAVI
                     QKPLKMLILVDRAGVINIYK"
     gene            complement(<94614..>95999)
                     /locus_tag="PAS_chr3_0043"
                     /db_xref="GeneID:8199329"
     mRNA            complement(<94614..>95999)
                     /locus_tag="PAS_chr3_0043"
                     /product="peroxisomal integral membrane protein"
                     /transcript_id="XM_002492204.1"
                     /db_xref="GeneID:8199329"
     CDS             complement(94614..95999)
                     /locus_tag="PAS_chr3_0043"
                     /codon_start=1
                     /product="peroxisomal integral membrane protein"
                     /protein_id="XP_002492249.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0043"
                     /db_xref="EnsemblGenomes-Tr:CAY69969"
                     /db_xref="GeneID:8199329"
                     /db_xref="GOA:C4R3D4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C4R3D4"
                     /translation="MPNRLIPLANPANRVLQLDAKLLDNEISDMLYRQLSGAFNSNRL
                     PSWLGRIHSNYASELKLLLELLIFKVTVWNKHSSYGLTLQNLVMYDGGVHNKKFRSKQ
                     QSELRVTKKILLLSSVLLGYFVKKIQSYVYSFEDYDLETDGEDLSTLERIRLKTIKLL
                     KSQISTLEKAHSVLSLVNFVTFLVSGSFPDLTTRILNIRFKPLVTTQVAFASNPETIS
                     YEFQNRQLVWNTLTEFIVFILPALSVPKFTKSLVSSITGTSPKSSQVTDEDLKVFSSL
                     PERVCAICFQNSQNSDSGAQNDISLNDTLVTNPYETTCGHIYCYVCILSKLQIFKEEG
                     KNLPKSDPNKYWHCLRCNEPASWCRVYTGDVEDALRQKAVEEVTEDEDASSEDEEKRD
                     QDSEGAKTVSQSFHHVNGSDYQTASFIEQAELNENEYTDGSEVEIYDAEDEYTDEEVD
                     DDSPGFFVGAL"
     gene            complement(<97204..>97995)
                     /locus_tag="PAS_chr3_1146"
                     /db_xref="GeneID:8199330"
     mRNA            complement(<97204..>97995)
                     /locus_tag="PAS_chr3_1146"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492205.1"
                     /db_xref="GeneID:8199330"
     CDS             complement(97204..97995)
                     /locus_tag="PAS_chr3_1146"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492250.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1146"
                     /db_xref="EnsemblGenomes-Tr:CAY69970"
                     /db_xref="GeneID:8199330"
                     /db_xref="InterPro:IPR000979"
                     /db_xref="InterPro:IPR024654"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R3D5"
                     /translation="MLLLAIGDFHIPDRASSIPAKFTKLLAPGDKIQQVLCLGNVCES
                     PSTLEFLKGISPDFQMVKGEFDRDLSLPTSLVFNYDKLKIGLINGFNVIPNADPLSLL
                     TQARLMNVDVLVSGGTHKIEAYTLDGKFFINPGSATGAFTTKAPSKADLEALNVDKNL
                     AEDKEEDNDGKEDKDNKEREHQKQANEKTSEKPSPQTFKGETSNQVTPDEDDLDNINT
                     DSLEQLDPIPSFCLLDIQGNVCTLYLYTCIDGDVKVDKVSYRKED"
     gene            complement(<98764..>100146)
                     /locus_tag="PAS_chr3_1147"
                     /db_xref="GeneID:8200179"
     mRNA            complement(<98764..>100146)
                     /locus_tag="PAS_chr3_1147"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492206.1"
                     /db_xref="GeneID:8200179"
     CDS             complement(98764..100146)
                     /locus_tag="PAS_chr3_1147"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492251.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1147"
                     /db_xref="EnsemblGenomes-Tr:CAY69971"
                     /db_xref="GeneID:8200179"
                     /db_xref="GOA:C4R3D6"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:C4R3D6"
                     /translation="MKRKTDDHSGNPRKSKLPPSLRDKVEAAKQKLNGTPTGKTVEKT
                     ALNVELHPLLKQNVTSSIIPKDYNPVLHTKVRPGFSASQLNPYLDQTTLSKPTRPYRP
                     LKFVEKGTYVKKAEEQRERLKKQQEEQQLRSEKESLGLEPDEALGEQYYKPILPPSIE
                     PWDKPLLKGNSYDNLDDVTFLDSEDEDNPITIYIQHPVPIPCPWEKNEPAPPSLYLTK
                     EEQKRLRRNERAIKHKEIQDRIKLGLDPAPPPKVKLKNLMNVLTNDAIKDPTALEAKV
                     RAEVEERKLKHEMTNEERKLTPEQKAVKRELKKMKELDRGIYCAVFKIDRLVNPKHIY
                     KVDINAKQNSLVGSIVSVKDTFSLIVVEGGEKSIRKYKNLLLNRINWTENEHKKKPEG
                     EEKTDQEEPILEDLSSNQCFLLWEGPIADFRFRGWSNKQFEDELEALNFLGFHQAEMY
                     WREAKVTFSQ"
     gene            complement(<100280..>110206)
                     /locus_tag="PAS_chr3_0044"
                     /db_xref="GeneID:8200180"
     mRNA            complement(<100280..>110206)
                     /locus_tag="PAS_chr3_0044"
                     /product="E3 ubiquitin ligase of the hect-domain class"
                     /transcript_id="XM_002492207.1"
                     /db_xref="GeneID:8200180"
     CDS             complement(100280..110206)
                     /locus_tag="PAS_chr3_0044"
                     /codon_start=1
                     /product="E3 ubiquitin ligase of the hect-domain class"
                     /protein_id="XP_002492252.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0044"
                     /db_xref="EnsemblGenomes-Tr:CAY69972"
                     /db_xref="GeneID:8200180"
                     /db_xref="GOA:C4R3D7"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR010309"
                     /db_xref="InterPro:IPR010314"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025527"
                     /db_xref="UniProtKB/TrEMBL:C4R3D7"
                     /translation="MEDSQLIDETIVRPEVKIPDHTKNYIKYLSECSLSELESELGKV
                     TCWNSSKTDLYYWVPLLNRMDSILKEKVTKYNLEEEFAKPVEIQPADESLLAAILTFS
                     SLLFANCYNNSIYASTKHVYNLINCCSVPVLLAALRLCVALGDATIQTGTMKYKESKV
                     IDKFVNMSIGFLPPTPPVLSNKPVSLNAGSPTDPGSEGQFNLADCCKLTSRKVPTKWK
                     MLDFEYYNSDEKRTNEIGPKRKKSKLTPTNTQSSSGNDASSSKQKSVNFSREGVQHLI
                     ISEENMRKFSLQQIFDKFYDKLPKECFFDFALAVQIAKAFNTDTFESLKLRQQLVSIK
                     CMAISYLSCMQSATDFLDSVLSSDSTLINDLCELIDPSLETPDIIYESAGKALECISY
                     RKVFSLEILKALNGHVSYGSLFRYIKQYIKMMKDDSVVIPENRILLFNLLRNLLATKH
                     VAQSLSNTDILTLLIDLLSIRSSHRFHLSAGITVLCQYIEVIPRSLDKFILNNGFQLL
                     LKAIDDEIHYSLQNPGIPPADIIVSYNISFHQMLYLRELMIFVLSLIQTDSGDRMRNL
                     FDSILLEHFNLVLDNPKTFGSPIVICVVSSVSAILHTEPTAFSILNESGTIDRLLKSY
                     PQLFDSSNDLIQSLFDVFGALSLNKDGLNKVVESKSIDIFFEIFRNDNYSYELVEAAP
                     QLANSLDQLTRHFPELKPIVMDNIIRLIEDIPNIVSKTFPPTEFFQHPNGSFYKSKDD
                     VVVEKEEGVEKLKPLEATRGGLMYENVTYLITVLLEHNSRWKDITKKITFQKLLKFII
                     IDNAPYDFIVSDSLYSFMGVLKYYDDEDRNYGFVPLLDCIDEYTWKLHEFTHYEKDDV
                     SFFSQYEKMENGNIIGGKVIDNMKTLNALFFLLTDSYFSPGSLFSERMGQASSYFTSQ
                     KGAKLLKELVLYFRRLILEEVIIQRFTPDSVCEDTTFFAKVDFAPVQMTLGKQSDVKK
                     KIDSAPNTKSKNIAQLRLQINRAHTWLGFTFGSICRITMHKTQDRPASLGFKNAVHIL
                     SDFTIYITELYGNISTQDILIERAYHGIVTSLLYRLLVTRSRTLDLAIFAFAIVLLQS
                     DTFQILKKLLISCSTQLTTFDPEKLKEESKNFKTVSMNIESLTLHTIRYILSIFAIVG
                     NKSNLTLIPAARVYYEGDISGFGTLHNELVPSFLTQFRLFSLGMLLEVLSPLDDGIDL
                     LSFDKVVRSFPPVIVELFITISKNAYSHLGENSSTVPNGLLYPLVWQNVHPTNSRVDY
                     LVSLGLDRSDALEFLKSTGNSLAPILKDEVPFYQGDLSQDRIEELAAEAKNRPYIVPK
                     LEPLKPQYSNFSTHDELVFLRKANESAFVERWFIFAELFPDCVEKLSDLLIHVFLKNP
                     GTTSNFERTILSTLLAIILSLDTSSSEDEDKLAGTIGLFANLIKDSEVYDLGTESLEG
                     FLSFCADSISAEFVNCSWFPKLLFAFEHILVFTSFPEPEKLEVGIADIVEAQIPKFAD
                     SYRAPSAPLDEIFDTIIHCKNLKTMEVTIALSRVLSIFAKDDLKARKIFDSGILNELI
                     RASSLFTDDSNFPKLQNYLLLLMRTCMETGPILETLMDHYLQKKLSDSRTLSTLLKAN
                     GVLAARNPQILAECIGSSVRLSKCVDPLESLSIVPLKKGNEIEDSIMTDATTGKSTDE
                     LSEEPDYRQNTGLVHTLILELMSVCKNDIFSSPESSEPISPDNIRKSKQKLLKLFENK
                     HFGYAVFLLHATAELVSSYKQSKLEFLTFSRKKTIQSCQRPRPTALNFILHTLLGTEN
                     SGDFDESETQRRVIVSNLIKMIVFGFVSTPISKFDPNLPTKVDPDMTYVRQFTTDVLS
                     KVLTDTHSSVESPSTRYRKLSVFTELLQKLISEKRDLCGHGLDILFTKYDAYQMTKVL
                     VEKNFASLLTSLVSSFDLNFPNANGVMKPLLGCISSLGRIKHTYSDLLKDGQDGEDTH
                     STDSEEEEDNDEDMDNRDDTPNLLRNSTLGMYDVADVDNEDYSSEGGYEGGYEDLSED
                     NEHGPIEIIFSDDEDDDIEDDENDTYQGSSDMVIEDLDSAEIIEDDSNSEGPTDEEYE
                     IVNNGNFLINGREYENVEYDESDAQNDASFDEEVPFDSENPSFDDDAGDDTDYDGWLN
                     ILGAEDGDEDEEDEDEDNEHEELNRHHIGSRRGRQIVEIDRLGEEDPDLFASGNMESS
                     RLRSMIEHLFEADDQIAGAFERDGVRVSVVDNNGLIGLVDRPSKFMKPPSLEMKSSYE
                     RWSVANDIYGKVEYDALRLLPGLINMLFPPSYEIYKEKKEREEQKRLEREREIKRQQE
                     EREKELLERERSRQLETEQQQSQVDTADAESDEEDSEPIIINIGGEDVDIRGTGIDPS
                     FLLALPDDMREEVFTQHIRERRAQSSGDNASMDDIPSEFLEALPDSIRREVQTEESNF
                     RNFLLRGNDEDDSDQFDLSEETDSASQSTKKKFVLKKHKYYRTPLVDKFGICALIRFL
                     FLPQNKYDIDSLKQAFLQLSHNKQTRSEIMQMLLLVLHEATQDQKAIERIFYQLTSRS
                     NSAAQKILLKEEPISDGGIDSKELALQQFPISCTPLILSTQALEIINYLLNADVEFRY
                     YFLTLHDHQQLLKKFNKKQKLKEKDSYQKGPNYPINSLLSLLDRNIFLGDSFVLKQLC
                     YAVHIATKPLGKFKKLQEKKLKDGETVKPDVQFPFVSDENLKKLVSILVTDDCTSSVF
                     RKVVGGLQNLSILEEKRSILAQEISENATNLGKQLVVDLEQLSSRIKNADENVDELSS
                     ETLEKFTTASSKQAKLLRVLTALDYLFYTKKSADASESEIEALTNLYKSLALGPLWGG
                     LSECLVTLRDKKTLQYIATILSPLIESLMVVCKHSKVKELPIREVLKYEQKKNDFVNE
                     PIESLFFTFTDEHKKILNQMVRVNPKLMSGPFSMLVRNPRVLEFDCKKNYFDQRLHEG
                     NEKRPKLSISVSREQVFLDSYRALFFKKVDEIKNSKLEISFKGEAGVDAGGVTREWYQ
                     VLSRQMFNPDYALFIPVASDKTTFHPNRTSYINPEHLSFFKFIGRIIGKAVYDNCFLD
                     CHFSRAVYKRILGRQVTLKDMETLDLDYYKSLVWILENDITDIIDETFSVESDDYGVH
                     TIVDLKPNGRNILVTEENKQEYVRLITEYRLQTSVKEQMNNFLIGFHEIIPKDLVAIF
                     GDQELELLISGLPDIDVDDWKANAVYENYSPSSIQIQWFWRAVRSFDVEERAKLLQFA
                     TGTSKVPLGGFKELTGVDGVSKFSIHRDYGSTDRLPSSHTCFNQIDLPEYESYETLRG
                     SLLLAVTEGHEGFGLV"
     gene            <110554..>112191
                     /locus_tag="PAS_chr3_0045"
                     /db_xref="GeneID:8199331"
     mRNA            <110554..>112191
                     /locus_tag="PAS_chr3_0045"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492208.1"
                     /db_xref="GeneID:8199331"
     CDS             110554..112191
                     /locus_tag="PAS_chr3_0045"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492253.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0045"
                     /db_xref="EnsemblGenomes-Tr:CAY69973"
                     /db_xref="GeneID:8199331"
                     /db_xref="UniProtKB/TrEMBL:C4R3D8"
                     /translation="MSYLFTFFVIVHIYKTPTDYMGDTDSISTNYTMDTNQKDQEGST
                     AASSPSKIDLTGMKPQPLPIAPNMIDGLKPVRRTKIGDIKSLFEPKGDGSQIVHLLAE
                     IKDTLEEQNVAKTTPNAELSDIKELLISMVDRSKSNKALLNTLIQEESTPDNEMLVEI
                     RDMIFNMIDRSKTNKSSLDDLRGHFDEQISDRLSQVCKTVEQQSTDIHEKMKTLLDSK
                     VNSSLLSELDSKLGNIVDHETEELKSLKATVSSLTKKSDIQGIELKLTDFSERMERLQ
                     ESNDLKDSRLEEKFDKLVQELTTNNTKLESRQELKEKELEQKIVGKDEIIDVLKLEIH
                     DLHRKLQYSNEKHTNELEAKSNEILSLRQLLNDSNMQNTAIQEELSTLKAKGLESSQL
                     QASIEEMKREKSVLTRTLISSCARIKNQQEVFQLWSDRTEDIKSNLLTLQETLKSDRS
                     FIIPLKRPSTEGVDQLQESKNSPKKHIEVHHEEVGNISNGSIMSPIFMEKLSPKKRIV
                     SSPSKILSNRCLNSNSATPSKSPIRLSSTKNFTEQEN"
     gene            <112368..>114548
                     /locus_tag="PAS_chr3_0046"
                     /db_xref="GeneID:8199332"
     mRNA            <112368..>114548
                     /locus_tag="PAS_chr3_0046"
                     /product="Protein required for S phase progression and
                     telomere homeostasis, forms an alternative replication"
                     /transcript_id="XM_002492209.1"
                     /db_xref="GeneID:8199332"
     CDS             112368..114548
                     /locus_tag="PAS_chr3_0046"
                     /codon_start=1
                     /product="Protein required for S phase progression and
                     telomere homeostasis, forms an alternative replication"
                     /protein_id="XP_002492254.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0046"
                     /db_xref="EnsemblGenomes-Tr:CAY69974"
                     /db_xref="GeneID:8199332"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3D9"
                     /translation="MDKQHSILSFYSSFNTDVVDLRLGASESRVSSTGVSSTSSNETT
                     DRGVNDRRKVVKINDLLTGNMIKHRKEVTEASETIEETMRNLDPVRDIRNHEIIDLDQ
                     EQQNPPPKKNRVSLLSLLDGKGVRDKPTKPIEDTKLLVTLKISSSALKDIQKKIDRQE
                     LHTPGVAISNRDPLKPAFSFLNEIQLRAQRALENKHNESGSDCLSSKGMLPPPLKVGD
                     FLTQNVTDEVYNCPRRTLSLPSRANTRNHAVIDFPQALGDLKTEKTNPDPLRATKYHY
                     TTSDFQYHDLTRLVQEQVPDVKRHYGLECLIGLFHDIDFQRKIAHNSSQWIDLFKPTE
                     YKELLFSSDVSTGINDWIQSAFEKLQNMDRTKRKPAHASKKPKRDDNLDDFIVYDDIE
                     TIEVELFAPLLIIEGPAGSGKSSSIFTIVERQMKGFVFEINTGESRARKDIGFHLEQI
                     ATTKLVKRMTKGYADMLDISVEDFENISNQKGVILFDDCDVDLEDDKDLFITIKNLLE
                     YSHRPIVLTCTDSTKIPPDLIELSTVIQIDRPDEKLLSDYLFIIGCLMRFTIDRPILN
                     ELARLQDIRRSLMQLQAICNCKPPEGKIIQVKQVTPNTFEKVVAESNIQQLERYYDSL
                     QDDVMLPTIPNFDSLREEYLEFYASKAIRAGSRKWRPLYKNSKTYLIKYPFSVFQRLS
                     ITNTALFTELAPIIRLFARMDVIMDGIRRFLHNPTKILLGLHSR"
     gene            <114723..>117176
                     /locus_tag="PAS_chr3_0047"
                     /db_xref="GeneID:8199333"
     mRNA            <114723..>117176
                     /locus_tag="PAS_chr3_0047"
                     /product="Nuclear actin-related protein involved in
                     chromatin remodeling, component of chromatin-remodeling
                     en"
                     /transcript_id="XM_002492210.1"
                     /db_xref="GeneID:8199333"
     CDS             114723..117176
                     /locus_tag="PAS_chr3_0047"
                     /codon_start=1
                     /product="Nuclear actin-related protein involved in
                     chromatin remodeling, component of chromatin-remodeling
                     en"
                     /protein_id="XP_002492255.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0047"
                     /db_xref="EnsemblGenomes-Tr:CAY69975"
                     /db_xref="GeneID:8199333"
                     /db_xref="GOA:C4R3E0"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027668"
                     /db_xref="UniProtKB/TrEMBL:C4R3E0"
                     /translation="MSELSDSEVKVEVEEQAVPKKTPKQESSESTNGSAPKKQKRGSA
                     ASGQKVSAEILQRRREGRIKALATLQSKLDKLGIKRVDQKNALPASTVPSISLINQKN
                     YFTGYLKRDEQNLSIKNVKEMNRLLAEKKKKDKLSKSSAGTSTNTPDVDGEDEDDNDG
                     DVDERVGSNTIVMHPGTTNIRIGLATDIDPKIIKNVIAFPRRPGQESTKGYIFESRKG
                     SEHEAKEFETHLPSIVSSFRERMRYYKRRILPNSNETVANFNKRQEPQVVEDHNDIHK
                     VDFLDSKKLLNDPEVKYLVGDDALRLDDYSDWILRSPFYKGNFNEDKSIYRSNQEILG
                     DIELVIKEGLSKNLGIEPAKYADLNIILIIPNLYDKTYVAEMTNLLINMSFANIGVLQ
                     EGVSATFGSGISNGCVIDIGSHYTKVCCVDEGMIIPNSQIELDYGGDDVTKTFAKMLK
                     RNQFPYKELDLSRITDWNLISQLKEKYLTFEDADIAIQLYNFSVRNPHQLTKKYDFKV
                     FDEVMISPMGFFYPEVFGARGSPINRKGNFFDVHRDYFSGRYDSPLSRSQLDQVEGKF
                     LANMEDLEEIVNRLLSESCGLGSNYNMGNNSNTSSGNNNLGNTGAATAGSEDSSDYME
                     IEETKLKKQIKNFLELKKEGKGLNLTPLELAVIESISYAGFQDMNKLKKLYENILIVG
                     GSSKIDGLDLILVDRIHIARSPVLYSTSLDQAIKYITLKKEEFEKANKDSKTEGDVKE
                     FKITEEHLEHLRGLLEGTSAVPIEILSSSRDIDPAEMCWKGGSVYARLKIVNEMWINK
                     EEWNIFNDRAFNYKCLFTF"
     gene            complement(<117173..>117853)
                     /locus_tag="PAS_chr3_0048"
                     /db_xref="GeneID:8199334"
     mRNA            complement(<117173..>117853)
                     /locus_tag="PAS_chr3_0048"
                     /product="Essential t-SNARE that forms a complex with
                     Tlg2p and Vti1p and mediates fusion of endosome-derived"
                     /transcript_id="XM_002492211.1"
                     /db_xref="GeneID:8199334"
     CDS             complement(117173..117853)
                     /locus_tag="PAS_chr3_0048"
                     /codon_start=1
                     /product="Essential t-SNARE that forms a complex with
                     Tlg2p and Vti1p and mediates fusion of endosome-derived"
                     /protein_id="XP_002492256.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0048"
                     /db_xref="EnsemblGenomes-Tr:CAY69976"
                     /db_xref="GeneID:8199334"
                     /db_xref="GOA:C4R3E1"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="InterPro:IPR015260"
                     /db_xref="UniProtKB/TrEMBL:C4R3E1"
                     /translation="MDPFNDVYKDAVSQVNQLDGIINNLTPKNINQSNIDDIENNKQE
                     LNETIQDLRDTVRIIRENNDNYNISEKELDERIAKVDKISATFQQLNLHWNDKLAKRP
                     KEVTTMANRISQDYGNENPFNNDTAFQEFQQQEVLREQDQHLDSVYNTMQNIHLQAST
                     MGTELEDQGILLDDLDTDFDRVGGKLTSGVKRIEWFIEKNKERASDCCIILLIIALIF
                     LLVLLFIA"
     gene            <117945..>118097
                     /locus_tag="PAS_chr3_0049"
                     /db_xref="GeneID:8199335"
     mRNA            <117945..>118097
                     /locus_tag="PAS_chr3_0049"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492212.1"
                     /db_xref="GeneID:8199335"
     CDS             117945..118097
                     /locus_tag="PAS_chr3_0049"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492257.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0049"
                     /db_xref="EnsemblGenomes-Tr:CAY69977"
                     /db_xref="GeneID:8199335"
                     /db_xref="UniProtKB/TrEMBL:C4R3E2"
                     /translation="MPCHRRMMDIRKVIKFSDVGDITMAVCGIHFRCRLFSFNKGIRR
                     QSYSTI"
     gene            <118548..>119780
                     /locus_tag="PAS_chr3_0050"
                     /db_xref="GeneID:8199336"
     mRNA            <118548..>119780
                     /locus_tag="PAS_chr3_0050"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492213.1"
                     /db_xref="GeneID:8199336"
     CDS             118548..119780
                     /locus_tag="PAS_chr3_0050"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492258.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0050"
                     /db_xref="EnsemblGenomes-Tr:CAY69978"
                     /db_xref="GeneID:8199336"
                     /db_xref="UniProtKB/TrEMBL:C4R3E3"
                     /translation="MSLNVTPSILLPHIPSTGVDRYKNVNFLLRLNEDLVSAIQETTL
                     EQDVPKLIVKNGKLSFRIKGKLLEATVLRDNLKTELYSSSEDERFINMGTLDYKINMA
                     KSNIARCPQQPHKSLLKTSALSHQRSHPFLLTSSSAPPSPSPSSSSFSSSLHSDVQHL
                     IQQFLLKGNSLTKEEVGALISKSKVPKAALRRMISKVHDVNYVLRDFYLLQVNCHLLG
                     AMQRHTIRQYLSCKLDQIGYPENHPLKLKILHALPDFKFFKKKKIQSPKPVASPIAST
                     SKAENNSPSPSSSASSDGLKKRKADNVSPITSSEDDVKKTKTTKTTTTPVPKTVDPEL
                     LQLAINFKAKYPEYEKLYKSLSKPNCDPNHDKSWEHKQLTKLVKMHNQLSAWKAKLWE
                     EEDNMRAKSSGKVYIKEK"
     gene            complement(<119796..>120821)
                     /locus_tag="PAS_chr3_0051"
                     /db_xref="GeneID:8199337"
     mRNA            complement(<119796..>120821)
                     /locus_tag="PAS_chr3_0051"
                     /product="Subunit of the SAGA and SAGA-like
                     transcriptional regulatory complexes, interacts with
                     Spt15p to act"
                     /transcript_id="XM_002492214.1"
                     /db_xref="GeneID:8199337"
     CDS             complement(119796..120821)
                     /locus_tag="PAS_chr3_0051"
                     /codon_start=1
                     /product="Subunit of the SAGA and SAGA-like
                     transcriptional regulatory complexes, interacts with
                     Spt15p to act"
                     /protein_id="XP_002492259.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0051"
                     /db_xref="EnsemblGenomes-Tr:CAY69979"
                     /db_xref="GeneID:8199337"
                     /db_xref="GOA:C4R3E4"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4R3E4"
                     /translation="MTDAKDKDHKYRYRMEIQQMMFVSGETNDPPVETTSLIEDIVRS
                     QVVEIVLHSSQTALSRGTKSIVPEDVIFLIRHDKAKVNRLRTYLSWKDVRKNAKDQQS
                     GDLADIGGDDLLDNSTSQVAASGAPGAPGSSSSTSMDSKMLSKYKKSKIRLPWELQFV
                     FTEQPLDTNEDDAEDEDERAATLASLKRLKTNDERTKNMTKEEYVHWSECRQASFTFR
                     KAKRFREWCGLSHLAESRPSDDVIDILGFLTFEMVCSITEEALIVKMLEEQNGDLASS
                     TTTIQKLQESHRKRKHLFDGPDKDVRPITSGHVLEAWRRLQKRNVEKKAIRNFQGGKL
                     RSRVQLI"
     gene            <121028..>121990
                     /locus_tag="PAS_chr3_0052"
                     /db_xref="GeneID:8199338"
     mRNA            <121028..>121990
                     /locus_tag="PAS_chr3_0052"
                     /product="Thiamine pyrophosphokinase, phosphorylates
                     thiamine to produce the coenzyme thiamine pyrophosphate ("
                     /transcript_id="XM_002492215.1"
                     /db_xref="GeneID:8199338"
     CDS             121028..121990
                     /locus_tag="PAS_chr3_0052"
                     /codon_start=1
                     /product="Thiamine pyrophosphokinase, phosphorylates
                     thiamine to produce the coenzyme thiamine pyrophosphate ("
                     /protein_id="XP_002492260.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0052"
                     /db_xref="EnsemblGenomes-Tr:CAY69980"
                     /db_xref="GeneID:8199338"
                     /db_xref="GOA:C4R3E5"
                     /db_xref="InterPro:IPR006282"
                     /db_xref="InterPro:IPR007371"
                     /db_xref="InterPro:IPR007373"
                     /db_xref="UniProtKB/TrEMBL:C4R3E5"
                     /translation="MVFIKTTEPNFVAENADLVDIPVPTDPSINVIRPLHPIIRYQID
                     DNKVPGKTCLVILNQKINLFPRVFEKLWDNTYLRVCADGGANQLLSFVRENGLDEQKY
                     LPKYIVGDMDSLTEETKNYYLSTGKVIVKTQSSQYATDFDKAITVCFLHFNYPNFFND
                     FDTLNLDDNNGLTTLKNSLDTKEFTVPLDMIFLGAIGGRFDQTIHSIGELYKHASDNL
                     LQMRFFNTEYLEIIFLVPKGTNFIVLEKQHVDDPLCYLGLLPLNNPFIMHTKGLKYDV
                     ANYASSMTGNISSSNYNVGSNGFYVQNTDHLVVNIDLNHILGEV"
     gene            complement(<122032..>122976)
                     /locus_tag="PAS_chr3_0053"
                     /db_xref="GeneID:8199339"
     mRNA            complement(<122032..>122976)
                     /locus_tag="PAS_chr3_0053"
                     /product="C-4 methyl sterol oxidase, catalyzes the first
                     of three steps required to remove two C-4 methyl grou"
                     /transcript_id="XM_002492216.1"
                     /db_xref="GeneID:8199339"
     CDS             complement(122032..122976)
                     /locus_tag="PAS_chr3_0053"
                     /codon_start=1
                     /product="C-4 methyl sterol oxidase, catalyzes the first
                     of three steps required to remove two C-4 methyl grou"
                     /protein_id="XP_002492261.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0053"
                     /db_xref="EnsemblGenomes-Tr:CAY69981"
                     /db_xref="GeneID:8199339"
                     /db_xref="GOA:C4R3E6"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:C4R3E6"
                     /translation="MTEIFNSTYLDSIRGPTFSDITKNIFATQPHLTFLEKIWAAYYT
                     YMSNDTLATGLLFFMVHELMYFGRCLPWFIIDQIPYFRKWKIQPKQIPSNKEQWECLK
                     SVLKSHFLVEALPIWTFHPLCKTLGISVAVPFPSWKTLALQFSVFFVLEDLWHYWFHR
                     LFHYGAFYKYIHKQHHRYAAPFGLAAEYAHPVEVMALGFGTVGFPLLWAYFTRDLHLF
                     TITCWITLRLFQAVDAHSGYDFPWSLHNFVPFWAGAEHHDLHHHYFIGNYASSFRWWD
                     YTLDTEAGPEAKKEREERMKLKAERKAAALAQKNKKIA"
     gene            <124224..>124769
                     /locus_tag="PAS_chr3_0054"
                     /db_xref="GeneID:8199340"
     mRNA            <124224..>124769
                     /locus_tag="PAS_chr3_0054"
                     /product="60S ribosomal protein L20"
                     /transcript_id="XM_002492217.1"
                     /db_xref="GeneID:8199340"
     CDS             124224..124769
                     /locus_tag="PAS_chr3_0054"
                     /codon_start=1
                     /product="60S ribosomal protein L20"
                     /protein_id="XP_002492262.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0054"
                     /db_xref="EnsemblGenomes-Tr:CAY69982"
                     /db_xref="GeneID:8199340"
                     /db_xref="GOA:C4R3E7"
                     /db_xref="InterPro:IPR021138"
                     /db_xref="InterPro:IPR023573"
                     /db_xref="InterPro:IPR028877"
                     /db_xref="UniProtKB/TrEMBL:C4R3E7"
                     /translation="MSSTNTVPPVSQYKEFEVIGRRLPTETVPEPKLYRMTIFAKNET
                     IAKSRYWYFLQKLHKVKRASGEIVAIKEVLEERPTEVKTFGIWIRYDSRSGTHNMYKE
                     YRDVTRVGAVQGMYQDLASRHRARFRSIHILKVVELTNDDDIKRQYVRQFLEKDLKFP
                     LPHRVPKTQALYASKRPSTFY"
     gene            complement(<124898..>126043)
                     /locus_tag="PAS_chr3_0055"
                     /db_xref="GeneID:8199341"
     mRNA            complement(<124898..>126043)
                     /locus_tag="PAS_chr3_0055"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492218.1"
                     /db_xref="GeneID:8199341"
     CDS             complement(124898..126043)
                     /locus_tag="PAS_chr3_0055"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492263.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0055"
                     /db_xref="EnsemblGenomes-Tr:CAY69983"
                     /db_xref="GeneID:8199341"
                     /db_xref="GOA:C4R3E8"
                     /db_xref="InterPro:IPR013964"
                     /db_xref="UniProtKB/TrEMBL:C4R3E8"
                     /translation="MSKEKSTRRSIFIPPSYSDQNETQQKTMELENLEQELTLTLQQI
                     DSDLTKTNRIINDSIIPVMRRYGAASQGVWQGVKVWKSFFEASANVQLSGYDEAMESY
                     DDSTLHNKNSVNTGKDSAKEFNDDGNTGAVSNHTTDDIQKRYRESHRIFEQKRGPDDD
                     TMTESFPTRIKNSTPNKTGRSFQFDDNTASVSLDPPSPTYHHLKAPKELSSEKDTSPN
                     KQTQNPDQPTTSSIFDSSKLQQAQEEQRNKLMFMHRALDNVWQVQMTPKKRENTPIVN
                     SRTPKRRSEHKVRKAPQYDSSPFNAPEPPQLQSDLRLSMPSSPLRQVDDDQDESFMVA
                     PQISVETKKMSESTQKEQLFDEIELPESTEIEDTTLKKIPGKYADSK"
     gene            <126206..>126521
                     /locus_tag="PAS_chr3_0056"
                     /db_xref="GeneID:8199342"
     mRNA            join(<126206..126367,126420..>126521)
                     /locus_tag="PAS_chr3_0056"
                     /product="Mitochondrial intermembrane space cysteine motif
                     protein"
                     /transcript_id="XM_002492219.1"
                     /db_xref="GeneID:8199342"
     CDS             join(126206..126367,126420..126521)
                     /locus_tag="PAS_chr3_0056"
                     /codon_start=1
                     /product="Mitochondrial intermembrane space cysteine motif
                     protein"
                     /protein_id="XP_002492264.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0056"
                     /db_xref="EnsemblGenomes-Tr:CAY69984"
                     /db_xref="GeneID:8199342"
                     /db_xref="InterPro:IPR007918"
                     /db_xref="UniProtKB/TrEMBL:C4R3E9"
                     /translation="MGNAMSQSVAPECTELKNKYDSCFNSWYTDKFLQGKSLQNECEG
                     LWDDYRECLEAYLIKKGIKPMVDETAKDAPFEEKGELQSKEKK"
     gene            complement(<126586..>127149)
                     /locus_tag="PAS_chr3_0057"
                     /db_xref="GeneID:8199343"
     mRNA            complement(<126586..>127149)
                     /locus_tag="PAS_chr3_0057"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492220.1"
                     /db_xref="GeneID:8199343"
     CDS             complement(126586..127149)
                     /locus_tag="PAS_chr3_0057"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492265.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0057"
                     /db_xref="EnsemblGenomes-Tr:CAY69985"
                     /db_xref="GeneID:8199343"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:C4R3F0"
                     /translation="MYRVSEIPRGSDPDSYFSSIYKPASGTSRTTAGPSSGTKRSSRV
                     NYNFQSLEAQAHGNTVPTTQAEEKASNKRFEELNRENYNEQAKIEIPKSGLEAFTKHR
                     RLKPGETASTKRILASRKTLVNYVEEVDPQLMKIFKATTVPSNRRHLKKLCSICGNNA
                     PATCVKCGARFCSVSCGRTHEETRCTW"
     gene            <127260..>128649
                     /locus_tag="PAS_chr3_0058"
                     /db_xref="GeneID:8199344"
     mRNA            join(<127260..127304,127393..>128649)
                     /locus_tag="PAS_chr3_0058"
                     /product="Oxidoreductase of the mitochondrial inner
                     membrane, involved in cytoplasmic and mitochondrial iron
                     h"
                     /transcript_id="XM_002492221.1"
                     /db_xref="GeneID:8199344"
     CDS             join(127260..127304,127393..128649)
                     /locus_tag="PAS_chr3_0058"
                     /codon_start=1
                     /product="Oxidoreductase of the mitochondrial inner
                     membrane, involved in cytoplasmic and mitochondrial iron
                     h"
                     /protein_id="XP_002492266.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0058"
                     /db_xref="EnsemblGenomes-Tr:CAY69986"
                     /db_xref="GeneID:8199344"
                     /db_xref="GOA:C4R3F1"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR021163"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C4R3F1"
                     /translation="MIRQFVRFYSQKVAILPVPYGLSRFGVAPDHPEVKECQTRFEEV
                     AHDKRFNFYGNVDIGKDVSIEMLKDNYNAVIFAYGCSEDNKLNIKGADHKGVISSRQF
                     VGWYNGVFDLQDLNPPLEKARRVVIIGNGNVALDLTRVLLGPVDPLWKSTDITAKAIS
                     KLKESKVEHVTIVGRRGLLQSAFTNKELKELIDMHSIGVGFKGVSEDHIAPFAPLAKN
                     LGRVQKRRLDLLTKYFQKVKNSTKTACTKEWELQYLLSPKEIIAKDDQLLSKVVFEHN
                     VLVQPDIDVPVSIEPTGEFTELPADLLIYSTGYKGSAIQGLIEAGIPFNEKKGYIPNK
                     DGRVSPGIYASGWIRRGATGAIASTMMDAFFVAETVLSDLDNSSTEKHGLGHYISKQN
                     KPVVTWQDWEKIQQHESEAGTSLGKTREKLTTIDQVLELIK"
     gene            complement(<128696..>129052)
                     /locus_tag="PAS_chr3_0059"
                     /db_xref="GeneID:8199345"
     mRNA            complement(join(<128696..128938,128990..>129052))
                     /locus_tag="PAS_chr3_0059"
                     /product="Subunit f of the F0 sector of mitochondrial F1F0
                     ATP synthase, which is a large, evolutionarily cons"
                     /transcript_id="XM_002492222.1"
                     /db_xref="GeneID:8199345"
     CDS             complement(join(128696..128938,128990..129052))
                     /locus_tag="PAS_chr3_0059"
                     /codon_start=1
                     /product="Subunit f of the F0 sector of mitochondrial F1F0
                     ATP synthase, which is a large, evolutionarily cons"
                     /protein_id="XP_002492267.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0059"
                     /db_xref="EnsemblGenomes-Tr:CAY69987"
                     /db_xref="GeneID:8199345"
                     /db_xref="InterPro:IPR019727"
                     /db_xref="UniProtKB/TrEMBL:C4R3F2"
                     /translation="MSFVIRRKLSTLIPPKIASAKNLGSNPHAKKIQEVVKFYKALPQ
                     GQASFPKASSPIGKYGEKYFNDGNASAKPLLHLALGVILFGYSLEYYYHLRHHKGEH"
     gene            complement(<129258..>129518)
                     /locus_tag="PAS_chr3_0060"
                     /db_xref="GeneID:8199346"
     mRNA            complement(<129258..>129518)
                     /locus_tag="PAS_chr3_0060"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492223.1"
                     /db_xref="GeneID:8199346"
     CDS             complement(129258..129518)
                     /locus_tag="PAS_chr3_0060"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492268.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0060"
                     /db_xref="EnsemblGenomes-Tr:CAY69988"
                     /db_xref="GeneID:8199346"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C4R3F3"
                     /translation="MSTARVDPSEFLSRITGEKVVVKMRDGTECHGALQSIDGFMNVA
                     LENTVGKYKGETTKTYGDVFIRGTNGKYSLLSSILLERLLTL"
     gene            <129687..>132002
                     /locus_tag="PAS_chr3_0061"
                     /db_xref="GeneID:8199347"
     mRNA            <129687..>132002
                     /locus_tag="PAS_chr3_0061"
                     /product="Golgi-localized RING-finger ubiquitin ligase
                     (E3), involved in ubiquitinating and sorting membrane p"
                     /transcript_id="XM_002492224.1"
                     /db_xref="GeneID:8199347"
     CDS             129687..132002
                     /locus_tag="PAS_chr3_0061"
                     /codon_start=1
                     /product="Golgi-localized RING-finger ubiquitin ligase
                     (E3), involved in ubiquitinating and sorting membrane p"
                     /protein_id="XP_002492269.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0061"
                     /db_xref="EnsemblGenomes-Tr:CAY69989"
                     /db_xref="GeneID:8199347"
                     /db_xref="GOA:C4R3F4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4R3F4"
                     /translation="MNVDRAQIIFFLILFFLLLGPNGGNDLSNENRNKVISFKQFKED
                     IQHSNEVLRNSTWEEGYGDLAGFSVSYQDALDGLNRSSPINDNFTEDQKYSILPNEIS
                     ELAMDIWSAEEGTKKIRSGSFPLNVSGTLRGQFHNSNKSFTRIPMVLPPFYNYSHPLQ
                     VMVQPTTEFDDPTPTPIEEKESDINGNITDFEGDLMIRIGSLDEYTSINEYCKDTTVM
                     SLEVEANDFDELHQHKLNLIGLYHQNSGNLVATTRTGKFDGVHALPHLTLYQELFNQS
                     KNAMIQRTNKTHLEDLEISTMDYFRETSDNCEHVMYLHFESTGLSKDELRQIDDELFT
                     PIGRPHKKIPPVKVTSGLLYSPDCGISINFDEIVGPRKEVQEQRLRNVILSGIVILFV
                     QIFFSVQQMSATTTPSTISRISFSTLAILNLIDGSLSILYALCSVVYERLYLPITVSA
                     FLSFTLASVFEMRYMISIYLSQMNERNVSMRTALQGTPVDNINETQPLVDNNETILPT
                     TQAPTTTPQQQNLRPTILEDEQTVSGQIYTRFFFFLIAFTFLILNAILWPRKSRLIFE
                     YITVFALSSFWVPQVYRNVYRGTRKSFNWGFVIGTSILRVLPVGYVCLYKHNVFYHHY
                     DPIFFIVIVSWLGLQILVLQLQEFLGPRFFVPDKMLPAAYDYHPVLTESDLENGFGAS
                     EEEGHHVTHEDGHCVVDCAICMSELKVPVVSRKGLGNEESTEHSNIPGILSRRVYMVT
                     PCRHLFHSECLESWMQYKLQCPVCRNPLPPL"
     gene            <132173..>132910
                     /locus_tag="PAS_chr3_1148"
                     /db_xref="GeneID:8199348"
     mRNA            <132173..>132910
                     /locus_tag="PAS_chr3_1148"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492225.1"
                     /db_xref="GeneID:8199348"
     CDS             132173..132910
                     /locus_tag="PAS_chr3_1148"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492270.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1148"
                     /db_xref="EnsemblGenomes-Tr:CAY69990"
                     /db_xref="GeneID:8199348"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4R3F5"
                     /translation="MASSRTIKACLFDMDGLLINSEDIYTISLTKVLETYGKPPLTWD
                     LKIKLQGRPGPSASKLVIEHYDLPLTPEELFAKTTAVQMDLWPTVKFLPGALELLQYL
                     DTKKIPFALATSSHKLNYDRKTGHLQHGFDLFRHHIVTGDDSRIPPGKGKPFPDIWFA
                     ALESLNKERKQHGQDTIDITECLVFEDGVPGVEAGKASGAYVIWVPDERALKVLAGKE
                     KEIIGENNEHGIILKSLEAFDKTMLGS"
     gene            complement(<132959..>133921)
                     /locus_tag="PAS_chr3_0062"
                     /db_xref="GeneID:8200181"
     mRNA            complement(<132959..>133921)
                     /locus_tag="PAS_chr3_0062"
                     /product="5-phospho-ribosyl-1(alpha)-pyrophosphate
                     synthetase, synthesizes PRPP, which is required for
                     nucleot"
                     /transcript_id="XM_002492226.1"
                     /db_xref="GeneID:8200181"
     CDS             complement(132959..133921)
                     /locus_tag="PAS_chr3_0062"
                     /codon_start=1
                     /product="5-phospho-ribosyl-1(alpha)-pyrophosphate
                     synthetase, synthesizes PRPP, which is required for
                     nucleot"
                     /protein_id="XP_002492271.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0062"
                     /db_xref="EnsemblGenomes-Tr:CAY69991"
                     /db_xref="GeneID:8200181"
                     /db_xref="GOA:C4R3F6"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C4R3F6"
                     /translation="MATNSIKLLASDTHYALAELVSKRLGTPLTNVAIKRDSNKEVSF
                     SIGESIRDEDIFIIMQIGSGIVNDKVIELLIMINACKTASARRITAILPNFPYARQDR
                     KDKSRAPITAKLMADMLTTAGCDHVVTMDLHASQIQGFFDIPVDNLYAEPSVVKYIRE
                     TVNIDEAIIISPDAGGAKRAAGLADRLDLNFALIHKERARANEVSRMVLVGDVTDKVC
                     IIVDDMADTCGTLAKAAEVLLDNGAKKVIAIVTHGILSGNAIKNINNSNLDRVVCTNT
                     VPFEEKLPQCPRLDTIDISGVLAESIRRLHNGESISYLFRNATL"
     gene            complement(<134238..>135944)
                     /locus_tag="PAS_chr3_0063"
                     /db_xref="GeneID:8199349"
     mRNA            complement(<134238..>135944)
                     /locus_tag="PAS_chr3_0063"
                     /product="Putative protein of unknown function, contains a
                     zinc finger region and has homology to human BRAP2"
                     /transcript_id="XM_002492227.1"
                     /db_xref="GeneID:8199349"
     CDS             complement(134238..135944)
                     /locus_tag="PAS_chr3_0063"
                     /codon_start=1
                     /product="Putative protein of unknown function, contains a
                     zinc finger region and has homology to human BRAP2"
                     /protein_id="XP_002492272.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0063"
                     /db_xref="EnsemblGenomes-Tr:CAY69992"
                     /db_xref="GeneID:8199349"
                     /db_xref="GOA:C4R3F7"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4R3F7"
                     /translation="MYNIVIDLDSPKELLLKARDQSEITSLRNLKALLAGNQIFGEDG
                     LDLDYWSTTVLKHHNIFVKSNTKQAQPHLALNFKKRSNIVEEIRNTLSKVQNTRIGVP
                     DYRYTRIELIAFDKMHDTNYEKTDYLRASFLGYGVIRLFREEINEKTTEDAELGPEPT
                     SRSKIAAILAVPTYMSISAILKLVGENFVKDVVHFRIFKTQQYKRYMCILKFQSEDQC
                     AAFQRALNGKPFNSIERERCQVVQVNKIIINSPHDKANKSEELNFTYGIIELPTCPVC
                     LERMDTNMTGLLTIPCQHTFHCQCLAKWRDDTCPVCRYSQKERTSKDVTSEASQCSVC
                     GDTANLWICLICGNVGCDRYNSAHAVNHFKETSHCFAMQIETQRIWDYAGDQYVHRLI
                     QNQTDGKLVELSLNNEKAGSSSDSNGKNYSADKVDTMELEYSKLMIAQLEEYEKNMTK
                     IMEEEKIRFANLQTAMGRLGTDSKVSERTKELETKLDQMMQKYDEEKTLALVLTEKLE
                     FFDKQTSQLKKENEDLKEEINDLLMHFQTMEKYKDADESVKEGKLVLKPSRKSSRKGS
                     RK"
     gene            complement(<136103..>137641)
                     /locus_tag="PAS_chr3_0064"
                     /db_xref="GeneID:8199350"
     mRNA            complement(<136103..>137641)
                     /locus_tag="PAS_chr3_0064"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492228.1"
                     /db_xref="GeneID:8199350"
     CDS             complement(136103..137641)
                     /locus_tag="PAS_chr3_0064"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492273.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0064"
                     /db_xref="EnsemblGenomes-Tr:CAY69993"
                     /db_xref="GeneID:8199350"
                     /db_xref="UniProtKB/TrEMBL:C4R3F8"
                     /translation="MFIEGLDRKINLMMKTNTFFRKLGRKFKSFLAIGVELNPFVVLI
                     LGLLAAATLGMSTIERKSFRTGPMRFQLSSSPTFEKILQCSEIESASVCFDKHRKNLL
                     KESGPFLSPFGEPQLQTCLSIASKNPNDISLLLNLQTCYHQVDIIERATEFSYALPKT
                     SWWTTIGIFLSISMQLFVAIHSFVVFVMRKREFSIIHDSIHRLTQDNYLRLEKERELN
                     SYLSSVSINTNSELAKLKSKVSESENVPLEVRKLEENLASLKKQVYYSNTRMLEAMSK
                     QEREFVLQKKHGYNTTRYYDPSPLTQNSKLDKDKQNDKKKEKEEENSNKTIEKEKKRE
                     EHSFDLTTESGREAWKSYIQKSLAFKPKGPLLDKENKSTQATPVRLTTNQSSDQLKSI
                     KNISSWENSPQKTKNTITSGSALKLAAQSLKDDNILGASVKTLIANTNSDEQSEGKHL
                     GVTSSPLEVSVNDIQQIDKNGRPFRRIFVPGRGWLAAKTFRSEVDSGAIKLVTETETR
                     ITTN"
     gene            complement(<137836..>142920)
                     /locus_tag="PAS_chr3_0065"
                     /db_xref="GeneID:8199351"
     mRNA            complement(<137836..>142920)
                     /locus_tag="PAS_chr3_0065"
                     /product="RNA binding protein with preference for single
                     stranded tracts of U's involved in synthesis of both"
                     /transcript_id="XM_002492229.1"
                     /db_xref="GeneID:8199351"
     CDS             complement(137836..142920)
                     /locus_tag="PAS_chr3_0065"
                     /codon_start=1
                     /product="RNA binding protein with preference for single
                     stranded tracts of U's involved in synthesis of both"
                     /protein_id="XP_002492274.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0065"
                     /db_xref="EnsemblGenomes-Tr:CAY69994"
                     /db_xref="GeneID:8199351"
                     /db_xref="GOA:C4R3F9"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:C4R3F9"
                     /translation="MAVTQKRKWKDTEPKDDMSPVSAAARSSILNPSEVVFPRGGGSV
                     LTPLERKEISNRVTADVLFEKETAKESSFKSTDATKKRKTTATTVINPAPTVSGTIYD
                     QKDDSNTTTTSMTLKNLIPGSVVLGQVISIQKLGMQLGLPGNIRGYVPITSVSKQITQ
                     QLEALEQDSDDEDASSSPQLSEKVFPELSKIFQLGQWLRAVVLEESSVPSEHKHKIQL
                     SVEPEKVNAHLEDDDLVPGGVLQVAVNSVQDHGCIVDTGKKIPGFIFSKSFKNSGIDM
                     ETDLKPGFVLLATISKSNNKNTITLTLPSMNNKDNGSTLSTATSVDAVLPGVMVNAHI
                     LDITEEGIFCRVLGLLPGRIPLAHLKLFNVPEIRETYKIGSTIKSRVVGVLEYEGSKS
                     LTLSTIPSILELDSTYDESPLESFPFGFTFESVKIVGKDSNNVYLELNEDTYGQVHLS
                     KLNKEVSIDSFYKVGSTHHKARVIGYSPVDKVFVLTMDPRQLEAKFLNIQDIPIGEIV
                     TGVVTKVHSHGLNIKIFDQFEAQVPYGHMSDVMLTYPEMKFKIGTKVKGRVLKFYRGN
                     LCVTLKKSLLRSERDELIFTYEDVVPNKRTFATVEKFFPTGVLMSFFNNISGFLPKTE
                     ISEAYVNRPEDHLKLFQTISVRIDSIDPATNKFRVSCLLSKDLSEEQEKKISTFIPGS
                     SILEVYIVEKMKDAMIVEVKDSNVRGVIQEGQLSDGDQNQNKTLLRTAVVGSSLEALF
                     LHRDPKSRTINFTAKDSLIRASKSGQLPASFEELPAVGEIVYGYVHTITNAGLFIEFA
                     DGLSGFARTKDITDEPSDKLPSLYFKNQSVRARILKLDDEFRKFRLTLKDIDHQIVAA
                     TNPVDKSITNLNEFVPGKITKAKIKSVTPTQLTVELAENQLGRIDVSQVFDSLLEIKD
                     TKKPLSSFKEGAELKVKVIGYQNKDSSFTSVAFRDWGDILVELSIKKSELEEEGKVNV
                     LSLTQITPGTKWLGFVTRYARGFWWVSVSPKFRTKLSLMDLSKSGSVEELEKAYPLGS
                     AIEVTAKQIIGNKAVEVFSKENRIETINDVKVGDKLPCRIISLSHDYVTVELSDKVKA
                     KSFITEALDDYSESLESTFSTNDICTATVLSVDDTTRQIFVSLRSENAKDKLIESFED
                     VKRGDIVRGFITRISNFGVYVSLGRTVFALVRVTDISDLFLTDWKKHVKLNQFVTGKI
                     VDAGEERRILMTLKESQVGQGTGALHQFDDLKVGDVYEGTIKKIMDFGVFITLDGVHS
                     VDGLCHRSQISDSKIENFESLFNQGDRVKVKILDINRNKKQLSLGMKASYFANRDDEE
                     EADQLRAETDDSVDSDSDDQMMENIFETRQQDSDDEPDVDIDTESPKKIASGLSTNGF
                     DWTASILDQAEDDESSSSDEEDFTKKKDKKNRKTKASIAEDKSATLNTRTPQSVSDFE
                     RLLIGNPDSSILWMNYMSFQLQLSEIEKAREIAERALKIINYREEQEKMNIWIALLNL
                     ENTFGTDDTLEEVFKRACQYMDSYVMHQKLVGIFALSEKWEKCEEIYTVMTKKFGRNV
                     TTWVSYGAFLLERGNPDEARQVLGRALKVLPKADHIEVVRKFAQLEFAHGDAEQGRSL
                     FEGLLADVPKRIDLWNVYIDQEIKINEKKKVEDLFERVITKKLTRKQARFFFGKWLEF
                     EEKQKDVKAADYVKAQASDYVQKHQK"
     gene            <144270..>144836
                     /locus_tag="PAS_chr3_0066"
                     /db_xref="GeneID:8199352"
     mRNA            <144270..>144836
                     /locus_tag="PAS_chr3_0066"
                     /product="Peptide methionine sulfoxide reductase, reverses
                     the oxidation of methionine residues"
                     /transcript_id="XM_002492230.1"
                     /db_xref="GeneID:8199352"
     CDS             144270..144836
                     /locus_tag="PAS_chr3_0066"
                     /codon_start=1
                     /product="Peptide methionine sulfoxide reductase, reverses
                     the oxidation of methionine residues"
                     /protein_id="XP_002492275.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0066"
                     /db_xref="EnsemblGenomes-Tr:CAY69995"
                     /db_xref="GeneID:8199352"
                     /db_xref="GOA:C4R3G0"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:C4R3G0"
                     /translation="MPVVSSLISSNIKKSPQDKVVTVAGGCFWGLEYIYKMHFKDRIV
                     DTQVGFANGNLANPTYKEVCQGLTYHAEVLQIAYNPEVISYKELIDFFFLVHDPTQDD
                     GQGPDIGTQYRSAVFYLDEEEKEIAEQSLAETQKKWFPHHEIVTQVEKLTSYWDAEDY
                     HQEYLIKNADGYHCPTHVLRTEPKAISV"
     gene            <145294..>145653
                     /locus_tag="PAS_chr3_0067"
                     /db_xref="GeneID:8199353"
     mRNA            <145294..>145653
                     /locus_tag="PAS_chr3_0067"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492231.1"
                     /db_xref="GeneID:8199353"
     CDS             145294..145653
                     /locus_tag="PAS_chr3_0067"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492276.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0067"
                     /db_xref="EnsemblGenomes-Tr:CAY69996"
                     /db_xref="GeneID:8199353"
                     /db_xref="UniProtKB/TrEMBL:C4R3G1"
                     /translation="MGICLSCLRPNYDDNDLNNDYSENTPLLNDEDNAVNSHFYEARN
                     NELEDIVNNTNENLIDVTNFHLDTNQEVQPSEKGANSLNSTLHSEKDLSELEAKIRED
                     FAIDESLKSLPLVLNLE"
     gene            complement(<145705..>147414)
                     /locus_tag="PAS_chr3_0068"
                     /db_xref="GeneID:8199354"
     mRNA            complement(<145705..>147414)
                     /locus_tag="PAS_chr3_0068"
                     /product="Component of the RSC chromatin remodeling
                     complex"
                     /transcript_id="XM_002492232.1"
                     /db_xref="GeneID:8199354"
     CDS             complement(145705..147414)
                     /locus_tag="PAS_chr3_0068"
                     /codon_start=1
                     /product="Component of the RSC chromatin remodeling
                     complex"
                     /protein_id="XP_002492277.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0068"
                     /db_xref="EnsemblGenomes-Tr:CAY69997"
                     /db_xref="GeneID:8199354"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:C4R3G2"
                     /translation="MAPKRKLTSEIGSSNKQQKRKGSTTTKPSKLVDLDVKQESNLKG
                     LTLRQFFTHVLDQLETLTAIEEETGAEYRRIDPYVKLPSKKFFPDYFQLIQVPISLEE
                     IEKKVKANKYKDANQFLEDFELMKNNANFYNDAESTIAKDSVIIWEFVKDLVESYESG
                     STPDEEDYSEKIGGVIDELLSMKKPKIGKLALPFIESVDRDEYPEYYEVIKEPITFQM
                     IQEFLKEGKYKGGKKGVEKFQNDLTLLFNNARTFNDSKSLIYRNAELLEKKAESEIPL
                     IYKEPEHSSIKLKIKPIKTETEESLSAKKRGRKPKKAKAVTFTEKESKKVVEKSDNED
                     LEEINEDLDLDNEPSLYQDDFSDEEEQVDETKLIDKNSIVNPLEPSESYRFKYKSSDK
                     NDTAEYPYEEPSIKEVSFSTFRARLINSAFNVHSTDKQMYEYKFPIKELIPNEESPNK
                     REAHFSLSLPSITESFHFDTKLNPDLRTDAKFETKLTVNNEKMNPIPSVSYEDILSSK
                     YEMKLAIGLNLVEFHCTVYSKPGKNDVDSITRLPSRHASDSKGANNVVHEKILIWIHI
                     AQQ"
     gene            complement(<147604..>149493)
                     /locus_tag="PAS_chr3_0069"
                     /db_xref="GeneID:8199355"
     mRNA            complement(<147604..>149493)
                     /locus_tag="PAS_chr3_0069"
                     /product="Carnitine acetyl-CoA transferase present in both
                     mitochondria and peroxisomes, transfers activated a"
                     /transcript_id="XM_002492233.1"
                     /db_xref="GeneID:8199355"
     CDS             complement(147604..149493)
                     /locus_tag="PAS_chr3_0069"
                     /codon_start=1
                     /product="Carnitine acetyl-CoA transferase present in both
                     mitochondria and peroxisomes, transfers activated a"
                     /protein_id="XP_002492278.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0069"
                     /db_xref="EnsemblGenomes-Tr:CAY69998"
                     /db_xref="GeneID:8199355"
                     /db_xref="GOA:C4R3G3"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:C4R3G3"
                     /translation="MSAPLLFKRSFSMSLRRQAGQLYKYQDSLPNLPVPELSQTVELY
                     KRSLIPLYPEGETDPNFLRYSKVIDDFFKTDGPKLQERLQTLAKSERNWLAKYWDNVA
                     YLDYRDPVSPFVSYFFNHKDHRNIPFRGDQLKKAAALTREVVLFAQAVHEESLAPEVI
                     KPRVGAANQTPTAFCMESFRWMFNNGRVPGAPSDTNIQYDPSKNSYVTVISHGNFYVL
                     NHHDSQGNPLSEADLYQQLTEIKKHSLVNKQGEIAPVGVLTSSNRDVWYNNYSELIQS
                     PLNKNNIELINASTFVLALDSDSPVTIEEKSRRSWHGNGANRWFDKPVQMFVAENGSS
                     GFLGEHSKMDGTPTLGLNDYVNKKLKSETYSFETASTSDKQWKFLNWDITPATQTAIK
                     QELATFDQTVNSLDIRVWQYPGLGKSLIKKFKLSPDAFIQMLIQLAYYKMTGISRPTY
                     ESASTRKFFRGRTETCRSVSKESLEYVKKWQDANVSDAEKVAAFRNAVSSHLNYITKA
                     SNGQGCDRHLFGLKQQYQSGETVHELFTDPICAYSQHWFLSTSQLSSEEFNGYGWSPV
                     VPDGYGLAYMVNNEWLHVNVTVAKDNGLGLRADVMHYYLTEAANEIKELLTNELNQNQ
                     LKAKL"
     gene            <150574..>152703
                     /locus_tag="PAS_chr3_0071"
                     /db_xref="GeneID:8199356"
     mRNA            <150574..>152703
                     /locus_tag="PAS_chr3_0071"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492234.1"
                     /db_xref="GeneID:8199356"
     CDS             150574..152703
                     /locus_tag="PAS_chr3_0071"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492279.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0071"
                     /db_xref="EnsemblGenomes-Tr:CAY69999"
                     /db_xref="GeneID:8199356"
                     /db_xref="GOA:C4R3G4"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C4R3G4"
                     /translation="MQNDNPYGDITGSQRDPQKQQQQQQQQQQQQQQQQQQLQQQQVP
                     RQSYVTVPPSHQQQYTAPQQIIYQQPQFFTPQHQRQTSGSSMAQLDTHNALFDFPSQP
                     QAPSQLQTQFGTTSPAAWPLGHRRNQPSISTALGSFHMEHADMGTYVNPQSQPQVDPG
                     MYLQPSPSIQPFGTSQSEQLAPMMKEDSKLQQALESLRMEISLKDLAKQYRITYEDMK
                     SVSKDVDSKEFHEKERLRQVFTIRCLLQFLYIPSEREIRQRQRESNQHSHSPNRSTSL
                     IASVPRVHVYATYHRLTESCHVEPFGSSSLGKLLRITFSGIQTKRLGTRGQSKYHYMG
                     IDIKPEYLKLSTVSDIDAKGKFSNRAIEASLREQSHAKNKKSQHHLFELKQNLDVTEH
                     IESPFHSYINNYTEIPSNQALQLIAVSPHMESPTSPSFHQNLMLGSSDTLLKIIETEN
                     SSLLDDLQVYFDVSVLLLSDARVVKQLVYSENLLLVANQFMGFLDAGTTSLDSERVRA
                     LHSFINILSKFLKGLKLNEEFERVIADALIKDSLVDELSSVAAGSFGTWEEFNNLVFD
                     SESKKCLQTFGISESTNIANILIEFFNREIPDFLITLTNTNEVDIQLLTGLVPLIVNL
                     FSKIREALGNQSLRLQSFLMMFDVFQTIVLKYVTFRVDDALAESRKSVTYNLWLLCSS
                     INEWLTFISETFGLYEMIQKEKESGTT"
     gene            complement(<152825..>153724)
                     /locus_tag="PAS_chr3_0072"
                     /db_xref="GeneID:8199357"
     mRNA            complement(<152825..>153724)
                     /locus_tag="PAS_chr3_0072"
                     /product="Diacylglycerol kinase, localized to the
                     endoplasmic reticulum (ER)"
                     /transcript_id="XM_002492235.1"
                     /db_xref="GeneID:8199357"
     CDS             complement(152825..153724)
                     /locus_tag="PAS_chr3_0072"
                     /codon_start=1
                     /product="Diacylglycerol kinase, localized to the
                     endoplasmic reticulum (ER)"
                     /protein_id="XP_002492280.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0072"
                     /db_xref="EnsemblGenomes-Tr:CAY70000"
                     /db_xref="GeneID:8199357"
                     /db_xref="GOA:C4R3G5"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="UniProtKB/TrEMBL:C4R3G5"
                     /translation="MAATTARPQRIGRSRVSKLEERISTSSSYSSLSSLDASDDTVLS
                     TESTSPVLDKAKNTSTSYLLLQSHKRFNKLIHKHELPRKLFHMSIGFFTLYLYTKNVQ
                     KEQIQLPLVVGFVVVFALDLIRFRWPQVNKLYCSTVGFLMREREVDEYYNGVNWYLLG
                     LAVVFLFFKKDIAVMAVLLLSLSDTAASTVGRAWGQYTPKITSHKSLAGSLAACVVGI
                     LSCYLFYGYFVPNYPECNDIPNQFEWVSEKSGLNIHSLALLSGLVASVSEGIDLFNWD
                     DNFTIPVLSAVFLRLVIKLTNTD"
     gene            <155104..>156852
                     /locus_tag="PAS_chr3_1149"
                     /db_xref="GeneID:8199358"
     mRNA            <155104..>156852
                     /locus_tag="PAS_chr3_1149"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492236.1"
                     /db_xref="GeneID:8199358"
     CDS             155104..156852
                     /locus_tag="PAS_chr3_1149"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492281.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1149"
                     /db_xref="EnsemblGenomes-Tr:CAY70001"
                     /db_xref="GeneID:8199358"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:C4R3G6"
                     /translation="MSSLELIMDNDHAEEVAVSHVSYSKPSTPIPSLMASLNEENTPV
                     PLMSSPNKNFQTPLRYVSTPDLLASNYSLSDLSHNLPTPIVNNELITIRQQNESEILY
                     TYDLLRRPAANAGSSSLNEMSGNIPKSVSNGVVSVRDIFNISDNTDEDIHQYRLNNPL
                     MSQFSFHNFSMNSGLMIDDRMTGSFSEPDTSDDDEQLFTPPLDNSEIAFFPCTATSSQ
                     IEQTDRKNIFAVKRPFSEAHINLLGKSKKSKVSAGAKPHCSISSTSNEETKLESGLQT
                     PNPTQSSSTFKFKVKPVCITPKSVNYPSAPKTHVKKISKWIGISKLTDERVQRIYTLA
                     TSRKLKFKDIQKSLSVFTIDNIQAKVDIIGNLLINRRNGIRDHPHPILVKDKNAEQYE
                     VNVRTSCGDDKDDSLQILIDACSGNPSNSSLLHTPSSPETSSSTYCLTSSLSTLASSP
                     LSSNLRTKAGHIKRPLNSFMLYRGILLKLGIVLNVVKSIENSIDLNNPSVLRKLHDND
                     PSLVSQILKLIPTVVKTNHQVLGQAISMLWVTESSQVKEQFGKFSQVEKRLHKLCYPN
                     YKFNPHRSGSSKGRKT"
     gene            <157093..>158841
                     /locus_tag="PAS_chr3_1150"
                     /db_xref="GeneID:8200182"
     mRNA            <157093..>158841
                     /locus_tag="PAS_chr3_1150"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492237.1"
                     /db_xref="GeneID:8200182"
     CDS             157093..158841
                     /locus_tag="PAS_chr3_1150"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492282.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1150"
                     /db_xref="EnsemblGenomes-Tr:CAY70002"
                     /db_xref="GeneID:8200182"
                     /db_xref="UniProtKB/TrEMBL:C4R3G7"
                     /translation="MPVSSPVPTSTGHPAERLSDFVPEEFRIQLAKTPPRLTIEQPVY
                     QDRLKEIRNNEKFAFIVQWLYLLRGVIKLYEVHFDVISFEEELIGINGELFLLKFKSN
                     LIYALNGFRIDNIANHPELFNEQIQSILPNWFLEHYDSDEALSAFDFNDASIEVKLDI
                     FYELLRLLMVRKEATVRKTVELYDSPWDTMKLLPVFAEDDVKNSVLKEYLILMDDRMY
                     YREWSFPKIKVPAQRKEYLKLLDEYENPFGDLEPKITRWECLTVGIYEFDEYLNNLKL
                     KTGKKTSSKEGKLLKALEPFVEQIYGTDLKKRKEALHRKKELQLQSLLANRKRSSRLE
                     AKERQREEERRKEHDERIRQINEGTALRSSRRLIMKQTQKEESAPPTNTALSRADRLQ
                     QRRALEAGLSGTSSPVPVTPDENKYSSFKTESAAASDNESSGNTSFAQAPEQQAKSHP
                     VEAVPEQPKQEPNHQSASTIPTSINSSIQPVNTFIPPPQFKNLLVDETAVHSYGYSPT
                     PVTVPVLTPVESVSKPLQTVPINTYPASPLNQSSININQTGPGGISDLDTEKNTESED
                     KHTSQQIGNFYSPLNK"
     gene            <158991..>161210
                     /locus_tag="PAS_chr3_0073"
                     /db_xref="GeneID:8200183"
     mRNA            <158991..>161210
                     /locus_tag="PAS_chr3_0073"
                     /product="Glycerol 3-phosphate/dihydroxyacetone phosphate
                     dual substrate-specific sn-1 acyltransferase of the"
                     /transcript_id="XM_002492238.1"
                     /db_xref="GeneID:8200183"
     CDS             158991..161210
                     /locus_tag="PAS_chr3_0073"
                     /codon_start=1
                     /product="Glycerol 3-phosphate/dihydroxyacetone phosphate
                     dual substrate-specific sn-1 acyltransferase of the"
                     /protein_id="XP_002492283.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0073"
                     /db_xref="EnsemblGenomes-Tr:CAY70003"
                     /db_xref="GeneID:8200183"
                     /db_xref="GOA:C4R3G8"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:C4R3G8"
                     /translation="MAEAGSQPDSTQSDKPWPEVSSATADSESEEVYVEVSWIRKLIY
                     DIVLWSFCVVFDCFFREIRSRGSFNLPRSGPTIFVGAPHANQFVDPIILMGQVQQRAG
                     RRISFLVAEKSHRRKFIGLISRSQMAIPVSRAQDNLKGGRGKIRRDSENPLRIVGEDT
                     YFTQDCANQRMLALPNSLGTSEIGEVVSDTELILKKEFRHPSTEAEEKANRILAEGTS
                     YKLAPKIDQSIVYKKVFQHLAHGNSIGIFPEGGSHDRTDLLPLKAGVAIMALGAMSSD
                     KSCKVKIVPCGMNYFHPHKFRSRAMVEFGRPIEISDELVSMYENKETTKDAIKEVLRI
                     ITKGLKSVTVTCPDYETLVCIQTARRLYSNNFSSRLSLESILEMNRRLVKGYEHFQNE
                     PRIQELKEKILAYHEVLRLSGIPDHKVNDYRPEKRLQTFAELLGNLFQFALLGLLALP
                     GALLFFPVFVATRKISAKKAKEALAASTVKIKAIDVVATWKILVSLGFAPLLYIFYST
                     VGTYIIRSRYYIEPGFGKTAFTFFGFYILSATITYSALIVGDIGMDSFKRLKPLWLFL
                     TDSETLSNLKKERQELSLEITEVVNEFGPQLFSDFNLLDYQKKVESKRKKKRSEKYRK
                     KAFEVSSMGLDSSDEEEELKTQDVRRRRAARKQAASTTEAPSNRFDNKSTGINISNVP
                     IFSNDLYGGTSSAPTTDVSSISSELSSDYQSSDGENENDDSQLKDRIRDRIHDSRHD"
     gene            <161385..>162191
                     /locus_tag="PAS_chr3_1151"
                     /db_xref="GeneID:8199359"
     mRNA            <161385..>162191
                     /locus_tag="PAS_chr3_1151"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492239.1"
                     /db_xref="GeneID:8199359"
     CDS             161385..162191
                     /locus_tag="PAS_chr3_1151"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492284.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1151"
                     /db_xref="EnsemblGenomes-Tr:CAY70004"
                     /db_xref="GeneID:8199359"
                     /db_xref="UniProtKB/TrEMBL:C4R3G9"
                     /translation="MSDEEQSQVPVVNKAKEDEEFGSFSDASFEEFEAAPELDEPTRS
                     FSTLSIEDLEQSDSKSDEKVVKIVNGILGVQPEDLNNAIEENRPFLDERARALLNQLS
                     SEPNNLQQLNWKQSIIRRQLFLNLSIPFDLDELYPRERKLGISKSYGKDSFSDSTDKL
                     ATDIPFVEVSPERAKQLTEESDSIVQNIERRLQSEQYYTDGHLSEQELEDILKEMKGF
                     NSQLIELLSGWNQERLELLKDREISEGYLTNILDNTQKFRRQSSIKQRHL"
     gene            complement(<162196..>163701)
                     /locus_tag="PAS_chr3_0074"
                     /db_xref="GeneID:8200184"
     mRNA            complement(<162196..>163701)
                     /locus_tag="PAS_chr3_0074"
                     /product="Protein that acts together with Uba3p to
                     activate Rub1p before its conjugation to proteins
                     (neddylat"
                     /transcript_id="XM_002492240.1"
                     /db_xref="GeneID:8200184"
     CDS             complement(162196..163701)
                     /locus_tag="PAS_chr3_0074"
                     /codon_start=1
                     /product="Protein that acts together with Uba3p to
                     activate Rub1p before its conjugation to proteins
                     (neddylat"
                     /protein_id="XP_002492285.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0074"
                     /db_xref="EnsemblGenomes-Tr:CAY70005"
                     /db_xref="GeneID:8200184"
                     /db_xref="GOA:C4R3H0"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R3H0"
                     /translation="MSEKYDRQLRLWAQRGQSLLRHSNVCLLGATTTGTEALKNLVLP
                     GCGKFTIVDSSKVTTSDLETNFFLTQQDLGSNKAAAVVRNLNELNPDVEGTALDISLT
                     NNLVEDSHFWSQFSLIIIASSWHLQKVLTLADTLWDMKIPLIHVSTIGFYGYMRIYIK
                     EHTITESHPESFSDFRIDRPWKELKEMSDSVDLEADDKEHIPYLLILIKALDRWKSIH
                     GKQPSTPKEKAQFKQSCSELQSDLSLQNFEEAVTFSWRASQVSTQVPENVKTIINDPI
                     LDNLSRSTPLFWIYVKALKLFIEKNGQLPPLPGVLPDLHSSTEAYIKLQHIYKAKAEE
                     DIIEFTGLVSQILSSIGRDADHLDHDSIRIFCKNSRYLFLQRGSKTLIDPRLIRELGN
                     TPLLSLFIAFIATHKFMDTHSGIIPQESDYNELISIVQLILKSEKVPDFLSDIVKEIL
                     RSKGTQLHNICSFMGGIVGQEAVKLITGQYIPLENSLVFDGINSCTEKWKI"
     gene            <164330..>165592
                     /locus_tag="PAS_chr3_1152"
                     /db_xref="GeneID:8199360"
     mRNA            <164330..>165592
                     /locus_tag="PAS_chr3_1152"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492241.1"
                     /db_xref="GeneID:8199360"
     CDS             164330..165592
                     /locus_tag="PAS_chr3_1152"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492286.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1152"
                     /db_xref="EnsemblGenomes-Tr:CAY70006"
                     /db_xref="GeneID:8199360"
                     /db_xref="GOA:C4R3H1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C4R3H1"
                     /translation="MKFAKLYDEMLKSEEIPEDWIGSRIQYKSLKKCINRVVKELESA
                     CLEKDLIEVLLEGDHRLADYVLEKDSKIITPKLIIRVPHDKQGLPKSETSSRLWEFVN
                     NREYLKDDELFKVVEVKEEEEATCLVFHFHEDSSFFRELSLELEGLNNFKEAQKRYLV
                     DQVDMISKSVSESTSFVKRRSDLYTWRELFKLYIDSEIFFKSSTSTAGERSVQQAKAN
                     LAAFWNHVNNKKFHKAFHQKGSRSAFKSFIGLNERLLKVSQFQYLNKMAMTKILKKFD
                     KQTSLHTRLIFPKLLAHNTFIEESFAQQLCYKISTNLLSIIPQLDDYTCPICCSVAFK
                     PIKLDCGHIFCVRCLVKLQRSGEDRCPLCRGEVVLNADNSNLDVEHMEYLQKYFPKEV
                     KIKQNETEREIAKERFEAVYGEKNCIIM"
     gene            <166362..>168377
                     /locus_tag="PAS_chr3_0075"
                     /db_xref="GeneID:8200185"
     mRNA            <166362..>168377
                     /locus_tag="PAS_chr3_0075"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002492242.1"
                     /db_xref="GeneID:8200185"
     CDS             166362..168377
                     /locus_tag="PAS_chr3_0075"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002492287.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0075"
                     /db_xref="EnsemblGenomes-Tr:CAY70007"
                     /db_xref="GeneID:8200185"
                     /db_xref="UniProtKB/TrEMBL:C4R3H2"
                     /translation="MSIIQQLFRSNRKKQSKKKEQTRKSPQTQANQLHPSDVPTGQHS
                     QNEAVTYKDKEQILRTSLNSSETTSKSASSDVNKRLSDKVSHRRSSSTSARAAYVLPT
                     ATLRHSVSPNLNSYFPNGSDLPSIDKLPREMLPIVTLIHAQQARIYVEGLVKVPDNPD
                     LSISNDSLLDLPDSWRIVSSKLSGTELSFWGMNQDGSLATTNDPEDDEVGLFKPIYAN
                     IVDAAFSLDVSRLIIKITLSLQRELQLRCANINDLKLFYSSLLLAQFEYQQMQKAFTG
                     ALLSAKAVNFSDIKVLLAPENKFVKEEWTTIRFPWLNAKWLRCYISVIPGESVSFPSL
                     KFKDKEKVNKDKPGKIEIYISSRKGKKNLLATIFNGRSCFSIYPEVPEFIDSNSLIRI
                     EGEVLVNETLLDKLLNQDLDGLLSRSSSQTKLNKRSSTGSLSSFKNPFRSNSLTSMGH
                     SRLRSSSVNSVESNGSSICLPANSKVCRTNFVYIIPETHHGVPDSETMIRLLIPIFNV
                     FKLYGRPQKFLSSRDNKQSLLFGLPQLPHTQYLDSESSYQLVDLNLENSIKEEWALFD
                     WTQVFQEMCSYRISQGIKGSGSLVDTFRDGLLYSKELADLKRFEYAEDLEFYDAEEEE
                     QNFKQGITGNGKTSKHQRVLSQDISNNSVKMTPVNGINSDSYVSVNT"
     gene            <169095..>170036
                     /locus_tag="PAS_chr3_0076"
                     /db_xref="GeneID:8199361"
     mRNA            <169095..>170036
                     /locus_tag="PAS_chr3_0076"
                     /product="Protein of unknown function, has similarity to
                     Pry1p and Pry3p and to the plant PR-1 class of pathog"
                     /transcript_id="XM_002492243.1"
                     /db_xref="GeneID:8199361"
     CDS             169095..170036
                     /locus_tag="PAS_chr3_0076"
                     /codon_start=1
                     /product="Protein of unknown function, has similarity to
                     Pry1p and Pry3p and to the plant PR-1 class of pathog"
                     /protein_id="XP_002492288.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0076"
                     /db_xref="EnsemblGenomes-Tr:CAY70008"
                     /db_xref="GeneID:8199361"
                     /db_xref="GOA:C4R3H3"
                     /db_xref="InterPro:IPR001283"
                     /db_xref="InterPro:IPR014044"
                     /db_xref="InterPro:IPR018244"
                     /db_xref="UniProtKB/TrEMBL:C4R3H3"
                     /translation="MKLSTNLILAIAAASAVVSAAPVAPAEEAANHLHKRAYYTDTTK
                     THTFTEVVTVYRTLKPGESIPTDSPSHGGKSTKKGKGSTTHSGAPGATSGAPTDDTTS
                     TSGSVGLPTSATSVTSSTSSASTTSSGTSATSTGTGTSTSTSTGTGTGTTGTGTTSSS
                     TSSSATSTPTGSIDAISQTLLDTHNDKRALHGVPDLTWSTELADYAQGYADSYTCGSS
                     LEHTGGPYGENLASGYSPAGSVEAWYNEISDYDFSNPGYSAGTGHFTQVVWKSTTQLG
                     CGYKECSTDRYYIICEYAPRGNIVSAGYFEDNVLPPV"
     gene            <170254..>171165
                     /locus_tag="PAS_chr3_0077"
                     /db_xref="GeneID:8199362"
     mRNA            <170254..>171165
                     /locus_tag="PAS_chr3_0077"
                     /product="Alpha subunit of the translation initiation
                     factor eIF2, involved in the identification of the start"
                     /transcript_id="XM_002492244.1"
                     /db_xref="GeneID:8199362"
     CDS             170254..171165
                     /locus_tag="PAS_chr3_0077"
                     /codon_start=1
                     /product="Alpha subunit of the translation initiation
                     factor eIF2, involved in the identification of the start"
                     /protein_id="XP_002492289.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0077"
                     /db_xref="EnsemblGenomes-Tr:CAY70009"
                     /db_xref="GeneID:8199362"
                     /db_xref="GOA:C4R3H4"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR011488"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR024054"
                     /db_xref="InterPro:IPR024055"
                     /db_xref="UniProtKB/TrEMBL:C4R3H4"
                     /translation="MSTSTCRFYENKYPEVDDVVMVNVQQIAEMGAYVKLLEYDNIEG
                     MVLLSELSRRRIRSIQKLIRVGKNEVVVVLRVDKEKGYIDLSKRRVSSEDIAKCEERY
                     TKSKSVHSILRHCAEKFNMPLEELYRTIGWPLSKEFGHAYDAFKISITDSTVFDKVQP
                     PSQEVLEELKVYISRRLTPQAIKCRADVEVSCFSYEGIEAIKSSLKAAEDISTEANQV
                     KVKLVAAPLYVITTQSLDKTQGIEILERAIKIIEDSITKQGGSCNVTMAPKAVTATED
                     AELQALMERKENEDKVSDEDSDLDEED"
     gene            <171348..>172292
                     /locus_tag="PAS_chr3_0078"
                     /db_xref="GeneID:8199363"
     mRNA            <171348..>172292
                     /locus_tag="PAS_chr3_0078"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492245.1"
                     /db_xref="GeneID:8199363"
     CDS             171348..172292
                     /locus_tag="PAS_chr3_0078"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492290.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0078"
                     /db_xref="EnsemblGenomes-Tr:CAY70010"
                     /db_xref="GeneID:8199363"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="UniProtKB/TrEMBL:C4R3H5"
                     /translation="MVKVRPATHAGSWYSGNPNELNSQLSHYLSLAKSSGKTSVKGAR
                     VLVGPHAGYSFAGKTLAQTYNSFDPTGIKRVFILGPSHHIYFKDEVRTTRYGAYATPL
                     GNVPVDTDTIKDLVSNARHIDYMSSSVDENEHSFELHMPLYYKACLDKGLSTPPPIIP
                     ILISGFPGQLADSLTSTLQPYFEDKENAFFVSTDFCHWGDRFGYTSYTPNGDLESMDD
                     ITVAFNGKSNSLKIYESIEAVDKKGMELISKGDVSLWRQYLQATENTICGAYPLTVLL
                     KLMGKADTFEWLGYTQSSHVLDPYDSSVSYASGYAIPS"
     gene            <176913..>179115
                     /locus_tag="PAS_chr3_0079"
                     /db_xref="GeneID:8199364"
     mRNA            join(<176913..176942,176995..>179115)
                     /locus_tag="PAS_chr3_0079"
                     /product="Beta-adaptin, large subunit of the clathrin
                     associated protein complex (AP-2)"
                     /transcript_id="XM_002492246.1"
                     /db_xref="GeneID:8199364"
     CDS             join(176913..176942,176995..179115)
                     /locus_tag="PAS_chr3_0079"
                     /codon_start=1
                     /product="Beta-adaptin, large subunit of the clathrin
                     associated protein complex (AP-2)"
                     /protein_id="XP_002492291.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0079"
                     /db_xref="EnsemblGenomes-Tr:CAY70011"
                     /db_xref="GeneID:8199364"
                     /db_xref="GOA:C4R3H6"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:C4R3H6"
                     /translation="MVNDSKYFVKCRGSELLAEFREATNSKKEKNTLLKKKNVLKKFL
                     ANITVESTDIIDVFTEVIKLYKEAQQSSLDQELRVMIYHCLRSTNHYRSEDREQVIEL
                     LLRDYYSKSIPAHIKGLALQTLTSIPNEHFIQASIPAVKKSLHDQDPHVRKTGCFCVA
                     RIYEFDLQIGNDAHLIDHLNDKLDDGNPSVVSSALVALSDITEKVEEFEFSISEDHAF
                     ELLDILPTINEWAQASSLSSILYFAPDSQATACEIIDKVLPYLQQSNNEVVLNALKVI
                     IYMSNYIMHPEDLIPQLPKRIGSALVSVLNSGPEIQFLLLRNTILLLLSKFNLVSLNV
                     TSFFCRYNDPIYIKDTKLEIIYLLANEENLHIILEELEEYARDSDVQMSRKAIRAIGN
                     LAIKLEDIATDAVLVLSDLIESKVPHILQEVVVVFKRIVRRYPYLHSKMLNNLMENID
                     MIEEPGSKLAIVWLIGEYNTAMEKNAVSLLKKIGQNFREDNSEVQLAFLTALIKVYLN
                     FSADKMCEDLVVETFRTATEDIGNIDVRERGFYYWRLLSNRRDFPNAIEEIVNAKLPV
                     ISSDPDNLDTRVLEELEMNIGTLASIYLKPVSHVFRLNKVKELQHTSALKREHSSVFA
                     AQKNHSSKTLRLRSSSSLTYRNKSASSLTPIEAEFKFNRQQAGQRYSSSKADDTDSDT
                     MVGSLDISGSRKQKNSLGLTRRMSKLGRKLTISR"
     gene            complement(<179154..>182531)
                     /locus_tag="PAS_chr3_0080"
                     /db_xref="GeneID:8199365"
     mRNA            complement(<179154..>182531)
                     /locus_tag="PAS_chr3_0080"
                     /product="Putative DNA helicase"
                     /transcript_id="XM_002492247.1"
                     /db_xref="GeneID:8199365"
     CDS             complement(179154..182531)
                     /locus_tag="PAS_chr3_0080"
                     /codon_start=1
                     /product="Putative DNA helicase"
                     /protein_id="XP_002492292.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0080"
                     /db_xref="EnsemblGenomes-Tr:CAY70012"
                     /db_xref="GeneID:8199365"
                     /db_xref="GOA:C4R3H7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018973"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3H7"
                     /translation="MEKRANETSSYTGELKKQKKALSIPVSDWPEYFQTLEKIHFRIN
                     TYFTFLCSRKHLVTTWELIKTAPESALKRQVTLEEGAQIAALLPDNVNFEYIDENQIH
                     TEKKQFTYNRGWEQKETDIFQLKDSDSDLNMSKQILIFEFVDGKIRKERDGISRYSSA
                     NALTTPTFSQDSMKKLISKRNTNFEIKVSQFLHKCYDNSLDPQDELNHIAKAYIPTTA
                     TYQDPIEEMVSNSTKTPSQPSNETRDPIPVIIDHLKQTPFYRDQISDKGLFHLQPKEP
                     VYEELDFDLSPEIWTGITHTKKINKLYSHQAEALNSICVHKKHVIISTSTSSGKSLIY
                     QIPLLKALQETNGLATALYVFPTKALAQDQKRSLSELVKSIPSLFNTVLDTYDGDTEK
                     SARLSIREHASVIFTNPDMLHSSILPSHKQWVPFLRNLQYVVIDELHMYKGLFGAHVA
                     LIMRRLRRLCSIYGNDSVQFISCSATLKYPMAHMHNIFGIDESDCQLIVKDGSPSGGK
                     YVVTWNPPNLMSRTLSQQDGNSTRESFIVQTAKVLVQLVLKNVRTICFCVVRRVCELL
                     MKEVRSQLKSMDKLDLVTKVMSYRGGYSTSDRRKIEREMFNGNLKCIISTNALELGID
                     IGTLDCVVMCGFPLSIANFQQQSGRAGRRNKDSLTIVVGSDDPVNRHYMNNPQELISM
                     EYQDLILDFSNTAVLESHLQCAAFEKPIDDLDWEAKWFSDYNQDQIEEILANRLDFLE
                     TSPDYPEPAYHVSSRYLPWPPSHVSIRAIEEENYAVVDITNNRNVVIEEVEASRTSFT
                     LYDGGIFIHQGLPYIVRDFNSDDKYAKVERVNVDWITSQRDFTDVDPVEVEKIRSLRN
                     GSDVPIYFGKIYTTIVVFGFFKKNKIGEIIDAVEVNNPPIVIKSKGIWIDIPSSALDF
                     IRMKHLNIAGGIHAAQHAIMNILPLFILSGVDEIQTECKAPEKEFATRQTKRVRPARL
                     IFYDAKGGQCGSGLSTKAFEYIDDILEKALNTVLNCPSECEWGCPNCVAAPFCKENSL
                     VLSKPAAIIILATILKKTIDLNSIPSGPEPFMPDIQIETIGESTETVKLSKDIEIIDV
                     RKASTPLEEVPKDEEIVFLGKRAIHNTPSTIKTEENP"
     gene            <183587..>184897
                     /locus_tag="PAS_chr3_0082"
                     /db_xref="GeneID:8199366"
     mRNA            <183587..>184897
                     /locus_tag="PAS_chr3_0082"
                     /product="Enolase I, a phosphopyruvate hydratase that
                     catalyzes the conversion of 2-phosphoglycerate to phosph"
                     /transcript_id="XM_002492248.1"
                     /db_xref="GeneID:8199366"
     CDS             183587..184897
                     /locus_tag="PAS_chr3_0082"
                     /codon_start=1
                     /product="Enolase I, a phosphopyruvate hydratase that
                     catalyzes the conversion of 2-phosphoglycerate to phosph"
                     /protein_id="XP_002492293.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0082"
                     /db_xref="EnsemblGenomes-Tr:CAY70013"
                     /db_xref="GeneID:8199366"
                     /db_xref="GOA:C4R3H8"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="UniProtKB/TrEMBL:C4R3H8"
                     /translation="MAISKVFARYVYDSRGNPTVEVDLYTEKGLFRAIVPSGASTGVH
                     EALELRDGDKSKWLGKGVLKAVANVNDIIAPAIVKANIDVKDQEAIDAFLNKLDGTPN
                     KGKLGANAVLGVSLAAAKAGAAEKNVPLYQHIADLSGTPKPYVLPVPFQNVLNGGSHA
                     GGALAFQEFMIVPTDAPTFSEALRIGTEVYHNLKSLAKKTYGQSAGNVGDEGGVAPDI
                     STPKEALDLISAAIEKAGYTGKIGIALDVASSEFYKDGKYDLDFKNPNSDPSKWLSGQ
                     ELAALYKELISQYPIVSIEDPFAEDDWAAWSHFFSTVDIQIVGDDLTVTNPIRIKRAI
                     EEKSANALLLKVNQIGTLTESIKAATDSYAAGWGVMVSHRSGETEDTTIADIAVGLRA
                     GQIKTGAPARSERLAKLNQILRIEEELGDKAIYAGKNFHKSVAI"
     gene            complement(<184965..>187573)
                     /locus_tag="PAS_chr3_0083"
                     /db_xref="GeneID:8199367"
     mRNA            complement(join(<184965..186953,187046..>187573))
                     /locus_tag="PAS_chr3_0083"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492249.1"
                     /db_xref="GeneID:8199367"
     CDS             complement(join(184965..186953,187046..187573))
                     /locus_tag="PAS_chr3_0083"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492294.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0083"
                     /db_xref="EnsemblGenomes-Tr:CAY70014"
                     /db_xref="GeneID:8199367"
                     /db_xref="UniProtKB/TrEMBL:C4R3H9"
                     /translation="MLNQKQWIVKQLKRSKSLSEEEKGEVWNQIQAVLVEAIRKKKED
                     VNDWERQGLPFFDKCDLQLCCEKDNDEPVLQGNNVDPIIDTTQRVAVSTDSPGDLPMD
                     DEEDSEDNFEKEEVEQIDRNHEANENAEPQNDGTIVTLGNEEEMVDEQSKDELSDKSI
                     EDLNKTPIEESDIEPAKKSEVQYVDNIKKDVIESEQASSTEEQHKSAEEIFEVPESQT
                     VLVDQIEQTEKSQLEDLQESQHRILETKDTNSDNKIATTGDYDERSAEQEDKQSHATN
                     QSATENKGALGATNDSIHDQDHEMVDRDPTSRIEVIKFRAFPRKGYLDRVTGSSGGVA
                     ISIQNQTEVSTFFNGQPNLNPDAQFLNPSETQSEPQVTNQLSEDPHDFPHKTSMKSSQ
                     HSPARSPINSPSKPISSATNSPKKSPNRTRTESPIIVPPGKPDSKFSPANAATTHSNK
                     SFVNSSLNSSSNSLTELSSKSPARSPGSHNFQTSQAPSQSNLPTFTPAVVTSQSPVLS
                     HSQSADYDDVSTHGIDSKTKDGSPTSPKGSPTASLPSSGPNLNPDNSLFGRESAPNSQ
                     QLSNTVTNEVDKLNLKKQVELLRRHFVNISSRSDDLAMQQEIESIFEKTAAIKDLEKR
                     VVFKTVCSQVLVKLFLKRSYFSTEVLPYLQFIAENRSTFDLYQEQDSYEYHLCLLTCY
                     YIYHRMEPELDKFAQCIVDRIEALDSKLDSQANQPLPMLLCKIGLSILYAFLDRNYHD
                     LFKSCFELVTIIDTEDHAAGKQFRLQSIRFSLATFLDREREKAITVIQQKFTEIPLRV
                     LIFELRFYSEDECLGFLDSLNLLNKLKEPQNESDDLILRF"
     gene            <187928..>190717
                     /locus_tag="PAS_chr3_0084"
                     /db_xref="GeneID:8199368"
     mRNA            <187928..>190717
                     /locus_tag="PAS_chr3_0084"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492250.1"
                     /db_xref="GeneID:8199368"
     CDS             187928..190717
                     /locus_tag="PAS_chr3_0084"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492295.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0084"
                     /db_xref="EnsemblGenomes-Tr:CAY70015"
                     /db_xref="GeneID:8199368"
                     /db_xref="GOA:C4R3I0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4R3I0"
                     /translation="MLSVTPESKSGKKIVAKRACLACREKKIKCDGEPMRAGKEADII
                     YPCTNCALCHTKCIFIPSNRGGRRKKGVSKVANSDFKKTTRGLPQEGSVHNYDVDTEA
                     FPYNYSLHSPESLKMQRLYPESLGHNQDARRSSYDRISSTHSQLSPNTSHHPQDYPTI
                     AHPGQYPNFNLPLPQSGRPGNVYTAPPMRVSSSTGALPLKSVPLKYSAQQYVGFHPPF
                     VGPHPSREDPIDSTDSVTTMSYRDHTPHFQRTPSSLSSSRYYDQTSSWLRTQSHYGSN
                     SPIDDSFLKPRKSLSSHSAAVKPRNSTLVMTSDSELELYEFPSWEITSYFIDLYYKYI
                     HPARSLMPSKAEFLKSISFPMHASLLHSLILTCCTHADPKIVRSHTFRNPKHWYNLTE
                     KYWPEMDLKCSLMSLTMLSETLSGYKFFRESIDGFQRASNLVKLNNMLASYTSMPDSQ
                     WKELVQISSTRQLMDRESFVRSIWLLYRLAIFHRLNEGDPFKPRPELTMEYPNDLEFP
                     MSDESFFNSFSNKDSDSEIKKPVTWEDVSSAIDYSITTDKDEVTLPNSFENYAPAVSF
                     FSTKVLSDVMDLIYRGICTLESKVTLFNSKLNALEKLSRNVYRIESVVVDRDVHSKVM
                     LINCTTLTGLFQIHLSRSILHTPICGELLLFKRCLHKAMLESQKQNLVSEDILNSFLE
                     ALRSADENQWRSLVPVIMSASGLVKLLELGQGVVDHKGTDLQGQILPVVVGPTSLEPA
                     IDIGVVDSDDEPVLKSKPWWHYAVSGIGAKRSGSVSTEPDVANAWVQYPLFASIPLCY
                     ATYHSASLLVLSKFVDIQLSTEDTANFNLKNNQVAIDFCVYGKRKVSLLSDDEKHDDK
                     SGEILTRKITVPVLQTHADIILKCWNSDILLEHMRLFAKFLQVQGKYYPIYNNAYQNC
                     QALTNFLEDKFLPNL"
     gene            complement(<190791..>192482)
                     /locus_tag="PAS_chr3_0085"
                     /db_xref="GeneID:8199369"
     mRNA            complement(<190791..>192482)
                     /locus_tag="PAS_chr3_0085"
                     /product="Phosphoribosylaminoimidazole carboxylase,
                     catalyzes a step in the 'de novo' purine nucleotide
                     biosyn"
                     /transcript_id="XM_002492251.1"
                     /db_xref="GeneID:8199369"
     CDS             complement(190791..192482)
                     /locus_tag="PAS_chr3_0085"
                     /codon_start=1
                     /product="Phosphoribosylaminoimidazole carboxylase,
                     catalyzes a step in the 'de novo' purine nucleotide
                     biosyn"
                     /protein_id="XP_002492296.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0085"
                     /db_xref="EnsemblGenomes-Tr:CAY70016"
                     /db_xref="GeneID:8199369"
                     /db_xref="GOA:C4R3I1"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005875"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016301"
                     /db_xref="UniProtKB/TrEMBL:C4R3I1"
                     /translation="MDSQVIGILGGGQLGRMIVEAASRLNIKTVILDDGFSPAKHINA
                     AQDHIDGSFKDEEAIAKLAAKCDVLTVEIEHVNTDALKRVQDRTGIKIYPLPETIELI
                     KDKYLQKEHLIKHNISVTKSQGIESNEKALLLFGEENGFPYLLKSRTMAYDGRGNFVV
                     ESKEDISKALEFLKDRPLYAEKFAPFVKELAVMVVRSLEGEVFSYPTVETVHKDNICH
                     IVYAPARVNDTIQKKAQILAENTVKTFPGAGIFGVEMFLLSDGELLVNEIAPRPHNSG
                     HYTIDACVTSQFEAHVRAITGLPMPLDFTKLSTSNTNAIMLNVLGAEKSHGELEFCRR
                     ALETPGASVYLYGKTTRLARKMGHINIIGSSMLEAEQKLEYILEESTHLPSSTVSADT
                     KPLVGVIMGSDSDLPVISKGCDILKQFGVPFEVTIVSAHRTPQRMTRYAFEAASRGIK
                     AIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSTLDGVDSLHSIVQMPRGVPVATVAIN
                     NATNAALLAIRILGTIDHKWQKEMSKYMNAMETEVLGKASNLESEGYESYLKNRL"
     gene            <192905..>193699
                     /locus_tag="PAS_chr3_0086"
                     /db_xref="GeneID:8199370"
     mRNA            <192905..>193699
                     /locus_tag="PAS_chr3_0086"
                     /product="Peroxisomal 2,4-dienoyl-CoA reductase, auxiliary
                     enzyme of fatty acid beta-oxidation"
                     /transcript_id="XM_002492252.1"
                     /db_xref="GeneID:8199370"
     CDS             192905..193699
                     /locus_tag="PAS_chr3_0086"
                     /codon_start=1
                     /product="Peroxisomal 2,4-dienoyl-CoA reductase, auxiliary
                     enzyme of fatty acid beta-oxidation"
                     /protein_id="XP_002492297.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0086"
                     /db_xref="EnsemblGenomes-Tr:CAY70017"
                     /db_xref="GeneID:8199370"
                     /db_xref="GOA:C4R3I2"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C4R3I2"
                     /translation="MSADLFSLNGKVALITGGTSGLGQGIVRGLYEAGAELILIHRPS
                     TDPTAFIEEVRMSNADGASIHTIELDLVDADLAKLEETVTSPAVEKSSTGKIDILINN
                     AAIAIKSEFTSFTEKDYAAIQKVNVDFPFRLTQLVTKHFIKNQIKGRIIFTASLYSFE
                     VTYPNQSVYATTKGAINSLMKALSVELAPKGITVNSLVPGFVKSNMTADSYGNEKKSN
                     EIVSRIPIGRWGEADDFKGPTVFLCSEAAAYLTGVSLPVDGGWLSK"
     gene            complement(<193708..>195093)
                     /locus_tag="PAS_chr3_0087"
                     /db_xref="GeneID:8199371"
     mRNA            complement(<193708..>195093)
                     /locus_tag="PAS_chr3_0087"
                     /product="Protein involved in bud site selection during
                     bipolar budding"
                     /transcript_id="XM_002492253.1"
                     /db_xref="GeneID:8199371"
     CDS             complement(193708..195093)
                     /locus_tag="PAS_chr3_0087"
                     /codon_start=1
                     /product="Protein involved in bud site selection during
                     bipolar budding"
                     /protein_id="XP_002492298.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0087"
                     /db_xref="EnsemblGenomes-Tr:CAY70018"
                     /db_xref="GeneID:8199371"
                     /db_xref="GOA:C4R3I3"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:C4R3I3"
                     /translation="MNNYNPDGSPVHGDYVQSNFRNKHDLEKYSPPKSNDPHDRLPTL
                     YEVLNRKTQTPVDLWSFYVYMKDSQSAIDYLDFWLDVIQHLNLCKSYVKGLKTTLTAN
                     YRQRNATNVASAIPRKTPPNNGSFVSPFGANDIGNNSRESVGSQKHKSISSSVLLDMI
                     MTENLLEDEDNNRLSSFLKGEATLRTSDPNVNQRIEELKRHSQSIGLNMGASNSNLSV
                     FETQPENREINRISTIKPEMLETFIKEEMDSAQLKNDSPRPENLFVTRADLRSSSRKI
                     LYTYFMEAAEKRLFIPEYIIKNIRHNLETEGRDDPEVFEEAKEYVFKAMENEAFPGFL
                     LSNAISNITVTSHLVRLIFGFFFLFVGFWVGYTLIFLNWNPKPVRAVVVIPFFIGTYL
                     LITSIYNIDPVLSIFGYGESKATHSGLIKLKEPFVRRLLLKRGLWVLLLTSVIAAVLS
                     IIFALVPGKRL"
     gene            <196924..>198018
                     /locus_tag="PAS_chr3_0089"
                     /db_xref="GeneID:8199372"
     mRNA            <196924..>198018
                     /locus_tag="PAS_chr3_0089"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492254.1"
                     /db_xref="GeneID:8199372"
     CDS             196924..198018
                     /locus_tag="PAS_chr3_0089"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492299.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0089"
                     /db_xref="EnsemblGenomes-Tr:CAY70019"
                     /db_xref="GeneID:8199372"
                     /db_xref="GOA:C4R3I4"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:C4R3I4"
                     /translation="MFGMLTETQAQQEERLLDEEEKIAPTAIYDLELLRECKSSRRRW
                     KFFCVLVFILTFTSVAQLYLSLSEFKNQLLITTLNRVKSAELTKDIDIIPIHSHNDEW
                     RRLPLYDALKVGAQSVEADIWYFDSDPETIFVGHNKVFLSSKWNLDDMYLNPLFSLIG
                     QNNIAKRFEDENVSTRRNGIFYNNLHQTLYFYLDIKSNGEKTMAALEDKLSHFINNEY
                     LSYYDSETDEFVEGPITVIITGNYPYDFIVSKTKRFFFIDAPLFKFKDDEELAKYNHS
                     SISLASSASLYELTESRRALGGVSGLSESQVETISSYIDIAHNNDIKVRVWETPSWPI
                     RTRNEVWKQLITLGVDTLNVDDLYAATTFF"
     gene            complement(<198143..>198472)
                     /locus_tag="PAS_chr3_0090"
                     /db_xref="GeneID:8199373"
     mRNA            complement(<198143..>198472)
                     /locus_tag="PAS_chr3_0090"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492255.1"
                     /db_xref="GeneID:8199373"
     CDS             complement(198143..198472)
                     /locus_tag="PAS_chr3_0090"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492300.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0090"
                     /db_xref="EnsemblGenomes-Tr:CAY70020"
                     /db_xref="GeneID:8199373"
                     /db_xref="InterPro:IPR019434"
                     /db_xref="UniProtKB/TrEMBL:C4R3I5"
                     /translation="MAKSSRSKSKLQAKAVKRSLEFQKYEDERRKRLFEKSQAALVKQ
                     KEEASEDKDSKPAKVSTVEVDIDIDSVPLKKPEKRTTKKNFKKRSRRQKWNHRLGFEQ
                     FTPEKPW"
     gene            <199002..>199616
                     /locus_tag="PAS_chr3_0091"
                     /db_xref="GeneID:8199374"
     mRNA            <199002..>199616
                     /locus_tag="PAS_chr3_0091"
                     /product="60S ribosomal protein L19"
                     /transcript_id="XM_002492256.1"
                     /db_xref="GeneID:8199374"
     CDS             199002..199616
                     /locus_tag="PAS_chr3_0091"
                     /codon_start=1
                     /product="60S ribosomal protein L19"
                     /protein_id="XP_002492301.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0091"
                     /db_xref="EnsemblGenomes-Tr:CAY70021"
                     /db_xref="GeneID:8199374"
                     /db_xref="GOA:C4R3I6"
                     /db_xref="InterPro:IPR000196"
                     /db_xref="InterPro:IPR015972"
                     /db_xref="InterPro:IPR015974"
                     /db_xref="InterPro:IPR027547"
                     /db_xref="UniProtKB/TrEMBL:C4R3I6"
                     /translation="MASPSSKIHHVTNKSRANLRTQKRLAASIIGAGKKKVWLDPNET
                     EQIAQANSREAIRKLYKDGLIVKKPPVGHSRARARAFAEAKRAGRHTGYGKRKGTANA
                     RMSTQTLWMRRLRVLRRLLVKYRDNGKIDKTLYHTLYRESKGNAFKHKRALIEHIIQA
                     KAEAAREKVLKDESEARRAKNRAQRERRQQRQAEKREAFLNEEA"
     gene            complement(<199673..>201526)
                     /locus_tag="PAS_chr3_0092"
                     /db_xref="GeneID:8199375"
     mRNA            complement(<199673..>201526)
                     /locus_tag="PAS_chr3_0092"
                     /product="Transcription factor required for full Ty1
                     epxression, Ty1-mediated gene activation, and haploid inv"
                     /transcript_id="XM_002492257.1"
                     /db_xref="GeneID:8199375"
     CDS             complement(199673..201526)
                     /locus_tag="PAS_chr3_0092"
                     /codon_start=1
                     /product="Transcription factor required for full Ty1
                     epxression, Ty1-mediated gene activation, and haploid inv"
                     /protein_id="XP_002492302.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0092"
                     /db_xref="EnsemblGenomes-Tr:CAY70022"
                     /db_xref="GeneID:8199375"
                     /db_xref="GOA:C4R3I7"
                     /db_xref="InterPro:IPR000818"
                     /db_xref="UniProtKB/TrEMBL:C4R3I7"
                     /translation="MSGQQGSKLPMIVDVSIDEQGKQVYQVHSTKKRVRDDMPVSNFK
                     SSKVKTESSVPLAASESGSSSSSASNVKEEEQDLKIPGSVEDTDVNPIWPADVELAFR
                     EALTIIPKKGLNKIKISGKCSGRNELISDYIFSKTGQVRTRKQVSSHIQVVKNMNKDH
                     ELIKLILEGPEDSNLVEPFDSVFTKIVLAKTTGGKENNSPENLSDSENDNINITPPAT
                     ALRTRASVPHLQLNDATMSGHQDTPVRATSARLPTPSSDNRDSVSLDRPLYVQAEIQN
                     FQFCLENAVMGMRFYLSNLQEPGFMYPPLRLKENANIKSRFPYLDSFVSTLNTRGVPI
                     LHGMTKIGNINYEQISSMDAFRSNSYITLQLDNLSVENASWSVVTAVYSFGKEKALFV
                     DPVEVKSDPSFGETRMYTLKVDFANRFWNAYTKGIWDLYLNPNIDNAVIARKEKYSIK
                     GTTIKQVLVSGNLSPRSITRFEDINSSLVRCILLWEFYKVEHPEPNTTTIRRLHLTND
                     DAMYVMNQPPFELTPQSSSKISSEAGLELPFQNLQRAPSVPYLDDSAHQMPVQQIPLT
                     SGVGVPLAGPAPFLDDMLMGNEESAHVNQFQGEAIDGDPKVIMSTSNIPLN"
     gene            <202296..>205295
                     /locus_tag="PAS_chr3_0094"
                     /db_xref="GeneID:8199376"
     mRNA            <202296..>205295
                     /locus_tag="PAS_chr3_0094"
                     /product="Constituent of 66S pre-ribosomal particles,
                     required for large (60S) ribosomal subunit biogenesis"
                     /transcript_id="XM_002492258.1"
                     /db_xref="GeneID:8199376"
     CDS             202296..205295
                     /locus_tag="PAS_chr3_0094"
                     /codon_start=1
                     /product="Constituent of 66S pre-ribosomal particles,
                     required for large (60S) ribosomal subunit biogenesis"
                     /protein_id="XP_002492303.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0094"
                     /db_xref="EnsemblGenomes-Tr:CAY70023"
                     /db_xref="GeneID:8199376"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R3I8"
                     /translation="MSGIKLDLSSLGDKVSSKLMGFKPTKEKEVKNKKSGGNTKGRSQ
                     DQGSMSGNPSTQNDTSDILNTGDIQKDLSSVMKNIGLTGKPLSTPTKQKKKASKKQES
                     KNNKEVAKEKSVEPIKNTKVPKEQERSKVTVKELSMKKSNMVTDFSNVITDKLSIPAQ
                     KDWYNVPMDTAVTADKLSAESLAALMKRGQEFLDRENEIYMREFSKASSQKKFLNDIL
                     TSGTLSDKISALTLLIQEAPLHNVKSVDALLLMCEKKSRTAALQSIEAVTDMLVNGIL
                     PDRKLHYFHRQPLNMQLSDEQLAIYVFEDHLKKQYFQFIGVLEHLLSDPISHIRVTVL
                     RHIFNLLASKPEQEANLLRLGVNKLGDSDNKINSKTSYLLLKLEEQHPAMVKVILDAI
                     IDVCFKSKEYHTQYYSVLTLNQTVLSVREVEIANQLVKTYFSLFEKTLLSNDKTNNLQ
                     LKAKEVTPGKQKKSIKRGKKGGISVKKVELTQDELMDERNSKLFSAILTGLNRALPYS
                     KLPDDIFTKHLDTLFRITHSTNFNTSVQALILIHRITVEQNVSKESADRYYRTLYESL
                     LDPRLITSSKQGIYLNLLFKSLKHDSNIERVMAFVKRIIQICHNWISIGTVSGMLYLL
                     IQLEHSIPTLRNLVFNSPIDYPVKVQEDDQKDSKKEPTTDSEKLPTSYDPRQRDPRFA
                     GAEKSSLWELNTFVDHFHPTVRLYARSLLDGSDEKVTKPDLGLYTLSHFLDKFVYKTA
                     KKNSATPSGSIMQSLNTPSTGHVLVHSANVSSSIDPSNTEEWLSRKVSEINPEDIFFH
                     QYFTIKKKRTGSLVNKKKKKKHTDDSDEEAASDSDSDIDSAVEGEISEGDASDFDEDE
                     VWSALVQSNPEVEALNNDLDNMSDFDPADFDYSDSDEEEKKKDDNVPVQIPSHLAAIA
                     AQEPYPEDSDNDNDNKFSSDEEAKIFGPDSEDELSSEDEKPKKKRARTDTSDDVSKKS
                     KSLKGLPMFASIEDYADLLEDDGEDEE"
     gene            <205824..>207644
                     /locus_tag="PAS_chr3_0095"
                     /db_xref="GeneID:8199377"
     mRNA            <205824..>207644
                     /locus_tag="PAS_chr3_0095"
                     /product="Phenylpyruvate decarboxylase, catalyzes
                     decarboxylation of phenylpyruvate to phenylacetaldehyde,
                     whi"
                     /transcript_id="XM_002492259.1"
                     /db_xref="GeneID:8199377"
     CDS             205824..207644
                     /locus_tag="PAS_chr3_0095"
                     /codon_start=1
                     /product="Phenylpyruvate decarboxylase, catalyzes
                     decarboxylation of phenylpyruvate to phenylacetaldehyde,
                     whi"
                     /protein_id="XP_002492304.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0095"
                     /db_xref="EnsemblGenomes-Tr:CAY70024"
                     /db_xref="GeneID:8199377"
                     /db_xref="GOA:C4R3I9"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C4R3I9"
                     /translation="MAPVPDIAYHTLNDLDHSWSMAPSASTIPMGEYIFRRIQSLGVS
                     SVFGVPGDFNLNLLEHLYSVEGMSWVGCANELNSAYAADGYSRASNKMGCVITTFGVG
                     ELSAINGISGAFSEYVPILHIVGTTPLSAKIAENNHTHHLVPKLSVFEPSDHFTYEKM
                     VAPVSCHQETVVNASDAPGQIDTLIRQILKYKRPGYLFLPSDLADINVDGDFLIQRTT
                     QQFYQSVDTNQSLTREVATKVLDKIYNCSNPAVLGDILCDRFQVTEHVRAFVKNACIK
                     SFSTFMGKSVLDESDSRYIGTYNGVESNNEVIGYFQASDLILHIGNYYNEINSGHDTL
                     YNNIDEEQLILMHPEYIKIGTELFRNVNFVHVLDVMLQMMDVSQIPRGISPTLSKKEI
                     NHIEHISASTPISQTHLLHKLQDFIKEDDFVVVETGSIMFGLPDLVLPKGARLFGQHF
                     YLSIGYALPAALGVGVAMKDGNSKGRLILLEGDGSAQMTIQEFGNYVYQQITPIIFLL
                     NNSGYTVERIIKGPQREYNDILPNWNWTEIFKTFGDRYESKSETKKIQTVEELDQVML
                     YTNNNNSKLKLFEVILDQMDVPWRFSYMTAASKNKAKIVG"
     gene            complement(<207728..>210391)
                     /locus_tag="PAS_chr3_0096"
                     /db_xref="GeneID:8199378"
     mRNA            complement(<207728..>210391)
                     /locus_tag="PAS_chr3_0096"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492260.1"
                     /db_xref="GeneID:8199378"
     CDS             complement(207728..210391)
                     /locus_tag="PAS_chr3_0096"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492305.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0096"
                     /db_xref="EnsemblGenomes-Tr:CAY70025"
                     /db_xref="GeneID:8199378"
                     /db_xref="InterPro:IPR012860"
                     /db_xref="UniProtKB/TrEMBL:C4R3J0"
                     /translation="MGELDSLAYILTAEFDKSKGIVITNQHPCEDDSWLLSSQLQDIS
                     NVLMPSQLQHSMNRESITVFPIYSTYSDVEFENAILSYDPKPHSLPSVILSISYFKSD
                     DSYRNGTANCLSIVTSLSFWYAYKNLLIVLLHLYMKDNDFSQLSAVFQTLNEIPLRQL
                     DLYFQNIPTIQKDLLKTLIERQELNNESEEESFLAKILNPNILDEDETEIIRGMLMFK
                     DYLEFSPQSKCFKANVLIPSVGTHFPIQIPLLSLLSSRFTFFGLNLEQESIIRTFLLD
                     SKSLKIQFYQDNKAFITNKEKDSIDNTAFKSVLPYGVHNTPFIIALINALLQRKRIIV
                     YSYSRSCNELLEFIMAYFIIVENFMSTDSPCTTDHLYPYVDLSQLEILEKMPFYVAGT
                     ANIIFQSKPIWDLFINLDDKSILLNFDSFTSNSQVLSRRSNSHKKFLNLKTNPNNFFR
                     RQTSNISNSSSSPFRTRHSSQTSGNSTPSPSVSSVKKRPDADSLYEIYANSSQQFEEN
                     YKFLLPTFKNNDALFSSSIAETQFDFNKHTSVGSSSSFIAFGFQYEDTSLDEISLFDS
                     SLSQIDSSLLKSIEDLLKNNERDSVICDTIFKYLDHLINRCFKSHEMISNSKKVREFT
                     DYIQLKLDDSGESSFNNKNLVISEINKYMQRNKIVQPFVLGVDYGNQFFSVTYPLDTN
                     SFNKSNLLSYYSSLNKGSSRNLFLYEDYLKANSMDGIIKTKLSNYLVGVKEQTYLFDI
                     EYILQNCFFVANEKFKDVHSLSFMKGQKQLYQIYKMLNGYINSVDSFDPLLYHCLKTD
                     KILDLNKQKNDKYVFDTLESTLMIVLFLVPEESNITGGQDEIQYPLQEEFENYLKILF
                     DKRTFFTEWFINHSNGFIKSGLRDYFHFHYE"
     gene            <210605..>211930
                     /locus_tag="PAS_chr3_0097"
                     /db_xref="GeneID:8199379"
     mRNA            join(<210605..210856,211437..211663,211720..>211930)
                     /locus_tag="PAS_chr3_0097"
                     /product="Nuclear protein that binds to RNA and to Mex67p,
                     required for export of poly(A)+ mRNA from the nucle"
                     /transcript_id="XM_002492261.1"
                     /db_xref="GeneID:8199379"
     CDS             join(210605..210856,211437..211663,211720..211930)
                     /locus_tag="PAS_chr3_0097"
                     /codon_start=1
                     /product="Nuclear protein that binds to RNA and to Mex67p,
                     required for export of poly(A)+ mRNA from the nucle"
                     /protein_id="XP_002492306.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0097"
                     /db_xref="EnsemblGenomes-Tr:CAY70026"
                     /db_xref="GeneID:8199379"
                     /db_xref="GOA:C4R3J1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R3J1"
                     /translation="MASLDKSLDEIISSNKKPVVRSKKAPAPKASKVAKVSKKQVARN
                     NIPKASVPKTPGSSDYIDPSYATKVIVYNLPHDIKQNAVKEFFQSQVGGVKSIALSYN
                     EKGLSKGIATVVFRDNTHATTAVKKYNGAPIDGGANKLRLEMIFDPTKKPLISRISAN
                     PVVEKPRKLNVQPIQTINKKKGPKATSKPAAAKPAPSKAGPKGGKKVRKPKKTVEELD
                     QEMADYFENKN"
     gene            complement(<211981..>212310)
                     /locus_tag="PAS_chr3_0098"
                     /db_xref="GeneID:8200423"
     mRNA            complement(<211981..>212310)
                     /locus_tag="PAS_chr3_0098"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492262.1"
                     /db_xref="GeneID:8200423"
     CDS             complement(211981..212310)
                     /locus_tag="PAS_chr3_0098"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492307.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0098"
                     /db_xref="EnsemblGenomes-Tr:CAY70027"
                     /db_xref="GeneID:8200423"
                     /db_xref="UniProtKB/TrEMBL:C4R3J2"
                     /translation="MSTFTGNGIPSFAKFWKQTLFLSTLAIGTALFVKSKIHLRKKNQ
                     HLPDAVLGDREQDYDISKIRPGFPQSKDDMTAYGRKSEFQGTADSYLTRKSGDKFSFF
                     PWFGGSK"
     gene            <212600..>213760
                     /locus_tag="PAS_chr3_0099"
                     /db_xref="GeneID:8199380"
     mRNA            <212600..>213760
                     /locus_tag="PAS_chr3_0099"
                     /product="Mitochondrial NAD+ transporter, involved in the
                     transport of NAD+ into the mitochondria (see also YE"
                     /transcript_id="XM_002492263.1"
                     /db_xref="GeneID:8199380"
     CDS             212600..213760
                     /locus_tag="PAS_chr3_0099"
                     /codon_start=1
                     /product="Mitochondrial NAD+ transporter, involved in the
                     transport of NAD+ into the mitochondria (see also YE"
                     /protein_id="XP_002492308.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0099"
                     /db_xref="EnsemblGenomes-Tr:CAY70028"
                     /db_xref="GeneID:8199380"
                     /db_xref="GOA:C4R3J3"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R3J3"
                     /translation="MSKNAQVDDLAHGLAGAGGGILSMIITYPLLTLSTHAQSSKTQK
                     PLDGSVDEKELEPKKSSTYGTLKRILKKQGVRGLYNGLESAILGIAVNNFIYYYFYEL
                     TGNTLEGLSRGRKRGSRVGGLSAFQSIVAGAIAGVISRIATNPIWVANTRMTVLSREQ
                     RDLKRVNTLQAILYIFKTEGFKTLFSGLIPALFLVLNPIIHYTIFEQLKTLLVKTRKR
                     ALTPLDALLLGAFGKLISTVITYPYVTLRTRMHLQNAENARNSSGESSVSNSAVLSAT
                     SDEDLGKEGDNEKKIAQEQPTNTIWGLSTKMLKEEGISSFYSGMSVKLSQSILSAAFL
                     FFFKEELVSASDVAIKAVKKVDYKSFLNNPAQVVPDLNPAPSPNADGSPVDI"
     gene            <213926..>214834
                     /locus_tag="PAS_chr3_0100"
                     /db_xref="GeneID:8199381"
     mRNA            <213926..>214834
                     /locus_tag="PAS_chr3_0100"
                     /product="Ornithine transporter of the mitochondrial inner
                     membrane, exports ornithine from mitochondria as pa"
                     /transcript_id="XM_002492264.1"
                     /db_xref="GeneID:8199381"
     CDS             213926..214834
                     /locus_tag="PAS_chr3_0100"
                     /codon_start=1
                     /product="Ornithine transporter of the mitochondrial inner
                     membrane, exports ornithine from mitochondria as pa"
                     /protein_id="XP_002492309.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0100"
                     /db_xref="EnsemblGenomes-Tr:CAY70029"
                     /db_xref="GeneID:8199381"
                     /db_xref="GOA:C4R3J4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R3J4"
                     /translation="MKNESDTSSYIKSNTQKKIDELVFGSVAGALGKVVEYPLDTIKV
                     RLQYSSGKTPEHPSTWKVITQTYKHEGFFNGFYKGLSSPLMGAAAECSSLFFSYELAQ
                     DWVKSYKPEITLLDKIYCGAFSGVVTSFILTPIELVKCKMQVINLQMKSEKPPGIARL
                     VSDIYKSQGLKGLWKGQLSTMIRETGGTALWFGAYEYVLILFNGGISKDAKSNGTSLQ
                     YIIAGGVAGAVYNASFYPVDTIKSMIQTEQSHHQQVKTADIILRLWRSRGFRGFYSGL
                     GITLLKSVPANGIVFFTHQTLKNNFS"
     gene            complement(<215484..>216257)
                     /locus_tag="PAS_chr3_0101"
                     /db_xref="GeneID:8199382"
     mRNA            complement(<215484..>216257)
                     /locus_tag="PAS_chr3_0101"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492265.1"
                     /db_xref="GeneID:8199382"
     CDS             complement(215484..216257)
                     /locus_tag="PAS_chr3_0101"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492310.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0101"
                     /db_xref="EnsemblGenomes-Tr:CAY70030"
                     /db_xref="GeneID:8199382"
                     /db_xref="InterPro:IPR025207"
                     /db_xref="UniProtKB/TrEMBL:C4R3J5"
                     /translation="MDKRQARPKSYLSVHDSIKNQVSIVKKPLIISKDLNEILKTQHQ
                     YEPNQAKHLSPLALNRLIRSVNFLLKARYASIFNRQAIHLVSLQYIESEKRMEIERLD
                     EFLKLYYLLEPFNSQDHSANNVHGLLLVQKEHFMDKVHKLPPSSTVAHLLKQRSDITP
                     LLASYDKVKENLISKENKVEALKQKLSHYNDILKLLTSSLSDPERLQQNLVISSNTEL
                     TAQINQLRILLSRLEYKLRDPKVKLQVSNTLKALPSKVN"
     gene            complement(<216374..>216871)
                     /locus_tag="PAS_chr3_0102"
                     /db_xref="GeneID:8199383"
     mRNA            complement(<216374..>216871)
                     /locus_tag="PAS_chr3_0102"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492266.1"
                     /db_xref="GeneID:8199383"
     CDS             complement(216374..216871)
                     /locus_tag="PAS_chr3_0102"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492311.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0102"
                     /db_xref="EnsemblGenomes-Tr:CAY70031"
                     /db_xref="GeneID:8199383"
                     /db_xref="UniProtKB/TrEMBL:C4R3J6"
                     /translation="MNYSYRQEELDCYFEFQCSTIVESVDAYPFRLEITRSIESVLDD
                     PQPELTLNNAVEKSSLLTMGDILFGRKKQCFNGPPVKGTQWTTNSLRKTADSKPNEKP
                     LKGLLAPSTDSISENVFTFNSSSHSLVEPAKVEDQLLAINSQNTNSSNPGSEVNLYSR
                     SCSIM"
     gene            complement(<217129..>217599)
                     /locus_tag="PAS_chr3_0103"
                     /db_xref="GeneID:8199384"
     mRNA            complement(<217129..>217599)
                     /locus_tag="PAS_chr3_0103"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492267.1"
                     /db_xref="GeneID:8199384"
     CDS             complement(217129..217599)
                     /locus_tag="PAS_chr3_0103"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492312.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0103"
                     /db_xref="EnsemblGenomes-Tr:CAY70032"
                     /db_xref="GeneID:8199384"
                     /db_xref="UniProtKB/TrEMBL:C4R3J7"
                     /translation="MDTIPRQNGVKRKMAAKLFNIKKNFEKLNGLAWLKQHRNLASAI
                     DIVDFPNSNKDISSASIMGSGYIPLHDILYQKAHPSSFMEQLKAGAIESDARSWNSST
                     RSSRIQVYQPEPSAIFAVHEVFVCSVQEVEFLEEYVTIVSQTSSSSNANEIISQ"
     gene            complement(<217832..>218380)
                     /locus_tag="PAS_chr3_0104"
                     /db_xref="GeneID:8199385"
     mRNA            complement(<217832..>218380)
                     /locus_tag="PAS_chr3_0104"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492268.1"
                     /db_xref="GeneID:8199385"
     CDS             complement(217832..218380)
                     /locus_tag="PAS_chr3_0104"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492313.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0104"
                     /db_xref="EnsemblGenomes-Tr:CAY70033"
                     /db_xref="GeneID:8199385"
                     /db_xref="UniProtKB/TrEMBL:C4R3J8"
                     /translation="MLTRRSVGLLQSTRISPVLTNFSSSRFYSAHHESDKKHDDHHEE
                     HHDEHHDDHHTPLGPAENIFNKWNVTPFVWLFATVGIFQWDKSHRESHDGKGILDFLG
                     EIKVKESLDTYFKEYQTKVASTADLYGLISFTPKRDIHHYVIRVDEVPGKHFPTNTTG
                     NFGNTVDFENLEPRRKPINPYL"
     gene            <218614..>218937
                     /locus_tag="PAS_chr3_0105"
                     /db_xref="GeneID:8199386"
     mRNA            <218614..>218937
                     /locus_tag="PAS_chr3_0105"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492269.1"
                     /db_xref="GeneID:8199386"
     CDS             218614..218937
                     /locus_tag="PAS_chr3_0105"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492314.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0105"
                     /db_xref="EnsemblGenomes-Tr:CAY70034"
                     /db_xref="GeneID:8199386"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:C4R3J9"
                     /translation="MVEWLAIVYDKPGTDRTELRPLHLKDIPPAVESGIVTNAGAIYH
                     GLDFEGKPSEFAGSAFNLVADTKEEALEFLKKDVYAKSGIWDVDNILIFPYGCAYRKG
                     KDLPK"
     gene            complement(<218966..>219460)
                     /locus_tag="PAS_chr3_0106"
                     /db_xref="GeneID:8199387"
     mRNA            complement(join(<218966..219333,219448..>219460))
                     /locus_tag="PAS_chr3_0106"
                     /product="Profilin, actin-and phosphatidylinositol
                     4,5-bisphosphate-binding protein, involved in
                     cytoskeleton"
                     /transcript_id="XM_002492270.1"
                     /db_xref="GeneID:8199387"
     CDS             complement(join(218966..219333,219448..219460))
                     /locus_tag="PAS_chr3_0106"
                     /codon_start=1
                     /product="Profilin, actin-and phosphatidylinositol
                     4,5-bisphosphate-binding protein, involved in
                     cytoskeleton"
                     /protein_id="XP_002492315.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0106"
                     /db_xref="EnsemblGenomes-Tr:CAY70035"
                     /db_xref="GeneID:8199387"
                     /db_xref="GOA:C4R3K0"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:C4R3K0"
                     /translation="MSWNAYTDNLIATNKLDRAAIYSAAGDSQWATTNDLTLLPNEIQ
                     ELVAGFKDPSGLQATGLHIKGQKYFLLKNDERSIYGRHETEGIIAVKTKQAILIAHYP
                     PGVEAGEATLIVEKLADYLISVGY"
     gene            complement(<219653..>220942)
                     /locus_tag="PAS_chr3_1154"
                     /db_xref="GeneID:8199388"
     mRNA            complement(<219653..>220942)
                     /locus_tag="PAS_chr3_1154"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492271.1"
                     /db_xref="GeneID:8199388"
     CDS             complement(219653..220942)
                     /locus_tag="PAS_chr3_1154"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492316.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1154"
                     /db_xref="EnsemblGenomes-Tr:CAY70036"
                     /db_xref="GeneID:8199388"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:C4R3K1"
                     /translation="MSQELEQNRHSGEESPDPVLDANTSDVDDDGLDLFGDDDDEQPE
                     AKPGQLDDSSNDAEEDEQEKAGKPEAKVTSHTKSVYDNGETLDISLPIHPKSHIPQGK
                     QDRWVVKLPDFLDINAEPFDPRPFEMNVKTHEDKNQELLDKLIAVNTVRWRYAKSETG
                     GIFKETNSQIIQWEDGTYSLRVGSEIFDMFTTNTDDNYLVSEHNEEGILMTESTLSKS
                     VKLVPASFQSTTHQKLAKALSAKQKKESYARSVVTKEDPEERQRRLESQENERYRLER
                     RRKQAEEEEDYDSYAVSTSRSRPSRASQMYNAADEDDDDDDVAIGRTLASRRNNGYED
                     DGFIIDDEEEEEAVENDSADEESENEGDDDEEDDEEAAERLNRLKRAGASKYTNEGEQ
                     AQSEPVKSEEADNASQRDDAPRKKRRVILDDDEEEEE"
     gene            <221352..>222836
                     /locus_tag="PAS_chr3_0107"
                     /db_xref="GeneID:8200186"
     mRNA            <221352..>222836
                     /locus_tag="PAS_chr3_0107"
                     /product="Sporulation-specific chitinase"
                     /transcript_id="XM_002492272.1"
                     /db_xref="GeneID:8200186"
     CDS             221352..222836
                     /locus_tag="PAS_chr3_0107"
                     /codon_start=1
                     /product="Sporulation-specific chitinase"
                     /protein_id="XP_002492317.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0107"
                     /db_xref="EnsemblGenomes-Tr:CAY70037"
                     /db_xref="GeneID:8200186"
                     /db_xref="GOA:C4R3K2"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029070"
                     /db_xref="UniProtKB/TrEMBL:C4R3K2"
                     /translation="MKIAQLFLRNHLDFVLISGTGVVLFTLIALFGDISTLDSNNRQT
                     QKVLKDSMKALDKEQKEQQQVIHGSPHAPLSYRTCAYFSYWSVYEPRNFTPSDLPISQ
                     LTNVFYAFFDIDCETGKVVVIDKWSSLEMPLKFSPRSDDIKTLYADGTAEAKKLKQLH
                     FSKKTVGALKQLYQMKLIKPSLQTSMSIGGWGRTDGFKALMKDESKVEQFVSSCVSAM
                     QEFGFDGVDLDWEYPSNDEEGQFLLHLVSSLKRKLSQLEAHYELPPDTFLITLATPAS
                     LYTLQHYPLSRLDLFVSFWNVMTYDFAGSWSPQTEYHSNLYSPKGEMLSVKDAMAYYV
                     RNAIPPNKLIMGLPNYGRGFGNTDGYNKKFKGVGKGTSDEEGIYNYNMLPQNFKDNEK
                     YDPEAVAAYSYEPISRTFVSYDTPRVVREKAKFVKNNGYGGAMWWEACGDFYFDNPEQ
                     SLLLNFVDELGGTQTLLKVPSSQHQDNNTKSAFYKKSNTLKGLV"
     gene            complement(<223044..>223907)
                     /locus_tag="PAS_chr3_0108"
                     /db_xref="GeneID:8199389"
     mRNA            complement(<223044..>223907)
                     /locus_tag="PAS_chr3_0108"
                     /product="Protein required for Golgi localization of
                     glycosyltransferases"
                     /transcript_id="XM_002492273.1"
                     /db_xref="GeneID:8199389"
     CDS             complement(223044..223907)
                     /locus_tag="PAS_chr3_0108"
                     /codon_start=1
                     /product="Protein required for Golgi localization of
                     glycosyltransferases"
                     /protein_id="XP_002492318.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0108"
                     /db_xref="EnsemblGenomes-Tr:CAY70038"
                     /db_xref="GeneID:8199389"
                     /db_xref="GOA:C4R3K3"
                     /db_xref="InterPro:IPR008628"
                     /db_xref="UniProtKB/TrEMBL:C4R3K3"
                     /translation="MSEGLQRRRGVKSSNDSSEALDVNNKENNRVAFDPQDLSSNSRE
                     VQSPMLTLMEEVLLIGLKDREGYLSFWNDNISYALRGLILLELAFRGKIQMVNDPARR
                     RFELPDRLIEVVDGSLTGEMLLDEALKLMKSDPTNSSVLNWIDLLSGETWNLMKINYQ
                     LKQVRERLAKGLVDKGVLRTERKNFFLFDMATHPISDPQAKRQVVKRMLNMLTNRNYI
                     IENDPKYFAKECGYQHLRSVALVCGCYAGNVLENVVFDLNYEQRDRAFNRADELLSQY
                     SDYPFENKKIP"
     gene            complement(<226274..>228238)
                     /locus_tag="PAS_chr3_0110"
                     /db_xref="GeneID:8199390"
     mRNA            complement(<226274..>228238)
                     /locus_tag="PAS_chr3_0110"
                     /product="Nucleolar protein involved in pre-rRNA
                     processing"
                     /transcript_id="XM_002492274.1"
                     /db_xref="GeneID:8199390"
     CDS             complement(226274..228238)
                     /locus_tag="PAS_chr3_0110"
                     /codon_start=1
                     /product="Nucleolar protein involved in pre-rRNA
                     processing"
                     /protein_id="XP_002492319.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0110"
                     /db_xref="EnsemblGenomes-Tr:CAY70039"
                     /db_xref="GeneID:8199390"
                     /db_xref="GOA:C4R3K4"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="UniProtKB/TrEMBL:C4R3K4"
                     /translation="MAKKQGKPSKEKDVFTSDDRFKSLYNDPRFSMPKKDQFKIKLDD
                     RFTSDDIKDYRHSAKIDRYGRKLKGEAANNDFERYYTTKDKELKDNNSKAEAKDLKKD
                     DEHSSESDESDSEEEAKVSKNSTVDIKVHIDKADDQLIDRARGEGFYSSSDEDSSDDT
                     SEEVSEEELEIESGNVEEGEPSKRLAVVNLDWDQVRSQDLMATFAGFVPSGGKIIRVD
                     ILPSEFGKERMQREDTEGPPKEVFKSSKKSKLSRANSSDDDSESSDTESEIEDLAAAA
                     KKLYEEDDEQDYDSKSLRRYQLQRLRYYYAVVTCDSIKTAKNIYINCDGTEYESTANV
                     FDLRYIPDEMEFDDRPRDSCSSVPKNYKPNNFTTDALQHSKVKLTWDETPVERVKMAQ
                     RAFSQKEIDEMDFKAYLASDSDSNSDQESNKKNLYKNLAIESSMLGYKSIFDDVKENG
                     SEDVDMEITFTPGLSEAEALKQKAESEGRELSTIEKVQQREKERKKQRKERIKELMKN
                     NREAIKESRRKPEETRELVIENNTDDEDDDAHFNMKDIVKAEKQKKRKGKSRTKNIDQ
                     EMLQDDFKPDLKDERFKEIFEEHEFAIDPTQAQFKETATMKEILKERSKRSHESKITK
                     SKKQKKEKKEPVENGNDIRNLVKKIKNKSK"
     gene            <228617..>230350
                     /locus_tag="PAS_chr3_0111"
                     /db_xref="GeneID:8199391"
     mRNA            <228617..>230350
                     /locus_tag="PAS_chr3_0111"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492275.1"
                     /db_xref="GeneID:8199391"
     CDS             228617..230350
                     /locus_tag="PAS_chr3_0111"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492320.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0111"
                     /db_xref="EnsemblGenomes-Tr:CAY70040"
                     /db_xref="GeneID:8199391"
                     /db_xref="GOA:C4R3K5"
                     /db_xref="InterPro:IPR006571"
                     /translation="MGQSVSSEEETKQDYRTVKVSKGQLQRLFDKNCLSLLTPIEVYS
                     LKENLHVRDINNDKQLSIDETVQLLGLPKDCPCNEVVYDFVRVLGWFPFFNSVDPLKG
                     ISLPMLIRSVVLSRSKSFFKLFKGDSSYKFEDLVFLVLSILSEPKDLVEKNLDSSCDE
                     TGVLELALQGDSNIHWAQCKVIKDFDNTNIKERKVSAYNLAIFLTFLLAISRPLMSDY
                     SQHLSQWSNFMSHGMNLVRSFDSSITERSLHSKTVGYAAFISTIETKMPNVLHPLDAL
                     LDSLLFMKQSKGASDVTPEFSVSTKLINEYSLAQLSTVLPLELCYSRLRKLYVGSESG
                     FSMRSFESKCFNWNAPTITFISGHRITSKKTKRYLLFEEQFPRSRAAEDETGSDFDHA
                     NDDSARLTFAVFLNQHWKTSNKEPFGDSKTTIFQLSPRQAVFKSSTFRKDYCYFNTSG
                     GGIGFGNEEPYLKNNTTKFRPGNVSLTIDSGLEFCVFRHLGKGGSFNPMVLEDDSIPV
                     YEDRFVISDLEVWGCGSEKELLEQAKRWAWEEKEAMARQRINADTLGEERAFLEMAGL
                     VGNHGASGGSV"
     gene            complement(<230400..>231746)
                     /locus_tag="PAS_chr3_0112"
                     /db_xref="GeneID:8199392"
     mRNA            complement(<230400..>231746)
                     /locus_tag="PAS_chr3_0112"
                     /product="Essential serine kinase involved in cell cycle
                     progression and processing of the 20S pre-rRNA into m"
                     /transcript_id="XM_002492276.1"
                     /db_xref="GeneID:8199392"
     CDS             complement(230400..231746)
                     /locus_tag="PAS_chr3_0112"
                     /codon_start=1
                     /product="Essential serine kinase involved in cell cycle
                     progression and processing of the 20S pre-rRNA into m"
                     /protein_id="XP_002492321.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0112"
                     /db_xref="EnsemblGenomes-Tr:CAY70041"
                     /db_xref="GeneID:8199392"
                     /db_xref="GOA:C4R3K6"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="InterPro:IPR018935"
                     /db_xref="UniProtKB/TrEMBL:C4R3K6"
                     /translation="MSDKESDREQETQNTKANILDKYANRIKTDEFVFKKSKTSKDKS
                     DRATVENVLDPRTIKFLEKLYRNGTITKLNGCISTGKEANVYHAVNETNGKQYAIKIY
                     KTSVLIFKDRERYVDGEFRFRNTKNQHNPRKMIKIWAEKEFRNLKRLHSSGLIPTPEP
                     VALKSHVLCMEFLTENEESPSPKLKDYQFKDTEEVGRFYQQMLVYMRIMFQKCHLIHA
                     DLSEYNSIVHKGQLYIFDVSQSVEPDHPMSLDFLRMDIKNVNDYFQRKIQVYPERLVF
                     QFIVNGWDAIKEKTDKNTVLEEENEQTLFQYLESLPLKGEDDSDAGFEDDIFRSMHLV
                     RSLNNLEDRDFQEFADGKITTLNELVQDINLESDSDLSSDSESESDSDLDAESDSASD
                     SEKSWEERDTSLKGKRFEDKDEKKARKQQAKELKQDKRKTKMKKHLKKKLIRKTKK"
     gene            <231895..>232724
                     /locus_tag="PAS_chr3_0113"
                     /db_xref="GeneID:8199393"
     mRNA            join(<231895..231924,231981..>232724)
                     /locus_tag="PAS_chr3_0113"
                     /product="Component of the inositol phosphorylceramide
                     synthase"
                     /transcript_id="XM_002492277.1"
                     /db_xref="GeneID:8199393"
     CDS             join(231895..231924,231981..232724)
                     /locus_tag="PAS_chr3_0113"
                     /codon_start=1
                     /product="Component of the inositol phosphorylceramide
                     synthase"
                     /protein_id="XP_002492322.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0113"
                     /db_xref="EnsemblGenomes-Tr:CAY70042"
                     /db_xref="GeneID:8199393"
                     /db_xref="InterPro:IPR013862"
                     /db_xref="UniProtKB/TrEMBL:C4R3K7"
                     /translation="MGFLNSALPKKFLGIFPLYIGVELILGYAIINKMSGPYGLLSLF
                     TGHPIDFFQAMFYISSVIVLPLYFHGFKELFSPRIGMFSLVTTIYVLDTFLGLLSNLY
                     FALQWFTYGGEDTTINKPSFGESATTASESIASAATSTLSFSSFTASPTPDFNPLDST
                     VPQPYKREMDENVQSASQARELFVIIASSVLLNGVRIYFTLILLAFTKILIRMGKNEG
                     IQSNDFNDLNYMQGETKFGRVLYFLKVKCLRILQTVYNY"
     gene            <232965..>233732
                     /locus_tag="PAS_chr3_0114"
                     /db_xref="GeneID:8199394"
     mRNA            <232965..>233732
                     /locus_tag="PAS_chr3_0114"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492278.1"
                     /db_xref="GeneID:8199394"
     CDS             232965..233732
                     /locus_tag="PAS_chr3_0114"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492323.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0114"
                     /db_xref="EnsemblGenomes-Tr:CAY70043"
                     /db_xref="GeneID:8199394"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR013857"
                     /db_xref="UniProtKB/TrEMBL:C4R3K8"
                     /translation="MSLRTVFGTVKQVFKETFAPRDITPTLTLLDFKNNHELEKVVTR
                     CDQELGGYSTVNLDIARNGDNKCAHFHGNLNLDTPANNPKVMYSGWAMFRTKHKNAYQ
                     HKLFYLSDYFANFRWDFSPYQCMVLKCKIEPTECFTPSNSKDGTRLRSFFVNIQTDSA
                     SQTDLFQHRLFFQKPGQWETIIINLDDFVLTNRGRVLSQISGEMERERIKSIGIGITD
                     GIYGPYSLYIDSIKVMFGVDLAQSLNEARNANNEKSK"
     gene            complement(<233812..>236212)
                     /locus_tag="PAS_chr3_0115"
                     /db_xref="GeneID:8199395"
     mRNA            complement(join(<233812..234383,234556..>236212))
                     /locus_tag="PAS_chr3_0115"
                     /product="Transcriptional repressor and activator"
                     /transcript_id="XM_002492279.1"
                     /db_xref="GeneID:8199395"
     CDS             complement(join(233812..234383,234556..236212))
                     /locus_tag="PAS_chr3_0115"
                     /codon_start=1
                     /product="Transcriptional repressor and activator"
                     /protein_id="XP_002492324.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0115"
                     /db_xref="EnsemblGenomes-Tr:CAY70044"
                     /db_xref="GeneID:8199395"
                     /db_xref="GOA:C4R3K9"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C4R3K9"
                     /translation="MPDHVELQETSSYNDGRTDRPASRSGATTMSTKTSFIHKLYYML
                     EDGSMKHLIWWLPSGSSFAVVPNEDFSKALSHYFKHTNIASFVRQLNMYGFHKVNENS
                     STNSSNNGSTLPLDSVTQTEQNRSRASSTSSNPNGLSVWEFRHSSGFFQQGNSEDLKL
                     IKRRSRQSREGAPKGKDGVDIGNESNTFTPAPAIGPQALSAPSGAAQVSTTLEHPPVT
                     NGFSGSNGSMAPSSQSLASTSNPMTGTNPDVQSYTPQHYTLNSPSNTETNDEGHPMCQ
                     NTDPNSNSLTDNSGTKRFGNETTTNKSELGDNVLAKYNDLNNKFIEFRKDYDILQYKY
                     DLALEEMKKSNFDMINLINFMKESILSRTDFIRNQQSHPFDNEKNFEAELDSFKKSIL
                     EKCNERDLELRDSITKMTPPMIQPVVQPQSYQSHPNQVQYHPYHVQMPQQPFQQPNLS
                     NAYHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAATTTTTTTTTTTT
                     AAATAASATTTIATAAATTTTVPTVTCNYPTTPATTTSRNKILLLPPQIAGSHSGQIP
                     PVLSVPENRPQPYPQQNVENSHDGELKKYSSGSSLPRGSLSSVSSHSLGNNFSAGSVT
                     TLMEESQTETKRPSYSLINPPRSIPEYELPNNNNNINRQRLPSASSLTSIINITSNPA
                     YKDKYRAPNARHNSDYQYQRQQSIGSPSYPRLTDDNKRSLLTNEEENETRKRQRSMMD
                     TK"
     gene            complement(<236857..>238212)
                     /locus_tag="PAS_chr3_0116"
                     /db_xref="GeneID:8199396"
     mRNA            complement(<236857..>238212)
                     /locus_tag="PAS_chr3_0116"
                     /product="Protein of the mitochondrial inner membrane that
                     functions as an ATP-dependent chaperone, required f"
                     /transcript_id="XM_002492280.1"
                     /db_xref="GeneID:8199396"
     CDS             complement(236857..238212)
                     /locus_tag="PAS_chr3_0116"
                     /codon_start=1
                     /product="Protein of the mitochondrial inner membrane that
                     functions as an ATP-dependent chaperone, required f"
                     /protein_id="XP_002492325.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0116"
                     /db_xref="EnsemblGenomes-Tr:CAY70046"
                     /db_xref="GeneID:8199396"
                     /db_xref="GOA:C4R3L0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3L0"
                     /translation="MNSLPATANSNTPVVSLEKLKETDGSFKGMASGLLEDVMKGNPY
                     FAAGGGLMLLGTGLALLKSGITRVSGLAYRQMLVDLEIPSKDKSYLWFLEWMSQYKHR
                     SSRHLSVETNYTQHNNGSISTSFSLVPGPGKHLIKYEGAWMLINRERSGKLLDMTNGT
                     PFETITLTTLYRDRNKFPSLLEEAKRMALKTREGKTVIYTSWGQEWRPFGQPRMKRLI
                     DSVVLDKGIKESIIDDVQDFLTSGQWYHDRGIPYRRGYLLYGPPGSGKTSFIQSLAGY
                     LDYNICILNLSETNLTDDRLNYLMNHIPERSILLLEDVDAAFNKRSQTDEKGYSSGVT
                     FSGLLNALDGVASAEEMLTFMTSNHPERLDPALLRPGRVDYKVLIDNASIYQIERMFL
                     RFYGETHRELCDEFLEQFKTLGLPTVSAAQLQGLFVYNKRDPKKAIEMVEVLKQPNHV
                     F"
     gene            <238466..>242308
                     /locus_tag="PAS_chr3_0117"
                     /db_xref="GeneID:8199397"
     mRNA            <238466..>242308
                     /locus_tag="PAS_chr3_0117"
                     /product="Ubiquitin-specific protease that removes
                     ubiquitin from ubiquitinated proteins, cleaves at the C
                     ter"
                     /transcript_id="XM_002492281.1"
                     /db_xref="GeneID:8199397"
     CDS             238466..242308
                     /locus_tag="PAS_chr3_0117"
                     /codon_start=1
                     /product="Ubiquitin-specific protease that removes
                     ubiquitin from ubiquitinated proteins, cleaves at the C
                     ter"
                     /protein_id="XP_002492326.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0117"
                     /db_xref="EnsemblGenomes-Tr:CAY70048"
                     /db_xref="GeneID:8199397"
                     /db_xref="GOA:C4R3L1"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR025305"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C4R3L1"
                     /translation="MPDQVPSASTNVNNPFAQLEAYDFSKSKIFKTSNRLIDDIKNSV
                     LFLEQFSILNLPAVDYATQLSLQYQNRQINESFKLVLLNNQLDFAPTVSTEQLPNGTR
                     TVFRGLIVQDTVHGIPISDIPIYHCRILFKSLENEILCSKHQFFHFSDDSLSPSDRSD
                     LVTDYAKISKGELTDCEDDLKPSIVQSCPKLLDSTNYICRKCYKVLRIEIFEKDLSNE
                     EYKQFELNEIQFRYSKTVSADPSLNISNENDVNKIPSQSECLWTLFKVLRGPLSRDPE
                     ELEVKTLDVNHKILNIHLDMDIFEKCLFFHKSADGSYLTPPLFSEYGVFENLVRESYI
                     RKLLEVVYLGTICPNNPGLKRLNQFAQAYWFNDTGSKIFHFLKEFDSTAAIEWFGGLR
                     YDVLERYNPALTTLVSANYFNNKLICGSYSLLCESDPQNTPKYFDALRDIGLLRQAPV
                     VQEFVAKEASKNVFSFRDTMRNYQILGIDTSSADFPTLSDDEILKFYKYELILANSES
                     SYDRLRNALSSIADYRKSEALQNYLRIEPIHNIDQAYKHFDTPQSIEDDVLITAFQFK
                     KDDFPQAVALYDRALLTIAIQRKSLFLWSYITHNLDYLFKVIVASSSKTITGVEDAYK
                     YLGCDPLATDFQVVTIFQERLIKDPGIDVILFFYSLVVIEKSRSSKLIGKFLQNGVVD
                     ASFLPLESSPVGLNNIGNTCYLNSLLQYYFVIKPLRTAIQNFKDILPSSEEEFNSIED
                     YSKRRIGGRTVGYKETERSFQFVYQLRDLFDELIHSRRIAITPTKELAYLAFSPSTDE
                     VQFHLPEVQKPRPSITESETGMSDAPVPELSPVAMDWSSSIAYPEPSSSHHEESAALN
                     SPDESSELIHSPTKRKLSPQPSTEDLNEIDTKVSVTNAEPPTTTLPKRATTAVALIGN
                     DQLENALELGRQQDVTECIENVLFQLESASKPTSLDSDDQEQNDLVKELFYGRTKQIL
                     QPVDKETKENITDSSVRTKVERFVSLLVNIGDHPKDLYDALDTYFTEDLIDLDDGQVK
                     RSLTITELPKFLQIQVQRVQFDRERGIPFKALDPLPFHEKLYMDRYLETDNEELILKR
                     KEIFQWKNEISKLNRRKDEILVPSSHSMTPRNALIATKEFLEAQKELPGDIQATESTL
                     ITLQKEIDILNSELQTINSRLSELEEKCQHQFDQFKNTGYSIFAIFIHRGEASYGHYW
                     VYIRDPTRNIYRKYNDETITEVPISEVFNFSESNTATPYFLVFVREDLEDEVEPLKRE
                     LDSSPTTEDFRISVEELD"
     gene            complement(<242340..>244223)
                     /locus_tag="PAS_chr3_0118"
                     /db_xref="GeneID:8199398"
     mRNA            complement(<242340..>244223)
                     /locus_tag="PAS_chr3_0118"
                     /product="One of six subunits of RNA polymerase III
                     transcription initiation factor complex (TFIIIC)"
                     /transcript_id="XM_002492282.1"
                     /db_xref="GeneID:8199398"
     CDS             complement(242340..244223)
                     /locus_tag="PAS_chr3_0118"
                     /codon_start=1
                     /product="One of six subunits of RNA polymerase III
                     transcription initiation factor complex (TFIIIC)"
                     /protein_id="XP_002492327.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0118"
                     /db_xref="EnsemblGenomes-Tr:CAY70049"
                     /db_xref="GeneID:8199398"
                     /db_xref="GOA:C4R3L2"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R3L2"
                     /translation="MARRSQRISEKPIKSESLDKVSSDLDVSVRTSSRVENDTDSDYI
                     NTSTVSGASDEKGQQATKKNLSKPKKRSKNKTESDSIPAYFEWRSSNPDYEKLDDDPY
                     LDELLHFENTLQKIDSSSRVTALALKDRIFYCYGFNFGIVKSVIDRREEWVTNVFHPS
                     VSTVASGKYNIREIDLASFPETNYQPLVKMDDTLPKLDRTISLKLDDSQTMTHIHPSM
                     LIEIPNENDRVAKLLNTGGFVLETIWLPSYVAEKVPAYLLISLKDHDPQDGAFNPQFS
                     VFKRQQYPSALQFYKINPNNLNSILLVTIYLKTGGLTNLKVLSAEDNVVQLIALSSEK
                     TIHLYKLILEDTKSEICLTVDKPSLELSVKDLLITSFDMISPDRIIFGTSSGTIGEFD
                     LSNKDPFSPVYLYQTPLQSIVLLKTNGSDLLYEDSLNSELVVITSMDYKSLILDLADI
                     IKLVRTAIKQRYFLNQIEYSPFAKVFIATDDTASLTLFASRDSTAIISGASHTNRINR
                     IGISPLHPMALSGSVDGEVRISNSFSSIFFMARSKSRPVSLCLWKLEHSSSEDAFRLV
                     SHLKVGKAEQKVTLDATIFPNSITFTSLSWNESISSCNLYAAGSACGLVILEALESGT
                     TKK"
     gene            complement(<244342..>245499)
                     /locus_tag="PAS_chr3_0119"
                     /db_xref="GeneID:8199399"
     mRNA            complement(<244342..>245499)
                     /locus_tag="PAS_chr3_0119"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492283.1"
                     /db_xref="GeneID:8199399"
     CDS             complement(244342..245499)
                     /locus_tag="PAS_chr3_0119"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492328.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0119"
                     /db_xref="EnsemblGenomes-Tr:CAY70051"
                     /db_xref="GeneID:8199399"
                     /db_xref="GOA:C4R3L3"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R3L3"
                     /translation="MTRDNDIEKAGFNTKLVHGDDSSARVPDVVQPINVSTTFRYNDD
                     PASLVAALDLEPGSGILDNLIYSRLSHPNSEKLEQVFEGILDGHVVMYSSGLAAFMAM
                     LTHYNPKVIAIGQGYHGCHGIADIFTRLNGLKQIGLDDDYSQLGPGDIVHLETPVNPE
                     GVSFDIKHYAEKAHARGAYLVVDSTLAPPPLQEPFKFGADMIMHSATKFFGGHSDLLA
                     GCLVTKDLDIKHKLIEDRVYLGTNVANLESFLLLRSLRTFKIRLLTQSQSAQQLVQYL
                     QNHIKEFSALSAVHHSSLQKDAYIKEQLPIGHSPVFSIDVDSPETARQLPYRLKYFHH
                     ATSLGGVESLVEWRSMTDKSVSQTLVRVSVGIEDVEDLIQDFHQALSGLSK"
     gene            <245785..>246903
                     /locus_tag="PAS_chr3_0120"
                     /db_xref="GeneID:8199400"
     mRNA            <245785..>246903
                     /locus_tag="PAS_chr3_0120"
                     /product="Integral membrane protein of the endoplasmic
                     reticulum, required for normal content of cell wall bet"
                     /transcript_id="XM_002492284.1"
                     /db_xref="GeneID:8199400"
     CDS             245785..246903
                     /locus_tag="PAS_chr3_0120"
                     /codon_start=1
                     /product="Integral membrane protein of the endoplasmic
                     reticulum, required for normal content of cell wall bet"
                     /protein_id="XP_002492329.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0120"
                     /db_xref="EnsemblGenomes-Tr:CAY70053"
                     /db_xref="GeneID:8199400"
                     /db_xref="InterPro:IPR024722"
                     /db_xref="UniProtKB/TrEMBL:C4R3L4"
                     /translation="MKSSWKIGLFFIAFVVELVSCESSFPSFLFSHKLIPGIQDKLPH
                     SPQEPFTLQQTNYMINQVLEKCQANVFILVNQPGVIVQDFQDFYSFQNLRSYMVQAST
                     ILTFPHTVVTEEDPHKGLDLDKIQTYIMRQCRAKLLTLKDDDPGSIESFIDSKTRVIR
                     MDFTGIPSKAEEEYEGQREEILKKHDLTLLKVIRELPSPFITLLYTTDTAQEFAKIPD
                     ELVNVNEIPNDPQMIPLSMKNEILQKENVIFPDITLFDLTRLSEYERNNLGHYMNFDQ
                     KDRDAEPVLAVNDDKDKPIFNKPRSKKVDVRPEWLRFGEDDDSIPTLFNEEILRENAL
                     LVLSLSVSILGILLFIICKILASLVRLAFRSIHKQKTE"
     gene            complement(<247081..>247374)
                     /locus_tag="PAS_chr3_0121"
                     /db_xref="GeneID:8199401"
     mRNA            complement(<247081..>247374)
                     /locus_tag="PAS_chr3_0121"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492285.1"
                     /db_xref="GeneID:8199401"
     CDS             complement(247081..247374)
                     /locus_tag="PAS_chr3_0121"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492330.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0121"
                     /db_xref="EnsemblGenomes-Tr:CAY70054"
                     /db_xref="GeneID:8199401"
                     /db_xref="UniProtKB/TrEMBL:C4R3L5"
                     /translation="MKLSSSVSGAVRTFTYFMASGSHYMLKDVEYISLYGDEPSAIEQ
                     AYAIFINVLEMDENGNVTNMSHAEKRATDYIRSYCDPSFTVQPPYEDWEVALY"
     gene            <247583..>248071
                     /locus_tag="PAS_chr3_0122"
                     /db_xref="GeneID:8199402"
     mRNA            <247583..>248071
                     /locus_tag="PAS_chr3_0122"
                     /product="Small subunit of the clathrin-associated adaptor
                     complex AP-3, which is involved in vacuolar protein"
                     /transcript_id="XM_002492286.1"
                     /db_xref="GeneID:8199402"
     CDS             247583..248071
                     /locus_tag="PAS_chr3_0122"
                     /codon_start=1
                     /product="Small subunit of the clathrin-associated adaptor
                     complex AP-3, which is involved in vacuolar protein"
                     /protein_id="XP_002492331.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0122"
                     /db_xref="EnsemblGenomes-Tr:CAY70056"
                     /db_xref="GeneID:8199402"
                     /db_xref="GOA:C4R3L6"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027155"
                     /db_xref="UniProtKB/TrEMBL:C4R3L6"
                     /translation="MKFYTSVDIETQRLLLQQVHQLVITRTEDQCSFLTPPPLLEDYD
                     DIKVIYRHYATLYFVFIVDNQESELGILDLIQVFVEVLNNCFTNVCELDLVFGWQVLQ
                     AALEEIVQGGMVIDTNIKKIVAAIDKANLQIESSTAGSNLASKGLFAFKKQAPGLFNA
                     WG"
     gene            complement(<248123..>248575)
                     /locus_tag="PAS_chr3_0123"
                     /db_xref="GeneID:8199403"
     mRNA            complement(<248123..>248575)
                     /locus_tag="PAS_chr3_0123"
                     /product="Mitochondrial protein required for assembly of
                     ubiquinol cytochrome-c reductase complex (cytochrome"
                     /transcript_id="XM_002492287.1"
                     /db_xref="GeneID:8199403"
     CDS             complement(248123..248575)
                     /locus_tag="PAS_chr3_0123"
                     /codon_start=1
                     /product="Mitochondrial protein required for assembly of
                     ubiquinol cytochrome-c reductase complex (cytochrome"
                     /protein_id="XP_002492332.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0123"
                     /db_xref="EnsemblGenomes-Tr:CAY70058"
                     /db_xref="GeneID:8199403"
                     /db_xref="InterPro:IPR012420"
                     /db_xref="UniProtKB/TrEMBL:C4R3L7"
                     /translation="MAAANSSYLLWKKSLIYGGGIIGTGVLLYKFTTPTEEQLIARLS
                     PELRQEYEQNKSLRRKEQEELMKIVRETSKSNDPIWKTGPLTPSWESSATGPTDRLPK
                     GKELLVAKQAFEKSQAEEKQKEELRLLKKQVEETSQLESSKGSKWKFW"
     gene            <248830..>250308
                     /locus_tag="PAS_chr3_0124"
                     /db_xref="GeneID:8199404"
     mRNA            <248830..>250308
                     /locus_tag="PAS_chr3_0124"
                     /product="Squalene epoxidase, catalyzes the epoxidation of
                     squalene to 2,3-oxidosqualene"
                     /transcript_id="XM_002492288.1"
                     /db_xref="GeneID:8199404"
     CDS             248830..250308
                     /locus_tag="PAS_chr3_0124"
                     /codon_start=1
                     /product="Squalene epoxidase, catalyzes the epoxidation of
                     squalene to 2,3-oxidosqualene"
                     /protein_id="XP_002492333.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0124"
                     /db_xref="EnsemblGenomes-Tr:CAY70059"
                     /db_xref="GeneID:8199404"
                     /db_xref="GOA:C4R3L8"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="UniProtKB/TrEMBL:C4R3L8"
                     /translation="MSPERDYNIIVIGAGVVGPCIATALARQGRKVLIVERDWSEPNR
                     IVGELMQPSGLKALRELGMIEAINDIDAFYTAGYLVKNYNEDVLIPYSYKQDLKLVEE
                     PVPGCVKDGNDKLKDDKDTEAGISVKDWESDERIRGVAFHHGRFVMNLRKIATQEPNI
                     TKLQGNVTSLLKNDLDACIGVEVEDDSKNRKNYTAELVICTDGIYSKFRKELFLSKKP
                     QVGSYFVGLELQNAIVPKLHYGHVIMGDHAPILMYQISQTKTRVLCAYRSEKLPPKND
                     VLKYLNEVVLPSFPAETQPSLIEALSKDDCYRAMPNQYLTAKTNTIPGLAFIGDALNM
                     RHPLTGGGMTVGINDAALLARVLYDVRDLLDDATVSEKLAEFHYERKKLSSVINVLSI
                     ALFSLFDGDSKALLILRRGCFAYFKRGGKCVTDPVDLLSGLLPSPMILFHHFFSVAFY
                     GLWLNYIDRGLIGFPLAIWENLCALYTAIIVFTPYLWDELVV"
     gene            <250557..>252119
                     /locus_tag="PAS_chr3_0125"
                     /db_xref="GeneID:8199405"
     mRNA            <250557..>252119
                     /locus_tag="PAS_chr3_0125"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492289.1"
                     /db_xref="GeneID:8199405"
     CDS             250557..252119
                     /locus_tag="PAS_chr3_0125"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492334.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0125"
                     /db_xref="EnsemblGenomes-Tr:CAY70061"
                     /db_xref="GeneID:8199405"
                     /db_xref="GOA:C4R3L9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R3L9"
                     /translation="MLKIPRPTKVDPRPECFSSTLKECFCIFTLTFAPAAASMATGAY
                     QISINKVADHFHVAGGALTWSISSVGLANGSLLLLMGSIADLFGRRYSVLTAFTLYSM
                     FSLIGGFMNNYIALCIFRALQGVVVAVGTPAAAGIIGANYPIGRRKNRAFACFAAGAP
                     LGMCFGLVVGGIAAEFSTWRAIHFFNTVWYALLATVAFITVPKDQDTELSKKGKLATL
                     KELDYMGAFLSLTGFTLFCFSLTQVDVTVHGWKTPYIIALLIVGSLLIVALFVWEKYV
                     PRRPLMPMEMWSNSRFARSITIMSLLWLCFAGTLTYFSILFFENVQARSPLLTTAYIL
                     PMGIVGILTNIFIAFTLHVIPGRILLLAASLSFCGSAVIWATVSKNRLYWAGPFQAIS
                     LSVIGADTAYNVCNMVTMTSVSKDLQSSAAGVFNTVIQLSGAVGLAISSAVVNARNPL
                     YGTPQQNDDPVKLLDGFRNAWYCAIGYSVVAVVLSCFLKIGTYGNSQHEEAEPEIASE
                     TLPQGFDGKTSP"
     gene            <252521..>253027
                     /locus_tag="PAS_chr3_0126"
                     /db_xref="GeneID:8199406"
     mRNA            <252521..>253027
                     /locus_tag="PAS_chr3_0126"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492290.1"
                     /db_xref="GeneID:8199406"
     CDS             252521..253027
                     /locus_tag="PAS_chr3_0126"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492335.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0126"
                     /db_xref="EnsemblGenomes-Tr:CAY70063"
                     /db_xref="GeneID:8199406"
                     /db_xref="UniProtKB/TrEMBL:C4R3M0"
                     /translation="MVEVFMVHPNLQLSSCNNDLTKDLNRYKSVYETLQERYNEQVRA
                     FEKSHGGSKEDDGSLQYKELGYIKYFVDLAQKEYEYMCSYYQINNIIRKYFSKQEISP
                     EMEEEGLDLIEKEMASYKEIEKELDQLKARRGDVEQPIAEYCKRHPDDEGCKNRKEPL
                     IDTINAHN"
     gene            complement(<253092..>255248)
                     /locus_tag="PAS_chr3_0127"
                     /db_xref="GeneID:8199407"
     mRNA            complement(<253092..>255248)
                     /locus_tag="PAS_chr3_0127"
                     /product="Protein kinase with similarityto
                     serine/threonine protein kinase Ypk1p"
                     /transcript_id="XM_002492291.1"
                     /db_xref="GeneID:8199407"
     CDS             complement(253092..255248)
                     /locus_tag="PAS_chr3_0127"
                     /codon_start=1
                     /product="Protein kinase with similarityto
                     serine/threonine protein kinase Ypk1p"
                     /protein_id="XP_002492336.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0127"
                     /db_xref="EnsemblGenomes-Tr:CAY70065"
                     /db_xref="GeneID:8199407"
                     /db_xref="GOA:C4R3M1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:C4R3M1"
                     /translation="MMSSWKQKLKDSTHHFSRAKKDSSPTRDDQTFYSGGSPSSGSVD
                     VLSVSKPKPVLTRDSLEQANQRRNSSTESSMSTQTAVELDRASRSGNTVNVEEELKNL
                     SLKDDEQAIFTKDLSTTDPVMVPSSDSNSQLNSTEKTSDSQGFKPGLLTCKIYTGNDM
                     KLPIPLKISKVLMDRLIESGVDVNLSKLQETCNELLSAASQITNSEKDKTGNKINSKK
                     LELLMTKSIPALISVPSMYDPTPVKKPLIYLVVEFDKNTETINSIGNTINSPKFNNVT
                     TFDVSSNMQTLTINAFARLPSVLIPEDSLNQLNEEAKNLHNDKEPFRPLPQHDILIGS
                     TRVDLNKSTDISNATSSSRLINHEWVNIINPYNKDCMGLINLSIDFHPYSSKKSMSID
                     DFQLLKVIGKGSFGKVMQVRKKDTGKVYALKVIRKAHIVSKMEVTHTLAEKFVLSKVD
                     NPFIVPLKFAFQSPSKLYLVLSFINGGELFFHLLKSGKFSLARAKFYISELLSAIETL
                     HDMNIIYRDLKPENILLDYQGHIALCDFGLCKINMQLEQKTNTFCGTPEYLAPELLSG
                     QGYTRVVDFWTLGTLLYEMTVGLPPFYDENVKIMYKKILNDPLKFPAGFDPDAKSLIT
                     GLLQRDPTKRLGFNGSHEIKNHQFFADIDWQRLLSKSYIPPFKPPVQDSFDTSNFDAE
                     FTSERPLDSVVDDYLSESVQKQFGGWTYIGSSSYYP"
     gene            <261874..>265197
                     /locus_tag="PAS_chr3_0129"
                     /db_xref="GeneID:8199408"
     mRNA            <261874..>265197
                     /locus_tag="PAS_chr3_0129"
                     /product="SUMO/Smt3 ligase that promotes the attachment of
                     sumo (Smt3p"
                     /transcript_id="XM_002492292.1"
                     /db_xref="GeneID:8199408"
     CDS             261874..265197
                     /locus_tag="PAS_chr3_0129"
                     /codon_start=1
                     /product="SUMO/Smt3 ligase that promotes the attachment of
                     sumo (Smt3p"
                     /protein_id="XP_002492337.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0129"
                     /db_xref="EnsemblGenomes-Tr:CAY70067"
                     /db_xref="GeneID:8199408"
                     /db_xref="GOA:C4R3M2"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR023321"
                     /db_xref="InterPro:IPR027229"
                     /db_xref="UniProtKB/TrEMBL:C4R3M2"
                     /translation="MFVTGRQLFQSVSYSLWLGSTVHVFDRILTFQDTINRINTLRVS
                     ELKALCRATGRLVSGRKADLAERLKLFFQLGRDNNDNVLLLATRTLVLKAANFQEVPN
                     FDTIYNALKTNSHLFMLPSAGSNVVPAVQSSVTHNQLPMSTGNTNMFQGVNMFPTKPS
                     EDSKKVRPWVYFQESPFYRLKRLVHGTPVMAEKAPGRRGQCNIQFILNESETKTLFGK
                     PNYKLLLLSGSYDGRNVTNNAFVEFPQPLEIYCNKAPVKGNVKGIKNKPGTARPANLT
                     PFVKEPPTMNNLQVVYAFSNTDYLFYLYIVESFSAFDVLQKVLAQPHIIKEATLNSFN
                     KTEDDDDVVEMSQILSLKCPLSFSRMKYPCKSIYCEHVQCFDGLAFLQLQEQASTWSC
                     PLCSKKIDVKDLALSDYVEEILKNTSDLVETVEIDPNGNWTIGKEDEPDVSQPQEKST
                     EGLKSEPTEEFLPPPDASVEVISLDSDSEDQDDGVAINPPEPEVLNSTVLPQDMLSTT
                     VAVSNTTNNEGPSSSSASLPNGEEMLDYSDLPTANIRRGLPRIDSEGEDTASISSSPL
                     PPPSRPPIQSLSGENRLNAAMSVASGTQAQSNDTLHNSELGDVAEKDVGTEDGNRRQR
                     SISPLPPPAAPPPHLHSQSSNAQSANNTNSSITIEDSHAVKTASVTSQENPQGSLSVS
                     FTPPDAHRSISDPQSAQLRQMFNSTPYNSELTTNYSSNLANRPSSFSSSGFPRNTEVV
                     PPSNGNRRSEFNRTKSIQIFLQRQEQLLTHNPTLQQLEASLKLQDHIYNQIATQKKIL
                     EALNPSLRNEEGQYDQVIRQATVRTAQKNRILKLLAKKRGQLNHTHNHHANVNSISEK
                     VDGTMPNGHGSTDFVQSLRSAPLQASQNFSPLASSAQQEQHSQSPNFNRSYLVPSASN
                     SSGQVQNQDQYNFNFYGQPLVQTPNEVGAQTLPQLYPGAPSIHSSLRNDKQTQSQNIS
                     RNGVQPQLLNPAQESSETPSLVLPSWSNNSLLQSTGNPSASSPTNGYNNAEMHNDQDQ
                     NQQTQTKGLLGISMHTSIFDKTPLQDSNGSLKEPSTQKSTSSSSYARPAEGIAEVANK
                     RSKTVVDLTLSDEENDGDH"
     gene            complement(<265199..>265921)
                     /locus_tag="PAS_chr3_0130"
                     /db_xref="GeneID:8199409"
     mRNA            complement(<265199..>265921)
                     /locus_tag="PAS_chr3_0130"
                     /product="Farnesyl cysteine-carboxyl methyltransferase,
                     mediates the carboxyl methylation step during C-termin"
                     /transcript_id="XM_002492293.1"
                     /db_xref="GeneID:8199409"
     CDS             complement(265199..265921)
                     /locus_tag="PAS_chr3_0130"
                     /codon_start=1
                     /product="Farnesyl cysteine-carboxyl methyltransferase,
                     mediates the carboxyl methylation step during C-termin"
                     /protein_id="XP_002492338.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0130"
                     /db_xref="EnsemblGenomes-Tr:CAY70069"
                     /db_xref="GeneID:8199409"
                     /db_xref="GOA:C4R3M3"
                     /db_xref="InterPro:IPR007269"
                     /db_xref="InterPro:IPR025770"
                     /db_xref="UniProtKB/TrEMBL:C4R3M3"
                     /translation="MNSSKNLEPGQLEDQEKARILDSNNLHQVSAISLSLGVLFGLSL
                     SFLFTSELFQLPLYILCLSLFHFLEYYITAKFNTDKVSLDSFLINNGAEYILAHSLAI
                     FEVVLEAHWFPTLKSHRYISFFGLIFIVIGQFLRSTAMITAGRSFSHMISTTKKKEHV
                     LVTNGMYKYTRHPSYAGFFWWALGTQLMLCNPICFIGFLFTLRRFFKHRIEFEEQYLV
                     AFFNRDYINYKSCTGTLIPFIE"
     gene            <266154..>266723
                     /locus_tag="PAS_chr3_0131"
                     /db_xref="GeneID:8199410"
     mRNA            <266154..>266723
                     /locus_tag="PAS_chr3_0131"
                     /product="Essential nucleolar protein that is a component
                     of the SSU (small subunit) processome involved in th"
                     /transcript_id="XM_002492294.1"
                     /db_xref="GeneID:8199410"
     CDS             266154..266723
                     /locus_tag="PAS_chr3_0131"
                     /codon_start=1
                     /product="Essential nucleolar protein that is a component
                     of the SSU (small subunit) processome involved in th"
                     /protein_id="XP_002492339.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0131"
                     /db_xref="EnsemblGenomes-Tr:CAY70071"
                     /db_xref="GeneID:8199410"
                     /db_xref="GOA:C4R3M4"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C4R3M4"
                     /translation="MGKAKKTRKFAQVKRTLKSTDQRLKNSVQKPRDPKDDPELVRSV
                     PQVSSALFFQYNQAIKPPYQVLIDTNFINFSIQKKIDIVRGMMDTLYAKCVPLITDCV
                     VAELEKLGPKYRIALKLAKDPRIKRLSCSHRGTYADDCLVHRVIQHKCFIVATNDADL
                     KRRVRKVPGIPIMSVGGHKYEIERLPEVF"
     gene            <266992..>268938
                     /locus_tag="PAS_chr3_0132"
                     /db_xref="GeneID:8199411"
     mRNA            <266992..>268938
                     /locus_tag="PAS_chr3_0132"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492295.1"
                     /db_xref="GeneID:8199411"
     CDS             266992..268938
                     /locus_tag="PAS_chr3_0132"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492340.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0132"
                     /db_xref="EnsemblGenomes-Tr:CAY70072"
                     /db_xref="GeneID:8199411"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:C4R3M5"
                     /translation="MTDESIAQLKDMGFDEEVARQALVMTNNDVTGALSYLFGDGIPK
                     QQQGENEDTQHPEEKPNQRSDKENDQELEIESDHVQNTDIKLAGSSSSSLSPPPLPSR
                     EIHLDEEIRTKIAAYGSLRSDEPGVIEEDSDIEDDDDMSSVDSSDDYTVYDDPSATQR
                     NSYIPPILVPINYEYFESYLAPLIITLHEIPSFRNLIFKLESFNDYGYEKNWWKDKDI
                     KIAGSVGNRFVMELQRVVAFLDNAPSKRFFASIHNLVQHLSKDLLAGLNDMEGVEDFF
                     PAFFKSLSGAATGVDNEKLQRLFQSEIIEIYNGEEREKQVVECFTIEPDVLKCNIYQT
                     FHKLLWENDFERLGMIHINRLSEVMVIPILGNLNESVYGSFSVSEIFYPQIYLKENEQ
                     LMRSKIELRQELINQRLSNSKKIMDISSYQGKRVNDFLSTTVEYLQNKAEDEEIHKAL
                     QNINQIKDNIIKEKLSITDQQNAIVEKLNSNMDLFNIPGIVKEEKLDWEPYFLTSIVL
                     DTSNIYYFTKNFESKETDYCWYQVRYFHREHSKRVSNFNIRKIMDFSEIQNTIHEFTR
                     SGISNTMTLTYVKRSAFFDEDPLDVLPNNLVKFFNRDNEQLAENLRENSDEESEVIDL
                     TRDSDSYEEFDSSAESNGESARRI"
     gene            <269861..>270790
                     /locus_tag="PAS_chr3_0133"
                     /db_xref="GeneID:8199412"
     mRNA            <269861..>270790
                     /locus_tag="PAS_chr3_0133"
                     /product="GTP-binding protein of the ras superfamily
                     required for bud site selection"
                     /transcript_id="XM_002492296.1"
                     /db_xref="GeneID:8199412"
     CDS             269861..270790
                     /locus_tag="PAS_chr3_0133"
                     /codon_start=1
                     /product="GTP-binding protein of the ras superfamily
                     required for bud site selection"
                     /protein_id="XP_002492341.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0133"
                     /db_xref="EnsemblGenomes-Tr:CAY70074"
                     /db_xref="GeneID:8199412"
                     /db_xref="GOA:C4R3M6"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3M6"
                     /translation="MDRRRELNILMLGNVGVGKSSITLQFVQNQMPEHHDDDIEDTYS
                     RVWEIEGKEYQINILDTADSSQSTMETDLQSDHRRQQILATQGIILAFRINSKDSFDN
                     LSNILRNLSRIRGNSLPPILLLGNMMDLEDEREVSRTEAEYLQYQYKLDDYIEASASM
                     RLNVDDVFTRMIELILDIPDSKPHSANDSQVGIRQNSSMQGESKHDRNIDDEDFKLMR
                     EESYDERSRSLSQVSQDDHRLSPSLHQSSAISGREAKPVAEEPSKNQNGITENNQVTT
                     GNENKDSRELHSVNKTAVSAVKEKRATSCCILM"
     gene            complement(<271593..>273898)
                     /locus_tag="PAS_chr3_0134"
                     /db_xref="GeneID:8199413"
     mRNA            complement(join(<271593..272858,272912..>273898))
                     /locus_tag="PAS_chr3_0134"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492297.1"
                     /db_xref="GeneID:8199413"
     CDS             complement(join(271593..272858,272912..273898))
                     /locus_tag="PAS_chr3_0134"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492342.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0134"
                     /db_xref="EnsemblGenomes-Tr:CAY70076"
                     /db_xref="GeneID:8199413"
                     /db_xref="GOA:C4R3M7"
                     /db_xref="InterPro:IPR007342"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C4R3M7"
                     /translation="MLRRFLNFRRPLHYSAPIVSEEVQHAVKNNIPVVSLESTIITHG
                     LPYPQNLELANEVEHVIRDQSAIPATIAFINGSPKVGLSTEDLRLLADPASSGLPKHK
                     TSRRDIPYVVARGLTGGTTIASTMMLSKMAGIKVFATGGLGGVHRNGEVTMDVSADLE
                     ELSRTDVAVVCSGPKSILDVPRTMEYLETKGVPVCTFNDGNAPFGKHVPGFYTRSSNV
                     ASPFEFSSPKEAASMIFASLNMGLDNGQLFCIPPPLESALDLNFINSIIEDALQEAKV
                     LEISGKNVTPFLLDKIYHKTNGKSVECNAQFVLNNAKIASQIATELASLTKNESSIPN
                     KNKAKFNPSLNTPRIPQKVEAVIVGSIAHDTMCSLQSGYIANDSNPGTHAQSIGGVGF
                     NVALATHLASRDHGSFVETRLCSAVGNDLLGRGLMETMKSCGMATDAVSISENFPTGT
                     YVSIHDHSGALVVASADMKVVENISIEHAMECLGKYQPRWVLLDCNLSNSLIDSIVKL
                     EDFDVVIEPASAIKAAKLGKLNNLRIFPHNSVKLITPTVTELNAIFNEFHDNCLFDAY
                     QNEWFPVVDSLGLDYNVRHALDREFERNDYLRPLLEQGFLTKTFRLLPFFNNIIVKDG
                     KNGIIVFQIITDCDKYDNLIKGSKIIGSVSTFSFLTKGKPVGVGRIGVLVQHFPVLDV
                     VPSDEIINVTGAGDSLLGYLFSKLSADSSWLTRLDSTRESYLINSMKSSAASLKSNQA
                     INIDQIRQIP"
     gene            <274722..>275882
                     /locus_tag="PAS_chr3_0135"
                     /db_xref="GeneID:8199414"
     mRNA            <274722..>275882
                     /locus_tag="PAS_chr3_0135"
                     /product="Basic leucine zipper (bZIP) transcription factor
                     of the ATF/CREB family, activates transcription of"
                     /transcript_id="XM_002492298.1"
                     /db_xref="GeneID:8199414"
     CDS             274722..275882
                     /locus_tag="PAS_chr3_0135"
                     /codon_start=1
                     /product="Basic leucine zipper (bZIP) transcription factor
                     of the ATF/CREB family, activates transcription of"
                     /protein_id="XP_002492343.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0135"
                     /db_xref="EnsemblGenomes-Tr:CAY70078"
                     /db_xref="GeneID:8199414"
                     /db_xref="GOA:C4R3M8"
                     /db_xref="InterPro:IPR000837"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C4R3M8"
                     /translation="MAHNNPQLVQEQPFSPVSQIDVNPRQSQGQIQQQSNTLSSPINQ
                     GAEKSKKSSGGTFPHLFNQPTFDVHTMPPTNPPIFEQYYQQPSPFSHPIKTPNVIGVH
                     NSHQYPSAVSHAGLGFLDDQQFLSMNPSYYNTVNDDSSLYANVVPDVLNFNSTFDNDG
                     IVPSNPQFPTLKRRISISNGQIGQLIQATHMYQQQQQKGANFDQQELVKTSEHQARKT
                     PTHNIKLEDNSEFVSSLDSEGSDTKSSTIVLDDDGLPKHQLLYNNEVIFNPNDTLIPG
                     TSAWKRQKLLERNRIAASKCRHKKKVIQEKLQKDVDLFSQENRFLSKRIQLLEKSLEQ
                     IQALVDGHISNCSNEDDLSQIREAIRNLRVDEGALKKNFRDSIKLTQDEDSE"
     gene            complement(<275891..>277186)
                     /locus_tag="PAS_chr3_0136"
                     /db_xref="GeneID:8199415"
     mRNA            complement(<275891..>277186)
                     /locus_tag="PAS_chr3_0136"
                     /product="Component of the ESCRT-I complex, which is
                     involved in ubiquitin-dependent sorting of proteins into"
                     /transcript_id="XM_002492299.1"
                     /db_xref="GeneID:8199415"
     CDS             complement(275891..277186)
                     /locus_tag="PAS_chr3_0136"
                     /codon_start=1
                     /product="Component of the ESCRT-I complex, which is
                     involved in ubiquitin-dependent sorting of proteins into"
                     /protein_id="XP_002492344.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0136"
                     /db_xref="EnsemblGenomes-Tr:CAY70079"
                     /db_xref="GeneID:8199415"
                     /db_xref="GOA:C4R3M9"
                     /db_xref="InterPro:IPR008883"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017916"
                     /db_xref="UniProtKB/TrEMBL:C4R3M9"
                     /translation="MGLPESLLRWLFQVLKPQYHNPVLCYQDVSLILMKYSSLKPRTR
                     VFADNKGQDQLLLSLYGSIPCKHHNVTYEIPITIWIPLDYPNSHPTIYVTPSNETHVL
                     NPNNYVDANGKVYHPFISQWHSVYGADKYNDPKKVQENRLLKLVEVIGDAFGREFPLF
                     KRHAPPPIPGYDNPRQSPRLPTNEVNPMNSPRSEVLASSQPPPLPTKPKEYQSPPPDS
                     SRPLNFNTSSHSTPSQQSLSSPQPGATVPYVYKDMLSSNFDQSHKGDEQHSLLTSLHK
                     SLSVLLEQDLKLLYNEDILPQLQRIEKELLALKDLASKDDQLVKYYQTQIKKNKQILE
                     SKISEASYMIKNLSNDKSVDKIDEILVAETVVFNQLYDLRTEEASINDTIDIITKSHD
                     SGSIDTDLFLKYTRQLSREKFMVIALTKKIITSIGIENK"
     gene            <277352..>277694
                     /locus_tag="PAS_chr3_0137"
                     /db_xref="GeneID:8199416"
     mRNA            join(<277352..277359,277565..>277694)
                     /locus_tag="PAS_chr3_0137"
                     /product="Vacuolar H+ ATPase subunit e of the V-ATPase V0
                     subcomplex"
                     /transcript_id="XM_002492300.1"
                     /db_xref="GeneID:8199416"
     CDS             join(277352..277359,277565..277694)
                     /locus_tag="PAS_chr3_0137"
                     /codon_start=1
                     /product="Vacuolar H+ ATPase subunit e of the V-ATPase V0
                     subcomplex"
                     /protein_id="XP_002492345.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0137"
                     /db_xref="EnsemblGenomes-Tr:CAY70081"
                     /db_xref="GeneID:8199416"
                     /db_xref="GOA:C4R3N0"
                     /db_xref="InterPro:IPR008389"
                     /db_xref="UniProtKB/TrEMBL:C4R3N0"
                     /translation="MSGVWRSTVLLTLAMCWLMWAFTYLAQLHPLVAPRRSDLRPEYA
                     E"
     gene            <278151..>279248
                     /locus_tag="PAS_chr3_0138"
                     /db_xref="GeneID:8199417"
     mRNA            <278151..>279248
                     /locus_tag="PAS_chr3_0138"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492301.1"
                     /db_xref="GeneID:8199417"
     CDS             278151..279248
                     /locus_tag="PAS_chr3_0138"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492346.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0138"
                     /db_xref="EnsemblGenomes-Tr:CAY70083"
                     /db_xref="GeneID:8199417"
                     /db_xref="UniProtKB/TrEMBL:C4R3N1"
                     /translation="MALDLGSILWYLPLKVYGTAQVMVAILSFLIWQPIMSVIDVLFY
                     GLIRLPMSILLFKLLLIEDEKLQVHAGRVWEFSKIMYQFLSAAFIVGTCVGVWLGLSL
                     ILVSYLLLWEKPIFTPFKISNVLKSIAEYLGFADLWSKIVSSFGEPNAEGREHKTKRY
                     VLSLTSEQLKAMLVGDRKNVNPALSEGSTLVERTQSSRNKIARSVSNNFSKFNNSPRR
                     FSPLSPKSNIEVVNQNFQRPSSSGTTRTSTSTMDSAASTLTETSLPKGNSPVSHPVPP
                     ELTVNPLAIPTQPFWRSPSTSDVQQLTETPRSSRSPRDSVTSIVDPQYDDDRYFTPIV
                     SPQAPRSSFSASNNPESSRSISDYVIPEEEE"
     gene            <279350..>280375
                     /locus_tag="PAS_chr3_0139"
                     /db_xref="GeneID:8199418"
     mRNA            <279350..>280375
                     /locus_tag="PAS_chr3_0139"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492302.1"
                     /db_xref="GeneID:8199418"
     CDS             279350..280375
                     /locus_tag="PAS_chr3_0139"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492347.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0139"
                     /db_xref="EnsemblGenomes-Tr:CAY70085"
                     /db_xref="GeneID:8199418"
                     /db_xref="UniProtKB/TrEMBL:C4R3N2"
                     /translation="MFNSLYHAGNGRMNNNAFVSDMELQFPIINEQINSPLIFHTSSG
                     STESDTKVGGDQEYIFGPSPQPSASRSGISSGSEVMASTRLKSHPKSKVREKIEPNPE
                     WSEESKSNIPLIQRRLQLFLAMNYQEDPDTGDLICKYNEDVSDAPPDLGKSLQTIEKL
                     KKASTDKAGGNKRLPDDNSLELIRSSRIEILKFLINDILRGSGLIPRGENWYALTQYV
                     SLASTTPSLSDFSPVTSSASSVSSTFSHAMSTPSPQRLSVDILLNLSDAENISDQTNV
                     YQAKISLHFMSTACHPTTMMNFKDTFFPTITHNFRYLTPNSNPGGLKYVKLPTDMVLL
                     TTEVVVV"
     gene            <280750..>281607
                     /locus_tag="PAS_chr3_0140"
                     /db_xref="GeneID:8199419"
     mRNA            <280750..>281607
                     /locus_tag="PAS_chr3_0140"
                     /product="ER localized, heme-binding peroxidase involved
                     in the degradation of heme"
                     /transcript_id="XM_002492303.1"
                     /db_xref="GeneID:8199419"
     CDS             280750..281607
                     /locus_tag="PAS_chr3_0140"
                     /codon_start=1
                     /product="ER localized, heme-binding peroxidase involved
                     in the degradation of heme"
                     /protein_id="XP_002492348.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0140"
                     /db_xref="EnsemblGenomes-Tr:CAY70086"
                     /db_xref="GeneID:8199419"
                     /db_xref="GOA:C4R3N3"
                     /db_xref="InterPro:IPR002051"
                     /db_xref="InterPro:IPR016053"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="UniProtKB/TrEMBL:C4R3N3"
                     /translation="MSTKIPQQEIIPLRTDLAALGNRINAETRNAHNKIDKMMTLKFA
                     LALRDPKIYRQGIQMYYHIFSAIEESLDRELSKETPWTSILKQVYKPTIRRSERLYKD
                     LLFYYDNDPKKFAEPIMPEQIRFIRHIKESTAEKPYLLLAYMHVMYLALFAGGRIFRS
                     KLAKAVGLFPQVVGKTTEEISLEATNFFRFECEDEDAFRIVYKRDYELATRNNLTETE
                     KQEIIKESQLVFEENATCVKEIESHNLRRLQEKVLYKVATKGYYVVLAVLIMLAVFLL
                     KTIASRLLL"
     gene            <281879..>282568
                     /locus_tag="PAS_chr3_1155"
                     /db_xref="GeneID:8199420"
     mRNA            <281879..>282568
                     /locus_tag="PAS_chr3_1155"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492304.1"
                     /db_xref="GeneID:8199420"
     CDS             281879..282568
                     /locus_tag="PAS_chr3_1155"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492349.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1155"
                     /db_xref="EnsemblGenomes-Tr:CAY70088"
                     /db_xref="GeneID:8199420"
                     /db_xref="UniProtKB/TrEMBL:C4R3N4"
                     /translation="MSLSLISTVALLAPAFYFDPVLALDLGSLDQWQDTDSSRNSNAS
                     NDESGNSDSNSDASSESSLENSNQESNQNSEEGSTQDSNQNSNQNSAQTQQQTAATTQ
                     AQRASESEQTQSLAATTAASLETNTQQTPETTPTTTVWWSQSVTQWWTPSVTKWWTPE
                     SELTASSTDNSNSLSSTLSTVVSSSSTLKNTTSKNSTNSGLRSHQPNSNWKSGMLVGG
                     ILMASVVLSGL"
     gene            complement(<282658..>284424)
                     /locus_tag="PAS_chr3_0141"
                     /db_xref="GeneID:8200187"
     mRNA            complement(<282658..>284424)
                     /locus_tag="PAS_chr3_0141"
                     /product="High-affinity inorganic phosphate (Pi)
                     transporter and low-affinity manganese transporter"
                     /transcript_id="XM_002492305.1"
                     /db_xref="GeneID:8200187"
     CDS             complement(282658..284424)
                     /locus_tag="PAS_chr3_0141"
                     /codon_start=1
                     /product="High-affinity inorganic phosphate (Pi)
                     transporter and low-affinity manganese transporter"
                     /protein_id="XP_002492350.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0141"
                     /db_xref="EnsemblGenomes-Tr:CAY70089"
                     /db_xref="GeneID:8200187"
                     /db_xref="GOA:C4R3N5"
                     /db_xref="InterPro:IPR004738"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R3N5"
                     /translation="MSSEPVMQAKTKSKRLNVHNLLDEFDHIEDPFERRRLALEKIDN
                     AKFSLYHVRAIMVGGIGFLTDSYDIFAINLATSMLGYVYWGGAHGGTGRIPSSTESLM
                     KVSTSVGTVLGQVVFGKLCDYVGRKIWGIELIIMITATILQVCAGESPAVNFVALLTF
                     YRIVMGIGIGADYSLSSTITSEYSTKNTRGMIMAAVFANQGWGQLLAGIVALICVVGW
                     KSDLIDATNASECVGPCVLALDKMWRVLVGFGAVPGCIALYFRLTTPESPRYKLHKEL
                     QAYEQQMARQNDKMQLIAAENANNETAAAPLTFADRAVLEEEEEEHKVQPATWADFWN
                     HYRQWKYGKFLIGTAGSWFLLDVAFYGLNLNSAVILQAIGFASDENVYEKLYNVCAGN
                     LILICAGALPGYWVSVATIDTLGRKFIQLMGFIVVTALFCAIGFAYDKLSDKGLLGLY
                     IIVQFFINFGPNCTTYIYPVEIHPTRFRSTAHGISSASGKIGAIIAQTVLGTLINHGC
                     SADKPNCFLPHVMEIFALFMLLGVGTTLLLPETKKKSLEAIGEIYHGELNPDAFAADE
                     EDLSSSTGVDQELVNYQEQKHV"
     gene            complement(<286223..>287224)
                     /locus_tag="PAS_chr3_0142"
                     /db_xref="GeneID:8199421"
     mRNA            complement(<286223..>287224)
                     /locus_tag="PAS_chr3_0142"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492306.1"
                     /db_xref="GeneID:8199421"
     CDS             complement(286223..287224)
                     /locus_tag="PAS_chr3_0142"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492351.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0142"
                     /db_xref="EnsemblGenomes-Tr:CAY70091"
                     /db_xref="GeneID:8199421"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="UniProtKB/TrEMBL:C4R3N6"
                     /translation="MSDRVARYKAKREEERAAAAVHFEEEENIDDNEIVESKCIPCTS
                     EYQYEPERIIKVFQTCFQDMFEDQTELNQLVQSVKGDLYNRDYAAAFGEERKRDAYVI
                     RWSPARALAYSSLFSQLKEVRELIYDFSDEKKDLDVLAVGGGAGSELVALNSIYCFAK
                     EAYPNTEKKITVTLVDIADWSLVVDKITDFTKKYWLYKTATYKPEFVNHDILKPGVSF
                     VNRDLITLLFTTNELFAEDRTEATKFLQRLSSECKSGALLLIAESAGSFSHIQVGKKK
                     FPLTFLIDTILCGRPGSDNGAWTIIDGNDSVWYRTPKVQYDLKLENMRFFYRLYRKR"
     gene            complement(<287971..>288585)
                     /locus_tag="PAS_chr3_0143"
                     /db_xref="GeneID:8199422"
     mRNA            complement(<287971..>288585)
                     /locus_tag="PAS_chr3_0143"
                     /product="Secretory vesicle-associated Rab GTPase
                     essential for exocytosis"
                     /transcript_id="XM_002492307.1"
                     /db_xref="GeneID:8199422"
     CDS             complement(287971..288585)
                     /locus_tag="PAS_chr3_0143"
                     /codon_start=1
                     /product="Secretory vesicle-associated Rab GTPase
                     essential for exocytosis"
                     /protein_id="XP_002492352.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0143"
                     /db_xref="EnsemblGenomes-Tr:CAY70093"
                     /db_xref="GeneID:8199422"
                     /db_xref="GOA:C4R3N7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3N7"
                     /translation="MASRGTSRQQYDLTMKLLLVGDSGVGKSCLLLRFVDDSFNPSFI
                     TTIGIDFKIRTVEINGKKVKLQIWDTAGQERFRTITTAYYRGAMGIILVYDVTDERSF
                     NSVHNWYQTLNQHANEDAQLFLVGNKCDDEESRQVTKEQGEQLASELGVPFLEASAKS
                     NKNVDAIFLELAKRFEEKMRNTQQGPGSAGIDVNSSNDTKSSCC"
     gene            <289030..>290799
                     /locus_tag="PAS_chr3_0144"
                     /db_xref="GeneID:8199423"
     mRNA            <289030..>290799
                     /locus_tag="PAS_chr3_0144"
                     /product="Beta subunit of cytoplasmic phenylalanyl-tRNA
                     synthetase, forms a tetramer with Frs2p to generate ac"
                     /transcript_id="XM_002492308.1"
                     /db_xref="GeneID:8199423"
     CDS             289030..290799
                     /locus_tag="PAS_chr3_0144"
                     /codon_start=1
                     /product="Beta subunit of cytoplasmic phenylalanyl-tRNA
                     synthetase, forms a tetramer with Frs2p to generate ac"
                     /protein_id="XP_002492353.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0144"
                     /db_xref="EnsemblGenomes-Tr:CAY70095"
                     /db_xref="GeneID:8199423"
                     /db_xref="GOA:C4R3N8"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="UniProtKB/TrEMBL:C4R3N8"
                     /translation="MPTVAVDKEDLYQLLGRSYTTEEFDELCFEFGIELDEDTTNDCA
                     KGERPQLKIEIPANRYDMLCIEGIAQALNEYLGRSSAPAYSLQPAVPQVTMTIKESTS
                     TIRPYAAAAILRGIKFTQRSYDSFIALQDKLHTNLCRNRTLVAMGTHDLDTLEGPFTY
                     EALPPSEITFIPLNQTKAMDGNQLMEFYEKDKNLGKYLHIIKDSPVFPVILDKNRNVA
                     SMPPIINSDRSKITLETTNVFLDITGTDKTKVAIVVNQLVAMFSRYCSTPFSIEPVNV
                     VSEHNKETRVFPDIKPRLMQAEISYINSCLGLNLDVDTIIQLLKKMGLQPKQNESKND
                     LLDVYIPITRPDVLHQCDIMEDASIAYGYNNLVKTQAQSQALVAQPLPINKIADIVRL
                     ATSQNGWSETLPLTLCSHDENFKFLRQNDDSKAVKLANPKTIEYQVVRTTLLPGLLKT
                     VKENRKHSLPIKVFECGDIVLKDETLERRAKNQRNWAAVFVGKTAGFEFVQGLLGKIM
                     QTLRTDWLEKPSAGKRGYWIEQDDANATFFPGRGAKIFFRAADGAEANEIGSIGVLHP
                     EVLGFFEIPFAASSVEINTEKFL"
     gene            <294649..>295860
                     /locus_tag="PAS_chr3_0146"
                     /db_xref="GeneID:8199424"
     mRNA            <294649..>295860
                     /locus_tag="PAS_chr3_0146"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492309.1"
                     /db_xref="GeneID:8199424"
     CDS             294649..295860
                     /locus_tag="PAS_chr3_0146"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492354.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0146"
                     /db_xref="EnsemblGenomes-Tr:CAY70096"
                     /db_xref="GeneID:8199424"
                     /db_xref="UniProtKB/TrEMBL:C4R3N9"
                     /translation="MELRISKVPTSLSLNSRSRSLEDHVHCEAFKDEENFSSTYYDSG
                     MPQYRKHHIELAFLMKNDNLSLACRLQKISDILLMNARSRNFSLILKPRISKLLQKTV
                     LPSTVQVMENIQLYLEEEPEIVNSLMQIIESIYILENAQECQPFEPTISVLTDFYIFL
                     TMLQEAENTHTLDVWCLKVLDTVAVVTETSRNFEEIISWLVDFLNQMKGKQTSIWQNS
                     FDLLSKVLKHMSSLCEAPLSDALERSENGKILKLSLESQYKEYVTFDYSTAKYFPLNI
                     SETLNDIKVWKYLETEKKFPSFVALFEATQNSSYLSKNTALHLRQPDSLSNNKNHSPN
                     VEKENLNTHKSILGILCRKLKHSLAKRVAYSKQILNSFLGGDILVPSIGKTDSSAFKK
                     DVCNESVLDVI"
     gene            complement(<295960..>298572)
                     /locus_tag="PAS_chr3_0147"
                     /db_xref="GeneID:8199425"
     mRNA            complement(<295960..>298572)
                     /locus_tag="PAS_chr3_0147"
                     /product="Essential DNA-binding protein specific to
                     single-stranded yeast telomeric DNA repeats, required for"
                     /transcript_id="XM_002492310.1"
                     /db_xref="GeneID:8199425"
     CDS             complement(295960..298572)
                     /locus_tag="PAS_chr3_0147"
                     /codon_start=1
                     /product="Essential DNA-binding protein specific to
                     single-stranded yeast telomeric DNA repeats, required for"
                     /protein_id="XP_002492355.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0147"
                     /db_xref="EnsemblGenomes-Tr:CAY70098"
                     /db_xref="GeneID:8199425"
                     /db_xref="GOA:C4R3P0"
                     /db_xref="InterPro:IPR019337"
                     /db_xref="UniProtKB/TrEMBL:C4R3P0"
                     /translation="MEKGARIHYQIPSAISFRVKDMSLERLRQQPTLQELNEVLDELL
                     PIISDSAVKESVKLDIRSTLITVTVRQIYPDLSNLAKRKLAEIFQGAVGIKLLISSIQ
                     HAESLEIKCSLCDLLIIFLHNESSLESIFESNIRQARSLLFGSTVFNVLNETYQDVRQ
                     YKHTVTGKLQEITTLKGYTSVVLPTLVANLKKERNPQLLLAALQLCSPNESQLVFDHF
                     FQSPEPFSTLVSTYNTFTPVQKPAFIKALLGYCISRYSLRAPQNLDNLQKVYSILSQF
                     PWDSWSSFFITVLDYQNLPLLKVYVKLINKYQVSDLLKSLVQIWGAPTFINKTPLTLQ
                     KHYLHLIVLLLSHNPATNTEISSDHTFLTTITNRIDSTSLSVRAQGMLLANLVLQNSD
                     SQNKKVFIMKEQDDYESTFFEDLGDELKDSEAFDLVTSLVSDVCFPPLQTVSRVEKVT
                     EVTNMTPQNSNLHIVTDDELSDPEDSDDDDPSVSRKDYPTRPVYIKELLQYLLADEKD
                     PKAFDKLEVALKVAPTLIRQKSHFGDEIKHFTNELLATLVGLSNRFEMENFDQQRTNS
                     IISIIVSNSEHAIKELLNLFLTGDYSLQQRLIILTSFSLAARELKGHQDENVTRSFNK
                     VKTEFASSLLPKHIHDQFIELEHKQNGLLTFDQHAVQQLEDDYLNSTVESAEKNLMPH
                     GKVLRVSRGLELKKAQKSLQLSKSRQKKFFKLVGPKFFFPLATTWHALNSQSGFKIGR
                     YSPILTSHFIRTLSLILDTAYPSAPDLLDMIQEMVSILIPLKDSYFDQFSAPELVDKG
                     MNDELLILDSLVLSFLVILQNTNQEFLLQNYGQELSQISDWLQSILETVIDDGIRRKC
                     AGVLVSINNLFGNA"
     gene            <298739..>303589
                     /locus_tag="PAS_chr3_0148"
                     /db_xref="GeneID:8199426"
     mRNA            <298739..>303589
                     /locus_tag="PAS_chr3_0148"
                     /product="Glucose-repressible protein kinase involved in
                     signal transduction during cell proliferation in resp"
                     /transcript_id="XM_002492311.1"
                     /db_xref="GeneID:8199426"
     CDS             298739..303589
                     /locus_tag="PAS_chr3_0148"
                     /codon_start=1
                     /product="Glucose-repressible protein kinase involved in
                     signal transduction during cell proliferation in resp"
                     /protein_id="XP_002492356.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0148"
                     /db_xref="EnsemblGenomes-Tr:CAY70100"
                     /db_xref="GeneID:8199426"
                     /db_xref="GOA:C4R3P1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4R3P1"
                     /translation="MEAPEVKAQDVDFHDKSDSNSENSEVFLQEATARNPVLVLELTL
                     DSKIKYISKSWESIVGTSIEKLIGTPISEIIVGSEDDKAVLQKATDIMIVDDNSYRVK
                     FTTPTNTLKHEPSESEGEEEEQAPDIHSSPKSLERNSNICSDLSTDGGFIQLEGQGIL
                     IHNNTTHTPTHSIWMLKPSKQIDDLSLELPQQLVEGLGFGINIFESYLYQLTEAGIVD
                     EDNIPPPTHELCRICETQVPSWWMERHSEFCVTQHKTETIVELKHDAVVDQKKLIKQM
                     LLTLSNSDGISLPSKFTNSDDYPSSASSSSSSSSIASYRGFPLPTVTHPKQKHASVAR
                     QLITKMTPAVMNLNRFPFKNLFALQDMCDDAIRVNYGTVELHNGDYIVAYSPNSEAAI
                     KSLSERKLPESTDKAIKLLTEDTEAICKEKLDAIMRLSYVNQYVEKVTREMDDLILDA
                     VKHTIEKIRDQIERDDYNITSSSDDLDDRVIDPTPMKPNTFGQIYKFNESEQDRSLEF
                     ENVTEYEDAVSTIHSPQPQTRNTSSHVDLFNQTYLTNDSIPSNALSKSPAITELGKET
                     SRSLTPKELSETSTPVISISSNMSSNDGIEVIQTASSQNAPPKGQASQTLLQKAGSRS
                     SRSLTKNNLNSPRRQLSPAPNYFSGSPMSSIQKNTMSRIVRLSDSSRASTPQSSPKMN
                     TIDIPPVSDVEKDSTRSSINRIAPPLSPLLLSSNIPKQAMGPSIRDYEIIKPISRGAF
                     GSVYLTKRKITGEYFAIKVLKKSDMIAKNQVTNVKSERAIMMLQSESPHVVQLYSSFQ
                     SRDYLYLVMEYLNGGDCATLLKNMGQLPDMWAKRYIAEVIVCVEDLHNKGIVHRDLKP
                     DNFLIDHEGHLKLTDFGLSRMGLVGRHSRARENSTGFLGPPEMEVFQSQPSINARRRS
                     RAGSIPQLSLSPGVGPFGTHDSDNVVTHSPSSYYALESVLKSDKQAARTSSTSSSLNS
                     PLVKPLVNRSNSQTSFIIHDEDMVPSRMNSPFPSMNLALFDPKTSTQTRKFVGTPDYL
                     APETIQGVTQDEASDWWSIGCILFEFLFGYPPFHAKTPELVFDNILHGEIQWPEIPDQ
                     LFQELCSNTAKDLITNLLQKDPSKRLGINGAVEIKSHPYFKEIHWETLFTEEASFVPL
                     VENVEDTDYFDSRGAEMMIFPSDSESAHESNKETDNIPQTQASSPSLKTSAYITPSSG
                     SGSPGSNSQLGVPLKGKERRGSRLAEGSNGEFGLFSFRNISALEKANKDVIKRLKNEH
                     LENRGSFSSEPGSPTIQKGRQFSNSSGTIRRADSSPSNVLNSPIKRASSLNSGAILNP
                     KFGAVSNTGYSSGEEVASSAITKEDTNSPVGPNLLTTHARLHRSSGSRSTDHGSPIHK
                     ALKADSKTPVQSSPTDSNGHPGHGRFDSFSSASKMLFNYNNNNSTRRSSDLSATSSDT
                     DDTKNAALLRLKKRRNSRKFRTSSSSTRNKPWVFRYDILLLEPIPIHRYNMEVLLKKI
                     GVNVVSIKDPAELIRRASAGVKFDFIFTTFKLPNLDSADLVKLIKNTASVNSDTPIVC
                     VTAYFKEASSSGVFDYVIEKPATIEAIKHCINLFSEVKIMDAQEAISDSESLVSVPSF
                     NMAHAH"
     gene            complement(<303597..>304907)
                     /locus_tag="PAS_chr3_0149"
                     /db_xref="GeneID:8199427"
     mRNA            complement(<303597..>304907)
                     /locus_tag="PAS_chr3_0149"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492312.1"
                     /db_xref="GeneID:8199427"
     CDS             complement(303597..304907)
                     /locus_tag="PAS_chr3_0149"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492357.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0149"
                     /db_xref="EnsemblGenomes-Tr:CAY70102"
                     /db_xref="GeneID:8199427"
                     /db_xref="UniProtKB/TrEMBL:C4R3P2"
                     /translation="MESILLLPNERILKIIPIESCYLAPFTTKECYGLVGTADNRGLS
                     ILLEFYHYNSTNYTNVTVYVTSSRLVVVPHNQFRVLNRQRLSKYAFSIPYFSLSSFNL
                     SENRSCGRINFRAPASVTSISISLEFTDKNKNALTSLTSLVSSLIFAQGVSQCLEDKK
                     TDKIDVSWINRIDMGEGLFFIEGSTIPIQTFSNQPNKQEEEILPTYEHSEMATGRFLQ
                     AQKLLNRVRISLKSRTDDAYPEEEDCITLKEFVSQDDHYDHREASISIKEIRDLTQVT
                     GTWLAKVLITNCVRFIQRNLPKISLLREIMNDIPPTYQSLAEEFFFRCQNELYDTADP
                     ADIEEEPELVIPVRHNAMIVAETIASEQNTPKLRRSKSKRFMTGMKKLVNSHSCQPNI
                     PNIPRGNRHTLYTPSHSAASPNSSLDRSKSVTLGASRARLLQQF"
     gene            complement(<305816..>306415)
                     /locus_tag="PAS_chr3_0150"
                     /db_xref="GeneID:8199428"
     mRNA            complement(<305816..>306415)
                     /locus_tag="PAS_chr3_0150"
                     /product="GTP-binding protein of the rho subfamily of
                     Ras-like proteins, involved in establishment of cell pol"
                     /transcript_id="XM_002492313.1"
                     /db_xref="GeneID:8199428"
     CDS             complement(305816..306415)
                     /locus_tag="PAS_chr3_0150"
                     /codon_start=1
                     /product="GTP-binding protein of the rho subfamily of
                     Ras-like proteins, involved in establishment of cell pol"
                     /protein_id="XP_002492358.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0150"
                     /db_xref="EnsemblGenomes-Tr:CAY70103"
                     /db_xref="GeneID:8199428"
                     /db_xref="GOA:C4R3P3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3P3"
                     /translation="MAVNNPSEFRKKLVVVGDGACGKTCLLMVFAEGEFPPSYVPTVF
                     ENYATPVEVDNRIVQLTLWDTAGQEDYDRLRPLSYPDANVVLICFAIDIPDTLDNVQE
                     KWISEVLHFCPGVPIILVGCKLDLRNDPEVIRELQAVGKQPVSTSEGQAVADKIGALK
                     YLECSAKTGEGVRAVFENATRATLMAKERKQRKKKCNIV"
     gene            <307950..>308396
                     /locus_tag="PAS_chr3_0152"
                     /db_xref="GeneID:8199429"
     mRNA            <307950..>308396
                     /locus_tag="PAS_chr3_0152"
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /transcript_id="XM_002492314.1"
                     /db_xref="GeneID:8199429"
     CDS             307950..308396
                     /locus_tag="PAS_chr3_0152"
                     /codon_start=1
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /protein_id="XP_002492359.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0152"
                     /db_xref="EnsemblGenomes-Tr:CAY70105"
                     /db_xref="GeneID:8199429"
                     /db_xref="GOA:C4R3P4"
                     /db_xref="InterPro:IPR019145"
                     /db_xref="UniProtKB/TrEMBL:C4R3P4"
                     /translation="MTSMSAPATTLDQVENELSQLIETLIHLGVQVHDYAGTAESQLG
                     LSNNINKVVEHLQKLHNTDLNIPIPVDVVNYIEDGRNPDIYTREFVEVVRKLNQFLRG
                     KQLGFKYAQSTLGQKIVNEFPELKEQVENIKKRTFIETVPMGTNSS"
     gene            <308573..>308962
                     /locus_tag="PAS_chr3_1156"
                     /db_xref="GeneID:8199430"
     mRNA            <308573..>308962
                     /locus_tag="PAS_chr3_1156"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492315.1"
                     /db_xref="GeneID:8199430"
     CDS             308573..308962
                     /locus_tag="PAS_chr3_1156"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492360.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1156"
                     /db_xref="EnsemblGenomes-Tr:CAY70107"
                     /db_xref="GeneID:8199430"
                     /db_xref="UniProtKB/TrEMBL:C4R3P5"
                     /translation="MMLVKFYYKSKPSKKKQSRLKKIVSFKYSKIPHDQRKLASFMSD
                     IQTKQLDDSDDVHPLNISYLLGKESMSSTSSDGESCHVESPDDMDFETKNLFWKNKNV
                     ELTAYLSGYKRLYRVLEQRKRVLKGLA"
     gene            complement(<311262..>312863)
                     /locus_tag="PAS_chr3_0154"
                     /db_xref="GeneID:8200188"
     mRNA            complement(<311262..>312863)
                     /locus_tag="PAS_chr3_0154"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492316.1"
                     /db_xref="GeneID:8200188"
     CDS             complement(311262..312863)
                     /locus_tag="PAS_chr3_0154"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492361.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0154"
                     /db_xref="EnsemblGenomes-Tr:CAY70109"
                     /db_xref="GeneID:8200188"
                     /db_xref="UniProtKB/TrEMBL:C4R3P6"
                     /translation="MGLKTADPIPTPAFFRTYIYILSISPTLLGKETRMFLILLSSAL
                     TYVICWFGYTFLLHSYRDVDPLVLYHQSSVANTRKEGETAVYRSVDTPHGIDLVTGLR
                     ISWKYKLRDGNLKDIWKLGINHNSKITFGQEEYSMDSLTKTMQALSNYIESSQFSCIG
                     VDLSQYEWFIIILTGLCSLRDFTLHFHEDLIETYTSTEPKVIFTSFAYLDRVLKSDFD
                     TIVLVDSPPCPLVIDSRVATFSSLNLINENAEEYEYTFDLKDDTRNLLVQHSQGDAFT
                     YNQRCFVSSISALLQSLPTEHEWSTKDRLLTTFTNDITFNLNSLVKIFGALVTGINVR
                     ILPPQKLISELDNSTILNIPDNLLYQLMPKRNSFLVSRSRWLFSKGVFNKIAELPSFR
                     PLRLIYTSILEPPSVSSPFSSSYNYVQAITGARIINERLYEHIVGPIVKTNLFDYRIT
                     GGFVDRKHTFPRKLGVSANNGELILRDYQDYSADQKEGKLSVRGFNVGIKDIDEFRKD
                     DYWTHTDIVGKFGGDGVLYEDIATH"
     gene            <315713..>316444
                     /locus_tag="PAS_chr3_0156"
                     /db_xref="GeneID:8199431"
     mRNA            <315713..>316444
                     /locus_tag="PAS_chr3_0156"
                     /product="Diaminohydroxyphoshoribosylaminopyrimidine
                     deaminase"
                     /transcript_id="XM_002492317.1"
                     /db_xref="GeneID:8199431"
     CDS             315713..316444
                     /locus_tag="PAS_chr3_0156"
                     /codon_start=1
                     /product="Diaminohydroxyphoshoribosylaminopyrimidine
                     deaminase"
                     /protein_id="XP_002492362.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0156"
                     /db_xref="EnsemblGenomes-Tr:CAY70110"
                     /db_xref="GeneID:8199431"
                     /db_xref="GOA:C4R3P7"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:C4R3P7"
                     /translation="MSFVPFLEPFIPHENTLLPELPFVTLTYAQSLDSRIAAKKGERT
                     VISHQETKNMTQYLRSKHDAILVGVKTVLADDPGLNCKLGTPIRPIILDPTFQLLSKI
                     ASLKLIKLGLSGEGEPPVFITRKGVVSPDLQANLRSDYGISIVEIADRDVHRGKMSWF
                     AILKILKDAEIHSVMVEGGATIINDLLICRQNSVPLVASLIITVGPVYLGKDGVEVTP
                     ARSVKLGNVRWWHGIQDAVVAASLE"
     gene            complement(<316473..>317117)
                     /locus_tag="PAS_chr3_0157"
                     /db_xref="GeneID:8199432"
     mRNA            complement(<316473..>317117)
                     /locus_tag="PAS_chr3_0157"
                     /product="RNA polymerase subunit ABC27, common to RNA
                     polymerases I, II, and III"
                     /transcript_id="XM_002492318.1"
                     /db_xref="GeneID:8199432"
     CDS             complement(316473..317117)
                     /locus_tag="PAS_chr3_0157"
                     /codon_start=1
                     /product="RNA polymerase subunit ABC27, common to RNA
                     polymerases I, II, and III"
                     /protein_id="XP_002492363.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0157"
                     /db_xref="EnsemblGenomes-Tr:CAY70112"
                     /db_xref="GeneID:8199432"
                     /db_xref="GOA:C4R3P8"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="InterPro:IPR014381"
                     /db_xref="InterPro:IPR020608"
                     /db_xref="InterPro:IPR020609"
                     /db_xref="UniProtKB/TrEMBL:C4R3P8"
                     /translation="MEDNNRIISRLWRSFRTVKEMAADRGYFISQEEMDQSLEEFRSK
                     ICDSMGNPQRKLMSFLANPTPEALEKYSDLGTLWVEFCDEPSVGIKTMRNFCLRIQEK
                     NFSTGIFIYQNNITPSANKMIPTVSPAIIETFQESDLVVNITHHELVPKHIRLSDGEK
                     SQLLQRYKLKESQLPRIQREDPVARYLGLKRGQVVKIIRRSETSGRYASYRICL"
     gene            complement(<317242..>320016)
                     /locus_tag="PAS_chr3_0158"
                     /db_xref="GeneID:8199433"
     mRNA            complement(<317242..>320016)
                     /locus_tag="PAS_chr3_0158"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492319.1"
                     /db_xref="GeneID:8199433"
     CDS             complement(317242..320016)
                     /locus_tag="PAS_chr3_0158"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492364.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0158"
                     /db_xref="EnsemblGenomes-Tr:CAY70114"
                     /db_xref="GeneID:8199433"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR021772"
                     /db_xref="UniProtKB/TrEMBL:C4R3P9"
                     /translation="MTSVSYTLDTSEVTGHKLGVNSLAFSGDRLFSAGRDGMVASWSI
                     NKSVSNDAQGDDKYDEFDTNYKTHPQIDNYIAKNVDNETELSKLERSIARGLNFRQSS
                     FNGFELDKYSMLHSDWINDISVLDDSTIASCSSDLSVKLWNHKTSQVDTLGHHSDYVK
                     CLDFNEENNFLVSGGLDRQLKLWDVDHRKESSHYTGKSDRSSIYSVATSNHMICAGGP
                     ENAIQMYDHRIATPVLSLMGHRSTVRCLKISPSYILSGSSDTSVKLWCLRTNRILRTL
                     DMHLAPVWSLHAPDPDFGVFYSGDKSGLLFKTDLRSCNYDDYLDESNNDNFILQNKIN
                     ENLGVATLIADLSKSSKSENSVLSIVSNGSNVFTSTTTIQNSTEKSLKNTCIQAWKIP
                     ITNKIIIHQAIRLRKNILLLNSFRPGNLEDGDESRDVYDLVSMLSHETSNYDLAQIDD
                     ALSISHISPEATPIEDVIGLKSTPFASFQGGSSGEFAYADINTGQLTINIDPIDPDQF
                     ELLPMNDKPSFSCSGNPGLIRYQLLNNRRQVATMDDSLNTQLWDLLNFKKVDECMLYD
                     TKDVELEGSDEESYRFESYAEKFQTNETLPIWCKVQVRAGKLFITLEENTLTNTEIYM
                     DDLFELYPELGKYYSTHHNSESHDYTALRFNIGKLVLTSLFQNFVDLEIVKQKTGSVS
                     TSSSGISKKTEDPSDSTSKKFRLFGRTKSSNNTGASSIISTEDLVESIFDPNQPFKFN
                     NFEVPRISSTKNVQLIVNQQFQDLRNVTIEVYETNLSILKTLDQGSIDQVLKDLETHL
                     PKWIINALFYNKYMEKPLNKVNFVLLDGTPKDSPHKLPPLENNSLKLSAYNMLRMRKV
                     LCYIVEKFSEKPPEASIYPDPSSWLTVHCQGQKLDLNMTLATVKARIWKNSGDIELNY
                     TRTVPPSGGD"
     gene            complement(<320149..>320928)
                     /locus_tag="PAS_chr3_0159"
                     /db_xref="GeneID:8199434"
     mRNA            complement(<320149..>320928)
                     /locus_tag="PAS_chr3_0159"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492320.1"
                     /db_xref="GeneID:8199434"
     CDS             complement(320149..320928)
                     /locus_tag="PAS_chr3_0159"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492365.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0159"
                     /db_xref="EnsemblGenomes-Tr:CAY70115"
                     /db_xref="GeneID:8199434"
                     /db_xref="InterPro:IPR009730"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q0"
                     /translation="MKRYYTGKKVDDIDSDSSEEGTDSDLQEEPPLTVEGSLREVPKD
                     NILSLHSDLDERTQERNTDKKTINSTEHKNDDVLKMESNHDYESVQKTEDQTPPSSNA
                     EYLTSTAKETTLKVNDFSEQVPNASLVESSEESLDESVEESSEDSSDSSSTGQVLKPV
                     FVKRSKNVKPDSELDPDKEKNIILNNLQHYADKARETRIIPTQKDYLIIDDTDDIDPE
                     KEKLDWKIRELHRLKRDRDILVAKDQEYEEMQARRSLQDLT"
     gene            <321045..>321926
                     /locus_tag="PAS_chr3_0160"
                     /db_xref="GeneID:8199435"
     mRNA            <321045..>321926
                     /locus_tag="PAS_chr3_0160"
                     /product="ribosome biogenesis protein BRX1"
                     /transcript_id="XM_002492321.1"
                     /db_xref="GeneID:8199435"
     CDS             321045..321926
                     /locus_tag="PAS_chr3_0160"
                     /codon_start=1
                     /product="ribosome biogenesis protein BRX1"
                     /protein_id="XP_002492366.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0160"
                     /db_xref="EnsemblGenomes-Tr:CAY70117"
                     /db_xref="GeneID:8199435"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="InterPro:IPR026532"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q1"
                     /translation="MSAIYKALNKRSESKHTAKRVNRQRVLLMTSRGVTYRHRHLVQD
                     LFSLLPHAKKEPKLDHKKRLYELNEIAELYNCNNVMYFEAKKHQDLYLWISKPPNGPS
                     LKFHVQNMHTLDELNFTGNCLKGSRPILSFDKAFDDGEAQFQLMKELFIHVFGVPPLA
                     RKSKPFIDHVMSFSIVDGKVWIRNFQIAETEELKENEEAATIDDSILKDLTLVEIGPR
                     VVLTLITVLEGSFGGPKIYENKEYVSPNVVRAQQKQLEAEAAANRSKATLDRKIKIRD
                     QVLEADPLDNEVLFKNG"
     gene            complement(<322043..>322314)
                     /locus_tag="PAS_chr3_0161"
                     /db_xref="GeneID:8199436"
     mRNA            complement(join(<322043..322198,322267..>322314))
                     /locus_tag="PAS_chr3_0161"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492322.1"
                     /db_xref="GeneID:8199436"
     CDS             complement(join(322043..322198,322267..322314))
                     /locus_tag="PAS_chr3_0161"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492367.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0161"
                     /db_xref="EnsemblGenomes-Tr:CAY70118"
                     /db_xref="GeneID:8199436"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q2"
                     /translation="MGAAYTILGKTFQPHQLALATIGLVTLLAIPKPGGAKKETTPQI
                     NASSPEEEAFIKEYLAKHDQKHD"
     gene            <322564..>324486
                     /locus_tag="PAS_chr3_0162"
                     /db_xref="GeneID:8199437"
     mRNA            <322564..>324486
                     /locus_tag="PAS_chr3_0162"
                     /product="Component of a membrane-bound complex containing
                     the Tor2p kinase and other proteins"
                     /transcript_id="XM_002492323.1"
                     /db_xref="GeneID:8199437"
     CDS             322564..324486
                     /locus_tag="PAS_chr3_0162"
                     /codon_start=1
                     /product="Component of a membrane-bound complex containing
                     the Tor2p kinase and other proteins"
                     /protein_id="XP_002492368.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0162"
                     /db_xref="EnsemblGenomes-Tr:CAY70120"
                     /db_xref="GeneID:8199437"
                     /db_xref="GOA:C4R3Q3"
                     /db_xref="InterPro:IPR008828"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q3"
                     /translation="MAFPLSHRDAVFYMRRSILAISSVQTSGYDSVLQPLLSDNGNGN
                     DLSVSPPIEVNHSEFSPETSPHNEADSPSTITKEPNGSIGTLKSESTSQNNTSSDEIP
                     DKINTETDKGIETNNSDLEIDSSVDFFSSDDEDSFDEEYSDFPSSIDPELRSVPLTSE
                     TTAGTKNLSFAKRRNSNDSFKSRYTHNRSRSKTLGSLIGASSFNTGLTTVSEQLKTSK
                     SFNNLLNANRSDSSIGLEESALTRKTREKYHKPILTSRLTLMMKESPLENYKFVGTGD
                     HMVNLEVYVPSSSRYCDSPLELRINPAFTVVDTIGYILLTLSKLQELKSQSDENPNYW
                     RLHDPDIPSFTLDRTRKVSSYELDEVTLAKVDEKGFQENERITPMAFVFDPVSTEGAP
                     TTDAVPPPKESSFFLGEDIDDLVLNKTKIRGGMGNISHGSQDSVELAPFSLPNHNLLH
                     DQNVPKEITDLSAYEGKERKPPVTKKVASKAKKPALLHTSKQNPFSHFGSLSLHKSNI
                     ASSFRMGPKPKRSTILPISGAGSPLWATENFQKWTVYRKKQPMFISRHERSLVIDGDF
                     IYILPFSDDKGGISDGKTTSFLISRIIKCKQSRKYPNNFKIIIQKNSKFKRYDLEALN
                     SKQCREIVSKINFLIT"
     gene            <337216..>337944
                     /locus_tag="PAS_chr3_0164"
                     /db_xref="GeneID:8199438"
     mRNA            <337216..>337944
                     /locus_tag="PAS_chr3_0164"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492324.1"
                     /db_xref="GeneID:8199438"
     CDS             337216..337944
                     /locus_tag="PAS_chr3_0164"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492369.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0164"
                     /db_xref="EnsemblGenomes-Tr:CAY70121"
                     /db_xref="GeneID:8199438"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q4"
                     /translation="MWATCPGRIQLERGEAEELDLEEMRKTATWGRETRQKLIRYSFQ
                     KSSKLSILKPNIKMDLTYSAWKERVRTRNYILSKPDQEKPSTFTRLYRKVVRNWKKST
                     MDETQTPKGQSSPMNCTIFSSSLNQKYMSSDYEYSIPRRGSLRDSEESSLASIVSPGS
                     GIIPLKKDHSFRRQKSQLSRYSYKPADFGAIFDNLPESTDNDSQTFIASPLSDSSPNQ
                     DLWNHLPIRPFRAIDDGLEVEESD"
     gene            <338088..>339311
                     /locus_tag="PAS_chr3_0165"
                     /db_xref="GeneID:8199439"
     mRNA            <338088..>339311
                     /locus_tag="PAS_chr3_0165"
                     /product="Cytoplasmic tryptophanyl-tRNA synthetase,
                     aminoacylates tryptophanyl-tRNA"
                     /transcript_id="XM_002492325.1"
                     /db_xref="GeneID:8199439"
     CDS             338088..339311
                     /locus_tag="PAS_chr3_0165"
                     /codon_start=1
                     /product="Cytoplasmic tryptophanyl-tRNA synthetase,
                     aminoacylates tryptophanyl-tRNA"
                     /protein_id="XP_002492370.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0165"
                     /db_xref="EnsemblGenomes-Tr:CAY70123"
                     /db_xref="GeneID:8199439"
                     /db_xref="GOA:C4R3Q5"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q5"
                     /translation="MSQKELETATEQLHIKEESQVVTPWEVEGAIVDGKAQSIDYDKL
                     IKDFGTRHITQETLDRFTKLTGHKPHHFITKGVFFSERDFGKILDLYEKKQPFFLYTG
                     RGPSSDSMHLGHMVPFIFTKWLQDVFDVPLVIQLTDDEKFLFKPKLTIEDVKQFSKDN
                     AKDIIAVGFDPKKTFIFSNLEYISGGFYENVVRISRQITTSTAKSVFGFGDSDCVGKM
                     HFASIQIAPSFPSSFPDVLDLPPTAPALIPCAIDQDPYFRVSRDVAEKLKFSKPALLH
                     SKFFPALQGASSKMSASDTNTAIFMTDTPAQIKKKINKYAFSGGQTTVEEHRELGGDP
                     DVDVSYQYMKVFKDDDEFLRQTYDAYKSGDLLTGEMKQACIQVLQEFVKNFQDRRAAI
                     DEDTLNAFMKPHRIS"
     gene            complement(<339375..>341348)
                     /locus_tag="PAS_chr3_0166"
                     /db_xref="GeneID:8199440"
     mRNA            complement(<339375..>341348)
                     /locus_tag="PAS_chr3_0166"
                     /product="Arginyl-tRNA synthetase"
                     /transcript_id="XM_002492326.1"
                     /db_xref="GeneID:8199440"
     CDS             complement(339375..341348)
                     /locus_tag="PAS_chr3_0166"
                     /codon_start=1
                     /product="Arginyl-tRNA synthetase"
                     /protein_id="XP_002492371.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0166"
                     /db_xref="EnsemblGenomes-Tr:CAY70124"
                     /db_xref="GeneID:8199440"
                     /db_xref="GOA:C4R3Q6"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q6"
                     /translation="MLIAHKINLRTFFHFMLIKLPYCHLIKRAFATKVVTPRIAPEYR
                     PTMLGSVESLTNNLNTLSLKLPEVNIQGSFPESNPVDLLRNYITQELSKISGVDKELI
                     FPALEWGTTLEKGDLLIPVPRLRIKGANPKDLAEQWAAAFPKGGYLKDVIAQGPFLQF
                     FFNTSVLYKLVISDALERGDDFGALPLGKGQKVIVEFSSPNIAKPFHAGHLRSTIIGG
                     FISNLYEKLGHEVMRMNYLGDWGKQFGVLAVGFERYGDEAKLKTDPINHLFEVYVKIN
                     QDIKAQSESTEEIAEGQSLDDQARAFFKKMENGDESAVSLWKRFRELSIEKYIDTYAR
                     LNIKYDLYSGESQVPQEIMDEATKIFEEKGLLSEDQGAKLIDLTKFNKKLGKAIVQKK
                     DGTSLYLTRDVGAAIDRYRKYKFDKMIYVIASQQDLHTAQFFEILKRMDFEWAKNLTH
                     INFGMVLGMSSRKGTVVFLDTILEETKEKMHDVMRKNDSKYQQIANPEEVADLVGISA
                     VMIQDMQSKRINNYEFKWERMTSFEGDTGPYLQYAHSRLASITRNADIDLAELPGADF
                     GLLVEPQAEYLVRLLAQYPDVLRTSLKNHEPSTLVTYLFKLTHQVSSCYDVLWVAGQE
                     KPLATARLALYASARQVLYNGMLLLGLTPVERM"
     gene            complement(<341523..>343303)
                     /locus_tag="PAS_chr3_1157"
                     /db_xref="GeneID:8199441"
     mRNA            complement(join(<341523..343162,343255..>343303))
                     /locus_tag="PAS_chr3_1157"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492327.1"
                     /db_xref="GeneID:8199441"
     CDS             complement(join(341523..343162,343255..343303))
                     /locus_tag="PAS_chr3_1157"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492372.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1157"
                     /db_xref="EnsemblGenomes-Tr:CAY70126"
                     /db_xref="GeneID:8199441"
                     /db_xref="GOA:C4R3Q7"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q7"
                     /translation="MIINHLVLTALSIALANDYESLDLRHIGVLYTAEIQIGSDETEI
                     EVIVDTGSADLWVIDSDAAVCELSYDEIEANSFSSASAKFMDKIAPPSQELLDGLSEF
                     GFALDGEISQYLADKSGRVSKREENQQDFNINRDEPVCEQFGSFDSSSSDTFQSNNSA
                     FGIAYLDGTTANGTWVRDTVRIGDFAISQQSFALVNITDNYMGILGLGPATQQTTNSN
                     PIAANRFTYDGVVDSLRSQGFINSASFSVYLSPDEDNEHDEFSDGEILFGAIDRAKID
                     GPFRLFPYVNPYKPVYPDQYTSYVTVSTIAVSSSDETLIIERRPRLALIDTGATFSYL
                     PTYPLIRLAFSIHGGFEYVSQLGLFVIRTSSLSVARNKVIEFKFGEDVVIQSPVSDHL
                     LDVSGLFTDGQQYSALTVRESLDGLSILGDTFIKSAYLFFDNENSQLGIGQINVTDDE
                     DIEVVGDFTIERDPAYSSTWSSDLPHETPTRALSTASGGGLGTGINTATSRASSRSTS
                     GSTSRTSSTSGSASGTSSGASSATQNDETSTDLGAPAASLSATPCLFAILLLML"
     gene            complement(<344017..>344693)
                     /locus_tag="PAS_chr3_0167"
                     /db_xref="GeneID:8200189"
     mRNA            complement(join(<344017..344594,344651..>344693))
                     /locus_tag="PAS_chr3_0167"
                     /product="3,4-dihydroxy-2-butanone-4-phosphate synthase
                     (DHBP synthase), required for riboflavin biosynthesis"
                     /transcript_id="XM_002492328.1"
                     /db_xref="GeneID:8200189"
     CDS             complement(join(344017..344594,344651..344693))
                     /locus_tag="PAS_chr3_0167"
                     /codon_start=1
                     /product="3,4-dihydroxy-2-butanone-4-phosphate synthase
                     (DHBP synthase), required for riboflavin biosynthesis"
                     /protein_id="XP_002492373.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0167"
                     /db_xref="EnsemblGenomes-Tr:CAY70128"
                     /db_xref="GeneID:8200189"
                     /db_xref="GOA:C4R3Q8"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q8"
                     /translation="MSVFTPIEDALKAYKNGEFLIVMDDEDRENEGDLIVAAELITTQ
                     KMAFLVRYSSGYVCVPLSTKRAAELELPPMIKNRTDRQGTAYTHTVDARDGTTTGISA
                     SDRALTCQVLANPRSKPEELMRPGHICPLIAREGLLKERRGHTEAAVQLCELTGLQPA
                     GVIGELVRDEDGSMMRLDDCVQFGLRHNVKIINLDQIIEYMDSKNS"
     gene            <345343..>345981
                     /locus_tag="PAS_chr3_0168"
                     /db_xref="GeneID:8199442"
     mRNA            <345343..>345981
                     /locus_tag="PAS_chr3_0168"
                     /product="Cytoplasmic and vacuolar membrane protein
                     involved in late endosome to vacuole transport"
                     /transcript_id="XM_002492329.1"
                     /db_xref="GeneID:8199442"
     CDS             345343..345981
                     /locus_tag="PAS_chr3_0168"
                     /codon_start=1
                     /product="Cytoplasmic and vacuolar membrane protein
                     involved in late endosome to vacuole transport"
                     /protein_id="XP_002492374.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0168"
                     /db_xref="EnsemblGenomes-Tr:CAY70130"
                     /db_xref="GeneID:8199442"
                     /db_xref="GOA:C4R3Q9"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C4R3Q9"
                     /translation="MNRLFGGRSNEPKPNLNDAINSIEERVSSIDVKLTKVNTELSTY
                     QQKLSRMRDGPAKNAVKQKAMKLLKQRKQLEAQKDQLESQSWNMSQASMTTDNLKNTM
                     ITVSAMKSANKELKKTYGKIDIDKIESLQDEMLDLIDKSNELQDSLAQSYDVPDDISE
                     SELDAELDALGEEMDFDAELGESNGLPSYLQNNDELPTFVDDEQEKKEEVAA"
     gene            complement(<346003..>346947)
                     /locus_tag="PAS_chr3_0169"
                     /db_xref="GeneID:8199443"
     mRNA            complement(<346003..>346947)
                     /locus_tag="PAS_chr3_0169"
                     /product="O-methyltransferase, catalyzes two different
                     O-methylation steps in ubiquinone (Coenzyme Q) biosynth"
                     /transcript_id="XM_002492330.1"
                     /db_xref="GeneID:8199443"
     CDS             complement(346003..346947)
                     /locus_tag="PAS_chr3_0169"
                     /codon_start=1
                     /product="O-methyltransferase, catalyzes two different
                     O-methylation steps in ubiquinone (Coenzyme Q) biosynth"
                     /protein_id="XP_002492375.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0169"
                     /db_xref="EnsemblGenomes-Tr:CAY70131"
                     /db_xref="GeneID:8199443"
                     /db_xref="GOA:C4R3R0"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R3R0"
                     /translation="MHHLRRQFSHVGRLLQQSKLTATSEIEMSHFNQLASTWWDVNGP
                     QRILHKMNLLRMDFINDTIKSHLKLNKGVTDPEEQIYIPPFNVDNVLPKEIADRINGE
                     QEIRRQQLWQQLKLDALDIGCGGGILSESLARLPVVNRVKGIDLSTEVLEVARQHKKL
                     DPMVREKLTYELKAVEDLDPNTEQYDVVTMFEMLEHVNYPAEVLKAALRHVKPGGWIF
                     ISTINRDLISWFTTIFMGEHILKIVPLGTHTYDKYINEKELEKWVEDGHENSDLGDLR
                     KQFEVAGSKGCVYLPCYGWKFTDNVEVGNYFMALKRRD"
     gene            complement(<347027..>349222)
                     /locus_tag="PAS_chr3_1158"
                     /db_xref="GeneID:8199444"
     mRNA            complement(<347027..>349222)
                     /locus_tag="PAS_chr3_1158"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492331.1"
                     /db_xref="GeneID:8199444"
     CDS             complement(347027..349222)
                     /locus_tag="PAS_chr3_1158"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492376.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1158"
                     /db_xref="EnsemblGenomes-Tr:CAY70133"
                     /db_xref="GeneID:8199444"
                     /db_xref="GOA:C4R3R1"
                     /db_xref="InterPro:IPR008895"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:C4R3R1"
                     /translation="MSSSSESEEELGIIATRERRANAGSRLKQLLQQEELDIGSQDFE
                     QDDDDENVNLLFQEDENDDEFVEENEEEEEGEEDEEEDDEEDKENTPSNKAVSEEPND
                     EMFSSESEISASDSDESEGEREFRREEKLKRKKRAEKAKFIPPVINKSTPKKTKPKTK
                     VTAHSFLNASSRASTRKSAVENKLAIVERLKEEEERRSKLKPVIRKEVVALTQKERLA
                     EAKTTERTNVLSLNKFHEQEQERKEKQKQMMLNRRKKLENVLRFYSASALVYPIDELK
                     DLEKVKKIEAEFMKSHKKRVYKKRKKKTEANKDESTETPKGEVKVEASENTKDGKKDD
                     HAPIKTNELDTKETDNQGENLPIRDDNKQDETTLSTVDNSPDINKAPTEIDIVEDRDV
                     VMKDATDSAEVVESTSSPLLSSKEKIDNENVQSKESSEPTVDIKTEAESSIEPSQKTK
                     KVSFNEESSQLEFSTESPVASLINNNVKETEIKKDVNQTFVKPESETEIETETEPRTQ
                     SNDKQEEEEEEEEEEEKTDSKEEEVQYEGPPQFVARNTIELLEFSKKLTKLEYTKYIL
                     GDQAVLPAQRRTSHLKPLIRIKQLPTMIETLFIPYSSTHEKEFHEILTLPKFGEENKT
                     VHKQLLVKESDTKKIEIITPAPIGIYLPNGSKKICPISGKPASYFDPKNGVPYASVEA
                     YKVLKDVQDEQFAWIQPDKGGEYSRYKGGIGAYLQRWDVRHAKNVPDWF"
     gene            complement(<349336..>349838)
                     /locus_tag="PAS_chr3_0170"
                     /db_xref="GeneID:8200190"
     mRNA            complement(join(<349336..349759,349813..>349838))
                     /locus_tag="PAS_chr3_0170"
                     /product="Co-chaperone that binds to Hsp82p and activates
                     its ATPase activity"
                     /transcript_id="XM_002492332.1"
                     /db_xref="GeneID:8200190"
     CDS             complement(join(349336..349759,349813..349838))
                     /locus_tag="PAS_chr3_0170"
                     /codon_start=1
                     /product="Co-chaperone that binds to Hsp82p and activates
                     its ATPase activity"
                     /protein_id="XP_002492377.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0170"
                     /db_xref="EnsemblGenomes-Tr:CAY70135"
                     /db_xref="GeneID:8200190"
                     /db_xref="GOA:C4R3R2"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="UniProtKB/TrEMBL:C4R3R2"
                     /translation="MVVHNPNNWHWVDKNCLPWAKSYFQEVLPNTTQKNDAYEIVVTS
                     VDLVDGDCDVTQRKGVTKCIFDLKIQVSATVKVNTNSEVEEISYTVTLPELVHDQDED
                     EYEYVIEGNLDHKSQIRKLLTPLLTEKLSKFQQALIDAHTQDVQHST"
     gene            <350370..>350960
                     /locus_tag="PAS_chr3_0171"
                     /db_xref="GeneID:8199445"
     mRNA            <350370..>350960
                     /locus_tag="PAS_chr3_0171"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492333.1"
                     /db_xref="GeneID:8199445"
     CDS             350370..350960
                     /locus_tag="PAS_chr3_0171"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492378.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0171"
                     /db_xref="EnsemblGenomes-Tr:CAY70136"
                     /db_xref="GeneID:8199445"
                     /db_xref="GOA:C4R3R3"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:C4R3R3"
                     /translation="MEKQDHQLPITKGSYTNYPKSKNTSIYYAIFLEILILYGIVTNY
                     QQLYEHSEYLAGVCLGSFSTLFSQSISQLYRQSFSFDKHFKFFLWGCINSLISNFWIG
                     ILLHSLDNNIHRFLLDQTVGVLTGQLIFVFFNAFWESSLNYASLKSTYLTCLRYSYMI
                     WPLVSFLSFFHLHEDYIFPLNCFVTLIWNIILAMIS"
     gene            <351277..>352755
                     /locus_tag="PAS_chr3_0172"
                     /db_xref="GeneID:8199446"
     mRNA            <351277..>352755
                     /locus_tag="PAS_chr3_0172"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492334.1"
                     /db_xref="GeneID:8199446"
     CDS             351277..352755
                     /locus_tag="PAS_chr3_0172"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492379.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0172"
                     /db_xref="EnsemblGenomes-Tr:CAY70138"
                     /db_xref="GeneID:8199446"
                     /db_xref="GOA:C4R3R4"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="InterPro:IPR024002"
                     /db_xref="UniProtKB/TrEMBL:C4R3R4"
                     /translation="MADDNYFSTPHEAALALVATAMKKARLRPEMLVISSIIAGMLFT
                     VGGMLHLLTQAHLQGFMSEYMGIINLLQGSVYPIGLFYVVVLGTELFNSNVLFFTVAL
                     IRGSVSIVDLIVNWVVSFVFNFASTLFVCEVICHLSGITSTETMRLGSIQIIEEKASC
                     GFVKTLLRGIPGNFFVCLAIYLQLMVKPLHVKFLMIFLPIFTFVTMGFTHVVADFYLC
                     LTGIINGSSVSIGEYIWKIMIPATIGNIIGGVFFAIAIPWYLHLYVVEQDRERLDLPD
                     YVEKDEQPYLSMDSRVVRVPETRDSIGSTGLTRFKTTNSVRSTPKGVFPVVDMDCEGD
                     DDIDQVLDADQFKPSYNLKRMMTKRKNSNTDVESKAGSFKLDKFASRGTVSERELGLF
                     RRFAPSRKNSHKSASSEFEILQQKVSQAGITPAAAGASDEIAGTDSNAIKMMARSHRM
                     NSNYSQQSRMSSSYHIDQLKEDEEPMSSNETDSTESNIRTRI"
     gene            <353048..>356629
                     /locus_tag="PAS_chr3_0173"
                     /db_xref="GeneID:8199447"
     mRNA            <353048..>356629
                     /locus_tag="PAS_chr3_0173"
                     /product="Protein required for establishment and
                     maintenance of sister chromatid condensation and cohesion"
                     /transcript_id="XM_002492335.1"
                     /db_xref="GeneID:8199447"
     CDS             353048..356629
                     /locus_tag="PAS_chr3_0173"
                     /codon_start=1
                     /product="Protein required for establishment and
                     maintenance of sister chromatid condensation and cohesion"
                     /protein_id="XP_002492380.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0173"
                     /db_xref="EnsemblGenomes-Tr:CAY70140"
                     /db_xref="GeneID:8199447"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R3R5"
                     /translation="MAKKVVFELESPIISSISEPITTKELVDRLRNVCDQLSALDQDL
                     VDLDSLAEIKKDLVNQKLIKHNNQGVQAYVSCCLAEILRLYAPDAPYTATQLTNIFRL
                     FISQFKKLLDEESPYYLNLYNLLKRVVEVKSIALMTDLPAAEKLTDELFKGIYDICKH
                     SAFPEKVDTLISDLLSEVISESDSISLPVLKLILNKFMANKTVSDSQHKNIRVPGFSI
                     TLNICKTNTDRLSRQVTQYFSEVIYEVTANENGTNQVSLDPDTLDQLRKLHGLCIEIW
                     KYVPDLLLSVMGVLDNELDADSEQIRELATLTIGKIASVQPSDVNFVKVHQDSWNNWR
                     KKILDISSRVRASWVSATFNIIENRTDINDDIVTGITKALLDTDLHVRLNTVKVFNKL
                     QPETFVSKLLSRSIMDVLIHLLREKNYEIRKESISFVSNLYNRTFIDLYAADKKLDDT
                     IGTIPSAILNLVYINSTEINQHLDLALFEKILPFDNIDENRARRCLTVLKHLDTKARS
                     AFVAILKRQRQLSDVLTQFVGLCEAYNGGNPADKENKETLIKKIDKVSNWISLSIPPD
                     IRPISCLNRFVAENSKRYYKLIKIAISTESNYDTVRNALKELFNHLSSPSKEKTSMDS
                     AQVTPEQMVSTFKLLLYRTAVIISNQSNMHSLFEIANQNGELANTAQELIETISETSP
                     AVFKSQIHQFTNILRSICSAKSYHKATEERSLVKTLKTIYHYAKQYPQEMNMDESLTI
                     ALQFICEKGTPTESRFAVKILGLQGEKSILKRILATIYPLDDTSEHLASHLCVISEMF
                     LLDDSLLESVESDLTSTLIKDYLLKNKIKQKEDHSEFVSDDELETKEFTSCAIKIYSL
                     KVIVNRLRASHDAENSKELAEPVLKLLFFIIGNSGEIVNEKDSSYPSPQHFKTRLRLM
                     AGLSFLKLAKYPTYSKMMKPSLVYRLIFLVQDENETIREAFLNELQKYLAENHISDKF
                     LPLVFFTAYEPLDGLKAKTLTWMRSTYKRFSSDKSKPLIFEKSLVRLIHMIAHFPEFV
                     DSLKILPKEPEKASLVPTLISASEYIIEFLEVVATEKNISLLYYLATQVKKYQDGLFS
                     AADYDLDENPVIYNLYRVSELAQVCIKLLSLSKSWNVQTWPGKVQLPGDIFSSMKSIK
                     EAQDIVSISFLPDQVVVEVENAVRARIARTNSRKDGLRRNKRIKTAA"
     gene            complement(<356732..>358691)
                     /locus_tag="PAS_chr3_0174"
                     /db_xref="GeneID:8199448"
     mRNA            complement(join(<356732..358395,358607..>358691))
                     /locus_tag="PAS_chr3_0174"
                     /product="Essential subunit of the histone deacetylase
                     Rpd3S complex"
                     /transcript_id="XM_002492336.1"
                     /db_xref="GeneID:8199448"
     CDS             complement(join(356732..358395,358607..358691))
                     /locus_tag="PAS_chr3_0174"
                     /codon_start=1
                     /product="Essential subunit of the histone deacetylase
                     Rpd3S complex"
                     /protein_id="XP_002492381.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0174"
                     /db_xref="EnsemblGenomes-Tr:CAY70142"
                     /db_xref="GeneID:8199448"
                     /db_xref="GOA:C4R3R6"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C4R3R6"
                     /translation="MSDTIRRKRLRNQKPANGSTAATTEMSHGRPAGPGSLKLFATTQ
                     QEESQQLATEADYKLKLVTNESESLTKPSLERTRNLRPTPKSGAPNYQIKLKLTGPRS
                     PKSTNRTIQPPRTPSKKSAASPRDGRHVQKIKKSPRKQRAKAFPPAQFGAILPSASAS
                     PSSSSSLSALNSTNPLSGNTDSEPNLNSISVAAPNGSSTSPEPDNDDFCSGCGGPGTF
                     ICCEGCPRSFHFICCDPPLHEEDLSDDAWFCTECKAQRHPPPKHRGGFFAALLDQAVV
                     RNPRSFLLPKKIRETFVDVATTRLGSYSDGSSKVDQFSRASDKGNNASSQASQDVKFC
                     YRCKESDLRKPIIACEYCPLVWHLDCLDPPLAAPKLLGVRWKCPNHTDDLYNHRRRLK
                     NQPQIEVAMVRGFKNNGDVEIINDQNENDQDFVQLPTPPYFDNISTTEGIASLQKPAF
                     KIVQIDNITYRIPENGVILDFIETAKIKKLNEIEQLKKENESILTRVDKSKREVLGGL
                     IALKQSPIEQKLSNSANLSNEVDFRQLVEIAEAQLGCDQHITVPPLETETRDLVYIKQ
                     LIQLKGRDAMIKFLES"
     gene            complement(<358902..>360005)
                     /locus_tag="PAS_chr3_0175"
                     /db_xref="GeneID:8199449"
     mRNA            complement(<358902..>360005)
                     /locus_tag="PAS_chr3_0175"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492337.1"
                     /db_xref="GeneID:8199449"
     CDS             complement(358902..360005)
                     /locus_tag="PAS_chr3_0175"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492382.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0175"
                     /db_xref="EnsemblGenomes-Tr:CAY70144"
                     /db_xref="GeneID:8199449"
                     /db_xref="GOA:C4R3R7"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C4R3R7"
                     /translation="MSKTKVDYSFNNPDVVTQYSTAGSIAAQVLKEVKAKCVEGAKTF
                     DICVFGDNRLKEELEKVYEEEKQGKKTTSKGIAFPTSITPNNLVAYLSPTAPEDEANL
                     ELKKGDLIKVSLGAEIGGFPSIISETLVIGEDEVTGRKADVIAAAYYALQSAIRTIRP
                     GKRNMEVTKVVDDVAKAFDCVPVESMLSHNQERNILTGEKEIIINPTPEHRKQIGTFE
                     FNEGEVYGLDILISSSKTGKVKKSSYLTSIFKYTGTSYRLKLKTSQSSLNQVKKLSPY
                     FPVSLRSFADSKRGRMGLHECVSHQVVVPYDVVQEKEDELVAQFYATIGVGKDATVQL
                     TPFSFDISTIKSEHSVSDESLLNLLAQPLVEQE"
     gene            <360326..>361612
                     /locus_tag="PAS_chr3_0176"
                     /db_xref="GeneID:8199450"
     mRNA            <360326..>361612
                     /locus_tag="PAS_chr3_0176"
                     /product="Mitochondrial ornithine acetyltransferase"
                     /transcript_id="XM_002492338.1"
                     /db_xref="GeneID:8199450"
     CDS             360326..361612
                     /locus_tag="PAS_chr3_0176"
                     /codon_start=1
                     /product="Mitochondrial ornithine acetyltransferase"
                     /protein_id="XP_002492383.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0176"
                     /db_xref="EnsemblGenomes-Tr:CAY70146"
                     /db_xref="GeneID:8199450"
                     /db_xref="GOA:C4R3R8"
                     /db_xref="InterPro:IPR002813"
                     /db_xref="InterPro:IPR016117"
                     /translation="MNNLKLARFFATISKESKYVPNSGSYPLGYKVGAIHCGVKKNST
                     LDLAVLVSETPASAAAVFTTNKFKAAPVQVSRQILNDKNGKGISSIVVNSGNANAVTG
                     KGGIEDALKMVDTVDSTLKNAPSSTLVMSTGVIGQRLPIDNILKGIPVALKDVGSSHE
                     DWLRCAQGIMTTDTFPKLVSKSFEIDGRKYSLAGLAKGAGMICPNMATLLGFFVTDAP
                     VTPGALSKILTYATDRSFNCISVDGDMSTNDTICAMANGAAGGEEISETSSQFSKIQD
                     EITLFAQQLAQLVVRDGEGATKFITINVQDAQSYADAKKVASSIANSALFKTAMYGKD
                     ANWGRILCAVGYADADVNVLKTNVSFIPADGSAELKLLVNGEPEKVDEERASEILELE
                     DLEIRISLGTGGGQEANFWTCDLSHEYVTINGDYRS"
     gene            <361763..>363502
                     /locus_tag="PAS_chr3_1159"
                     /db_xref="GeneID:8199451"
     mRNA            <361763..>363502
                     /locus_tag="PAS_chr3_1159"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492339.1"
                     /db_xref="GeneID:8199451"
     CDS             361763..363502
                     /locus_tag="PAS_chr3_1159"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492384.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1159"
                     /db_xref="EnsemblGenomes-Tr:CAY70148"
                     /db_xref="GeneID:8199451"
                     /db_xref="GOA:C4R3R9"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:C4R3R9"
                     /translation="MSNAAPNMQILQQLATLPPQQQQQILRQNPQLAMFLRQVQQRQQ
                     QFINKQGQAPPGMGVGAGIQAAQGMQGQGGPMMPEQIPVGAAGHPGSLAHGVPGVSPA
                     ISTPPVGSSFRPKLPGGSAPLQPELPRLSSLRYWSEKLEKEGKPVDTNTLLYEQIITR
                     DKANIEARAQNEQEKKVLESLIKDLKFYNELKSYRMKSIQAVNNGMVEGPPSIWGEGY
                     QGYGHGFTGKTTTQFVYPQKRKKYSRIPESYIPDELMEQQAESIDEWVPIRMDFDIER
                     DNFKLNDTFLWNLNEKVVTLERFVAVLMEDYKFKNPLFLDTILANMKEQINEYRTATN
                     TRPQDLRVDIKLDIAMGNNQLIDQFEWDISDPNNDPEEFATVLCAELAVPGEFVTAVA
                     HSIREQVQIFIKALHLINYPFDGSVIEQEQVRRLVKPHILPNESILRSRTQFQDYSPN
                     LLEISIEELQRLDKDKERESRRKRRGMGRVGRRNGLVLPELSDAPKTIRTPIASTVLP
                     YGIEVGPSVDSFVDIVESIEDPKDPKVVERVREPSAINSSTGTPNIGGNNGVVSVQHD
                     YGNSLYVTIKLRR"
     gene            <363792..>364988
                     /locus_tag="PAS_chr3_1160"
                     /db_xref="GeneID:8200191"
     mRNA            <363792..>364988
                     /locus_tag="PAS_chr3_1160"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492340.1"
                     /db_xref="GeneID:8200191"
     CDS             363792..364988
                     /locus_tag="PAS_chr3_1160"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492385.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1160"
                     /db_xref="EnsemblGenomes-Tr:CAY70149"
                     /db_xref="GeneID:8200191"
                     /db_xref="InterPro:IPR019325"
                     /db_xref="UniProtKB/TrEMBL:C4R3S0"
                     /translation="MQTGTASFTNMSNEPQKVSKNQPTSHWSVSACHIYSSESIHDRL
                     DPSFETFPSSINSNSVAKDPLVSQSVHLLSSFEGDNSIKDSVHEHELDQMEPEGDSRE
                     IETAQDSGDALTNASFFMNMDNGVQQGTSSDAVDNGDIANEAQGSKGKTIFKQFRDKL
                     KSLPIFNQGRHFRYTRVEGEHPNVRGAENDGVFANITATSESGDPLGRGEEELPSYDE
                     AAADSAPTYWESTVVTPGYEDEVFVEGLPVGNLLNFFWNLMVSVIFQYLGFVLTYLLH
                     TSHAAKEGSCAGLGITIITLGFDLLPFSIFHRNNGQASRFEPAAPNDYDVDTSETLDG
                     YTDGFTSALDSGAKVEQEPTRSPIAAYALIALGMFLFLRAIAGYFRAKRMERLILNPV
                     TNPSPV"
     gene            complement(<365003..>365884)
                     /locus_tag="PAS_chr3_0177"
                     /db_xref="GeneID:8200192"
     mRNA            complement(<365003..>365884)
                     /locus_tag="PAS_chr3_0177"
                     /product="Mitochondrial inner membrane citrate
                     transporter"
                     /transcript_id="XM_002492341.1"
                     /db_xref="GeneID:8200192"
     CDS             complement(365003..365884)
                     /locus_tag="PAS_chr3_0177"
                     /codon_start=1
                     /product="Mitochondrial inner membrane citrate
                     transporter"
                     /protein_id="XP_002492386.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0177"
                     /db_xref="EnsemblGenomes-Tr:CAY70151"
                     /db_xref="GeneID:8200192"
                     /db_xref="GOA:C4R3S1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R3S1"
                     /translation="MPEKRKVDPFHSFIAGGTAGAVEGVVTYPFEFAKTRLQLVDKSA
                     NMSRNPLKLIATIARTQGVGALYTGCPAFVVGNTAKASVRFLGFDAIKKMLADKDGKL
                     SGPRGVLAGLGAGLLESVVAVTPAEAIKTAMIDDKQSAKPKYQGGIISGTVKLVKDLG
                     FKGIYAGVLPVSLRQAANSAVRLGSYNAIKTFLQQASSTDPGAPLSSSLTFAVGSFAG
                     VVTVYATMPIDTVKTRMQALGADKMYSSTLNCFVKIFKEEGLLTFWKGATPRLGRLVL
                     SGGIVFTIYEKVLLLLN"
     gene            complement(<366120..>367298)
                     /locus_tag="PAS_chr3_0178"
                     /db_xref="GeneID:8199452"
     mRNA            complement(<366120..>367298)
                     /locus_tag="PAS_chr3_0178"
                     /product="TFIIE large subunit"
                     /transcript_id="XM_002492342.1"
                     /db_xref="GeneID:8199452"
     CDS             complement(366120..367298)
                     /locus_tag="PAS_chr3_0178"
                     /codon_start=1
                     /product="TFIIE large subunit"
                     /protein_id="XP_002492387.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0178"
                     /db_xref="EnsemblGenomes-Tr:CAY70153"
                     /db_xref="GeneID:8199452"
                     /db_xref="GOA:C4R3S2"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017919"
                     /db_xref="InterPro:IPR024550"
                     /db_xref="UniProtKB/TrEMBL:C4R3S2"
                     /translation="MDYELATSLIRFVVRGFYTKHYVLVVEALLMHWVLSEDDLIYLL
                     GMQRKGLRALCNRLVEDRLISAQHQKEENLHQRMTTRTYYYIRFVDAIDAIKWKMHSV
                     VKSLKDQMAHDSDPQGYVCPRCRKRYSQLDALSMVSDNKLNFVCDICNGVLIEDDSGI
                     QAKRRQEKLTQLMGELDPIIGYLKRIDEGHVVDNTFETSLTRAVPAQSSTVSAAESGS
                     YALRAGQESKRELSQSLKNATARSQAVLHVDITTSDENQTREEKVKAEKQEKLKQNAL
                     PSWHSESTVGKGTLGKLGTQDIASEILEKEVSADDHVVEGKDQVQEIPKVETTGTNLE
                     DIEAQDALAAYYAQLAEKQAKEDADDDAEDGDEDEDFDIDDDEFEDILETGNNDEQDQ
                     "
     gene            <367451..>368983
                     /locus_tag="PAS_chr3_0179"
                     /db_xref="GeneID:8199453"
     mRNA            <367451..>368983
                     /locus_tag="PAS_chr3_0179"
                     /product="Glucosidase II beta subunit"
                     /transcript_id="XM_002492343.1"
                     /db_xref="GeneID:8199453"
     CDS             367451..368983
                     /locus_tag="PAS_chr3_0179"
                     /codon_start=1
                     /product="Glucosidase II beta subunit"
                     /protein_id="XP_002492388.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0179"
                     /db_xref="EnsemblGenomes-Tr:CAY70155"
                     /db_xref="GeneID:8199453"
                     /db_xref="GOA:C4R3S3"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR026874"
                     /db_xref="InterPro:IPR028146"
                     /db_xref="UniProtKB/TrEMBL:C4R3S3"
                     /translation="MLRLLTIGSIAVSLFPASAEIPPLRGVAPDLLEKYVPDKDGNWK
                     CLGHPEIVLHFDQVNDDYCDCPDGSDEPGTAACENGKFYCANEGFEPNFIPTFLVDDG
                     VCDYKVCCDGSDEKSGKCPNRCLELAEKAELLRLERKARLENGLKAKRDLIVQSQNKL
                     REISQRRAELEKTIQLEQQQLNYLNEQDPNDSALRKEVDPQLEKVVQILKVQKDEILL
                     LKTKADSLERLLKELEKNYNPNFNDAAVKAAVQGFRDYSSNSNDDSYSDLDSVEPENI
                     VKDIQKTINTFAFDTSNDSKYESIWSFWKEVLADKIVKIYQEFTAVPLKTASKPLKPI
                     SGTAQEIQKSIDSHNKEIVKIDSDLENSESRYGLEDIFRAYDGRCFVEKIGDYDYEYC
                     FTGSLTQISSNGQRVSIGTRDKIEVLEDEQSVGGYSYRVYYEKGAKCWNGPVRKAIAV
                     VQCGDVEQLVSVSEPEKCEYHLVVRSPVGCFSEDNVYLVKEIAEGESHAPFKVIPFKD
                     EL"
     gene            <369087..>370631
                     /locus_tag="PAS_chr3_0180"
                     /db_xref="GeneID:8199454"
     mRNA            <369087..>370631
                     /locus_tag="PAS_chr3_0180"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492344.1"
                     /db_xref="GeneID:8199454"
     CDS             369087..370631
                     /locus_tag="PAS_chr3_0180"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492389.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0180"
                     /db_xref="EnsemblGenomes-Tr:CAY70156"
                     /db_xref="GeneID:8199454"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C4R3S4"
                     /translation="MEQLIPFILFAVISQWFDDSHYSAYAAVNYPPEIWTQILNQLNQ
                     KDVIALMLTNRITCSLSATRLYRRVYITAENSQMPSTSYDEWNYTVTTATRFLKMLRT
                     SHGSKLAVETVYVGCKLNSVILFELASHLPHAALVCMDMAYVILPHHSWGSSFWIIGN
                     AITNNIAQLRLEELAVDDSIPFYGLQRGRALHLPSLKKLSVKATHWSKTLPLVTDLFS
                     AMHPFQLESLEVGDPLVFCEVCSSLGTSEQFRLKSLTLDFGSSSDIPPDYDYTRLLEI
                     MKNSIQEVNELRLRFWTFQETDGISEFLRKIAVLLGPNLQSLGIFFLGETPRSIEDQD
                     SIQLVTTKLYPSYLPDIVGFFAAIQHLRLEEITLSVSHQIGLDELTANVSNSRFSILS
                     AALLLSVVRLNVFGNLCGPFFNGWVRRYDIGHGRIFRIAPRHNVLGGALPPIQDDHIQ
                     SLPDLEMAQLVSQRQFICAARGQVSVPFTTANKNAPLLRERYRLLIEDHAGPLPADIH
                     INGLPV"
     gene            <371224..>373119
                     /locus_tag="PAS_chr3_0181"
                     /db_xref="GeneID:8199455"
     mRNA            <371224..>373119
                     /locus_tag="PAS_chr3_0181"
                     /product="Mitochondrial malic enzyme"
                     /transcript_id="XM_002492345.1"
                     /db_xref="GeneID:8199455"
     CDS             371224..373119
                     /locus_tag="PAS_chr3_0181"
                     /codon_start=1
                     /product="Mitochondrial malic enzyme"
                     /protein_id="XP_002492390.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0181"
                     /db_xref="EnsemblGenomes-Tr:CAY70158"
                     /db_xref="GeneID:8199455"
                     /db_xref="GOA:C4R3S5"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R3S5"
                     /translation="MSSLYMPSKSMKRLTVSCRRFISSAQPKIVTHKILTPVGTEAAA
                     KVDVPKTTRLSVEGPIECHLQGFELLNSPLFNKGSAFTPEERAAFGLEGLLPPVANDL
                     NEQAERAYKQLSFLKTPLAKNDFCTSMRQQNKVLFYELVRRHIRELLPIIYTPTEGDA
                     IAAYSHRFRKPEGCFLDVTDPESIEDRLSRFGESKDVDYIVVSDGEGILGIGDQGIGG
                     VRIAISKLALMTLCGGIHPGRVIPVVVDAGTNNKALLDDELYMGSRFPRVRGEEYYSF
                     FDKFIEVVKRRFPSAVLHFEDFGVTNAKPLLDKYRSVLPCFNDDIQGTGAVVMASMAA
                     ALKLTNRDLLDSTIVIYGAGSAGLGIAFQIVNHMVNHGATKEEAYSRIHLLDRHGLIL
                     TNMSDVSNKDQMLFADDPSSWDGINTKSLVDVIEKLKPTTLIGCSTQAGAFTEEVIKT
                     MYKYNPRPIVFPLSNPTRLHEAVPVDVMRWTDDNALIATGSPFKPVRGHVISENNNCF
                     SFPGIGLGAVLSRATTISDTMISAAVDELASGSPAFKDPKAGLLAPVEVINETSAKVA
                     AALILQSIKEGTARVEEELSPNGDKVSVPRDFEGCVAWVKSQMWRPEYRPMVKVERVP
                     EIHTHQS"
     gene            complement(<373171..>374793)
                     /locus_tag="PAS_chr3_0182"
                     /db_xref="GeneID:8199456"
     mRNA            complement(<373171..>374793)
                     /locus_tag="PAS_chr3_0182"
                     /product="Dicarboxylic amino acid permease"
                     /transcript_id="XM_002492346.1"
                     /db_xref="GeneID:8199456"
     CDS             complement(373171..374793)
                     /locus_tag="PAS_chr3_0182"
                     /codon_start=1
                     /product="Dicarboxylic amino acid permease"
                     /protein_id="XP_002492391.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0182"
                     /db_xref="EnsemblGenomes-Tr:CAY70160"
                     /db_xref="GeneID:8199456"
                     /db_xref="GOA:C4R3S6"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C4R3S6"
                     /translation="MSELKSELDTSTDLKKTLNARNVSIIAMGGGIGVGLMVGTAKAL
                     YDAGPGAVLISFLAVGMIAFGVIAAIGEMATFIPCDFAGYAHRYCHPALGFATGWTYM
                     LLYLFSMPNQIVSTSLVMEFWVSTDQVNSGVWIFVFMVVVWVANLLPVKYFGNFECVL
                     SSVKIITIVGLWIVMMVIMSGGAPNRQPSGFRYWHDPGAFRDYHQATVIEGPKGKALS
                     FMSVMVNAVFSYVGIEFVCVAIVEAENPRRALPKAIKLTFWRIILIYCFTVFLLGCCV
                     PSNDPLMEQAIKSTTSAASSPFVVAMKIAKINGLPHLINGCILLFAVSSATSDFYVAV
                     RTLHGLAVKRQAPRIFAQTTKHGVPIYGVLVGCGFSLLAFMTLTSSARTVFNYFVNVV
                     SVFGLLVWISLLVAHISFMKAIKKQNFDRNSFLPWRAPFQPLYSYVCILFCIVIVLMN
                     NFGVFLGDKFDYKNFITGYIGIPIYLALLGGYKLMNKSKRVSSSECDLFTGKATIDED
                     EKRLKNKELEQRKGREGTVMLWLEDHLINHFV"
     gene            <375658..>377061
                     /locus_tag="PAS_chr3_0183"
                     /db_xref="GeneID:8199457"
     mRNA            <375658..>377061
                     /locus_tag="PAS_chr3_0183"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492347.1"
                     /db_xref="GeneID:8199457"
     CDS             375658..377061
                     /locus_tag="PAS_chr3_0183"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492392.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0183"
                     /db_xref="EnsemblGenomes-Tr:CAY70161"
                     /db_xref="GeneID:8199457"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C4R3S7"
                     /translation="MKKLQLMGLKKKFSKKVPKEPVVYPEIHLVSLPDEILTLIFKNL
                     DKKTLCALSQINKRLQAVSQKTLYRAIRVSSTLKLLQLCRTLDRNSVEQKPWLYAIDS
                     LQLDIDIGNSANEFISVSIGKLGYSSSIKSTNYKDLLNTFNLYKNLMTHLLSLNSISL
                     TQVSPRLNFPIECSLYYKVNDRIECPKNYTYDDLRRDSIKTVRLESQDGISIPLRSHL
                     LWSFGLIKELILRNMNIDEESLVDTRYLVDASSGNWIIDPINQITQPITGFPTIDTIP
                     KHKKSYHSPIEKLTLNATTVSSSALHFLRNYFHNVTELCLLNIKNLHDLASITYFPNI
                     KALTIDLDSKIFWNFLNDFPVQFDSFFSVLCSLHKIQTITFVNVKFFNLSLIPREPVN
                     ELDYNSYKVSIYRLFTHLGRIENVSFILTTPKRITANTRYPLFMNRDWLSILWPFVDT
                     GCKVSIKYDEGSYEFQG"
     gene            complement(<377187..>378769)
                     /locus_tag="PAS_chr3_0184"
                     /db_xref="GeneID:8199857"
     mRNA            complement(join(<377187..377362,377467..>378769))
                     /locus_tag="PAS_chr3_0184"
                     /product="1,3-beta-glucanosyltransferase"
                     /transcript_id="XM_002492348.1"
                     /db_xref="GeneID:8199857"
     CDS             complement(join(377187..377362,377467..378769))
                     /locus_tag="PAS_chr3_0184"
                     /codon_start=1
                     /product="1,3-beta-glucanosyltransferase"
                     /protein_id="XP_002492393.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0184"
                     /db_xref="EnsemblGenomes-Tr:CAY70162"
                     /db_xref="GeneID:8199857"
                     /db_xref="GOA:C4R3S8"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C4R3S8"
                     /translation="MLYLVTVLLFLVHVVLGYIHPITIKGKHFYDSLTGELFMVKGVD
                     YQPGGASGVSTDKDPLSEIEECARDILLFQELGINTIRVYSVNPDLNHDKCMSLLASA
                     GIYLILDVNSPLPNQSINRYEPWSSYNHDYLYHIFKVVEQFSHYNNTLAFFAGNEVVN
                     DKVSATHSSNYMKAVVRDLKTYITHHSDRPIPVGYSAADDLSFRIPLAKYLECSNSTA
                     ELDSVDFYGVNSYQWCGYQNMQTSGYDQLVAHYADYTKPIMFSEYGCNEVTPRIFQEV
                     EAIYSSKMSSVFNGGLAYEFAQEPNNYGMVEYLSDGRVKLLKDFETFKNQLAKASETY
                     HIKQMNENVRSAPLKCQGTYENLGDKLVVPQSLGMAFITQGVKGEKGSYVELSDDDFV
                     VKKEIFLSDGTKFQKSKIVATHNLNGPDTQQTVPEKSQGSKNGQITNPNPKPKPQTRK
                     IPNKKTKPKQNKQEKSKVQKQIAREKKIRAIRQRQQEWNFKV"
     gene            complement(<379205..>380080)
                     /locus_tag="PAS_chr3_0185"
                     /db_xref="GeneID:8199936"
     mRNA            complement(<379205..>380080)
                     /locus_tag="PAS_chr3_0185"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492349.1"
                     /db_xref="GeneID:8199936"
     CDS             complement(379205..380080)
                     /locus_tag="PAS_chr3_0185"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492394.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0185"
                     /db_xref="EnsemblGenomes-Tr:CAY70164"
                     /db_xref="GeneID:8199936"
                     /db_xref="GOA:C4R3S9"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R3S9"
                     /translation="MSNMTFTLVVLLLSFYHPVGPCLQLLTTSIPPSFLTMVPEHYIG
                     SKSVDEVPTSEDPRVNACPYICDIGDCSRGYSRASHLKRHKETFHLKTRVFHCPIEGC
                     GRSFNRKDVRDRHYRRHAADISDNSLGSGPHTISIVGIERTDENTNPIEAQSIESLEL
                     MSSTPLTPKSITYSTQKQYHVVQTPKFILGNLICTGRIFGINGRKGSIPQTTTDQTHH
                     AIRNVCDVLREAKASLDEVIRVSVFLVCLEECTAVQSICSQYFPDGAVYDFIHIKFSP
                     GECFRVQLQVVGRGE"
     gene            <380477..>381742
                     /locus_tag="PAS_chr3_0186"
                     /db_xref="GeneID:8199937"
     mRNA            <380477..>381742
                     /locus_tag="PAS_chr3_0186"
                     /product="D-serine dehydratase (aka D-serine
                     ammonia-lyase)"
                     /transcript_id="XM_002492350.1"
                     /db_xref="GeneID:8199937"
     CDS             380477..381742
                     /locus_tag="PAS_chr3_0186"
                     /codon_start=1
                     /product="D-serine dehydratase (aka D-serine
                     ammonia-lyase)"
                     /protein_id="XP_002492395.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0186"
                     /db_xref="EnsemblGenomes-Tr:CAY70166"
                     /db_xref="GeneID:8199937"
                     /db_xref="GOA:C4R3T0"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR026956"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:C4R3T0"
                     /translation="MTTPPSSLTQSRNKYALSKQYLGKKVADLPTPSYLVERSRFRGN
                     CEKMLWSARRLNAPFRAHIKTHKTLEGTSLQLGINTDSEYKTDRIVISTLPEGWGILP
                     LVKQGLINDVHYSLPVVKSRLAELELYSFEVPHLRLMVDDIGQLEMLVRYSKEESKLA
                     TKWSVFIKIDMGTKRAGLTHDSQELKELLDQLLNSEAKDYVSLYGFYCHAGHSYGSAD
                     KAEATNFLLQEIENANNAARVAKQIDGTLQLVLSVGATPTAHASAEWEAPDLGQLEGV
                     LELHAGNYPCCDLQQVATNCVSLDDVSAHVLAEVVSHYPNRNNRNPGEQLINAGVIAL
                     AREFSSIPGHGIVVDPSTYGDWIVGKLSQEHGILFPFKEDSNCEFIPLGTKIKVVPQH
                     NCIAAAAFPWYFVIEEDTVVDIWVPFHGW"
     gene            complement(<381786..>382148)
                     /locus_tag="PAS_chr3_0187"
                     /db_xref="GeneID:8199938"
     mRNA            complement(join(<381786..382044,382090..>382148))
                     /locus_tag="PAS_chr3_0187"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492351.1"
                     /db_xref="GeneID:8199938"
     CDS             complement(join(381786..382044,382090..382148))
                     /locus_tag="PAS_chr3_0187"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492396.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0187"
                     /db_xref="EnsemblGenomes-Tr:CAY70167"
                     /db_xref="GeneID:8199938"
                     /db_xref="GOA:C4R3T1"
                     /db_xref="InterPro:IPR005349"
                     /db_xref="UniProtKB/TrEMBL:C4R3T1"
                     /translation="MEHPAFSLSGLSLVGGVMGYARKGSLPSLIAGVTFSAIYAGAGY
                     LLKNNMEYGVQTALGASTLMFIAGINRGIVSRYKKPVPIVLTILGAASTLYYAKKYEE
                     FYL"
     gene            complement(<382287..>383969)
                     /locus_tag="PAS_chr3_0188"
                     /db_xref="GeneID:8199939"
     mRNA            complement(<382287..>383969)
                     /locus_tag="PAS_chr3_0188"
                     /product="Major of three pyruvate decarboxylase isozymes"
                     /transcript_id="XM_002492352.1"
                     /db_xref="GeneID:8199939"
     CDS             complement(382287..383969)
                     /locus_tag="PAS_chr3_0188"
                     /codon_start=1
                     /product="Major of three pyruvate decarboxylase isozymes"
                     /protein_id="XP_002492397.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0188"
                     /db_xref="EnsemblGenomes-Tr:CAY70169"
                     /db_xref="GeneID:8199939"
                     /db_xref="GOA:C4R3T2"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C4R3T2"
                     /translation="MAEITLGTYIFERLKQIDVKTIFGVPGDFNLALLDHIYEVEGMR
                     WAGNANELNAAYAADGYSRVKSMAALITTFGVGELSAVNGIAGSFAEHVGLLHIVGVP
                     AISSQEKKLLLHHTLGNGDFGVFKRVFKNVSKSANFISDINEAQDMIDGAIREAFIYQ
                     RPIYLGLPTNLVEMKVDRTRLNTPIDLKPVPNPVEAEEEALQSILELISKASKPVILV
                     DACASRHFCQKEVDQLIDVTNFPVFVTPMGKGGVDEQKPQFGGAYVGSLSNPDITEFV
                     EKADLVISVGALLSDFNTGSFSYSHSKNIVEFHSDYTQIRSAVFQGVQMKALLQKLLP
                     LVGKASKHITAQVPPKIAPPIEKGASEDLTQDWLWSNISKFLRAGDVVITETGTSAFG
                     IVQSRFPTHVSGISQVLWGSIGFSVGATLGAVCATEELDPNRRVILFVGDGSLQLTVQ
                     EISTMARWNLKPYLFILNNDGYTIERLIHGEKASYNDIQPWDHLKLLDTFKAKNSEST
                     RVSTVGELTKLFKDQGFNKPDKIRVIEIMLETMDAPISLVKQAEITAKTNAA"
     gene            complement(<384516..>386051)
                     /locus_tag="PAS_chr3_0189"
                     /db_xref="GeneID:8199940"
     mRNA            complement(<384516..>386051)
                     /locus_tag="PAS_chr3_0189"
                     /product="Peripheral peroxisomal membrane peroxin"
                     /transcript_id="XM_002492353.1"
                     /db_xref="GeneID:8199940"
     CDS             complement(384516..386051)
                     /locus_tag="PAS_chr3_0189"
                     /codon_start=1
                     /product="Peripheral peroxisomal membrane peroxin"
                     /protein_id="XP_002492398.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0189"
                     /db_xref="EnsemblGenomes-Tr:CAY70171"
                     /db_xref="GeneID:8199940"
                     /db_xref="UniProtKB/TrEMBL:C4R3T3"
                     /translation="MAYNNSTNGERLLNTSDALLNEDIGALGVFASHINSSRLVTPKR
                     NSRLDSLDSVSKPSTVDEITPPTSDKEGEIQENNQAWKTQNAPSLLSPDHMQHPAMTK
                     HLQNGNGFSHINNNTNTLKPFNLPPISPSPLPMNGGSLRNINGVLNDSSAVTDKQPTA
                     TTTSPRVSAFTLLAAILEQLGGKDRLGKVIQYGLRILLIYSKRSSTFLSTVYEVSDAS
                     LNKSGGRFSLLVSLLRRPELLLYWFLKQFEKKATGLSSGLSMYRQMLRAGKTPFRLVN
                     LGYKINDTFQVFKKKGVDDGIVYFRKNWVNEKTVTELAQLYYSWFDESLLCFKLKMID
                     DPKYRGIATRQERLAWLSTILLTLKKNIFKYQANKRKEQHIRINQQVKYRAKALLSNI
                     SDQHQQNRSSPRSISNYSPRIQAYPSRMASPSPSMKMALTNSVSLQDTMDAELEALAN
                     EQYYVMLDILKGFCDLSFDMVNIFSIQIPEVLHLLFGFGAGSLALTGVVSKTRQELIN
                     KQI"
     gene            <387257..>387831
                     /locus_tag="PAS_chr3_0191"
                     /db_xref="GeneID:8199941"
     mRNA            join(<387257..387430,387508..>387831)
                     /locus_tag="PAS_chr3_0191"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492354.1"
                     /db_xref="GeneID:8199941"
     CDS             join(387257..387430,387508..387831)
                     /locus_tag="PAS_chr3_0191"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492399.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0191"
                     /db_xref="EnsemblGenomes-Tr:CAY70173"
                     /db_xref="GeneID:8199941"
                     /db_xref="UniProtKB/TrEMBL:C4R3T4"
                     /translation="MLNPTVKFPIWQMCRLEDSYREMLNVLASFVDPSAVQPYIDLSL
                     RVCLQLRMLIVYLAYTMAIIIMFPIFLMMVVDLVLYATKVLHLRPDRKAPAPFQNEKS
                     QDSPIVTAEPMQLHKGSSLTSLSSLRSSTSIASSLNVPVNVTKYSPAIRASDIHRRIP
                     RRAND"
     gene            <388215..>389252
                     /locus_tag="PAS_chr3_0192"
                     /db_xref="GeneID:8199942"
     mRNA            <388215..>389252
                     /locus_tag="PAS_chr3_0192"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492355.1"
                     /db_xref="GeneID:8199942"
     CDS             388215..389252
                     /locus_tag="PAS_chr3_0192"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492400.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0192"
                     /db_xref="EnsemblGenomes-Tr:CAY70174"
                     /db_xref="GeneID:8199942"
                     /db_xref="UniProtKB/TrEMBL:C4R3T5"
                     /translation="MHRIPLLSRLSDQAVVSNNPALRRSSNSTVDPTHSLSHRRLSQE
                     TLTTLINPLAATGTSPAIVENVTMLNMESRIDSDTESLQATLTEDAFGSVFEVPAISY
                     TYIRKLPIVTSNFFGKSVHVFASKLDVEQFKAQGKNGEVTPILTLHSQRGIQSLKKNS
                     PQCILYSYDGKDRVEHARMYHDILKNNNHKYTMVFRDSSIVVLINSKSGPFTDCEFKS
                     TRLRFLGTTGSYSTFGSRAITAVTVTNNDIELLTDGYSVDELASSNDLKPKLNKVAVK
                     NIKELSKFIPFATLRLEPTSVITKRIQKVGEIQTFDHVDSRIPSSNCMAMLAVLLVLR
                     EQETMKIQRND"
     gene            complement(<389326..>389928)
                     /locus_tag="PAS_chr3_0193"
                     /db_xref="GeneID:8199943"
     mRNA            complement(<389326..>389928)
                     /locus_tag="PAS_chr3_0193"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492356.1"
                     /db_xref="GeneID:8199943"
     CDS             complement(389326..389928)
                     /locus_tag="PAS_chr3_0193"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492401.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0193"
                     /db_xref="EnsemblGenomes-Tr:CAY70176"
                     /db_xref="GeneID:8199943"
                     /db_xref="UniProtKB/TrEMBL:C4R3T6"
                     /translation="MLFFNLLQYTLLLIIPMVQSYPLVIKKRDETINSVVVETSVVTV
                     DGNTYTTKITSTSTITVTAPDRTVYVTLDEDEPTNAPASSVNVQTTSTSPAQTSGAQA
                     STPITTSIAAQTSQVVLSSSRASPTSSQSSSSSTSSPTKTTQVSSTSSSEGTPYFTAT
                     DDGTCYIYYAEDDETATYSDDAPYTTSTVYQVVATVTLTK"
     gene            <390558..>391076
                     /locus_tag="PAS_chr3_0194"
                     /db_xref="GeneID:8199944"
     mRNA            join(<390558..390561,390760..>391076)
                     /locus_tag="PAS_chr3_0194"
                     /product="60S ribosomal protein L42"
                     /transcript_id="XM_002492357.1"
                     /db_xref="GeneID:8199944"
     CDS             join(390558..390561,390760..391076)
                     /locus_tag="PAS_chr3_0194"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="XP_002492402.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0194"
                     /db_xref="EnsemblGenomes-Tr:CAY70178"
                     /db_xref="GeneID:8199944"
                     /db_xref="GOA:C4R3T7"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:C4R3T7"
                     /translation="MVNVPKTRKTFCKGKQCRKHTQHKVTQYKAGAASLFAQGKRRYD
                     RKQSGYGGQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLALKRCKHFELGGDKKQKGQ
                     ALQF"
     gene            <391466..>393436
                     /locus_tag="PAS_chr3_0195"
                     /db_xref="GeneID:8199945"
     mRNA            <391466..>393436
                     /locus_tag="PAS_chr3_0195"
                     /product="Serine/threonine protein kinase"
                     /transcript_id="XM_002492358.1"
                     /db_xref="GeneID:8199945"
     CDS             391466..393436
                     /locus_tag="PAS_chr3_0195"
                     /codon_start=1
                     /product="Serine/threonine protein kinase"
                     /protein_id="XP_002492403.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0195"
                     /db_xref="EnsemblGenomes-Tr:CAY70180"
                     /db_xref="GeneID:8199945"
                     /db_xref="GOA:C4R3T8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R3T8"
                     /translation="MYSNQETDQNYAYQLHQQQLLQQQQQQQQHRPTNQASQQEFASQ
                     QQQYQQQHQQQFNSIPNIPPPPEHYSTYGSSPSNSLYSSSPFTEQQNVMSSSQPPSSP
                     QRSIRSNLVPVPTGNSLKNASKQGGGVFSLANPMSSNSNINQQSSFRNSLVDNLDNNR
                     LSTISQGRPQNMTDYVYFERRPDLLSKSAQDRAAAIKLKLEHFYKMSIDHAIERNQRR
                     VDLEYRLANEEGSTERKNRELHNLGKKESQFLRLRRTRLSLDDFTTVKVIGKGAFGEV
                     RLVQKKDTGTIYAMKTILKSEMFEREQLAHVKAERDVLAVSDSPWVVSLYYSFQDSLY
                     LYLIMEYLPGGDLMSQLINWQIFTEDITRFYMAECVLAIEAIHKLGFIHRDIKPDNIL
                     IDIRGHIKLADFGLSTGFHKTHDSKYYKQLLEKDPLPQPPVSNGGRNSMMVDAIHLTM
                     SKRQQMQTWRRSRRLMAYSTVGTPDYIAPEIFINQGYGQECDWWSLGAIMFECLVGWP
                     PFCSDTPQETYKKILHWQETLYFPDDIHLSPESVDLIRRLLTSADHRLGRYGGADEIK
                     SHPFFRGVNWDTIRQVDAPFVPRLKSITDIRYFPADDLENVPDSPAMANAAKHRDRLA
                     KQGKTEGNSKEDLPFIGYTYSRFDYLTRKNAL"
     gene            complement(<393932..>394147)
                     /locus_tag="PAS_chr3_0196"
                     /db_xref="GeneID:8199946"
     mRNA            complement(<393932..>394147)
                     /locus_tag="PAS_chr3_0196"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492359.1"
                     /db_xref="GeneID:8199946"
     CDS             complement(393932..394147)
                     /locus_tag="PAS_chr3_0196"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492404.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0196"
                     /db_xref="EnsemblGenomes-Tr:CAY70181"
                     /db_xref="GeneID:8199946"
                     /db_xref="UniProtKB/TrEMBL:C4R3T9"
                     /translation="MNSGSESSFKSSEQESKKTVYFETKRQTTLLNLMENQDHLIVKA
                     LNMSADGKPVSLSDARHACLEMFLGRK"
     gene            <394340..>395281
                     /locus_tag="PAS_chr3_0197"
                     /db_xref="GeneID:8199947"
     mRNA            <394340..>395281
                     /locus_tag="PAS_chr3_0197"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492360.1"
                     /db_xref="GeneID:8199947"
     CDS             394340..395281
                     /locus_tag="PAS_chr3_0197"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492405.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0197"
                     /db_xref="EnsemblGenomes-Tr:CAY70182"
                     /db_xref="GeneID:8199947"
                     /db_xref="GOA:C4R3U0"
                     /db_xref="InterPro:IPR014802"
                     /db_xref="InterPro:IPR028143"
                     /translation="MSELTEAEKRQLLREKRKAKLSQGGGLDRLKKITGENNSKLSTD
                     VPTKEPTADATTTATELPTQGLETRINAHDDPVSEIPDPLNEGFDGKEPDLDQLIASM
                     FNKSAGHENPNSEEQGVPELMRRFSSILQGGDSGAAGLGAEAGGINPLDLLNSLGGSN
                     IGKAQEEYGSTPEEIEFNKKSIAYKKHQNEVLKAKILVVRLVLILSLLFVYGRDFSLS
                     LFTQTYAPNGSSFMRVFLTLELIFQTSLFFFISKNKNFTDDSLISKLLNIGGAFIPAT
                     YRNLLQTASKYQVLLSMFLFDLSIVVVVFAIRAAFNF"
     gene            complement(<395294..>396163)
                     /locus_tag="PAS_chr3_0198"
                     /db_xref="GeneID:8199948"
     mRNA            complement(<395294..>396163)
                     /locus_tag="PAS_chr3_0198"
                     /product="Diacylglycerol pyrophosphate (DGPP) phosphatase"
                     /transcript_id="XM_002492361.1"
                     /db_xref="GeneID:8199948"
     CDS             complement(395294..396163)
                     /locus_tag="PAS_chr3_0198"
                     /codon_start=1
                     /product="Diacylglycerol pyrophosphate (DGPP) phosphatase"
                     /protein_id="XP_002492406.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0198"
                     /db_xref="EnsemblGenomes-Tr:CAY70184"
                     /db_xref="GeneID:8199948"
                     /db_xref="GOA:C4R3U1"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C4R3U1"
                     /translation="MIERIRDLIASWNGNKFILKWRICDVISLVIIIVLNFIFHRAKP
                     FQRQFTINDPTLSHPLVEIERVSGTMCWVYAMFIPFGFIGIVCLVVTERQSAAHMAFI
                     SLLGLTSSVFTTSFITGILKGWIGRCRPDFLERCLPSETALEGVWYEAPDVCTTDDLA
                     ALYDGFKTTPSGHSSVSFAGLSYSAFWLAGQLGAGVEGSDTWKSWVSSMPLFGACYIA
                     LSRTQDYRHHFVDVIIGAIIGIVFAYTYYRKYFPGLRSEVSNIPMILEQFKNTDPSTL
                     EEEAPDFELQELP"
     gene            <396296..>397885
                     /locus_tag="PAS_chr3_0199"
                     /db_xref="GeneID:8199949"
     mRNA            <396296..>397885
                     /locus_tag="PAS_chr3_0199"
                     /product="Putative protein of unknown function with
                     similarity to asparagine synthetases"
                     /transcript_id="XM_002492362.1"
                     /db_xref="GeneID:8199949"
     CDS             396296..397885
                     /locus_tag="PAS_chr3_0199"
                     /codon_start=1
                     /product="Putative protein of unknown function with
                     similarity to asparagine synthetases"
                     /protein_id="XP_002492407.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0199"
                     /db_xref="EnsemblGenomes-Tr:CAY70185"
                     /db_xref="GeneID:8199949"
                     /db_xref="GOA:C4R3U2"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C4R3U2"
                     /translation="MCGILLRFSRSSNLEIDNDYTFQSAKQLVSERGTDYQNLIHIPA
                     NNGVASLYSSVLSIRSPFTQQPLRSELYTVQFNGELYNKETRDKNDGHWILELLNDYD
                     DIFKVVGTLEGEFAYTILAHRENKIYFGKDQLGKKSLAYTVIDGTLYISSCIPDVPTR
                     TSFHECKNLSMYIFDMETSEIVVLPFKDNDYFPKEYSVSDVRDIEIYQPLISQIVESL
                     TSAVCTRTNNIHTLNTSIAKYAILFSGGIDCSILASLAAKTSPAGTIIDLLNVSFYNP
                     RTKTLPQNTPDRKLGIQNWENLRKMYPSIRFQLVEVDVTYEEYMDHKEKVKQLIYPND
                     TEMDLSIAIAFYFASRGKGFSRINANEKIPYESTCKVLLSGLGADELFGGYTRHERFF
                     TPISNIRKKQDKSTVPETVDANLYHLLQQELQKDLSNLWIRNLSRDDKVIACWSKEVR
                     YPFLDTHFINYATSVPLSLKLHYDPQSGDITRKWTLRHVADQLDMGWVSNEAKRAIQF
                     GAKSAKMEAGSGKMKGTDKLA"
     gene            complement(<397919..>398737)
                     /locus_tag="PAS_chr3_0200"
                     /db_xref="GeneID:8199950"
     mRNA            complement(<397919..>398737)
                     /locus_tag="PAS_chr3_0200"
                     /product="Sumoylated protein of unknown function"
                     /transcript_id="XM_002492363.1"
                     /db_xref="GeneID:8199950"
     CDS             complement(397919..398737)
                     /locus_tag="PAS_chr3_0200"
                     /codon_start=1
                     /product="Sumoylated protein of unknown function"
                     /protein_id="XP_002492408.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0200"
                     /db_xref="EnsemblGenomes-Tr:CAY70187"
                     /db_xref="GeneID:8199950"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="UniProtKB/TrEMBL:C4R3U3"
                     /translation="MPIKGRFTKKKPKRKDEPNRPSPTQFIKKIASLKKQTRRDEALD
                     VLHELAVVVSPLMKENGFTVGLLCEMFPKNASLLGLNVNMGSKIMIRLRPSHNMNLFL
                     PKREIIGTMLHELTHNRFSAHDVRFYDFLEGLKSRFFEIQVKGSLQTTGYVNFSEVLS
                     GNAARGQLIQKEKEKGQRLGGNKHAKPMRVLILEAAEKRMIDSKWCGGASNEVGLPKI
                     EDLMDDEEAQHSELKEENTKKVRKIVQPSKKKIVDLENLPNGKSIIIDLTNDDD"
     gene            <401425..>402888
                     /locus_tag="PAS_chr3_0202"
                     /db_xref="GeneID:8199951"
     mRNA            <401425..>402888
                     /locus_tag="PAS_chr3_0202"
                     /product="Protein involved in 5.8S rRNA processing"
                     /transcript_id="XM_002492364.1"
                     /db_xref="GeneID:8199951"
     CDS             401425..402888
                     /locus_tag="PAS_chr3_0202"
                     /codon_start=1
                     /product="Protein involved in 5.8S rRNA processing"
                     /protein_id="XP_002492409.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0202"
                     /db_xref="EnsemblGenomes-Tr:CAY70189"
                     /db_xref="GeneID:8199951"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C4R3U4"
                     /translation="MPEQDPLPPQNAGKKSKKSKKKGAMNPALLTPEYIAQQRALKLE
                     EKNKKRDLLTKLGIDPVSTIEKPYLKFIKRKMLQVAVPSDERLNISIMTYNMLAQALI
                     RRKLFPTSGDALKWGNRSVVLLNELKYYNCDIMCLQEVDYIQFNSFWNDELGKLGYDS
                     QFYREGTKNHGVVVFWRKALFNCIKVSHINHDQEKTSDIAPRTVAQNVGVLVALEFSE
                     KIKQKFPFSNRKGILIGTTHLFWHPFGTYERTRQTYLILKKMKEFHMSLTGSEKEDKM
                     NDEWFTLFAGDLNSQPFDAPYLSMTSKPVLYSGRAKTVLECSTSFQYSKKRNGESTED
                     EDGGNIEKFGPEQPQTPVPDQFSPTDEQKELVKKIQVLHNSLPVIATSLYSAAYAKIH
                     SENAGKDNDRNEPLISNWAHAWRGLLDYILVIQDWGFGDRTAPIDNVQLFQQTGIAIN
                     SLLRMPLPAELGNEGFPKAGMFGSDHLCMAANVGLAM"
     gene            complement(<402910..>404733)
                     /locus_tag="PAS_chr3_0203"
                     /db_xref="GeneID:8199952"
     mRNA            complement(<402910..>404733)
                     /locus_tag="PAS_chr3_0203"
                     /product="Guanine nucleotide exchange factor"
                     /transcript_id="XM_002492365.1"
                     /db_xref="GeneID:8199952"
     CDS             complement(402910..404733)
                     /locus_tag="PAS_chr3_0203"
                     /codon_start=1
                     /product="Guanine nucleotide exchange factor"
                     /protein_id="XP_002492410.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0203"
                     /db_xref="EnsemblGenomes-Tr:CAY70190"
                     /db_xref="GeneID:8199952"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:C4R3U5"
                     /translation="MSFNKSFNKLGSAKATASVSTAKGDSVSANPTRSESESDRGHKQ
                     LINILGQFEPHHDNKQWTSIEASTVSDQDLFANDDDSDDDGDEDDEEEEGDVIENEKL
                     PFKEGPSIAEKDEQRIDKKPESSKLAAEVEPQVNVSNENEDSSEPDHSAIPSTAKEGI
                     ENITKGVDSIQVKSENKSKSERLTKQNSAKKTLTKFDFQRFLKQLRSKDCEPVLKYIK
                     SFLTQFQARTWSVDEQIKLVKEFQQFIFGKLIECKPFDNLSTDEDVNNTMEGLEKFIM
                     SRIYNDTFPPLMVERKLSPSHREDLSRDKIYHINLKKYRWIQPKHLDIHLKIDSETSF
                     VKLAGTELSKVNDYKSPRDKIICILNCCKVIFALIRQQQKIHKVEENADIFVPLLVFV
                     ILKCKTRNLISNLSFIERFRNDRFLVGESSYYVSSLQIAANFITTIEQSLLTISAEDF
                     AAEIENNERKLKEESIKRKREQKILEEKKAQEDAQKQGLFSPLTEMIAGTGKGEDFAP
                     SQVLKSSAGIFQQSLSTLFSSPSRESSPVSSSVDELKTAKKQSLEESKKEARIKSERE
                     TTLKNLKQMFPDMDSEILLDIAIAKNSNIGDCIDACLELTE"
     gene            <405076..>406047
                     /locus_tag="PAS_chr3_0204"
                     /db_xref="GeneID:8199953"
     mRNA            <405076..>406047
                     /locus_tag="PAS_chr3_0204"
                     /product="Protein required for pre-rRNA processing and 40S
                     ribosomal subunit assembly"
                     /transcript_id="XM_002492366.1"
                     /db_xref="GeneID:8199953"
     CDS             405076..406047
                     /locus_tag="PAS_chr3_0204"
                     /codon_start=1
                     /product="Protein required for pre-rRNA processing and 40S
                     ribosomal subunit assembly"
                     /protein_id="XP_002492411.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0204"
                     /db_xref="EnsemblGenomes-Tr:CAY70192"
                     /db_xref="GeneID:8199953"
                     /db_xref="UniProtKB/TrEMBL:C4R3U6"
                     /translation="MMSDSEKLDALEIQRRNFEAQFGSLEDMGYIDKTKVRKSSKKNK
                     EHNDSEDDSGSGNDSSNDSESDSEEFNGFSENEEKGEDDYDENDTQLKGQPKTVKFTE
                     NFNTFKGPSKDELKMARAGKPISLKELKEKQRLALKNATANNSEEQEHLVNDLQLQRL
                     LDESHLLAGSSERFSGADLLDTIDFEDPIGKARLRTLNARVRKLASINGKNGGLPARL
                     EKMPMSMRKGMIKKQLEREAEFEKEAKEAGIVLSKKRKGEFRNLATGDRVTNKSDRIG
                     TGIKKATKMRDRGLKINSVGRSTRNGLVITPKEIAKVSGPSNKRKKR"
     gene            complement(<406092..>408645)
                     /locus_tag="PAS_chr3_0205"
                     /db_xref="GeneID:8199954"
     mRNA            complement(join(<406092..406845,406901..>408645))
                     /locus_tag="PAS_chr3_0205"
                     /product="Chromatin-associated protein"
                     /transcript_id="XM_002492367.1"
                     /db_xref="GeneID:8199954"
     CDS             complement(join(406092..406845,406901..408645))
                     /locus_tag="PAS_chr3_0205"
                     /codon_start=1
                     /product="Chromatin-associated protein"
                     /protein_id="XP_002492412.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0205"
                     /db_xref="EnsemblGenomes-Tr:CAY70193"
                     /db_xref="GeneID:8199954"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022100"
                     /db_xref="UniProtKB/TrEMBL:C4R3U7"
                     /translation="MSLEPVNQLVFSGGGQTIVKVTDDFKHLLVASQKGLLKIFDADH
                     QENEPTTIDILQDISSFSTCTNTDNIIATSKKGTVGFYSFSNHSLNNILFSSVLPLRD
                     SCLTNGGNLAVVGGDDSELILLDPQGETKLIKKIGLNNEITSLSYNRVSNLVAVSLSS
                     RVVRVYSLSSQSPEFVSSIEGQIPKKLFQDEFDDSLEDEFDELDEEDNFTFKDDKTKN
                     KAKDNNRVSTKPSWRPDGEVIAIPCEDNIIRLFSRSDDFSEGVAFPGKHRLSLVDLSW
                     SPNGNYLASVDLDDRLIIWDTQQKIVTHSYNLPKPVYNVDWISIGDRFDVVLGTFDGH
                     ILRFNGVVPRTGTTSVDKATSLFIDAEAGVSDVENNGNVAEAIPDADGDLDDFIIDTE
                     TSTTKRPPNGFLDEDDELFGEHSKKRKPPTIVSSSWKITPYSPGATPWSYDKRYLTIN
                     SFGYCWSVEQTANYTITVDFFNKDLHRSYHFKDVYGYDLASMNENALVLATSGSNSIN
                     PKASSTKRILFRPHDTDISQNWEREVPCQKDEYITCVSVSNSVVVVATSYGYIRSYSL
                     FGVAQTIEKNFSISCIFSMQDLDGKYYQRDAALPVNVDGKNDFVFKGLFFSDDGDPCL
                     VGHDDMLLVLSRWRDPLQARWVPILDIAAGIKKAASSGDKIKSWPLGLMGEKFNCIIQ
                     RTGIIQSSSYPDFPLRLPTEIEIELPVNSEAYSEEEESLNSEENYVKAKVLGELLNDA
                     IQNADEDEDSLEDSELRLFEYSRLYDKSLLLLLADACSKENSMKAFALANELRDDKAL
                     SSAIKIAERSNLETLVQQIAELREERLEQSQSQT"
     gene            <409001..>409882
                     /locus_tag="PAS_chr3_0206"
                     /db_xref="GeneID:8199955"
     mRNA            <409001..>409882
                     /locus_tag="PAS_chr3_0206"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492368.1"
                     /db_xref="GeneID:8199955"
     CDS             409001..409882
                     /locus_tag="PAS_chr3_0206"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492413.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0206"
                     /db_xref="EnsemblGenomes-Tr:CAY70194"
                     /db_xref="GeneID:8199955"
                     /db_xref="InterPro:IPR024602"
                     /db_xref="UniProtKB/TrEMBL:C4R3U8"
                     /translation="MATTSSVNIDSLLADDQFNDQQENQDEDSDFPFTQHMTKDLFDY
                     QVDQVEQENDGKFDADLLLYQNYRFMMLEDLRKELGDLLDQLDDQLVDLINRDYQDFI
                     TLGQSVGGTVETIQMVKFDVTSYKNSLASNQKYIDNVINTVKKLKSQKTNLSKLKWKA
                     EALVLLHTQVDMFEKYIAKKIQDEVVTFEQINKLTSLYLSITSILDSILEEHKPEDGP
                     IVILEKLKSQVNSSRYEYQSIMDTYISGLKSEIKKMTSSQPQDPKSVSELQEQVMTIL
                     TFYPYTGNNKLFSEPDE"
     gene            <410099..>411685
                     /locus_tag="PAS_chr3_0207"
                     /db_xref="GeneID:8199956"
     mRNA            <410099..>411685
                     /locus_tag="PAS_chr3_0207"
                     /product="Protein involved in pre-rRNA processing"
                     /transcript_id="XM_002492369.1"
                     /db_xref="GeneID:8199956"
     CDS             410099..411685
                     /locus_tag="PAS_chr3_0207"
                     /codon_start=1
                     /product="Protein involved in pre-rRNA processing"
                     /protein_id="XP_002492414.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0207"
                     /db_xref="EnsemblGenomes-Tr:CAY70196"
                     /db_xref="GeneID:8199956"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R3U9"
                     /translation="MAKDPFLSDGSRKRKRTNPPTSNVNRISKTQNKNQTERADEDIT
                     SESETENLSSDGEVKEEQSSESEDEEDFAETAADKRRRLAKQYLENLQAEQESYEFDA
                     QDLDNDILARRLQMDVNENKGTLYKFIADKLLVRDCKPTISRVGSKGMTCVSASYPFC
                     YTTSKDMELSKWKIDDFNKKPQKVKYVKGGVKYRNLNKEQHLNGHCGEVLTCSASSNG
                     KYVVTGGRDQRLIVWSTEALSPLRVWEIRNRNGVIFSTVFRKQSDQLYAACGDLKVRT
                     YGVAQMSQLETLYGHQDFVADISALSQERCVTVGSRDRTAMLWKIPEESKLTFRGGDS
                     EEKKNKFGNLNSKESDKLSFYAEGSLDCISMVDESHFVTGSDNGNVSFWAINKKKPIF
                     VIRQAHGLEPRIPSGDASGEINEQAAEFQVPKRNPYWVTAIHSLPLSDVFFTGSWNGT
                     IRVWKINSNLRSFELLGELPNANGVVTKIDSCEFDGKIRLFATLSKEHRLGRWIKTKG
                     RNALYSAVLDLQNLKRPKNS"
     gene            complement(<411805..>412455)
                     /locus_tag="PAS_chr3_0208"
                     /db_xref="GeneID:8199957"
     mRNA            complement(<411805..>412455)
                     /locus_tag="PAS_chr3_0208"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492370.1"
                     /db_xref="GeneID:8199957"
     CDS             complement(411805..412455)
                     /locus_tag="PAS_chr3_0208"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492415.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0208"
                     /db_xref="EnsemblGenomes-Tr:CAY70198"
                     /db_xref="GeneID:8199957"
                     /db_xref="UniProtKB/TrEMBL:C4R3V0"
                     /translation="MKLLNIASLLAIAASASAEATTTLQTTITITETQLSPEESSSLL
                     SVSSASVASEASAASAASEASAASVASELSAASEASVASEAAHQTLFRNYAIAINSTV
                     TPSVSSSSPTIAANSTVVSSTLTPYLNTTSALPTNRTVTTTASFYSNTSSFHNSSTIS
                     STRRSSITSSSSSSSSSSSESGAPTTSSTSATDGAAIYQVSGASLGLAAIAAIALL"
     gene            complement(<412934..>414088)
                     /locus_tag="PAS_chr3_0209"
                     /db_xref="GeneID:8199958"
     mRNA            complement(<412934..>414088)
                     /locus_tag="PAS_chr3_0209"
                     /product="Cytosolic protein required for sporulation"
                     /transcript_id="XM_002492371.1"
                     /db_xref="GeneID:8199958"
     CDS             complement(412934..414088)
                     /locus_tag="PAS_chr3_0209"
                     /codon_start=1
                     /product="Cytosolic protein required for sporulation"
                     /protein_id="XP_002492416.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0209"
                     /db_xref="EnsemblGenomes-Tr:CAY70200"
                     /db_xref="GeneID:8199958"
                     /db_xref="GOA:C4R3V1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="InterPro:IPR027370"
                     /db_xref="InterPro:IPR027711"
                     /db_xref="UniProtKB/TrEMBL:C4R3V1"
                     /translation="MNIVQEEVERLGKNKALEKCIKESNDLLSYLKQKQEQLNQDTDD
                     LKVQDVQIKINYWANQSLKHEKSLNTVIKKYQKSIDKVFNFDLSEVYRHRIPLESTRC
                     RQLVDRALIMHLLRIGDFEAANTIAKMDNIQVPDQLLNKFHELEEISEDLTVHHRLEK
                     AIAWANVNKHNLQRIGSDLQFNLHKLKFIDIYKKNPSSPYPAYEYAKINFPHFGNTHL
                     DVISKLMSSTIFTPNEPENPYLDSIDLTSSPYQKLFTQLSRDFCSFVGLSSESPIFNT
                     LQASYIAIPNFVKFNKISKMKNEKLDWTSENELPFEVELPKSLQFHSIFICPVSKEET
                     TPQNSPMALGCRHLISKDSLAKLKKRNSSIKCPYCPKTFAANEIQEVQFI"
     gene            <414276..>416783
                     /locus_tag="PAS_chr3_1161"
                     /db_xref="GeneID:8199959"
     mRNA            <414276..>416783
                     /locus_tag="PAS_chr3_1161"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492372.1"
                     /db_xref="GeneID:8199959"
     CDS             414276..416783
                     /locus_tag="PAS_chr3_1161"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492417.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1161"
                     /db_xref="EnsemblGenomes-Tr:CAY70201"
                     /db_xref="GeneID:8199959"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="UniProtKB/TrEMBL:C4R3V2"
                     /translation="MTKTELGFRYLISSLALCLLTSSNPELHYSKMDKDPGSYNSSIK
                     LVPNPQLMKTPLITLPLKKTKDDTDWKSALDSHIKLAYGANHEFSNEIDTFSAIRSDI
                     HNLKPDVLGRDILYKYYGQLELLGLRIPIKHLNVSFTWYDAFKTSSKVKQHSTAFEKA
                     SVLFNLAATFSELGKSSLSEGNFKASYTNFQYSAGILQFIAENFLHAPSGDLDPEVVT
                     TFQKVMIAQAQEIFLLKMFDDDSANVKHSLAAKLAKAASNMYESITEPLKGFLSKGVP
                     ITFSQLTAYKAIYYDALAHYHNALHNKATSKYGAAIADLKEAESQLKECENTFLPSDF
                     KQIGDFQSELSELIKIELPSIEKDNEFVFNDHVPSTAPIIKPLEGARPISLADQDFSA
                     TVGKDLFEKIIPMSVHEQSSLYSEMQAQLLREEGSNVELLDEELSSLMSYLNLPKSIL
                     ELKELLEIKPDELRLDFSDSTQELDPRILSAALEIQDSSYVTEAQAVRRIKEELLSKL
                     NNTQNLLLNEERNYSENKLRYGAKWTQQPSTMLNSSYKQNLTRTRKSLEDASLSDKKL
                     ESMISPYQYVLNILSGGPHSSELRNAFNPSLPDSEVSLLDIDDRSFNTKAKIGQLDSK
                     VQELHNLRKERANTYNDLKTAVRKDDISSIILINKDNPNMEENVFRKELLKFQPYRNR
                     IEATGERQNLLMQEIKVLMSEVLNDPTIKKNRLSKHSQKETQSKQLNNYLDAYKQWKT
                     YVTGLKQANSFYKQLFNLVNEQHNSVVNYTNQRQMEANALGQDSLSYGLGSLNLEGTS
                     QPPPRPPKDSDQDPYKNPSVFDPLLYASFSDNNQSRR"
     gene            <417461..>419890
                     /locus_tag="PAS_chr3_0210"
                     /db_xref="GeneID:8200193"
     mRNA            <417461..>419890
                     /locus_tag="PAS_chr3_0210"
                     /product="Subunit of the vacuole fusion and protein
                     sorting HOPS complex and the CORVET tethering complex"
                     /transcript_id="XM_002492373.1"
                     /db_xref="GeneID:8200193"
     CDS             417461..419890
                     /locus_tag="PAS_chr3_0210"
                     /codon_start=1
                     /product="Subunit of the vacuole fusion and protein
                     sorting HOPS complex and the CORVET tethering complex"
                     /protein_id="XP_002492418.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0210"
                     /db_xref="EnsemblGenomes-Tr:CAY70203"
                     /db_xref="GeneID:8200193"
                     /db_xref="GOA:C4R3V3"
                     /db_xref="InterPro:IPR006925"
                     /db_xref="InterPro:IPR006926"
                     /db_xref="InterPro:IPR016534"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R3V3"
                     /translation="MNNPSLGWERLDTVFYRLRECYSPLQWDIELDEQPVAISNSAAA
                     IAVFNSHSSHTSIDIFSGSGVLLNSIPWLLSNGQIVSMSWTDNEELLVVLQNGTIRKF
                     SDLTSEFDEFGLNLPEDSIVQEAKFFQDGIVVLTNEKKFVFFSSFSQVPRHFTLNVDS
                     IDCWNILYSDRVLQLFVSSNKSIHISTLTTETSVKFGQVITGIEFPPNGSFASLLTPD
                     NLIIATSDLENLLSEFSHNFKHIRSMQWCSNDAVVLATNDELQVIGPGDDSISFYYEN
                     RPFIRSQNDGLTVLTQSKLEFLSRVANFTEETFRIGSTKASAILLDSIDQLDRHSPKA
                     DENLRIVKPNLVEAVDNCIRSASEEFDPQWQKKLLRAASFGKSILDFYSSEEFVEICN
                     NLRVLNAVRQPEVGMFITYAQLLNYGHQGLIQSLIRRRLFLLASKICKFLSSFPDNIY
                     FAWAKLKIKSSYNTNDKELSEIILDKLAETKRVSYTGLSEVAYNEGRVELAHLLLDHE
                     PVLENQVPLLLQMGQDKNALLKSEQSGNVDLICSVLLRLYYKFSLSQFFILLSDSTDV
                     SIGIFKDIIGSVKPDLLLEYYYQDDQLIKIAESNLLQDSTYSLDAETKRNRLLELLKA
                     YEGKKFYENDVPIIESHLKLLNYQETLTNKFNHSFVAFSKIETISELARLDDEKLTET
                     QKYAYQFGISSTQLYHSVVKSLAKSHQWDKLFQFAKSKKSPVGYELFFRECYLQNEKR
                     QAGLYIGMCKELTYKARADLYLKIGEYRLAADEASKKKDIDLLQLVKDTAGSTNVGIT
                     RLIEDYVTRIG"
     gene            complement(<419912..>421165)
                     /locus_tag="PAS_chr3_0211"
                     /db_xref="GeneID:8199960"
     mRNA            complement(<419912..>421165)
                     /locus_tag="PAS_chr3_0211"
                     /product="Outer kinetochore protein required for
                     chromosome stability"
                     /transcript_id="XM_002492374.1"
                     /db_xref="GeneID:8199960"
     CDS             complement(419912..421165)
                     /locus_tag="PAS_chr3_0211"
                     /codon_start=1
                     /product="Outer kinetochore protein required for
                     chromosome stability"
                     /protein_id="XP_002492419.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0211"
                     /db_xref="EnsemblGenomes-Tr:CAY70205"
                     /db_xref="GeneID:8199960"
                     /db_xref="GOA:C4R3V4"
                     /db_xref="InterPro:IPR007902"
                     /db_xref="InterPro:IPR027716"
                     /db_xref="UniProtKB/TrEMBL:C4R3V4"
                     /translation="MDTTASQVISNSYIPPRLAEQNSRFLNRVALKSLLELVKIWSRW
                     PATKPKHNIGSEVDLFTESNITKKKLIDKILVEYWPNGLNLLQLSQIDTQLIVKKPSA
                     SSMGSSGWTSSMAKIPLSGEELMITIEPQLFLDQLMTHLSKVYLCHSYVAKHPVLPLT
                     IIRVQVFDFIPMKKRIPSKDELVSHKPFFLAIPQNSPFVIHTAFQDSVTKTIMQSIEL
                     TLSSSTRQVVLAPTNDPPVKTLEALHIFKGNSRFSNSLGSWQPYADGDVDMPVLGEEK
                     NHPIVKVNRIDNNAVSNRPTREQIAMLRFKGTVDPLKSERLFEDTRAIKEVEEDNTNP
                     YSSIAPVQFVKLALKSADDSNENPITIKFTGTDVYAGLYELAVKGPVDAALIPEALTG
                     EYGVESGTLENGKFTKEETILLDNN"
     gene            <421295..>423256
                     /locus_tag="PAS_chr3_0212"
                     /db_xref="GeneID:8199961"
     mRNA            <421295..>423256
                     /locus_tag="PAS_chr3_0212"
                     /product="Nucleolar protein"
                     /transcript_id="XM_002492375.1"
                     /db_xref="GeneID:8199961"
     CDS             421295..423256
                     /locus_tag="PAS_chr3_0212"
                     /codon_start=1
                     /product="Nucleolar protein"
                     /protein_id="XP_002492420.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0212"
                     /db_xref="EnsemblGenomes-Tr:CAY70207"
                     /db_xref="GeneID:8199961"
                     /db_xref="GOA:C4R3V5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R3V5"
                     /translation="MSDSNKEGKVDKNTLFVRGIPTNASKEQLSDFFSQFAPVKHAII
                     VTDKAEDSKGFGFVSFTSEDDSVLALAGAKAKKFNKVLLKVDIAKRRERKEKKASGEI
                     AREKPKYDKESIEKRRPRLIVRNLPWSARSSQDLKEVFEKFGNVVDVIIPRKAGGRMS
                     GFAFVTMRKQSGAEAAVAGSKDLKIDGREVQVELALEKEKFLEKKKVETKEESDDEDD
                     DDDDDEDEVDEDGEIEDDEDEDEEDEDHKPNRQTPYCIFIRNLPYDASEETLQEHFEK
                     FGPIRYALPVVDHNTGQAKGTGFVAFKNSQDYEDCLLNAPKPTSNSVLLPDEVSPLYV
                     YQGRVLSIAPAVDRDSAGRLMERNEKKRQEALGKGEKDKRNIYLLHEGRISENSVLAS
                     LLTPADLKAREESYKLRVQQLNKNPTLHLSLTRLAIRNLPRAMTEKSLKALGRKAIVE
                     FATELRQGKRNPFSKEELVRSSKHRFEMEGGNFQELLDEATTGHASVTLQKKNKKKGV
                     VLQSKIITEVKGTGEQGRSRGYGFLEYRDHKHALMGLRWLNAHLVTPEEIFEGLNEDE
                     KKSINMEGFSKRRLIVEFAIENAQVVRRRKEKAINFRKESLKRKADEMKKTEDELKAE
                     AKKAEEDKKAEDVRQIIADKRRRKKRQKH"
     gene            complement(<423308..>424990)
                     /locus_tag="PAS_chr3_0213"
                     /db_xref="GeneID:8199962"
     mRNA            complement(<423308..>424990)
                     /locus_tag="PAS_chr3_0213"
                     /product="tRNA(Ser) Um(44) 2'-O-methyltransferase"
                     /transcript_id="XM_002492376.1"
                     /db_xref="GeneID:8199962"
     CDS             complement(423308..424990)
                     /locus_tag="PAS_chr3_0213"
                     /codon_start=1
                     /product="tRNA(Ser) Um(44) 2'-O-methyltransferase"
                     /protein_id="XP_002492421.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0213"
                     /db_xref="EnsemblGenomes-Tr:CAY70209"
                     /db_xref="GeneID:8199962"
                     /db_xref="GOA:C4R3V6"
                     /db_xref="InterPro:IPR011671"
                     /db_xref="UniProtKB/TrEMBL:C4R3V6"
                     /translation="MENLKPDELPNILPGQSLLGKEWHGLFETKVDFSSKHFKKAMLN
                     LIREPNINSTVILRADILIENDYIDKSFVDKASDHIDLPNMENKENSVLTKNIDDTTV
                     RTIPLSSNLKLVPALEIVRRIIPRNPFKDCIINQTCLLLQDSLNDDAEVTQSLIVYVA
                     HLDDPEDIPFYLPCVKAVALFFDKGSLSVHYLPFDIEEVQKWKPTDRPVRTAYRLLKT
                     CKKHSEGVMSGYEKRVNHDLIVPKEDFQNRYISLKRKYSKNLVDNWKESTDPRKHVFE
                     DLAIAAFLIELWSQKYPSKDSFQFRDLGCGNGLLVYILIMEGYHGMGIDARRRKSWDS
                     YPESIQENLLEQVIIPSVLLRPHPAMIAVNPYLTDNGCIFQVPVPLKHIHDTTSRSLI
                     DSNVPIMAYYSSATLLESPHVNTAEFPPNTFLIGNHSDELTCWMPLLRFPFLVIPCCS
                     HALDGSKARFPPRKVKRNDKVQPTSFQSASSYAGLVDHVEDLATQVGWKVEKEMLRIP
                     STRNAALIGFDCLNPETDGPFKSIYEILAMEGGAEGWVENAMALSSRSPRGH"
     gene            <425378..>426386
                     /locus_tag="PAS_chr3_0214"
                     /db_xref="GeneID:8199963"
     mRNA            join(<425378..425391,425528..>426386)
                     /locus_tag="PAS_chr3_0214"
                     /product="Cyclin-dependent kinase"
                     /transcript_id="XM_002492377.1"
                     /db_xref="GeneID:8199963"
     CDS             join(425378..425391,425528..426386)
                     /locus_tag="PAS_chr3_0214"
                     /codon_start=1
                     /product="Cyclin-dependent kinase"
                     /protein_id="XP_002492422.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0214"
                     /db_xref="EnsemblGenomes-Tr:CAY70210"
                     /db_xref="GeneID:8199963"
                     /db_xref="GOA:C4R3V7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R3V7"
                     /translation="MSSSQLEKLGEGTYATVYKGRNKTNGTLVALKEIRLDSEEGTPS
                     TAIREISLMKELKHDNIVDLYDVIHTENKLTLVFEYMDQDLKKYMDTHGDSSGALEPQ
                     VIKSFMFQLLKGVMFCHDNRVLHRDLKPQNLLINSKGELKLGDFGLGRAFGIPVNTFS
                     HEVVTLWYRAPDVLLGSNNYSTGIDMWSCGCILAEMVTGKPLFPGESNESQLTKIFRL
                     MGTPNEHTWPGVSNYPHYKADFPVYVPQDLGTILPKIEPLALNLLTNLLQLRPEARIS
                     ARQALQHPYFREYV"
     gene            <427436..>428578
                     /locus_tag="PAS_chr3_0215"
                     /db_xref="GeneID:8199964"
     mRNA            <427436..>428578
                     /locus_tag="PAS_chr3_0215"
                     /product="Alpha1,2-mannosyltransferase"
                     /transcript_id="XM_002492378.1"
                     /db_xref="GeneID:8199964"
     CDS             427436..428578
                     /locus_tag="PAS_chr3_0215"
                     /codon_start=1
                     /product="Alpha1,2-mannosyltransferase"
                     /protein_id="XP_002492423.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0215"
                     /db_xref="EnsemblGenomes-Tr:CAY70212"
                     /db_xref="GeneID:8199964"
                     /db_xref="GOA:C4R3V8"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R3V8"
                     /translation="MVHIGFRSLKAVFILALSSLILYGIVTTFDGSRASRYQPPYVNH
                     SQDPLYHSGNSYNRENATFVTLCRNEDLYSIIQSIKKVEDRFNNKFAYDWVFLNEVPF
                     TDEFKERTSVLISGQAKYGLIPKEHWSYPDYIDQERAAESRRQLEDQHVVYGGLESYR
                     HMCRFNSGFFYKHPLMLDYRYYWRVEPEIEILCDVETDLFRYMRENNKTYGFTISIHE
                     FEKTIPTLWETTKEFMKQNPSYIAENNLMNFISDDNGKTYNLCHFWSNFEVADMDFWR
                     SDVYEKYFKFLDDTGKFFYERWGDAPVHSLAVSLFLPKEKVHFFNEVGYKHSVYSMCP
                     IDKDIWKNRKCYCDPNTDFTFRGYSCGRQYYKATGLTRPSNWKDYD"
     gene            <428902..>430113
                     /locus_tag="PAS_chr3_1162"
                     /db_xref="GeneID:8199965"
     mRNA            <428902..>430113
                     /locus_tag="PAS_chr3_1162"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492379.1"
                     /db_xref="GeneID:8199965"
     CDS             428902..430113
                     /locus_tag="PAS_chr3_1162"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492424.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1162"
                     /db_xref="EnsemblGenomes-Tr:CAY70214"
                     /db_xref="GeneID:8199965"
                     /db_xref="GOA:C4R3V9"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R3V9"
                     /translation="MAGATRINSRVVRFAIFASILVLLGFILSRGSATSYSLPSGLTS
                     DTSQSTGSSPKSESKPSSQGSSGATELKKTYTTDGKEKATFVSLARNSDVWSLASSIR
                     HVEDRFNHKFHYDWVFLNDEEFSDEFKRVTSALTSGKAKYGLIPKEHWSFPEWIDKER
                     AAKTRKEMAAKKVIYGDSISYRHMCRFESGFFFRHELMQEYEWYWRVEPDIKIYCDID
                     YDVFKFMKDNNKMYGFTVSLPEYVATIETLWDTTRAFIKENPQYLPEDNMMDFISDDD
                     GLSYNGCHFWSNFEVGSLSLWRSEAYLKYFDHLDKAGGFFYERWGDAPVHSIAAALFL
                     HRDQIHFFDDVGYFHNPFNNCPVDADLREERRCMCNPKDDFTWKGYSCVPEFFTVNNM
                     KRPKGWEAFSG"
     gene            <430272..>433010
                     /locus_tag="PAS_chr3_1163"
                     /db_xref="GeneID:8200194"
     mRNA            <430272..>433010
                     /locus_tag="PAS_chr3_1163"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492380.1"
                     /db_xref="GeneID:8200194"
     CDS             430272..433010
                     /locus_tag="PAS_chr3_1163"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492425.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1163"
                     /db_xref="EnsemblGenomes-Tr:CAY70215"
                     /db_xref="GeneID:8200194"
                     /db_xref="GOA:C4R3W0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019015"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4R3W0"
                     /translation="MQIIKLPWLCHQEEQRKFEVYTISVSADGKRLASGGLDGKIKIW
                     SMDSIYQYKRSDKENDLRYLQGSVQSDESKNALKVSENICRPLCSMSRHTGAVTCLRF
                     SPNNRFLASGSDDKIVLIWEQDEEYEYDSSVMEGMNPVFSNGSSGDQMDMERWTVRKR
                     LVAHDNDIQDMAWAPDGSILVTVGLDRSIIIWNGQTFEKMKRYDIHNSHVKGIVFDPA
                     NKYFITSSDDRTCRVFRYHKTSPTEMIFSVEHVITEPFTKSPMTTYFRRLSWSPDGLS
                     IAIPNATNGPVSSVAIVNRGSWESDISLIGHDSPCEVVSFCPRLFEVATSKEEKQLCS
                     VLATGGQDKTLAIWNTARPKPLVVIHDIVYKAITDLCWTPDGDVLTISSLDGTITVIV
                     FENNDLGVKTPIERNQEQLEIYGGEREGMVFPESVEQLILEEKSHNAQLLLRNPHLDQ
                     MMEKRIPQTAIRTTLQHKVVKPKKVNNINVLKTQKITMKNGKKRVSPLLLTSSSSTSN
                     RFIPVPNKERENLTSNLLSKSTYKFPKNGLPSLTTSLRPNVEIQTPKEESVLQEEDIN
                     IDHIEHHHHLKNSVPKTNNSSNAFKKKRDLAFPEFLRPAIRSVVTVFPEMKFQPKVLV
                     VLAPPTTETNIETNEKVELESSIEIRNQVEPKDLNLSKVYSSDTNGNRRFELTFQMNL
                     NNAISTSDNQWALSSDTGSIIVVSSAGRITSPILEVGASVCVLRSYNEHLLAITCEGT
                     CFSWNLKKQECVLNSISLAPIVNSHMLVKKVGDARNYSIVSAEGDNNPLPQILDCELS
                     KNGAPIVALSTKDIYSYSKKMKCWIHLIDSKYFELLGADNALFECVEALEGPIGMLIH
                     RLVDEFFHENTAGKKLKLYNKRVLEDLSNSLEELGENASQLREKLDKLYGDEVEAS"
     gene            <433442..>434689
                     /locus_tag="PAS_chr3_0216"
                     /db_xref="GeneID:8200195"
     mRNA            <433442..>434689
                     /locus_tag="PAS_chr3_0216"
                     /product="Arginosuccinate synthetase"
                     /transcript_id="XM_002492381.1"
                     /db_xref="GeneID:8200195"
     CDS             433442..434689
                     /locus_tag="PAS_chr3_0216"
                     /codon_start=1
                     /product="Arginosuccinate synthetase"
                     /protein_id="XP_002492426.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0216"
                     /db_xref="EnsemblGenomes-Tr:CAY70217"
                     /db_xref="GeneID:8200195"
                     /db_xref="GOA:C4R3W1"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:C4R3W1"
                     /translation="MSKGKVCLAYSGGLDTSIILAWLLEQGYEVVAFLANIGQEEDFE
                     AAREKALKIGATKFIVSDVRKEFVEEVLFPAVQVNAIYENVYLLGTSLARPVIAKAQI
                     EVAEQEGCFAVAHGCTGKGNDQVRFELSFYALKPDVVCIAPWRDPEFFERFAGRNDLL
                     NYAAEKDIPVAQTKAKPWSTDENMAHISFEAGILEDPNTTPPKDMWKLTVDPEDAPDK
                     PEFFDVHFEKGKPVKLVLENKTEVTDPVEIFLTANAIARRNGVGRIDIVENRFIGIKS
                     RGCYETPGLTLLRTTHIDLEGLTVDREVRSIRDTFVTPTYSKLLYNGLYFTPEGEYVR
                     TMIQPSQNTVNGVVRAKAYKGNVYNLGRYSETEKLYDATESSMDELTGFHPQEAGGFI
                     TTQAIRIKKYGESVREKGKFLGL"
     gene            complement(<434738..>435685)
                     /locus_tag="PAS_chr3_0217"
                     /db_xref="GeneID:8199966"
     mRNA            complement(<434738..>435685)
                     /locus_tag="PAS_chr3_0217"
                     /product="Type 2A-related serine-threonine phosphatase"
                     /transcript_id="XM_002492382.1"
                     /db_xref="GeneID:8199966"
     CDS             complement(434738..435685)
                     /locus_tag="PAS_chr3_0217"
                     /codon_start=1
                     /product="Type 2A-related serine-threonine phosphatase"
                     /protein_id="XP_002492427.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0217"
                     /db_xref="EnsemblGenomes-Tr:CAY70219"
                     /db_xref="GeneID:8199966"
                     /db_xref="GOA:C4R3W2"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R3W2"
                     /translation="MPERGPDQWFEEVKSCKALSENDMKHLCERVKDLLMEESNIQPV
                     QSPVTVCGDIHGQFHDLLELFKISGGFPGSSSNGIKQNYIFLGDYVDRGYFSLETFTL
                     LMILKIKFPQHITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLSA
                     IIDGKILCIHGGLSPDIRMLDQIRVLSRAQEVPHEGGFCDLVWSDPDEVDSWAVSPRG
                     AGWLFGARVAREFNHINNLQLIARAHQLVMEGFRYHFKEKDVVTVWSAPNYCYRCGNV
                     ASVMNVDDELDVNFKIFSAVPDDTQKMNPVKNQRNEYFL"
     gene            <436426..>437808
                     /locus_tag="PAS_chr3_0218"
                     /db_xref="GeneID:8199967"
     mRNA            <436426..>437808
                     /locus_tag="PAS_chr3_0218"
                     /product="Diacylglycerol acyltransferase"
                     /transcript_id="XM_002492383.1"
                     /db_xref="GeneID:8199967"
     CDS             436426..437808
                     /locus_tag="PAS_chr3_0218"
                     /codon_start=1
                     /product="Diacylglycerol acyltransferase"
                     /protein_id="XP_002492428.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0218"
                     /db_xref="EnsemblGenomes-Tr:CAY70221"
                     /db_xref="GeneID:8199967"
                     /db_xref="GOA:C4R3W3"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:C4R3W3"
                     /translation="MPEKKNSRSADEALSFLAKTNVERPMHYSKTGNITPDTVSSRED
                     HYQDYDDSQDDIINNKLLQRRQGGPHNKIEKQRRFALLRSSLNRRLETLVILWHTITI
                     PFLASLFFVLCTIPMLWPLIIVYLVYFYIDANTPSNGKSADRRVEWFRSLHIWKHFVN
                     YYPISVYKTVDLEPTFKTKKIEIILPKYHQVTTYLPSSVRKYIPTHRVLIEKEIKTGP
                     RYIFGYHPHGVVSLGITGAFGTNGCNIGELLPGIRIYLLTLITQFKLPLLRDYLMALG
                     ISSVSKRNVTALIKRNQSVCIVIGGASESLLSKPHTIDIVLKKRKGFVKVALELGDTE
                     LVPVFGFGENTAYNVFDPSVSGKSCSVLNYVRKQMCGFQLWLKQHFGFTFPFFHARGV
                     FNHDFGLLPYRKPINLVIGRPIPVPYIHSPTQEQIDHYHSLYVEELKRVFEQNKERFN
                     AGSLELRIVE"
     gene            <437955..>440363
                     /locus_tag="PAS_chr3_0219"
                     /db_xref="GeneID:8199968"
     mRNA            <437955..>440363
                     /locus_tag="PAS_chr3_0219"
                     /product="DNA helicase and DNA-dependent ATPase"
                     /transcript_id="XM_002492384.1"
                     /db_xref="GeneID:8199968"
     CDS             437955..440363
                     /locus_tag="PAS_chr3_0219"
                     /codon_start=1
                     /product="DNA helicase and DNA-dependent ATPase"
                     /protein_id="XP_002492429.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0219"
                     /db_xref="EnsemblGenomes-Tr:CAY70223"
                     /db_xref="GeneID:8199968"
                     /db_xref="GOA:C4R3W4"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR013986"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3W4"
                     /translation="MLASLNSQQYEAVTADIHKPLQIIAGPGTGKTKVLTSRVAYLLI
                     EHKIPPSNIIVTTFTKKAANEMVERLQVLFAKENLDPDKYLKGLLIGTFHSICVKLLR
                     RYGTQIGLTPKFKIADERDSNTILSKILTTLSDDVVRLKFHPSSVSVDIYQKDPKETD
                     KLHGYDLKKAKSQISKLKSLTTTPQTYSTTSARSFDLAVIYSLYQESLRKHNLIDFDD
                     CLLYTYLLLSETRKKGRVLLKELKHVLVDEFQDTNKIQMELLYLLGQCTDDQNFEDNV
                     TVVGDSDQSIYMFRNAVASNFENMIIHYQNCQEITLKENYRSTSNILNFSEQIMTQQK
                     DRKQKSLRSQISHLNIPIVYVRTQNTFKEADHIASEVAKLGLMSGLLTSYNDIAILLR
                     SSFQSRVIEQSLVTNRIPYEVVHGRAFWELKEIRVAMDYLRAIVNNSDNLAILRTLNF
                     PPRGVGNKTLQRLEELIDKSDCPVIETLEMAIHDKKNGFLNVKSESGVRQYIDILKEC
                     GRLLDSTSLDCEASLEACFDQIVQLANLKEIKKTPETSKGTHDSENALKAVEENLNEF
                     KRQLIEYKPIIDQIITAEAGDTPLTTRDVLSSFLDSIDLYETSNNENKKDSKKGRVTI
                     STIHGAKGLEWPVVFIPGCTDGVIPSKWTLEDDGPDSSTNLDEDRRCFYVALTRAKSM
                     LYLSSYKERSTPWSGEESNEVSCFLKPTLKMFQNQLVTSISNMSKNSWRDLYEAMGKE
                     YKPVSNILTESNRSRNHIVSTKDFLKNKQFKSPLLTKSTTAPSYVPDRSNNKKRRLGV
                     RRRI"
     gene            complement(<440370..>444494)
                     /locus_tag="PAS_chr3_0220"
                     /db_xref="GeneID:8199969"
     mRNA            complement(<440370..>444494)
                     /locus_tag="PAS_chr3_0220"
                     /product="Mitogen-activated protein (MAP) kinase kinase
                     kinase"
                     /transcript_id="XM_002492385.1"
                     /db_xref="GeneID:8199969"
     CDS             complement(440370..444494)
                     /locus_tag="PAS_chr3_0220"
                     /codon_start=1
                     /product="Mitogen-activated protein (MAP) kinase kinase
                     kinase"
                     /protein_id="XP_002492430.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0220"
                     /db_xref="EnsemblGenomes-Tr:CAY70224"
                     /db_xref="GeneID:8199969"
                     /db_xref="GOA:C4R3W5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R3W5"
                     /translation="METDSANHLDPVEPTYDTTLLPYLHSRKSSRKSFGGDDITNPNA
                     DLSTTPSRIPLPSSFMSEEGSKGESRFSFELNGMDSSTPEKSAWTGILESPKPSESFS
                     FFTEHPSIAHFNNSSGNHIESLSNSTSPSNADSDLSKRLSRIKKSATHSRQSSISWNV
                     DLPEEWTLNNITFWLNLYNFNESWLSMIKAHNLVGASFLSLANYPVLKTYTHEVDTVN
                     DSTPSRFIHLLRKTMGRKTSETLSLASANVNDYYASNVSAESFDSIIQSPVEEFHETS
                     NLETKSSSESPKSSVKHFADPAKLTTNIPKPSPLRSSSPSSSSTTLKHSVSQRTTNTR
                     QATENVKRPVSTIEYSTSRSDSPTSTFSYNVFRKHQKSNSSESNFFSKIYSNAPTNEV
                     EVERRSSVKSKKGLLTKFKKIGEEISKSNKSRDKLSESPISPASATSLVGGKDRWKRH
                     QSSVTTELSNKDWKQASRKSVDKTKNNVETNKERLSISKKDKVLSDIYEKHKPTPLKD
                     THTKTSSSFVLATSNDNNFIPIDVSEVQDLRQFKVVVIKALNIMNIEPISFHLTDFGH
                     IHGAELDDESLEKFRLDGFRNGSLKLHVKGTKFETSSSTASSMTLSFKSIEEGKLEKG
                     SSRYPTTPQYLLDTMNAHSKDMSVDYLNIKDKVRESQELKNELVPQSASTTTVPMSKE
                     RSFSFRSTKEEHQNNTFRVIRNKSWEVDFDKKRKSPYERTRQLVAKRDPPPPPSPYSP
                     PKNSLANREKRELPVLNPANQSSATSRTFGLDHNLEFPSKTNDEPTRISPFTPGSSNT
                     LIPKPYKGSSPHERRPVLSNERRGSRRRSSSLLTTSSIVSGNSYQNFNTKSESFHDPS
                     SGDSHGTFEESNTFDELPTFDISNPIESCSEEEEEDFWAKPPSSTTNTQPAAVAIDAK
                     EDQEEKITRMPSMAVRPPAEVVYDNLELFFPNTDLDKPLMDDASPPPSPNSPIPEVSP
                     VNNTRPQIHRKISSVRSASDHLARPNELGRGRVKTIRIVAQEAKKSRARLAENFESNK
                     KADGLLRRRSTKFWGRKVVEMKPGDARNLSKLKDGNGDYKQFSWVRGEMIGKGTYGKV
                     FLALNVTTGEMMAVKQVDLPSSGHNSSVFKEVVDAILSEVDTLSDLDHDNIVQYLGFE
                     QRAQTYTLFLEYVAGGSVGWCLRVFGRFPEEVIRFLTKQVLEGLAYIHSRGILHRDLK
                     GDNLLLETDGTCKITDFGISKRSRNIYSNDAEMSMQGSIFWMAPEVIDNVVNDKKQGY
                     SAKVDVWSLGCVVLEMFAGKRPWSNFEVISAMYNLGRSKSAPPISDEVKAYISSDGID
                     FINKCFTVDPDERPTAQSLICHPFCKTSSDFKFESTELAKLVKVNDKQANLVFE"
     gene            complement(<444718..>445200)
                     /locus_tag="PAS_chr3_0221"
                     /db_xref="GeneID:8199970"
     mRNA            complement(<444718..>445200)
                     /locus_tag="PAS_chr3_0221"
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /transcript_id="XM_002492386.1"
                     /db_xref="GeneID:8199970"
     CDS             complement(444718..445200)
                     /locus_tag="PAS_chr3_0221"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL49"
                     /protein_id="XP_002492431.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0221"
                     /db_xref="EnsemblGenomes-Tr:CAY70226"
                     /db_xref="GeneID:8199970"
                     /db_xref="GOA:C4R3W6"
                     /db_xref="InterPro:IPR028909"
                     /db_xref="UniProtKB/TrEMBL:C4R3W6"
                     /translation="MNLIPRALNSAKICFQRIPTRSFTTQFALLQNQQKQTISSKLPD
                     LQPLKFEKDLYATIRIHNRPYLITEGDKIILPFRLKNAEVGDVLNFDDVTTIGSRNFT
                     YSDTPIDSSLYSIKATVIEKTKKPMYTKEITKRRQRHVRHVNVKHDLTVLRVSELKLS
                     "
     gene            complement(<445350..>446039)
                     /locus_tag="PAS_chr3_0222"
                     /db_xref="GeneID:8199971"
     mRNA            complement(<445350..>446039)
                     /locus_tag="PAS_chr3_0222"
                     /product="3-hydroxyacyl-CoA dehydratase"
                     /transcript_id="XM_002492387.1"
                     /db_xref="GeneID:8199971"
     CDS             complement(445350..446039)
                     /locus_tag="PAS_chr3_0222"
                     /codon_start=1
                     /product="3-hydroxyacyl-CoA dehydratase"
                     /protein_id="XP_002492432.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0222"
                     /db_xref="EnsemblGenomes-Tr:CAY70228"
                     /db_xref="GeneID:8199971"
                     /db_xref="InterPro:IPR007482"
                     /db_xref="UniProtKB/TrEMBL:C4R3W7"
                     /translation="MPVSGRNPNSSFLPVQATHHFIMTTPAWLVSYNALSSIAWFSVL
                     VLATSYPEAQPQFFQDTQAYVRLVQTFAIVEVYNSLVGNVRSPVFTTAVQVASRLLVV
                     WGVFYVLPNSPANTHWAYITLCLSWSITEIIRYGYYALNIVTEGNPPKFLTWLRYNTF
                     LVLYPTGVGSEVTILFKSLDEAERVVGAWYKYLFIAILATYIPGFYMLFSYMLKQRGK
                     TLKKLSPKKEK"
     gene            <446438..>448546
                     /locus_tag="PAS_chr3_1164"
                     /db_xref="GeneID:8199972"
     mRNA            <446438..>448546
                     /locus_tag="PAS_chr3_1164"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492388.1"
                     /db_xref="GeneID:8199972"
     CDS             446438..448546
                     /locus_tag="PAS_chr3_1164"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492433.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1164"
                     /db_xref="EnsemblGenomes-Tr:CAY70230"
                     /db_xref="GeneID:8199972"
                     /db_xref="GOA:C4R3W8"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:C4R3W8"
                     /translation="MKRLATFFLLLVYVTAYNGTDSLSDPSSPSSCHNINHLPLKQQC
                     SFVRENCQDLQVGTLNYFELYYCKIESPAARPLLVIPLTLGLMSVLFVSLGLTSSEFL
                     CPNLSTISHFFDIPDNLSGLTLLAFGNGSPDIMGTYASFMSGDGSLAIGELIGSAYLI
                     TSFIVGAMVVVRPFRLFKDGSSDFTIRNEKLVFVRDLLFFALAVVLVIIFLSDRELSL
                     VECLVMVSLYALYVAVIVSWNWIVKFNEELIQRDQTVRSLYDDDEVDGELNIFHQLND
                     IEVEDNENSHVLNELMNVTGTQNNTSRIRSSVLGALEFKNVFENLSKEQSFPVDRHAL
                     INLRPESEPAYFDDPTDVENRPVTEPILAYRDGDYEARTHDIDLDVDDSENLKTLMSA
                     FYKKRHSSPRRRFQRLVLLLIPTFANFKDSSWINKIFILSSAPIVLSLTLTIPVRLIS
                     DFQDIPESETIEGSGTTTNRTTSLRAQVSLLITQAFFSFLLLTFATVGTSDGFAIYVV
                     FSLICSSIVSMIIYSVLVSPVSKSPTKSSNLVNIALSFIGFASSIAWISIFAEELINI
                     FKFYSVFFKISEAILGLTIFAIGNSIGDFISNLTIAKMGMPLMALAACFGGPLLNLLM
                     GIGVNGLIVLLSNNETSFHIDISSTLFTSSLFLLLSLVFLLVAIPLNNWYFERWIGTV
                     IVAFWCVGTTINVLIELFGY"
     gene            <448741..>450153
                     /locus_tag="PAS_chr3_0223"
                     /db_xref="GeneID:8200196"
     mRNA            <448741..>450153
                     /locus_tag="PAS_chr3_0223"
                     /product="non-ATPase regulatory subunit of the 26S
                     proteasome lid"
                     /transcript_id="XM_002492389.1"
                     /db_xref="GeneID:8200196"
     CDS             448741..450153
                     /locus_tag="PAS_chr3_0223"
                     /codon_start=1
                     /product="non-ATPase regulatory subunit of the 26S
                     proteasome lid"
                     /protein_id="XP_002492434.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0223"
                     /db_xref="EnsemblGenomes-Tr:CAY70231"
                     /db_xref="GeneID:8200196"
                     /db_xref="GOA:C4R3W9"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:C4R3W9"
                     /translation="MSSTTEETIPTNEDIELRFQLIQKSVSHFDPRFTLKVFRELGPL
                     RRRLDVNSLLQVVEKNYPQDENRQYLKDILVKLGAHSSQEGDHMEVDSGSVNTVLPEI
                     DIFIHVLILIYLHDHKEIKLANKFVPFTISALKSYNRRTLDYISSRAWFYIARIKELA
                     GELTSIRPDLLLALRTSTLRHDIGTRASTITLLLRNYILSNDINQASNLVEKTEFPED
                     ASNALVARYYYYLARIHAVQLAYSTAHNYAVTSIRKAPQSELATGFLQTATKLNILVE
                     LLMGEIPSLDTFRDPKLEKSLLPYLAVTRAVRLGDLNLFNKALAEYGDTFKDEKNYNL
                     VLKLRQNVIKTGIRIISLAYTRISLKDICIKLHLDSELSAEYIVAKSIRDGVIEATID
                     HEKGYMQSKEVLDVYSTREPQSVFDERIKFCMQLHNESVKAMRYPLSANRIDNKNAPD
                     NKDSEEELLAYSLSVFDDEL"
     gene            <450270..>451046
                     /locus_tag="PAS_chr3_1165"
                     /db_xref="GeneID:8199973"
     mRNA            <450270..>451046
                     /locus_tag="PAS_chr3_1165"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492390.1"
                     /db_xref="GeneID:8199973"
     CDS             450270..451046
                     /locus_tag="PAS_chr3_1165"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492435.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1165"
                     /db_xref="EnsemblGenomes-Tr:CAY70233"
                     /db_xref="GeneID:8199973"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C4R3X0"
                     /translation="MKRLGLSALDNVQNHNQRYQEVGKKLLEDQTNQLQTQLTVFQNG
                     LISFIKEHKKDIEDDPKFRTEFSQICLNFGVDPLAAFSIAYNGEGGQSTEKSKQKVVK
                     NDSTANQSEQDFYNDLGIKIMEICQDTADINGGVISIKEILQILSNKPLTKLFGIQLT
                     QDDIVKSINALTEALGTELQIITIGHKLYCKSVPQELNKDNSTVLETCGNIGFVTVSL
                     LIDNFRWKKARATTVLEDMVANGLLWIDEQASEIQYWELS"
     gene            complement(<451071..>453587)
                     /locus_tag="PAS_chr3_0224"
                     /db_xref="GeneID:8200197"
     mRNA            complement(<451071..>453587)
                     /locus_tag="PAS_chr3_0224"
                     /product="DNA-dependent ATPase"
                     /transcript_id="XM_002492391.1"
                     /db_xref="GeneID:8200197"
     CDS             complement(451071..453587)
                     /locus_tag="PAS_chr3_0224"
                     /codon_start=1
                     /product="DNA-dependent ATPase"
                     /protein_id="XP_002492436.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0224"
                     /db_xref="EnsemblGenomes-Tr:CAY70235"
                     /db_xref="GeneID:8200197"
                     /db_xref="GOA:C4R3X1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR013967"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3X1"
                     /translation="MAKKLHKPTNELGTGAGLPLDKRPRPVSNPLAIISRPFKIPVAR
                     DTSRNHSTLNGRQVRKARLKGPSSYALMEIDTNIVADSDLSVGADGEVVVRGKKGALT
                     SRRMLDSEGRSSPILNKKFTVPIKIDKENAFERQNSQPPPPLGTKRKPTLPPRPLHDP
                     MSEYAIVLYDPTVDIIPEIKEEDDRLRKEQEELEMERKKAEQITNKNKRIKPGKSLAE
                     ILGIAKDGSSLKKYPNVPVVIDPKLAKILRPHQISGVKFLFRCTSGLVDASAKGCIMA
                     DEMGLGKTLQCIALLWTLLRQSPRGTKTIEKAIVVCPSSLVKNWANEFDKWLGKGTLT
                     PLAIDGKSAKGSTISSQLSQWAMATGRNIVRPVLIVSYETLRRNVESLKGTKVGLMLA
                     DEGHRLKNGDSLTFTALNSLDCERRVILSGTPIQNDLSEYFSLLTFANPGLLGTRNEF
                     RKNYENPILRGRDSLADDKEREKGDQKLKELTEIVARFIIRRTNDILSKYLPVKYEYV
                     IFCNLSETQKSLYQRFTASKSISKLVKEVGGGAQSLQSIGLLKKLCTHPNLLNLPEDI
                     EGCENLLPDDYDYGHGNRRNREVQVWHSSKFLILQRFLYKINKETNDKIVIISNYTQT
                     LDLIEKLCISSRYGSLRLDGTMNINKRQKLVDKFNNPEGKEFVFLLSSKAGGCGINLI
                     GANRLILVDPDWNPASDQQALARVWRDGQTKNCFIYRFIATGSIEEKIFQRQSAKLQL
                     SSCVVDSNDDVERLFSADNLKQLFQFKENTFSETHSTYNCKRCHPDGKQFIKSSAMLY
                     GDPTTWNHIHPGSLASNEDTLIANEAQFNDISYCFQYISH"
     gene            <453965..>455437
                     /locus_tag="PAS_chr3_0225"
                     /db_xref="GeneID:8199974"
     mRNA            <453965..>455437
                     /locus_tag="PAS_chr3_0225"
                     /product="Soluble fumarate reductase"
                     /transcript_id="XM_002492392.1"
                     /db_xref="GeneID:8199974"
     CDS             453965..455437
                     /locus_tag="PAS_chr3_0225"
                     /codon_start=1
                     /product="Soluble fumarate reductase"
                     /protein_id="XP_002492437.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0225"
                     /db_xref="EnsemblGenomes-Tr:CAY70237"
                     /db_xref="GeneID:8199974"
                     /db_xref="GOA:C4R3X2"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:C4R3X2"
                     /translation="MSVIPLFPNLPPNPIIVVGGGLAGVTAAIQSVNSGANVVLVEKE
                     AKLGGNSMKASSGISGALTSQQISLHVNDSVDSFLEDSILSARSGKDHARSLLEILTD
                     ESADAIKWLTKVCKIDLSTVSLLGGHSQPRTHRGLSKPPGFAITSTVISILSDISERY
                     PQNVKVINQAKLTDIIVHDHEVDGVVIEFQDSKYRILGPVILASGGYSANKELISKFR
                     PELSSLPTTNGPYASGDVLSLALEKGIAGIDLDKIQVHPTALVPFDSKIVKDDQFLIL
                     GAEMLRGAGGLLLNARGERFCNELGTRDYVSAAIENTIKETGDDRVLLVLNEEAAKQL
                     QLNVQFYTAKGLMKKLTAEELIEEIGCDQQDLHQTFSNYNLFADLQRDEFGKVHFPNI
                     PFNLLNSESAQESFYVSYVSRAVHFTMGGLKFNGNAEIEHQDGRVVSGLFGAGEVTGG
                     LHGDNRLGGNSLLECVVFGKRAALTASSYLLKSLSNYHKL"
     gene            <455581..>457113
                     /locus_tag="PAS_chr3_0226"
                     /db_xref="GeneID:8199975"
     mRNA            <455581..>457113
                     /locus_tag="PAS_chr3_0226"
                     /product="Vacuolar transporter"
                     /transcript_id="XM_002492393.1"
                     /db_xref="GeneID:8199975"
     CDS             455581..457113
                     /locus_tag="PAS_chr3_0226"
                     /codon_start=1
                     /product="Vacuolar transporter"
                     /protein_id="XP_002492438.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0226"
                     /db_xref="EnsemblGenomes-Tr:CAY70238"
                     /db_xref="GeneID:8199975"
                     /db_xref="GOA:C4R3X3"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C4R3X3"
                     /translation="MNLNKTNSTGIHSVTSEALSRRSSRRSSILDLVASPTLTDYTSS
                     WKRSQSFGHLDVSDLRETLSRKNSNRTELSIDEETSLISGRHPINKYHYPESTIEEED
                     EDRLLSIGLDKSNNHQTILNAVNVLIGIGLLSLPLGLYLSGWILGITFLSGAAFLTKY
                     TAILLGRCTERDPALRSYNDIGKKVLGRKVNYAILLVFLIDLLGGAASLAILFVDSLS
                     SFFPEVSRKALRLVFGGVVIVFNFLPLSGLSFLSFIGIVSTSSVAVIVVVSGLLKKEA
                     PGSIFQPEVTNFWPTSFVNVLIAYGIFLCPFGGHPVLVELYRDMRTPEDYPSCMSKSF
                     SFTLVVNLFIGVFGFLMFGMDADSEITRSIMLTEGFPKWIPTVVCLFMTLLPLSKTPL
                     VLRPVVTAIDDLTFSETELLNSSQGIISPSTQVKRIFSRITAVVIAIMLSVTFNSFSQ
                     VLAILGSFICTTICIILPTTFYILLFKDELSYNQKAGFKLVIFVFIILAIMGTIAAAL
                     YA"
     gene            <457382..>458996
                     /locus_tag="PAS_chr3_1166"
                     /db_xref="GeneID:8199976"
     mRNA            join(<457382..457487,457561..>458996)
                     /locus_tag="PAS_chr3_1166"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492394.1"
                     /db_xref="GeneID:8199976"
     CDS             join(457382..457487,457561..458996)
                     /locus_tag="PAS_chr3_1166"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492439.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1166"
                     /db_xref="EnsemblGenomes-Tr:CAY70240"
                     /db_xref="GeneID:8199976"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="InterPro:IPR023093"
                     /db_xref="UniProtKB/TrEMBL:C4R3X4"
                     /translation="MCKFINNNRSISLRFTSNLLFGVTVCYKKKIEYFYNDTIIAKTK
                     LSKKLFTPYVTFNKYVVPKQKKNILSDDPCFNIEVDILQKVSYLQDISPSNSINLNDI
                     ENENLSSIFEGNAENHQSLKGNTFEGRDININNLDLDDIIPDVDFLFDGQEFASVHGN
                     DKDHESSFVAAENVDLGLEFDVLNLQTENEGDSNALNTEPKSPQKKDTVPKKLSKRQL
                     VFDNKITVSVSEFNDWTGNYLQRMIPENVTKTNAKMLKETNPFTTLLSQLSPSGKAAP
                     DETLDAYVRNAASRRESTTSNELEYARNQSHSRHSSRTSLASFNLNENILDEMNQDEH
                     YEQPLNNDSYFEENDSFFDIPDFRLRIGNSSSSSSTISRRRPTSTLDGFNRHNIIDEA
                     LYEQSFDAEFTTHDSLYNHLEDKAPSNPRDERFYHFLRNKSSIVGQRKVNPISNKVFS
                     KVTFQELVSSNITEAGCNKSIAASVFYGILTLATHNLVAIDHEPLQNYGILEGKDITI
                     TLIVG"
     gene            complement(<459104..>460012)
                     /locus_tag="PAS_chr3_0227"
                     /db_xref="GeneID:8200198"
     mRNA            complement(<459104..>460012)
                     /locus_tag="PAS_chr3_0227"
                     /product="Primary component of eisosomes"
                     /transcript_id="XM_002492395.1"
                     /db_xref="GeneID:8200198"
     CDS             complement(459104..460012)
                     /locus_tag="PAS_chr3_0227"
                     /codon_start=1
                     /product="Primary component of eisosomes"
                     /protein_id="XP_002492440.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0227"
                     /db_xref="EnsemblGenomes-Tr:CAY70242"
                     /db_xref="GeneID:8200198"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:C4R3X5"
                     /translation="MHRTYSLRSGRAPTAADVNNPPPPTSTTKSKFFGKNSIASSLRK
                     NAAGAFGPELSKKLAQLIKIEKNLERSIELVARERRTVAKQLSLWGEENDDDVSDVTD
                     KLGVLIYEIGELEDQFVDKYDQYRITLKSIRNIESSVQPSRDRKQKITDEIAHLKYKD
                     PQSPKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAFNYQFDALAELSEKLALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAENALSSWTQDNAAVRPSLSIRN
                     SEYDEEPNEEWEEKEEGDETRDETQA"
     gene            complement(<460386..>461516)
                     /locus_tag="PAS_chr3_0228"
                     /db_xref="GeneID:8199977"
     mRNA            complement(<460386..>461516)
                     /locus_tag="PAS_chr3_0228"
                     /product="Catalytic subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex"
                     /transcript_id="XM_002492396.1"
                     /db_xref="GeneID:8199977"
     CDS             complement(460386..461516)
                     /locus_tag="PAS_chr3_0228"
                     /codon_start=1
                     /product="Catalytic subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex"
                     /protein_id="XP_002492441.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0228"
                     /db_xref="EnsemblGenomes-Tr:CAY70244"
                     /db_xref="GeneID:8199977"
                     /db_xref="GOA:C4R3X6"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="UniProtKB/TrEMBL:C4R3X6"
                     /translation="MTDLSSLDPNIYTSSSNEALSISLAGNGKAVSFHPDFTYPIFGD
                     AEQIFGYKDLVIHLVFDSMSLYPFLNVRYSEKRDDADEVESKLLELLPEETVVKDEAL
                     WQDKIDGENFEIPGEILSTYTHKDENYHVYKLSINKCAESLQLHRRMQIFVLFFIEAG
                     SYIDAKDDMWEIYVVYKEDKTFIGFATGYSYWKYPGHEIFDSDAKYLWRKKISQFVIL
                     PPYQGQSHGSQLYKTIFEQWFKDDQVAEITVEDPSEAFDDLRDRCDLERLYQRGLLET
                     LPEPVISPEWFQTQQAKEKIEKRQFQRCVEMLLLHALKSKKNTRLQIKKRLFIKNRDA
                     LLDLDEATRKDKLQVAYERLEEDYQRILEKVRFVKKRPHQDT"
     gene            <461789..>462604
                     /locus_tag="PAS_chr3_0229"
                     /db_xref="GeneID:8199978"
     mRNA            <461789..>462604
                     /locus_tag="PAS_chr3_0229"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002492397.1"
                     /db_xref="GeneID:8199978"
     CDS             461789..462604
                     /locus_tag="PAS_chr3_0229"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002492442.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0229"
                     /db_xref="EnsemblGenomes-Tr:CAY70246"
                     /db_xref="GeneID:8199978"
                     /db_xref="UniProtKB/TrEMBL:C4R3X7"
                     /translation="MPPPQPKRQGLLQLAKSAQLYWFLGHAFAILFTALTFATSFFRS
                     PFSDTPLGFYKNALNAIIITYVIVLRQVHKGKPVTMIISQLRSLLKESNVQYLLLALV
                     FRLTATDPGPVFGGLYPFTIYSLFHFLNYLDTTLLATLPVSNADQVRNLIRMFVSSYN
                     EKSMYLAASCELFLVPSLLLSSLKSIILLEWYRAPFSFIRQLIVVFSVISFLRLRYQQ
                     NVYMKQLVDSYDLKISQLLYHPQLPQGFRLGYLRFKSLLTSTLGYLELEKKTR"
     gene            <463134..>465107
                     /locus_tag="PAS_chr3_0230"
                     /db_xref="GeneID:8199979"
     mRNA            <463134..>465107
                     /locus_tag="PAS_chr3_0230"
                     /product="ATPase involved in protein folding and the
                     response to stress"
                     /transcript_id="XM_002492398.1"
                     /db_xref="GeneID:8199979"
     CDS             463134..465107
                     /locus_tag="PAS_chr3_0230"
                     /codon_start=1
                     /product="ATPase involved in protein folding and the
                     response to stress"
                     /protein_id="XP_002492443.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0230"
                     /db_xref="EnsemblGenomes-Tr:CAY70247"
                     /db_xref="GeneID:8199979"
                     /db_xref="GOA:C4R3X8"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C4R3X8"
                     /translation="MGKSIGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSFVAFTD
                     TERLIGDAAKNQAAMNPANTVFDAKRLIGRKFDDPETQADIKHFPFKVINKGGKPNIQ
                     VEFKGETKVFSPEEISSMVLTKMKDTAEQYLGEKINDAVVTVPAYFNDSQRQATKDAG
                     LIAGLNVQRIINEPTAAAIAYGLDKKDAGHGEHNILIFDLGGGTFDVSLLSIDEGIFE
                     VKATAGDTHLGGEDFDNRLVNHFIAEFKRKTKKDLSTNQRSLRRLRTACERAKRTLSS
                     SAQTSIEIDSLFEGIDFYTSITRARFEELCADLFRSTIEPVERVLKDSKLDKSQVHEI
                     VLVGGSTRIPKVQKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILSGDTSSKTQDLL
                     LLDVAPLSLGIETAGGIMTKLIPRNSTIPAKKSEIFSTYADNQPGVLIQVFEGERTRT
                     KDNNLLGKFELSGIPPAPRGVPQIEVTFDMDANGILNVSAVEKGTGKTQKITITNDKG
                     RLSKEDIERMVSEAEKFKDEDEKEAERVAAKNGLESYAYSLKNSAAESGFKDKVGEDD
                     LAKLNKSVEETISWLDESQSASTDEYKDRQKELEEVANPIMSKFYGAAGGAPGGAPGG
                     FPGGFPGGAGAAGGAPGGAAPGGDSGPTVEEVD"
     gene            <465380..>465991
                     /locus_tag="PAS_chr3_1167"
                     /db_xref="GeneID:8199980"
     mRNA            <465380..>465991
                     /locus_tag="PAS_chr3_1167"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492399.1"
                     /db_xref="GeneID:8199980"
     CDS             465380..465991
                     /locus_tag="PAS_chr3_1167"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492444.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1167"
                     /db_xref="EnsemblGenomes-Tr:CAY70249"
                     /db_xref="GeneID:8199980"
                     /db_xref="GOA:C4R3X9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R3X9"
                     /translation="MNSEYDYLFKLLLIGDSGVGKSCLLLRFAEDTYTQDYISTIGVD
                     FKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVNQW
                     LQEIDRYATGGVMKLLVGNKSDLKDKKVVDYTVAKEFADALEIPLIETSALDSTNVEQ
                     AFFNMARQIKSQMVNNQAGSGTEKASINLRGQSVGGSQNSSCC"
     gene            <466178..>466732
                     /locus_tag="PAS_chr3_1168"
                     /db_xref="GeneID:8200199"
     mRNA            <466178..>466732
                     /locus_tag="PAS_chr3_1168"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492400.1"
                     /db_xref="GeneID:8200199"
     CDS             466178..466732
                     /locus_tag="PAS_chr3_1168"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492445.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1168"
                     /db_xref="EnsemblGenomes-Tr:CAY70251"
                     /db_xref="GeneID:8200199"
                     /db_xref="InterPro:IPR008506"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y0"
                     /translation="MAGNAEKKQATKNTKILKEIHLISLGVNALTLLIIFLLNRPSNK
                     KPFFFFNVPLVICELIVEKIGRPRFTLEKVSGGRTVPKLVSSGEDLSQSGLTEYLFDI
                     IYFTLLQNIVLVILGTNNVWYLSLVIPAFAAYKLYGLFLGGRQLLGGRSSFKEEEPAS
                     GSKEKGQSKRQQKLEKRGQKVRYR"
     gene            <467400..>469127
                     /locus_tag="PAS_chr3_1169"
                     /db_xref="GeneID:8200200"
     mRNA            join(<467400..467409,467749..467762,468021..>469127)
                     /locus_tag="PAS_chr3_1169"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492401.1"
                     /db_xref="GeneID:8200200"
     CDS             join(467400..467409,467749..467762,468021..469127)
                     /locus_tag="PAS_chr3_1169"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492446.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1169"
                     /db_xref="EnsemblGenomes-Tr:CAY70252"
                     /db_xref="GeneID:8200200"
                     /db_xref="GOA:Q9P4D1"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /translation="MDGEDVAALVIDNGSGMCKAGYAGDDAPHTVFPSVVGRPRHQGV
                     MVGMGQKDSFVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRLAPEEH
                     PVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYASGRTTGIVLDSGDGV
                     THVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYTFSTSAEREIVRDIKEKLC
                     YVALDFDQELQTSSQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLEASGID
                     QTTYNSIMKCDVDVRKELYSNIVMSGGTTMFPGIAERMQKELTALAPSSMKVKISAPP
                     ERKYSVWIGGSILASLGTFQQMWISKQEYDESGPSIVHLKCF"
     gene            complement(<469165..>470121)
                     /locus_tag="PAS_chr3_0231"
                     /db_xref="GeneID:8200201"
     mRNA            complement(<469165..>470121)
                     /locus_tag="PAS_chr3_0231"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492402.1"
                     /db_xref="GeneID:8200201"
     CDS             complement(469165..470121)
                     /locus_tag="PAS_chr3_0231"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492447.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0231"
                     /db_xref="EnsemblGenomes-Tr:CAY70253"
                     /db_xref="GeneID:8200201"
                     /db_xref="GOA:C4R3Y2"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y2"
                     /translation="MTIKKDSNVANSPRVWTTLITNTAYLPGLLNLDYSLKKVGSKYP
                     LVALYTDTFGPEGHAELDARNIPKLRIEYLLPLESKDYSNDTRFYDCWTKLQPFSLVQ
                     FERVVQIDSDMLVVQNMDELMELDLGNYDFAATHACVCNPYKKPHYPSDWIATNCAYS
                     SGNHQQRAKISPHLLEFAEEYNLVGPPATLSLGTCNGGLQVVNPSKERYEKIISALSA
                     PEKTSNYEFADQSLLSDVFRGNWLPLSYKYNALKTLATFHSDLWKPEEVKNIHYIITP
                     KPWDVTSNDEKFQDDTGTFVHWWKINEQRLEAERQVDTTNQS"
     gene            <470570..>472141
                     /locus_tag="PAS_chr3_0232"
                     /db_xref="GeneID:8199981"
     mRNA            <470570..>472141
                     /locus_tag="PAS_chr3_0232"
                     /product="Transcriptional activator"
                     /transcript_id="XM_002492403.1"
                     /db_xref="GeneID:8199981"
     CDS             470570..472141
                     /locus_tag="PAS_chr3_0232"
                     /codon_start=1
                     /product="Transcriptional activator"
                     /protein_id="XP_002492448.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0232"
                     /db_xref="EnsemblGenomes-Tr:CAY70255"
                     /db_xref="GeneID:8199981"
                     /db_xref="GOA:C4R3Y3"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y3"
                     /translation="MVLINGVKYACERCIRGHRVSACTHTDQPLVMIKPKGRPSSQCA
                     FCREQRKLRNHHAKCTCGKKTNTKMKYHENGCACSNDVGTVKLEGHCTCCHPKKKKSP
                     PEKEKLDEQDKTKNPGHKLKTDTKNGDDLFLEQQPINSELVSWDMGLSPSVSTSIMEY
                     PSSTNLLAQVEKSMSSGSAVSGPRQVGMEQLDNFHRVGDDTKHAGEISVPLTEYTQPL
                     LSMDQNLNHLLRDRKLDDALSSASREASRSASRASRRAGDNEETPNTYQNIPYPFSSG
                     GLLEMLNEEKSYKSEIHSSRTASKQQQYPLQPQSTWNSGGNTSTNTNGAASFGPEEVF
                     PLYPLIGPGGTPDYEPYTSPPSNLQANLTGSSHISSKSGTYSSHAPHHHGHHHHHHLM
                     HQFTPYSAPKPANSIHSSSSSVSIGAQVPGSVSPSLSSQRSFRSMDSTDSLVGFQLNN
                     TKTNATLTRLDEEFGDMPMMKPVATVVMDDILAGPSNIGENGNLPGNNETGTLSEEQP
                     DDFFFGLDMGVPLNR"
     gene            <472348..>473124
                     /locus_tag="PAS_chr3_0233"
                     /db_xref="GeneID:8199982"
     mRNA            <472348..>473124
                     /locus_tag="PAS_chr3_0233"
                     /product="Proliferating cell nuclear antigen (PCNA)"
                     /transcript_id="XM_002492404.1"
                     /db_xref="GeneID:8199982"
     CDS             472348..473124
                     /locus_tag="PAS_chr3_0233"
                     /codon_start=1
                     /product="Proliferating cell nuclear antigen (PCNA)"
                     /protein_id="XP_002492449.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0233"
                     /db_xref="EnsemblGenomes-Tr:CAY70256"
                     /db_xref="GeneID:8199982"
                     /db_xref="GOA:C4R3Y4"
                     /db_xref="InterPro:IPR000730"
                     /db_xref="InterPro:IPR022648"
                     /db_xref="InterPro:IPR022649"
                     /db_xref="InterPro:IPR022659"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y4"
                     /translation="MLEGKFEEASLLKKIVEAMKDCVSSCNFNCTENGISVQAVDNSR
                     VLLISLLIEKDTFEEYRCDRNITLGVGLGSLSKIIGNGANSDYLTISADDDADKLNII
                     FEDKVKDKISEYNLKLLDIDADLLDVGPMDTDATITLPSADFAKICKDMKVLSESLQI
                     IVTKDSALFQSVGDIGTGNIVIRPKTDIDHPEESVTISLDKPIDLSFGSKYLSDIIKA
                     TSLSQKVTIKLTDQSPGVFEYKLPSGYLRFYLAPKFDESN"
     gene            complement(<473178..>473702)
                     /locus_tag="PAS_chr3_0234"
                     /db_xref="GeneID:8199983"
     mRNA            complement(<473178..>473702)
                     /locus_tag="PAS_chr3_0234"
                     /product="Catalytic subunit of N-terminal
                     acetyltransferase of the NatC type"
                     /transcript_id="XM_002492405.1"
                     /db_xref="GeneID:8199983"
     CDS             complement(473178..473702)
                     /locus_tag="PAS_chr3_0234"
                     /codon_start=1
                     /product="Catalytic subunit of N-terminal
                     acetyltransferase of the NatC type"
                     /protein_id="XP_002492450.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0234"
                     /db_xref="EnsemblGenomes-Tr:CAY70258"
                     /db_xref="GeneID:8199983"
                     /db_xref="GOA:C4R3Y5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y5"
                     /translation="MISYKHLEFHPEKPTDNNEINQIIELVKVNLSEPYCIYTYRYFL
                     NQCPQLCYIAYDDEKPKGQNIIAVSISKAETHQGVRVRGYLGMIAVDPAYRGKGIAKT
                     LIDKSIDVMIDSYHCDEIVLETEVDNPQALNLYESFGFIRTRRLFRYYLNKNDAYRLV
                     LPLTEKSTIRTYFL"
     gene            complement(<473969..>474811)
                     /locus_tag="PAS_chr3_0235"
                     /db_xref="GeneID:8199984"
     mRNA            complement(<473969..>474811)
                     /locus_tag="PAS_chr3_0235"
                     /product="Zinc-finger protein of unknown function"
                     /transcript_id="XM_002492406.1"
                     /db_xref="GeneID:8199984"
     CDS             complement(473969..474811)
                     /locus_tag="PAS_chr3_0235"
                     /codon_start=1
                     /product="Zinc-finger protein of unknown function"
                     /protein_id="XP_002492451.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0235"
                     /db_xref="EnsemblGenomes-Tr:CAY70260"
                     /db_xref="GeneID:8199984"
                     /db_xref="GOA:C4R3Y6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y6"
                     /translation="MSVMNFHNSTMFMSQQPNNSYQLPPLLPPPLPLAYASAPNHPGH
                     AIPYPINTIPSTHPTTTTTTTIVPPNNNTLTLRGSPPYFDHLPHFKHVLPPISLPIVP
                     PLVPELHPVEVNDQKVRKTKTPRKKRQCPECHLFFSNLATHKSTHLSVMARPHLCPTC
                     HRGFARPNDLIRHKKRHLQDLGENGYKCPFYSFDNKEQGPEKSTTPKCHSKGVFSRCD
                     TYKNHLKALHFEYPTGTKKKDRSSVAGHCKSCYQRFNTLDEWLTNHIEKGQCPNMHLE
                     NLHK"
     gene            complement(<475354..>476346)
                     /locus_tag="PAS_chr3_0236"
                     /db_xref="GeneID:8199985"
     mRNA            complement(<475354..>476346)
                     /locus_tag="PAS_chr3_0236"
                     /product="Elongase"
                     /transcript_id="XM_002492407.1"
                     /db_xref="GeneID:8199985"
     CDS             complement(475354..476346)
                     /locus_tag="PAS_chr3_0236"
                     /codon_start=1
                     /product="Elongase"
                     /protein_id="XP_002492452.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0236"
                     /db_xref="EnsemblGenomes-Tr:CAY70261"
                     /db_xref="GeneID:8199985"
                     /db_xref="GOA:C4R3Y7"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y7"
                     /translation="MSDINTLSQKIPSYVQYGIPSIDHPFGIRLWPIFSHFFEAVVGY
                     PAEDFRFIQGLTTMANLKDALGVIAVYYFVIFGGQWLMRTLNARPFKLNFLFQLHNLV
                     LTGASFTLLILIVEQLIPGIYRHGIFWAICHKDSFTNELVTLYYLNYLIKYVELIDTV
                     FLVLKRKKLLFLHTYHHGATALLCYTQLLGHTAVEWVPIALNLAVHVVLYWYYFLSAR
                     GIRVWWKQWVTRFQIIQFLIDLGFVYFATYTFYADKYFPELPNMGTCYGTEEAAAFGY
                     LILTSYLVLFILFYIRVYKSGPTTSKGKSKAAATTGQKTETASPSGKSTSVRRA"
     gene            <481331..>481917
                     /locus_tag="PAS_chr3_0238"
                     /db_xref="GeneID:8199986"
     mRNA            join(<481331..481336,481396..>481917)
                     /locus_tag="PAS_chr3_0238"
                     /product="Subunit of the ARP2/3 complex"
                     /transcript_id="XM_002492408.1"
                     /db_xref="GeneID:8199986"
     CDS             join(481331..481336,481396..481917)
                     /locus_tag="PAS_chr3_0238"
                     /codon_start=1
                     /product="Subunit of the ARP2/3 complex"
                     /protein_id="XP_002492453.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0238"
                     /db_xref="EnsemblGenomes-Tr:CAY70263"
                     /db_xref="GeneID:8199986"
                     /db_xref="GOA:C4R3Y8"
                     /db_xref="InterPro:IPR007204"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y8"
                     /translation="MPAYHSTFLNESSDFRVVGNTSILPIKTKFRGPAYPSNSDYDII
                     DECLDLFRANSFFKNFEIKGPADRLLIYGILFISSCLQQLKSNTTKNEAVRILSNLSL
                     DDFSIPGDVGFPLNSLYQPPRDKTEADLLRGYVQQFRQELATRLIERLYSESDSKPSK
                     YWLAFTRRRFMNKSL"
     gene            <482144..>483025
                     /locus_tag="PAS_chr3_0239"
                     /db_xref="GeneID:8199987"
     mRNA            <482144..>483025
                     /locus_tag="PAS_chr3_0239"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492409.1"
                     /db_xref="GeneID:8199987"
     CDS             482144..483025
                     /locus_tag="PAS_chr3_0239"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492454.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0239"
                     /db_xref="EnsemblGenomes-Tr:CAY70264"
                     /db_xref="GeneID:8199987"
                     /db_xref="UniProtKB/TrEMBL:C4R3Y9"
                     /translation="MSTPITPPHPNANSEVDLTNIREIPRELENELQLNPDLSDDEEE
                     PIKIEQDKSFKEEDVYKSDTFKQDLTEELVLDFKLPSGLGPALSLTQQSRFISFVDDK
                     LLQIQRNFIKYLSEEDSTYTLSQLIRQINETISILWYSIFRVEQIPVVFHSAILGRNS
                     TSLNHASSVDLFGQPHYFIRIIGDLIDYVEKFPLSSVDELRELLALVAKLDNVVIVLV
                     DQDTVSTPSAKKDFIDKTEKVRLLSLATRFKLLLLSKYEELKTVRHPITAEFNIWPEY
                     DQLVGQVYEGIIDRTSI"
     gene            <483172..>483882
                     /locus_tag="PAS_chr3_1170"
                     /db_xref="GeneID:8199988"
     mRNA            <483172..>483882
                     /locus_tag="PAS_chr3_1170"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492410.1"
                     /db_xref="GeneID:8199988"
     CDS             483172..483882
                     /locus_tag="PAS_chr3_1170"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492455.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1170"
                     /db_xref="EnsemblGenomes-Tr:CAY70266"
                     /db_xref="GeneID:8199988"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z0"
                     /translation="MVWPFTSKKIQTRDEFRIPNDLDELLKQEEPTLSEREFKSNLKH
                     LSELTNHRPIDPNPTLVPKDSTAEEQSEILPSEPKDKIFTVKTALFENGPLLPDSRQD
                     PKPLTQEQLKNARELSQYKRENPLHASVLVNCAELQLAFLNCLTDGKFAERMRGCNVK
                     NNFYQSCLTKQSMIFKFFDYNSMTSIREFEEIKYVADSLFTKYYQCYDDLFEEEKNEK
                     FTKELRAKREEFHSKFGK"
     gene            <484244..>485623
                     /locus_tag="PAS_chr3_0240"
                     /db_xref="GeneID:8200202"
     mRNA            <484244..>485623
                     /locus_tag="PAS_chr3_0240"
                     /product="Essential protein required for biogenesis of 40S
                     (small) ribosomal subunit"
                     /transcript_id="XM_002492411.1"
                     /db_xref="GeneID:8200202"
     CDS             484244..485623
                     /locus_tag="PAS_chr3_0240"
                     /codon_start=1
                     /product="Essential protein required for biogenesis of 40S
                     (small) ribosomal subunit"
                     /protein_id="XP_002492456.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0240"
                     /db_xref="EnsemblGenomes-Tr:CAY70267"
                     /db_xref="GeneID:8200202"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007287"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z1"
                     /translation="MKIKTISRSSDAYVPVRNTEESAIPRNLNPALHPFERAREYTKA
                     LTATKLERMFAQPFIGQLGKSHRDGVYTLAKNFKIVNRVASGSGDGVIKYWDLTSRDE
                     IVSFKAHYGMVSGLCVTPSQKLLSCGDDKTIKMWNINNETMYGQNLTDDQETKVSSQG
                     LVKTYLGEHSFKTIDHHRENDVFVTGGRRINLWDVNRKSPVSDLSWGADNIVSVKFNM
                     SETSVIASTGSDNSIVLYDIRTNSPTQKVRTSMRSNALCWNPIEPFSFVSASEDHNCY
                     LWDMRNLSRSSNIYKDHVSAVMDVDFSPTGQELVTGSYDKTIRIYETTKGHSRDIYHT
                     KRMQHVFVTKFSMDSKYILSGSDDGNVRLWRSRASERSGVKSSRLKTRLHYDDKLKEK
                     FAALPEVRRIARHRHLSQVIKSAQEIKRTELQSLKRREENERKHSKPGTVVTKPEKEK
                     HIVGTVHKK"
     gene            complement(<485768..>486904)
                     /locus_tag="PAS_chr3_0241"
                     /db_xref="GeneID:8199989"
     mRNA            complement(<485768..>486904)
                     /locus_tag="PAS_chr3_0241"
                     /product="Plasma membrane associated protein phosphatase
                     involved in the general stress response"
                     /transcript_id="XM_002492412.1"
                     /db_xref="GeneID:8199989"
     CDS             complement(485768..486904)
                     /locus_tag="PAS_chr3_0241"
                     /codon_start=1
                     /product="Plasma membrane associated protein phosphatase
                     involved in the general stress response"
                     /protein_id="XP_002492457.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0241"
                     /db_xref="EnsemblGenomes-Tr:CAY70269"
                     /db_xref="GeneID:8199989"
                     /db_xref="GOA:C4R3Z2"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z2"
                     /translation="MSFFSFLCCSSPSNDRKLKSEITYSKPLSSTQKNLRKTLERDNM
                     NIRGKPAGPSKPTQKATLVVAARSDDNKSSESKETVTIKESSSSSGETNNAHTDQDGD
                     LVMKGSEPFSNSSSPKFSSGKLPTVESDTVNQEYEHDLDNEHNKTINENEANPLSNIS
                     SNSELPVLNNDEFDYLSNELDLTEIQPGQVVASSGWLLNPAPSNLKKRKCLILDLDET
                     LVHSSFKYIRQCDFVIPVEIENQVHNVYVIKRPGVDQFLKRCGELYEVVVFTASVSRY
                     GDPLLDILDQHKSIHHRLFRESCYNYQGNYIKNLSQIGRPLEDLIIIDNSPASYIFHP
                     QHSVPVSSWFSDTHDSELIDLLPFLEDLARDKVDNVSLVLDVNI"
     gene            complement(<487726..>490017)
                     /locus_tag="PAS_chr3_0242"
                     /db_xref="GeneID:8199990"
     mRNA            complement(<487726..>490017)
                     /locus_tag="PAS_chr3_0242"
                     /product="Topoisomerase I"
                     /transcript_id="XM_002492413.1"
                     /db_xref="GeneID:8199990"
     CDS             complement(487726..490017)
                     /locus_tag="PAS_chr3_0242"
                     /codon_start=1
                     /product="Topoisomerase I"
                     /protein_id="XP_002492458.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0242"
                     /db_xref="EnsemblGenomes-Tr:CAY70271"
                     /db_xref="GeneID:8199990"
                     /db_xref="GOA:C4R3Z3"
                     /db_xref="InterPro:IPR001631"
                     /db_xref="InterPro:IPR008336"
                     /db_xref="InterPro:IPR011010"
                     /db_xref="InterPro:IPR013030"
                     /db_xref="InterPro:IPR013034"
                     /db_xref="InterPro:IPR013499"
                     /db_xref="InterPro:IPR013500"
                     /db_xref="InterPro:IPR014711"
                     /db_xref="InterPro:IPR014727"
                     /db_xref="InterPro:IPR018521"
                     /db_xref="InterPro:IPR025834"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z3"
                     /translation="MATEKRQSTPALSESHDGFSVTESLSNTDDTSMKDETSDSPVPP
                     VSPIKTKSHKRKTSDESEKKRKKKKTEKHKHKHKSGTKKESDDDLETVKTSKEKKKRV
                     KKEETPLDSQSSQAIEMKDEEEEKYKWWEENNDNDEIKWHSLKHNGVLFPPEHVPLPS
                     HVKLYYDKKPVDLPIQAEEVACFFGAMLNTEHAQNPAFQNNFFSDFKKIVLEHGGANV
                     EIESFDKCDFSKIFDHYETQKSLKKSLTAAQKREIKSEKDKFEEKYKYCLLNGRRERV
                     GNFRIEPPGLFRGRGSHPKTGRVKKRIYPEDVSLNLSEDAPIPPPPEGHQWKEIKHDN
                     TVAWLATWRENVTNTVKYVLFAADSSLKGRSDFKKFEKARELKKYIHRIRKDYKKNFS
                     SKVMLERQMAVATYLIDVFALRAGGEKAEDEADTVGCCSLRYEHVTLKPPNTVVFDFL
                     GKDSIRYYQEVNVHEKVFKNLRLFKKSPKQPGDDLFDRLTPNILNKHLQNYLPGLSAK
                     VFRTYNASKTMQDQLDLIPNEGSVGEKVVKYNAANREVAILCNHQRTKPKSHDMGVQR
                     ISDNIRELFWQKLRLKRMILELDKSLKKTKPYYFEELDDLSVEEEQAIQDRVIAKERE
                     KATKKFTRDNEKLKTEDSPLLPEAMLEEKLKKIDELAAEYKKELKTRKPEIKSVTVTV
                     EKLESQVEKLEQRIRNATLLLQDKEDNSQVALGTSKLNYIDPRLTAMFSKKYDVPIEK
                     LFSKTLREKFAWAIESADENWTF"
     gene            <490478..>492508
                     /locus_tag="PAS_chr3_0243"
                     /db_xref="GeneID:8199991"
     mRNA            <490478..>492508
                     /locus_tag="PAS_chr3_0243"
                     /product="Polo-like kinase with similarity to Xenopus Plx1
                     and S. pombe Plo1p"
                     /transcript_id="XM_002492414.1"
                     /db_xref="GeneID:8199991"
     CDS             490478..492508
                     /locus_tag="PAS_chr3_0243"
                     /codon_start=1
                     /product="Polo-like kinase with similarity to Xenopus Plx1
                     and S. pombe Plo1p"
                     /protein_id="XP_002492459.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0243"
                     /db_xref="EnsemblGenomes-Tr:CAY70273"
                     /db_xref="GeneID:8199991"
                     /db_xref="GOA:C4R3Z4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000959"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z4"
                     /translation="MASARGSLPLQSLNNGQINSRSNAFNVQTPIKTGPLKPPGPAAT
                     ANQIAQQQDQKKKKKKEKLSSLCKTPPSIVRTRTGIGYHRGLFLGEGGFARCFQMKDE
                     SGKLFAAKTVAKASIKSEKTKTKLLSEIKIHKSMVHPNIVRFIDCFEDDVNVYILLEM
                     CPNQSLMELLKTRKALTEPEVRFIMVQIIGAVKYLHSRRVIHRDLKLGNIFFDPDMNL
                     KIGDFGLASVLPSKGSRKYTICGTPNYIAPEVLGGKAVGHSFEVDVWAIGIMMYALLF
                     GKPPFQSKDVQVIYEKIKKNDYIFNPTKDVSYQAKVLIKDILATNPLERPSLDEILEY
                     SWFRNGSFPSSFTVESLTQTPRNVMDISKEESAKNLAAAKAKAGFNEWHRNPVQILKS
                     DLESERPKALLPTSLSPSNVKQKYEEVSPVIASRETRPKTKIEQVSKIINNHPILLEK
                     LNHNITSTLENMQTIQEYIRTGNSVKQFIDIDHERPVLVSKWVDYSNKHGFSYQLSTN
                     DIGVLFNNGSTVLKISDEESLWHIIIDNSYGWTAHRYLAHDIPTRLKKEIEVVDFFSK
                     YMKANLCEVSEHSGKNVNDDVFLRRYTREDHCIMFELSNGSFQFNFKDHHKLCLSSNG
                     LVITHLSPHRTIETYPLAQVLEKGDFPGASDPMFAVKWEYMIASLRNKLEMQ"
     gene            complement(<492700..>493115)
                     /locus_tag="PAS_chr3_0244"
                     /db_xref="GeneID:8199992"
     mRNA            complement(join(<492700..493003,493063..>493115))
                     /locus_tag="PAS_chr3_0244"
                     /product="RNA polymerase II subunit B12.5"
                     /transcript_id="XM_002492415.1"
                     /db_xref="GeneID:8199992"
     CDS             complement(join(492700..493003,493063..493115))
                     /locus_tag="PAS_chr3_0244"
                     /codon_start=1
                     /product="RNA polymerase II subunit B12.5"
                     /protein_id="XP_002492460.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0244"
                     /db_xref="EnsemblGenomes-Tr:CAY70274"
                     /db_xref="GeneID:8199992"
                     /db_xref="GOA:C4R3Z5"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z5"
                     /translation="MNAPDRFELFILPDDVPKLKITPDSRVPNCIIIKFEREDHTLAN
                     LLREELALYPDVTFVAYKVEHPLFANFVMRLQTEEGTRPKQALERACASIINKLKTLD
                     HKFNEEWNIKNFSLND"
     gene            <493629..>498158
                     /locus_tag="PAS_chr3_0245"
                     /db_xref="GeneID:8199993"
     mRNA            join(<493629..493705,493809..494010,494088..>498158)
                     /locus_tag="PAS_chr3_0245"
                     /product="Component of the Sin3p-Rpd3p histone deacetylase
                     complex"
                     /transcript_id="XM_002492416.1"
                     /db_xref="GeneID:8199993"
     CDS             join(493629..493705,493809..494010,494088..498158)
                     /locus_tag="PAS_chr3_0245"
                     /codon_start=1
                     /product="Component of the Sin3p-Rpd3p histone deacetylase
                     complex"
                     /protein_id="XP_002492461.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0245"
                     /db_xref="EnsemblGenomes-Tr:CAY70276"
                     /db_xref="GeneID:8199993"
                     /db_xref="GOA:C4R3Z6"
                     /db_xref="InterPro:IPR003822"
                     /db_xref="InterPro:IPR013194"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z6"
                     /translation="MSGKDTWSSNNNPVKELNKNSIPPFQTPTVLPPPPSSLDKGMFP
                     IRAAAPDELLLTRSGQHYYPLPSLPGLGSGLNNGSHFPIPSIGPQGLSQEKDSNNNGA
                     TTLPPPHLGSQQSPVLSQPQPQSQSQADSNPQPQQLPPPTALHASANQYRPLNVKDAL
                     SYLDQVKVRFLDQPDVYNHFLEIMKDFKSQSIDTPGVIERVSTLFRGHPNLIQGFNTF
                     LPQGYKIECFVDPLNPNAIRVTTPMGTVTMTDGQSQVSLTQQPHTQLDQSPQSSSTQP
                     KLEQDQQASRLPSQDMLEKQLHQQQEQQHHHQQQQQIPQPHNSSLPQQLQQPQSQYLS
                     HQGPDVAYSQGNLSAEQVQNGAQVGFNHAISYVNKIKTRFANQPDIYKSFLEILQTYQ
                     KEQKPINEVYQQVTVLFQNAPDLLDDFEQFLPETSGQSLNVHQGGYEEKHNGHGTIQL
                     PPVGNFPPPSYGQNGNVINEAPGGKRRSISHGMHRIPSLGAAHFQGQPVGMPHDQQQQ
                     LAQIGQTQEYPVSDLRGPVNTGPASLLMGVPQPVSTGISDSNLSEEISFFDKVKKSIS
                     NKQTYNEFLKLINLYSQDIIDKDVLVAKVECFIGAFPELFSWFKTFVGYEEKSLHIEN
                     ITFKKHQLELSLCKSCGPSYRLLPKAETYMPCSGRDDMCWEVLNDEWVGHPTWASEES
                     GFVAHRKNQYEEVLFRIEEERHEYDYYMEANLRTIQTLETIANRIANMTPEEKAHFKL
                     PPGLGHTSSTIYKKVIRKIYDKDRGFEVIDALHENPAVAVPIILKRLKQKDEEWKRSH
                     REWNKVWREMEQKVFYKSLDHLGLTFKQSDKKLLTTKQLVAEVSTIKVEQSQKRLHPL
                     TPVSKEQLQYHYKDYDVMFDIINLVYIFLGHSSSYSQQDKKKLAEFVKFFVTTFFMLP
                     NEQVDDALQRRKTKEADAEAENGDSNSASLADDEGNLSSASTESSFSSKKRPRNDGDL
                     LRDVLKKNKKVVREATPDSTTASPTPETYSTQADVEEKLAKPTEDWINVSGHLGEPIF
                     DQTKERTVYNMFCNTTIYVLYRYLNVLYERLVEVKAMTKDVDADIKGRNEVQFAKELD
                     LLSHQLEDMGINITGDNSYLQVLELSKKLIEGDVEHQWFEESLRQAYRNKAYKLFSID
                     KVIQGLTKHMHSVVSDAKNSEMITLMAADRENSNTTARSQILYRIQVRSLMSPEDNMF
                     KISFDKSQDRTQITFIALEDLTLGDLKSERDKWNYYMTSYILSQPTESVPKSKINIPF
                     LRSAIAAEDDEKSSDIQGIANSNLKVKLDLNTYKLFFEEGSYDYFVKSSALKPQPASK
                     KDNQEKLQHLQSLLKSGDKSAKLLETLAKGPDEYKAFVSQLSTSEVSNTTQGGSKGDA
                     LKHSEITVDAESTIGQDDSLQEDVFKTAVDISVDQDKTVDQSTLSEAKADNDTIPNEE
                     EQDTQMEEGKVSR"
     gene            complement(<498257..>499447)
                     /locus_tag="PAS_chr3_0246"
                     /db_xref="GeneID:8200075"
     mRNA            complement(<498257..>499447)
                     /locus_tag="PAS_chr3_0246"
                     /product="Palmitoyltransferase with autoacylation
                     activity"
                     /transcript_id="XM_002492417.1"
                     /db_xref="GeneID:8200075"
     CDS             complement(498257..499447)
                     /locus_tag="PAS_chr3_0246"
                     /codon_start=1
                     /product="Palmitoyltransferase with autoacylation
                     activity"
                     /protein_id="XP_002492462.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0246"
                     /db_xref="EnsemblGenomes-Tr:CAY70278"
                     /db_xref="GeneID:8200075"
                     /db_xref="GOA:C4R3Z7"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z7"
                     /translation="MAVQLKWPWLGIAIPCFLISFIGYNAHYFIFTNYMTKRNQWWFQ
                     FYLTMVWISYYLAIKKSPGTPPPNFQPEPNEWRKWCRKCNNYKPERSHHCKTCKICVL
                     VMDHHCPWTANCVGYQNMPHFIRFLGWVVFTTSYVLLQICKRFYFFYQNRNLPSYLFK
                     KTEIVFAVILFFMDTLVLVTVSALLFRTLYHITFTGMTTIESWEHERLEDQFYTNRLW
                     RKIAYNYYQFHKKKLPALKSWTNITGKNDERLDSMSNELAETECPTSPEYQFDDDENL
                     VPDQFTIDDIIFPYDTGYWSNLTNTLGPIYEWVLPWGCPHGTGYYFSKSDFYQDDQLT
                     IPWPIDGNHTLKPDQDSKDTATSSSYQLSPYKLDDEPSPRNTDWSNDFGERMDDFGVD
                     TDVE"
     gene            <499558..>500937
                     /locus_tag="PAS_chr3_0247"
                     /db_xref="GeneID:8200076"
     mRNA            <499558..>500937
                     /locus_tag="PAS_chr3_0247"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492418.1"
                     /db_xref="GeneID:8200076"
     CDS             499558..500937
                     /locus_tag="PAS_chr3_0247"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492463.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0247"
                     /db_xref="EnsemblGenomes-Tr:CAY70280"
                     /db_xref="GeneID:8200076"
                     /db_xref="InterPro:IPR018812"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z8"
                     /translation="MLCEYENDPKLEFNAHERDVLSEIVVNENNSQESLVTTKEKIRA
                     HQSTEYELDTFSVKLYEDKINLASKIGRPVLDPISRWDFDVEELPYAPIVKIIDFYEF
                     DGTLFKSPVLNDELFRRSSIHMIESGAGLRDIDWWNFHEAWSCYTNESVRDNKKWKDC
                     WSLPIRELMKSSKQSDTTVCVLICSLRDAEMYNDLREVLASEDIAADAIITRPKHIPT
                     ADFKKIVVLDFLHYYSMCQEVNIYDWDKEFLTSMDQLFLKWSNNGDSMIDGTTVITPR
                     LYSHLDPLIERQLVENLIDEHNRRLVEFQDQNLDCLTVRQSLLGTVYFLTQTTRIEVL
                     KHCIENQKDFLPDDTDSLVFECEEIYISLNNSQSAIKALGGIGAQIRFGVSHYGSFDD
                     QFYALKLLGDKELPSLTKSPILLIARHTDAIVKPLDCDKITNWQVMDDLLLVNTVVGN
                     KGYLKVKKM"
     gene            <501008..>502189
                     /locus_tag="PAS_chr3_0248"
                     /db_xref="GeneID:8200077"
     mRNA            <501008..>502189
                     /locus_tag="PAS_chr3_0248"
                     /product="Component of the chromatin assembly complex
                     (with Rlf2p and Msi1p)"
                     /transcript_id="XM_002492419.1"
                     /db_xref="GeneID:8200077"
     CDS             501008..502189
                     /locus_tag="PAS_chr3_0248"
                     /codon_start=1
                     /product="Component of the chromatin assembly complex
                     (with Rlf2p and Msi1p)"
                     /protein_id="XP_002492464.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0248"
                     /db_xref="EnsemblGenomes-Tr:CAY70281"
                     /db_xref="GeneID:8200077"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R3Z9"
                     /translation="MRWIKAKTLTVHWHDDNQPVYSCDLQQDKVEGFRRLATAGGDGN
                     VRIWRLIYGREDNEDRESVSSVEYLSTLAKHTQAVNCVRFDPTGEYLASGGDDGVVLI
                     WRLSSEGGVVLEFGQDDDDIKESWIQKITCRCNTSEIYDLCWSPDSKYILAGSMDSTV
                     RLFEASTGKQVATIGDHNHYVQGVAWDPLNEFVVSQSADRTICVNRVTASTSGEISVK
                     SMAKLSRLELANSGDSNKRTIALYHNETLQSFFRRMAFSPDGNILATPAGIFKSSDDS
                     PESHTVYLYGRGSLSQAPIAHLPGLKKPAVAVRFSPVKLDLIPGLPDESVFSLPYRML
                     LAVATQDSVVIYDTQQTGPLALVTNIHYAIITDLTWSSDGKTLIVASADGFCSSVGID
                     V"
     gene            <502293..>502766
                     /locus_tag="PAS_chr3_0249"
                     /db_xref="GeneID:8200078"
     mRNA            <502293..>502766
                     /locus_tag="PAS_chr3_0249"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492420.1"
                     /db_xref="GeneID:8200078"
     CDS             502293..502766
                     /locus_tag="PAS_chr3_0249"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492465.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0249"
                     /db_xref="EnsemblGenomes-Tr:CAY70283"
                     /db_xref="GeneID:8200078"
                     /db_xref="UniProtKB/TrEMBL:C4R400"
                     /translation="MVDNSTIAFAVSLVAAFVFLRVFVRPPELIESRDAELKIKEAIE
                     SRKRTATTADSKRDVSEGMVEVVKTVVPQAKDADVREVLNKTRSVERAVELLLEQVRE
                     AKPEKSGMKEAEQKPEPVKLQNPGWADTKEERARNMELKRKQMIEQARKRCQSQG"
     gene            complement(<502831..>503307)
                     /locus_tag="PAS_chr3_0250"
                     /db_xref="GeneID:8200079"
     mRNA            complement(<502831..>503307)
                     /locus_tag="PAS_chr3_0250"
                     /product="Subunit of a histone deacetylase complex"
                     /transcript_id="XM_002492421.1"
                     /db_xref="GeneID:8200079"
     CDS             complement(502831..503307)
                     /locus_tag="PAS_chr3_0250"
                     /codon_start=1
                     /product="Subunit of a histone deacetylase complex"
                     /protein_id="XP_002492466.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0250"
                     /db_xref="EnsemblGenomes-Tr:CAY70284"
                     /db_xref="GeneID:8200079"
                     /db_xref="InterPro:IPR024145"
                     /db_xref="InterPro:IPR025718"
                     /db_xref="UniProtKB/TrEMBL:C4R401"
                     /translation="MPPRRDASASESESRRPHSSAPKQTKSRSHITQQVQKEFVAKYV
                     NSNGPNDRILPDPLDFNEYPTSNLRNYARKLIKNEQIPDCKTVFGSMLESKIGEESFS
                     YKKNHAPNTYRISKPQLASIVHQHFVSHLPVKESDTITNFIYKVKNQDKSFKLNIT"
     gene            <504046..>505203
                     /locus_tag="PAS_chr3_0251"
                     /db_xref="GeneID:8200080"
     mRNA            <504046..>505203
                     /locus_tag="PAS_chr3_0251"
                     /product="Putative protein with sequence similarity to S.
                     pombe gti1+ (gluconate transport inducer 1)"
                     /transcript_id="XM_002492422.1"
                     /db_xref="GeneID:8200080"
     CDS             504046..505203
                     /locus_tag="PAS_chr3_0251"
                     /codon_start=1
                     /product="Putative protein with sequence similarity to S.
                     pombe gti1+ (gluconate transport inducer 1)"
                     /protein_id="XP_002492467.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0251"
                     /db_xref="EnsemblGenomes-Tr:CAY70286"
                     /db_xref="GeneID:8200080"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:C4R402"
                     /translation="MQSYHGVIVTPKDAIILVDAALKKMIPQVTRRLTEFERQTQIGH
                     GSVFVWDEKESGMKRWTDGRSWSASRVSGSFLTYKEMENAKSGNSNSYIYGKQSESYR
                     YKDNGLLKQSFSVTLKNGKKLHLISYVYATYLKTLSGPNSSNKSVSSNPMSNSVGTLS
                     GSSSDMTQDGLLKRPSEDDRFQSLDLNSDLYPETVLNETYTLQYPPSSPISSTTSANS
                     GGVSKPKKSKRVASRITDERVISVPKSPSPVSSSTTPSTTAFSTMGGGASSVGSHLST
                     GTAGVLRFPPQNQMMMNHQVITLPALHTPASTLPAYKVPRSYLDDPTPKNTFLLPRSH
                     SITPIPYVQQQQQQYFPPQQPMQHLAPPVRAPGYVSHEDGRALSALDRAFC"
     gene            complement(<505277..>506647)
                     /locus_tag="PAS_chr3_0252"
                     /db_xref="GeneID:8200081"
     mRNA            complement(<505277..>506647)
                     /locus_tag="PAS_chr3_0252"
                     /product="Steryl ester hydrolase"
                     /transcript_id="XM_002492423.1"
                     /db_xref="GeneID:8200081"
     CDS             complement(505277..506647)
                     /locus_tag="PAS_chr3_0252"
                     /codon_start=1
                     /product="Steryl ester hydrolase"
                     /protein_id="XP_002492468.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0252"
                     /db_xref="EnsemblGenomes-Tr:CAY70288"
                     /db_xref="GeneID:8200081"
                     /db_xref="GOA:C4R403"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R403"
                     /translation="MDTPVKSDVEDSMSQTVRGWLVVLPSVLLVLFEGLVSLITANLP
                     KFVLRQCTAVVRFLFGVAGDKGAKLNGDIKSTDYLGRRELLHGALDIHEMAGVFNFTI
                     EDHIVQTDDNYLLTLHRLNPVSHGIRPNGRVLYFHHGLLMNSEIWLCREDVHENLPLH
                     FLLQGYDCWLGNNRGNKYSGKHLKYKPSQREFWDFSIDEFVRFDIPNNVDYILETTGK
                     ETVSYIGFSQGTTQIMAALSVNVALNSKIDKLCVISPATTPRGLNNGLLNSILHFSPN
                     LMYLLFGRNILFAHAGLWAQVMYPKLYLISIDIATNFLFGWKNENMDEADKYVSYYHL
                     YSTTSVKTVVHWFQIMNGARLTMYKDSSSLGANFYTPEYPTRTSLAVPTIIIYGTGDS
                     LVDIDQIRQQLPRKYLKKVVGLEGYEHLDLIWGRRVGDVIKSVGKFLHYNELDGESGK
                     SIIINT"
     gene            complement(<506956..>508527)
                     /locus_tag="PAS_chr3_0253"
                     /db_xref="GeneID:8200082"
     mRNA            complement(<506956..>508527)
                     /locus_tag="PAS_chr3_0253"
                     /product="Acetyl-coA hydrolase"
                     /transcript_id="XM_002492424.1"
                     /db_xref="GeneID:8200082"
     CDS             complement(506956..508527)
                     /locus_tag="PAS_chr3_0253"
                     /codon_start=1
                     /product="Acetyl-coA hydrolase"
                     /protein_id="XP_002492469.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0253"
                     /db_xref="EnsemblGenomes-Tr:CAY70290"
                     /db_xref="GeneID:8200082"
                     /db_xref="GOA:C4R404"
                     /db_xref="InterPro:IPR003702"
                     /db_xref="InterPro:IPR026888"
                     /db_xref="UniProtKB/TrEMBL:C4R404"
                     /translation="MSSILKQRVRYAPYLKKLRTPEQCVELFKDGQYLGWSGFTGVGA
                     PKVIPTALADHVEKNKLQGKFQFHLFVGASAGPEEGRWAENNMILTRAPHQVGKSISR
                     GINENRIQFFDKHLSMFPQDLTYGFYTKEKENDLLDYTIIEATAITEDGSIIPGPAVG
                     GSPEMLSVSDKVIIEVNTKTPSFEGIHDIDLPVNPPLRQPYPYTSVDQRNGRVAIPVD
                     PSKVVAIVESTENDKVPPNTPSDAMSKAIADNLLEFLEHEVKAGRLPENLHPLQSGIG
                     NVANAIIEGLAGGNFKNLSVWTEVLQDSFLDFFESGKLDFATATSIRLTESGFERLFE
                     NWDTYSHKLCLRSQVVSNSPEIIRRLGVIAMNTPVEVDIYGHANSTNVLGSRMLNGLG
                     GSADFLRNAKLSIMHTPAARPSKTDPTGVSCIVPFASHVDQTEHDLDVVVTDYGLADL
                     RGLAPKKRAQEIIKNCAHPDYVPILQEYYDRANFYCQKKKSLHEPHILRDALKMHLNF
                     EDFGTMKIDNWDKKF"
     gene            complement(<509330..>510640)
                     /locus_tag="PAS_chr3_1171"
                     /db_xref="GeneID:8200083"
     mRNA            complement(<509330..>510640)
                     /locus_tag="PAS_chr3_1171"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492425.1"
                     /db_xref="GeneID:8200083"
     CDS             complement(509330..510640)
                     /locus_tag="PAS_chr3_1171"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492470.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1171"
                     /db_xref="EnsemblGenomes-Tr:CAY70291"
                     /db_xref="GeneID:8200083"
                     /db_xref="GOA:C4R405"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R405"
                     /translation="MVSAVEPVPVRVSDRSDDLISEPSSFVFRSLSKEIYNTVHNNQE
                     TVEEEYFCPNLDTDLHHEMAALKKALKQISEKLECLSQGGSTPSRGRPISRFQETSIN
                     FDALVDRIVKKDDQYASYQLQQKLECRNNQELVEIMDSIQRCSLELMVNRFGNFLIQK
                     CFEVLENSLIEGLIITIARNIVQVSTDAFGCHVVQKALEMIQEGHKKFLVEYLLEHLE
                     STLLDSSAEHVWKRVLEIKWAIHPEMEEAITAKLSSTLQSRWLQVATTPRGSLIVQNI
                     LTNLPPTIQKTCLEELERDIPTLLTDRSGNWVIQFILQHFETSEIHQTIFQTILDNSQ
                     LYSTQMYSSKVIQKCLKAERFKSTFIDPYIDAICSTKPSKRRKPGAKPVVIELAVDIY
                     GSGIIRKILVEGSVDEKSRVNGLLQEHMETVCTTKWGSKCAAVL"
     gene            complement(<510816..>511721)
                     /locus_tag="PAS_chr3_0255"
                     /db_xref="GeneID:8200203"
     mRNA            complement(<510816..>511721)
                     /locus_tag="PAS_chr3_0255"
                     /product="Mitochondrial GTP/GDP transporter"
                     /transcript_id="XM_002492426.1"
                     /db_xref="GeneID:8200203"
     CDS             complement(510816..511721)
                     /locus_tag="PAS_chr3_0255"
                     /codon_start=1
                     /product="Mitochondrial GTP/GDP transporter"
                     /protein_id="XP_002492471.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0255"
                     /db_xref="EnsemblGenomes-Tr:CAY70292"
                     /db_xref="GeneID:8200203"
                     /db_xref="GOA:C4R406"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R406"
                     /translation="MSPTPSNADKKQSGVARILGSASAGICEIGVFHPVDTISKRLMS
                     NNTKVTSLSQFNKVIFREHAADPLGRRLLTLFPGLGYAACYKILQRVYKYGGQPFANE
                     FLTTNYRSSFEETFGKKTGKALMSATAGSLIGIGEIVLLPLDVLKIKRQTNPESFKGR
                     GFFKILADEGLGLYRGWGWTAARNAPGSFALFGGNAFAKEYVLGLKDYSDATWGQNFI
                     ASIFGASASLIVSAPLDVIKTRIQNRNFDNPESGFTILKNMAKNEGITAFFKGLTPKL
                     LTTGPKLVFSFALAQTLIPMFDKVL"
     gene            <511989..>513620
                     /locus_tag="PAS_chr3_0256"
                     /db_xref="GeneID:8200084"
     mRNA            <511989..>513620
                     /locus_tag="PAS_chr3_0256"
                     /product="mRNA 3' end processing factor"
                     /transcript_id="XM_002492427.1"
                     /db_xref="GeneID:8200084"
     CDS             511989..513620
                     /locus_tag="PAS_chr3_0256"
                     /codon_start=1
                     /product="mRNA 3' end processing factor"
                     /protein_id="XP_002492472.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0256"
                     /db_xref="EnsemblGenomes-Tr:CAY70293"
                     /db_xref="GeneID:8200084"
                     /db_xref="GOA:C4R407"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR021605"
                     /db_xref="UniProtKB/TrEMBL:C4R407"
                     /translation="MASNSIGEDFYQSLLELTFNSHPIIHSLTTIAQENMANADQIVE
                     AILKRINSSAPEHKLYTLYLIDSICKNVGSPYNLMFGDSLYQLFSRCYSLVADPVRQR
                     MIHIFETWKVTRTPSGSPLFPPDQLAKIDRFLTEVAKPKPVMITQQSLIEQLRQLQGL
                     VGQRLHSNPNDIKAKERLQILGDLLKIITSQPMSPQELTLVNTQVQGIRKDEEFKLKS
                     PTPAAAIPRPALSSDAMSVLGGVLQSVSMAPQYQQQQPKSPPPNILGGNVSSILSSLA
                     ESGLINNINSKHSNNLVSPINDILSSNDLSGSLAIDSGYINNHKPTQTEIDTLYRDKP
                     NQCSSCSKRFTEDDAGRQLKSLHLDWHFRINKRIKDYSNIQSRGYYLDDSAWVKFKEI
                     EIIGYKDSDDQTDSSNNTKISTTGGQSLNTRPAELDPAELARHYVVVPDDVTDMTTSC
                     GICKEEMVGKFNDDSGEWVWSNATQSGDKVYHYSCFRETQQERSLHNVVEKRERSDDS
                     VVSAAKRPETSSIGSSILNIDFSKLRGLTDNLANR"
     gene            complement(<513752..>514507)
                     /locus_tag="PAS_chr3_0257"
                     /db_xref="GeneID:8200085"
     mRNA            complement(<513752..>514507)
                     /locus_tag="PAS_chr3_0257"
                     /product="Adenylate kinase"
                     /transcript_id="XM_002492428.1"
                     /db_xref="GeneID:8200085"
     CDS             complement(513752..514507)
                     /locus_tag="PAS_chr3_0257"
                     /codon_start=1
                     /product="Adenylate kinase"
                     /protein_id="XP_002492473.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0257"
                     /db_xref="EnsemblGenomes-Tr:CAY70294"
                     /db_xref="GeneID:8200085"
                     /db_xref="GOA:C4R408"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006259"
                     /db_xref="InterPro:IPR007862"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028587"
                     /db_xref="UniProtKB/TrEMBL:C4R408"
                     /translation="MSPVEELKEYIHKLQDRVTELEIKAGVLPEPKLPAAIRMVLIGP
                     PGAGKGTQAPNLKEKFCACHLATGDMLRSQVQQKTELGVAAKKIMDQGGLVSDEIMVN
                     MIKAELDSNPECQKGFILDGFPRTIPQAEKLDSMLVESNKPLQKAVELKIDDELLVSR
                     ITGRLVHPASGRSYHREFNPPKKDMTDDITGEPLVQRSDDNADALKKRLVTYHQQTEP
                     IVEYYRKRGIWAGIDASQSPKQVWGDILKCLRN"
     gene            <514810..>516121
                     /locus_tag="PAS_chr3_0258"
                     /db_xref="GeneID:8200086"
     mRNA            join(<514810..514845,514898..>516121)
                     /locus_tag="PAS_chr3_0258"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492429.1"
                     /db_xref="GeneID:8200086"
     CDS             join(514810..514845,514898..516121)
                     /locus_tag="PAS_chr3_0258"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492474.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0258"
                     /db_xref="EnsemblGenomes-Tr:CAY70295"
                     /db_xref="GeneID:8200086"
                     /db_xref="UniProtKB/TrEMBL:C4R409"
                     /translation="MGLFGRSKRKSRETLGFHKPISATDQYYLNQAQQKASDNFNIGQ
                     TQPSRAYSLSGQAASTALYAHNQRQNSLTSYRPPSIIPAYERRTMSLNSGSLRNSQTP
                     RMRMNSITSTTTSVLVKTTKETLQDGSTRSITRQTIQDLGDYEIVQTTRIIPKHVVTA
                     SDNDLEALIGDFDQDFHNEIDYIPEEDEAVEENQGNSNDTSSGYYSVYSDAEEAPTRV
                     IPRSNVPSPRQPIEHSDSITSSNLRKNVKFHAPPQQPKKEMKPKKSVQLTDEEMYSKA
                     MEVAMAKVYGDRLNSMNKRGDATNPAVTATPSLTEQSIDGKHASKEQIKIEADAQASR
                     VQEKKGEPASNGKSDGKFDNSHSDASTGPTTPPASTTPSPASAQRKFFKMGSSSETKR
                     HSSTKSKHPSPQKSQLMRRLLALFDLA"
     gene            <516430..>519183
                     /locus_tag="PAS_chr3_0259"
                     /db_xref="GeneID:8200087"
     mRNA            <516430..>519183
                     /locus_tag="PAS_chr3_0259"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492430.1"
                     /db_xref="GeneID:8200087"
     CDS             516430..519183
                     /locus_tag="PAS_chr3_0259"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492475.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0259"
                     /db_xref="EnsemblGenomes-Tr:CAY70296"
                     /db_xref="GeneID:8200087"
                     /db_xref="GOA:C4R410"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R410"
                     /translation="MGPQKRYICSFCAKAFSRSEHKLRHERSHTKEKPFVCNVCDNSF
                     VRRDLLQRHCRTVHGMLLKENIDAAVNIKQYATGLAESSANDLVEPSPSQNPTLNTPS
                     SVPVGDSFLEKNIISLLTLCKKFSQVSIDLQLDNNISGYLLTYCNNFQFRPEYPSFFK
                     VFDTSSTVNPSPEPFSSHFLTNSSSTSSRFLSLDGNSEFLYLIICLGACEQSQSLDAI
                     KLFNKSWAIIINKISNQLINYNSDNFSEFIENLILLCFIYLNYFANHDFEDIDNHNID
                     HDNINIVLPCPVITLDVLFEYLNNIISTHINNNSSNPLETVEPFYWYAYVLLSKYSFI
                     YNKSPSSLHMFLADKFLPNTQVTMAQLLRNLSVTSLTDQPETIVSQLEYSQDDISKNV
                     FLNNMNLVVNHRISNIEQTLICALLNELQMIKFNDNQIRKSTSKIQHGIFNDSKNFLH
                     NAIILANKSFNNIYNAVSDDPGSSALPSGKETSFNDSVGATAVNIIQENNKGKLEANY
                     PPKVADLMNNNKFVEFVNSLILNKKKLLINCPLKFHDLLFNYLFLPLQDYNWVLLSLT
                     LKDFMYEVESLYNTLTSTSQHVPSENAEFDIAKFCHSSLTVPDIKSNLEKFIFHPFNK
                     MLVVNNNLGLTTLPLLFISLIYNNKQSFASIKSFLSLPSNKLLLLEFIIGNFLLLIRI
                     LVQRRISYSSQVVEDTEEDTPILNVIIYLISELGSGFSAIHNSEGHKNRSYSITIGIL
                     QSQVQQSKSKKSSGSKKYVGSENDLDVSGMTLQQILTNDDLYKFILQNIEKSLINWIS
                     ILVSIQMSTTNLILALNVVMKSIYASAAMEKFNGAANKSPTNFNNNHNNNNALDLATY
                     QTNVQKPVVEHESSAQDLPNKRIRLPPILQSPIPGSKDADYMVNGGNANNGKQDGLLW
                     GFN"
     gene            complement(<519238..>520365)
                     /locus_tag="PAS_chr3_0260"
                     /db_xref="GeneID:8200088"
     mRNA            complement(<519238..>520365)
                     /locus_tag="PAS_chr3_0260"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492431.1"
                     /db_xref="GeneID:8200088"
     CDS             complement(519238..520365)
                     /locus_tag="PAS_chr3_0260"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492476.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0260"
                     /db_xref="EnsemblGenomes-Tr:CAY70297"
                     /db_xref="GeneID:8200088"
                     /db_xref="GOA:C4R411"
                     /db_xref="InterPro:IPR003656"
                     /db_xref="UniProtKB/TrEMBL:C4R411"
                     /translation="MSLPPLINGFDRQTSESVESTLAQALNQYEPSVQLHNTGNAGSK
                     NRQQQQQQPQFVVDKSKQPVMPGASVGGTPSSLSHHNQLVHVNVGDSGPGRSGSNVDD
                     TVSSSPGHGSSTNAGGVVMSRASMHDESQHPRPATTSNITRVRHNRPGMKFGAKKKSW
                     VWDWFVQDSTDPNVAICDQCGRIIRRLPSDKGSPKKLSEHLRTHKIDKDTVIPNRDAL
                     MNNYAANGITTQLNGSNSLTQLTSSSNNGSGYPNVSNSMVSNNQVNNNNNGPRPNVVP
                     VGGLAHVPQHLLSEFDISPYSQMKFHKDIMRFLTEQKLSIDVVKTHAFRQIIFTLRPD
                     AIVDLNDLDHIYSSFMEVLKNNAAAENKKDSRVDGPEHSWL"
     gene            <520684..>521806
                     /locus_tag="PAS_chr3_0261"
                     /db_xref="GeneID:8200089"
     mRNA            join(<520684..520745,520846..>521806)
                     /locus_tag="PAS_chr3_0261"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492432.1"
                     /db_xref="GeneID:8200089"
     CDS             join(520684..520745,520846..521806)
                     /locus_tag="PAS_chr3_0261"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492477.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0261"
                     /db_xref="EnsemblGenomes-Tr:CAY70298"
                     /db_xref="GeneID:8200089"
                     /db_xref="UniProtKB/TrEMBL:C4R412"
                     /translation="MSLKSLKKSDLIQLAQELGLSYSSRDLKEELVENIARHFLEQDE
                     LESNPKYSKFYLSIRKGSPAKKPVVYERIGSEEELEESKKGLQIDGDEGEEDDEDSEI
                     VDEEVEDDDEDEEGGEDNESVDSLQYKVKSLKRTLFGRLEYFKEYLLDSNELVRDVLS
                     TPETVFLIELLFELALIELHYGETIPLYKVSFLPKALKKALPIRVKNLKVFNLQPLLT
                     ISFFQLFVTWFLSSVLVPLIASYYFNFSEYLQGYKYDPVIFGIAKLILTLTVVKSSIT
                     LSDVKDELFNEFNLPSTVLTHTYFAAKSFFLHGSVELRLIFGNVSIVSTLITTFVAFY
                     SVLQYV"
     gene            complement(<521900..>522508)
                     /locus_tag="PAS_chr3_0262"
                     /db_xref="GeneID:8200090"
     mRNA            complement(<521900..>522508)
                     /locus_tag="PAS_chr3_0262"
                     /product="Thymidylate and uridylate kinase"
                     /transcript_id="XM_002492433.1"
                     /db_xref="GeneID:8200090"
     CDS             complement(521900..522508)
                     /locus_tag="PAS_chr3_0262"
                     /codon_start=1
                     /product="Thymidylate and uridylate kinase"
                     /protein_id="XP_002492478.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0262"
                     /db_xref="EnsemblGenomes-Tr:CAY70299"
                     /db_xref="GeneID:8200090"
                     /db_xref="GOA:C4R413"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R413"
                     /translation="MRAPLIVIEGLDRTGKSTQTAKLCHRLNGFLVKFPNRETPIGKL
                     LNQYLTDASNPMPLEVAHLLFSANRWEMVKNIEDLLSKGTPVVMDRYVYSGVAYSMAK
                     GLDIEWCLAPDKGLPKPDVTIFLKANDLDSISQREGFGEERYEVASLQTSVRNNFEIL
                     RSRYDEWKVIIIDGKDIDQVHEHIWELVCPLTRGVTTGLNRF"
     gene            complement(<522531..>523442)
                     /locus_tag="PAS_chr3_1172"
                     /db_xref="GeneID:8200091"
     mRNA            complement(<522531..>523442)
                     /locus_tag="PAS_chr3_1172"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492434.1"
                     /db_xref="GeneID:8200091"
     CDS             complement(522531..523442)
                     /locus_tag="PAS_chr3_1172"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492479.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1172"
                     /db_xref="EnsemblGenomes-Tr:CAY70300"
                     /db_xref="GeneID:8200091"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C4R414"
                     /translation="MYIRKFHSLAALSKQQINHYDILGVPPHASKDEIKKRFRQLSKK
                     YHPDLNTHLEEPDKKANHDKFIQIVNSYEVLSDDSTKTQFDRNRGVNEEQLRKAKRQE
                     FHDRYYGDAKTYSHRPSGYYNTKKNRVHYGEGVRFRGKSQFHGEFNEPSNYDVPHFDY
                     DKHLAKNIAYEKRFTGARGYRGGDLRSHQMTHRSINHGVRKDIFIDKESGWGGVMAGL
                     VISFFGLSFTAWALSTKEARPGQYHREPTQKTTSKVQSSSSQTDSAPSHEFAKSPESP
                     SKSPSEKSPPESNSSNITSTLISRASR"
     gene            complement(<523580..>524389)
                     /locus_tag="PAS_chr3_0263"
                     /db_xref="GeneID:8200204"
     mRNA            complement(<523580..>524389)
                     /locus_tag="PAS_chr3_0263"
                     /product="Mitochondrial outer membrane protein"
                     /transcript_id="XM_002492435.1"
                     /db_xref="GeneID:8200204"
     CDS             complement(523580..524389)
                     /locus_tag="PAS_chr3_0263"
                     /codon_start=1
                     /product="Mitochondrial outer membrane protein"
                     /protein_id="XP_002492480.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0263"
                     /db_xref="EnsemblGenomes-Tr:CAY70301"
                     /db_xref="GeneID:8200204"
                     /db_xref="GOA:C4R415"
                     /db_xref="InterPro:IPR027532"
                     /translation="MSLEVNWEQIASSEAIREQLVDWLNDQLKAVEVPKYLADIHVTS
                     LSLGSKAPEITIRDIGKPFDDFYDIEEERAGTGEGDEDDGRVAPTSTPMKHQTSGSSD
                     QTDASNPISPSTSHDHENDMQFVTEIKYDSDICVEVAAQLLMNYPAEKFISLPVRLKL
                     SDLLIHTLAVVAYVNHRVFISLLCDISENEDTDNTESHSGNLRALSSKTASRIDVVKR
                     LKVESELGSYEPDNGSILRSVGKIETFLVDTIRNLLVQEVGWPNWIEFQGV"
     gene            <524540..>525664
                     /locus_tag="PAS_chr3_0264"
                     /db_xref="GeneID:8200092"
     mRNA            <524540..>525664
                     /locus_tag="PAS_chr3_0264"
                     /product="Ferrochelatase"
                     /transcript_id="XM_002492436.1"
                     /db_xref="GeneID:8200092"
     CDS             524540..525664
                     /locus_tag="PAS_chr3_0264"
                     /codon_start=1
                     /product="Ferrochelatase"
                     /protein_id="XP_002492481.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0264"
                     /db_xref="EnsemblGenomes-Tr:CAY70302"
                     /db_xref="GeneID:8200092"
                     /db_xref="GOA:C4R416"
                     /db_xref="InterPro:IPR001015"
                     /db_xref="UniProtKB/TrEMBL:C4R416"
                     /translation="MLNRRFQSTVSSSLNKGTGIVFMNMGGPSTVKETYDFLFRLFSD
                     GDLIPFGRFQNILARFIASRRTPKIESYYKAIGGGSPIRKWSEYQSSKLCEKLDIISP
                     QSAPHKPYVAFRYANPLTEDTLQKMKNDGITKAIAFSQYPQFSYSTTGSSINELYRQS
                     KILDPDQSIKWTVIDRWPDHPALVKTFAAHIKDTLNRFKTENGLTDTKDVVLQFSAHS
                     LPMDIVNKGDSYPAEVAASVFAIMKELNFSNPYKLTWQSQVGPKPWLGAQTEKITKQL
                     ASSDVPGVVLVPIAFTSDHIETLHELDIELIQELPNPSKVKRVESLNGDQTFIDSLAE
                     LVKSHIDSKVVFSNQLPLDSMLGVVSDNSLTDPKEFFRAH"
     gene            complement(<525717..>529153)
                     /locus_tag="PAS_chr3_0265"
                     /db_xref="GeneID:8200093"
     mRNA            complement(join(<525717..526296,526353..>529153))
                     /locus_tag="PAS_chr3_0265"
                     /product="Non-SMC subunit of the condensin complex
                     (Smc2p-Smc4p-Ycs4p-Brn1p-Ycg1p)"
                     /transcript_id="XM_002492437.1"
                     /db_xref="GeneID:8200093"
     CDS             complement(join(525717..526296,526353..529153))
                     /locus_tag="PAS_chr3_0265"
                     /codon_start=1
                     /product="Non-SMC subunit of the condensin complex
                     (Smc2p-Smc4p-Ycs4p-Brn1p-Ycg1p)"
                     /protein_id="XP_002492482.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0265"
                     /db_xref="EnsemblGenomes-Tr:CAY70303"
                     /db_xref="GeneID:8200093"
                     /db_xref="GOA:C4R417"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR007673"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024324"
                     /db_xref="InterPro:IPR026971"
                     /db_xref="UniProtKB/TrEMBL:C4R417"
                     /translation="MDFTFVVSEALTEFQATEKGQLTLEDSHSKLEEVTDALALSPEA
                     IGRSEIFDLLKDLVLASPTLNQKQRDQIGYLICSTISSIAKNTSTLIESGEVDSFPVY
                     KKYLELYGFLMHCHLTFLALEDHSAAVTTQKIRRATKKDVDLFKNHCLQLENALEATC
                     TVFGVNLERLFETTPERDLFVNLFTRPVYLLMESEQRIKVTSVKLHIFKVICIGIRNH
                     GHAPAAESSILQNLTYFLHLAVIMAELLDNLSEQYNYSQLTDEILRNVSLKEFNPNDA
                     NGPRSISLFIAKLSELNPRLVLRQMTFIAQLLDNSSHMLRCAVVEACGNIVITLAKDD
                     ISLENHQSQIETLLKLLEQRFLDQNPYVRTKAIQALLKLCELKERFSRRRYRFLKLAV
                     RSLNDRNPLVRRNAIKLICKVILTHSFSAMHGPQLGLSVWQKRLVDIQEQINSLDGSF
                     SSELIPTGDANNTSNTINLEQDQDFEGDITMRTIEEDSTMPTPGSSEQDADKDEHNEK
                     EVVDYEALNKLKLTHQYYKDAIKFIKTIHRGTKLAAVILYSKNRTEVLETMDFFVLAD
                     AYGIEIAELGVKKMLHLVWIKNNNDEGTSVSSHLMECYKQLFFTTPATATPLEKATYI
                     ASNLVALTKSASASDLASLEKLLCMMYTSTENDLIDDNTIKVLWKIYQAKDNSVSIEQ
                     KHGSIIILSMLSLADNQIALRGLDQLLNIGLGGEKVEDMILARFSCVAIQRMVPQGKK
                     IGHEKFTLERKDEIINKLVDMAVMYSEDGEWYGAAEHALNAIFIISSHPIEVGSSLLK
                     KKIETTFGEVLQEKTRIRNLTQLLFLVGHISIKTIVYLEKCEAEFKRRKLEASSSQGK
                     QKPDESKEVENELEMIGGTSEDDFSDAIAFIKEKELLFDENSLLAKFGPLVKEICANN
                     LEYQNTELQRSAVLCLEKFMKNSPDPIIRSNAVLGLGDMAVCFNNLVDENTDFLYRRL
                     HDDNIMVQRTCLMTITFLILAGQLKVKGQLATMAKCLENEDQGISDMCKLFFTELAAK
                     DNAIYNGFIDMFSGLTNDKTLEKDAMKRIIKFLVPFIGKERHQKQLAQKLLHRLEKVE
                     TEDQWNDVAFVLQSLPLKNNEQVQEALAEGFKVVQARS"
     gene            complement(<529727..>531373)
                     /locus_tag="PAS_chr3_0266"
                     /db_xref="GeneID:8200094"
     mRNA            complement(<529727..>531373)
                     /locus_tag="PAS_chr3_0266"
                     /product="Putative protein with similarity to the
                     allantoate permease (Dal5p)"
                     /transcript_id="XM_002492438.1"
                     /db_xref="GeneID:8200094"
     CDS             complement(529727..531373)
                     /locus_tag="PAS_chr3_0266"
                     /codon_start=1
                     /product="Putative protein with similarity to the
                     allantoate permease (Dal5p)"
                     /protein_id="XP_002492483.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0266"
                     /db_xref="EnsemblGenomes-Tr:CAY70304"
                     /db_xref="GeneID:8200094"
                     /db_xref="GOA:C4R418"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R418"
                     /translation="MTSQGSSEIKQEHAAVADSVNSSDDGFQVLTIINRETRETIVIK
                     KDWTDAEEQRLVRKLDFIITPLIFFGFFLLQLDRGNIANAYTDVNLINMLELNNYRIN
                     IASALFSLGIVIFEIPFNVALQRVSPSVFLSFQIFAWSLVATLQSQFTNLAGFYVTRF
                     LVGALEAGYIPGCLYFLSTWYKRSELGLRHTLFFYGNLTASATSGLIAAGILRDLSGV
                     GGMSGWQWIFFVEGIVGVGFSFIFFAFLPDSAAHPAAFWNKRWFYFTKEEARILRDRI
                     YVDDPAKSVSTRTTNHKDVWETFKKPIPWLHVLITISSMQTTAALSSYIPLIIRSMGF
                     GVFESNARSSIPQWCSMVLILLLSISSKHIKPRGGSIAFVLIWQLAAQIALRELPASA
                     SPTARFTALCFLVTAVANGHILNTSWLSVNIKSPRERSIALAMLIMAANIGGICGGQI
                     LRDNDRPLYRKGFLALIILDVFSVLLVFFTIWYYHNLNRKLEKLHGKEELVDEEEEKE
                     AETVESLHETVYVGFNTSEVMDKEEEENTFVRKPKYRYIP"
     gene            complement(<531692..>532549)
                     /locus_tag="PAS_chr3_1173"
                     /db_xref="GeneID:8200095"
     mRNA            complement(<531692..>532549)
                     /locus_tag="PAS_chr3_1173"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492439.1"
                     /db_xref="GeneID:8200095"
     CDS             complement(531692..532549)
                     /locus_tag="PAS_chr3_1173"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492484.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1173"
                     /db_xref="EnsemblGenomes-Tr:CAY70305"
                     /db_xref="GeneID:8200095"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="UniProtKB/TrEMBL:C4R419"
                     /translation="MSERKAINKYIPADFDPSQIRRTKKKKSTALPTVRLMAPFSMKC
                     SNCGDYISKSKKFNARKETTKEDYLGVKIIKFHFRCPLCSGEIVFRTDPVNADYVVEK
                     GAVRNFLRSNVKEPEKLETLEETLDRLEKQAEQDKKEELAKQKGIHKKLNDPDEDIIV
                     QVEKKMIEQREEQRRMDELDDLRSKNARIERIKRSEISLEDRILNDDSESLEKEIASR
                     TREAFENKRPLEIRPDDEFSSKEAKSVKLTVTAPKRASRALINSLSGNREHYNGMPRL
                     SLGYSSDSE"
     gene            complement(<532695..>533930)
                     /locus_tag="PAS_chr3_0267"
                     /db_xref="GeneID:8200205"
     mRNA            complement(<532695..>533930)
                     /locus_tag="PAS_chr3_0267"
                     /product="TFIID subunit (48 kDa)"
                     /transcript_id="XM_002492440.1"
                     /db_xref="GeneID:8200205"
     CDS             complement(532695..533930)
                     /locus_tag="PAS_chr3_0267"
                     /codon_start=1
                     /product="TFIID subunit (48 kDa)"
                     /protein_id="XP_002492485.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0267"
                     /db_xref="EnsemblGenomes-Tr:CAY70306"
                     /db_xref="GeneID:8200205"
                     /db_xref="GOA:C4R420"
                     /db_xref="InterPro:IPR007900"
                     /db_xref="UniProtKB/TrEMBL:C4R420"
                     /translation="MSSTPDGSTPVDSGKRTSDQIDVGEYKRVKVERGNRSETVDSGL
                     IDMSNSVGASLDIPTPDQLNPTNTGVQTPSLHQPGESISAHSLSLPGETSVGGSTGIS
                     RENTPQVRPDVSVSQSSSQLHQRNESFPGLSVSKSTTSLNKDTMFDNRKRLLGNNGAN
                     PNGQKSSDPEKLSDALTAAGVDLKEEESLLSQSTVIQQSRRQLSTLSSFLHPVHLATF
                     MRRVMENNGLRNYVDHDTELLSYMSSACEGFMAGILTDSVILANHRKRPIKSKLKHST
                     TPRSDVSKVLRDIATKQKEREEQRVQKRVTLDIEGQEDDGKSKQDNEEVLHRAANATA
                     MMMTSKSKKKKYSWMNADSGAQGGKTNSVLARGDSGIRYRDAREEPGLVLRDLLGALE
                     GRRMCVANTVVKGYARMND"
     gene            <534314..>535420
                     /locus_tag="PAS_chr3_0268"
                     /db_xref="GeneID:8200096"
     mRNA            <534314..>535420
                     /locus_tag="PAS_chr3_0268"
                     /product="RNA terminal phosphate cyclase-like protein"
                     /transcript_id="XM_002492441.1"
                     /db_xref="GeneID:8200096"
     CDS             534314..535420
                     /locus_tag="PAS_chr3_0268"
                     /codon_start=1
                     /product="RNA terminal phosphate cyclase-like protein"
                     /protein_id="XP_002492486.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0268"
                     /db_xref="EnsemblGenomes-Tr:CAY70307"
                     /db_xref="GeneID:8200096"
                     /db_xref="GOA:C4R421"
                     /db_xref="InterPro:IPR000228"
                     /db_xref="InterPro:IPR013791"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016443"
                     /db_xref="InterPro:IPR020719"
                     /db_xref="InterPro:IPR023797"
                     /db_xref="UniProtKB/TrEMBL:C4R421"
                     /translation="MAKGQIITFQDHENFRLRLILSTLAGKPIKIEKIRSHELNPGLK
                     DYEVSFLRLLEKVTNGSVIEISYTGTTVIYRPGIIIGGVLTHDCPVSKPVGYFIEYML
                     FLAPFSKEKFSIVFKGITSSKEDVGVDLLKWGFLPVMENFGVRECSIHTLKRGSPPLG
                     GGEVHLLCNSLIAQPITIHALEINKISSIRGIAYCTRVSPSIVNRIVSSVRDVLRNTI
                     GCEVNITTDVWRGETSGKSPGFGLTLFSESKKGKNWRYCIEDIGLARETPEDIGEATS
                     YKFLELLENSGVIGRNQLPLALTYMTIGKEDIGRLKVHKSQIDAKLVTMLRDIKSVFN
                     TQFLFKPSPEEAEEDYLVATVKGVGFTNTSKKVA"
     gene            complement(<535660..>537251)
                     /locus_tag="PAS_chr3_0269"
                     /db_xref="GeneID:8200097"
     mRNA            complement(join(<535660..535681,535842..536586,
                     536654..>537251))
                     /locus_tag="PAS_chr3_0269"
                     /product="Protein required for sorting proteins to the
                     vacuole"
                     /transcript_id="XM_002492442.1"
                     /db_xref="GeneID:8200097"
     CDS             complement(join(535660..535681,535842..536586,
                     536654..537251))
                     /locus_tag="PAS_chr3_0269"
                     /codon_start=1
                     /product="Protein required for sorting proteins to the
                     vacuole"
                     /protein_id="XP_002492487.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0269"
                     /db_xref="EnsemblGenomes-Tr:CAY70308"
                     /db_xref="GeneID:8200097"
                     /db_xref="GOA:C4R422"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C4R422"
                     /translation="MSDSLFGSNILESEDPWAEPGAFSSNKLNSSEFKPDWHPSGTAD
                     LQTAEDPLVDPFKQEDVFIKSTFEEPTSSRSIEAVKSAEIDSELGEADVEIPNLWSDT
                     VQEFNPLSPHNNSSNHMVTVKEIPEKQGLLFKHINYLVTHNIKFSGEYLKHAEQSTQN
                     KKGEFKVIRRYSDFSWLLEILLKKYPFRMIPDLPPKKFSIGATSSSNDSLFLQKRRRG
                     LQRFLNQIIHHPVLIKEPLVIMFLTVPNDFTNWKKIANIDTSDEFEGVKVRIPTRFRL
                     TLDKLYLNDEAQESQEEYEEDRAGAAANEHAINLQTTFKNIEHVWEENPTNYHNKDFM
                     DNINLITVNLGKIHEIWTKLCILVERSERREHALALDKAKFGDFLGIFIKHNHTVYDL
                     NNLANPKIIKHQRPNEEQQNLGIINNILLSVTNLTKKSKELKDEEVKIIGSDILESAQ
                     MLTG"
     gene            complement(<537367..>537930)
                     /locus_tag="PAS_chr3_0270"
                     /db_xref="GeneID:8200098"
     mRNA            complement(<537367..>537930)
                     /locus_tag="PAS_chr3_0270"
                     /product="Coenzyme Q (ubiquinone) binding protein"
                     /transcript_id="XM_002492443.1"
                     /db_xref="GeneID:8200098"
     CDS             complement(537367..537930)
                     /locus_tag="PAS_chr3_0270"
                     /codon_start=1
                     /product="Coenzyme Q (ubiquinone) binding protein"
                     /protein_id="XP_002492488.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0270"
                     /db_xref="EnsemblGenomes-Tr:CAY70309"
                     /db_xref="GeneID:8200098"
                     /db_xref="InterPro:IPR005031"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:C4R423"
                     /translation="MMAKRSRIQHFKSISWVSSRTFLNLGRLAQNSELKGNGQQYVVK
                     KTFHQPKSVVYNVISNVDKYHEFIPYCEASFINSRDTKGEPTEAGLTVGFKSFDETFL
                     CTLECQKDKQVIAKSITHSLFHNLLTEWNVTEASSSKTNVELILSYEFKSDLYNQVSA
                     LFASKVTSIMIKAFEKRAYTEHKQFCK"
     gene            <538327..>540128
                     /locus_tag="PAS_chr3_0271"
                     /db_xref="GeneID:8200099"
     mRNA            join(<538327..538870,538984..>540128)
                     /locus_tag="PAS_chr3_0271"
                     /product="Lysophospholipid acyltransferase"
                     /transcript_id="XM_002492444.1"
                     /db_xref="GeneID:8200099"
     CDS             join(538327..538870,538984..540128)
                     /locus_tag="PAS_chr3_0271"
                     /codon_start=1
                     /product="Lysophospholipid acyltransferase"
                     /protein_id="XP_002492489.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0271"
                     /db_xref="EnsemblGenomes-Tr:CAY70310"
                     /db_xref="GeneID:8200099"
                     /db_xref="GOA:C4R424"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:C4R424"
                     /translation="MVQWVQDQIRYMAYSTGLDEESTKIVMCLLLSFPLSALFKRLPD
                     NKYTLKNLVVIGVSFFYIFIILELKGGFVTLLISTTFTYLITKYLKSDLMPWFNLAFL
                     MGHLCINHLKAQFWQAEYDPTKIDITGAQMVLVMKLSSFAWSYRDGKLLKRDPKAFQE
                     KLNTYQRSRVVVEHPSILSFLGKRRKRMIPKSGRIAFAKVVQGAAWAAIWITSLNYIT
                     TDYLFTVEYQQKPLIVKGIVLTILGFTYRLKYYAVWLISEGCCILVGIGYNGYDASTG
                     KFYWNRVQNIAPWEFETGQNVRTCLEAWNMNTNKWLKNFIYLRSAKNNKPGFLSTLLT
                     FATSAFWHGTKPGYYLSFVSGAFYQTIGKIFRRNIRPIFTTKDAEPVTRYKTLYDIVS
                     WTVTHLAFGYLVQPFVILEFKKSIKVWSSVYFFPHIAIGIILFAFKGPFSRSVTGFLR
                     KYHLKSKGESETISAPKKDTITVHPNASDASLIPEYDNQEELNQPIILPEIDFSKEDY
                     DELMNKIDELQKLRSSKDFSLIENEEKQALYEALDSLSKDIGKVMGNIRSFKND"
     gene            complement(<540156..>541013)
                     /locus_tag="PAS_chr3_0272"
                     /db_xref="GeneID:8200100"
     mRNA            complement(<540156..>541013)
                     /locus_tag="PAS_chr3_0272"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492445.1"
                     /db_xref="GeneID:8200100"
     CDS             complement(540156..541013)
                     /locus_tag="PAS_chr3_0272"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492490.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0272"
                     /db_xref="EnsemblGenomes-Tr:CAY70311"
                     /db_xref="GeneID:8200100"
                     /db_xref="GOA:C4R425"
                     /db_xref="InterPro:IPR019258"
                     /db_xref="UniProtKB/TrEMBL:C4R425"
                     /translation="MNTGTPSQSSAGSWSAHATGSLTNSKVNENRSEKIFQQLDNLEQ
                     DLSKLVTSINRFQPSKEAAHRLVSDVDELNYTIDDLLYIHDKRRSQVLNQEVENRHLN
                     KSMINIMIGLTECRKELKKLPNLTEEQLEKVYTEKLKREMNDGDVDMDAPIKPLPSAE
                     ENLKDVETLLEYAMKLSKFSKIPASVDPNTLNPRNFIWPGEDSMRRGMLALASIHHER
                     LIETLNESTINPGGESTINNEQEVAETPSPSKSTKEHNNTTTKGPNQETDAQAAIDGL
                     DLFDSDEDL"
     gene            complement(<541108..>542034)
                     /locus_tag="PAS_chr3_0273"
                     /db_xref="GeneID:8200101"
     mRNA            complement(<541108..>542034)
                     /locus_tag="PAS_chr3_0273"
                     /product="Non-essential hydrolase involved in mRNA
                     decapping"
                     /transcript_id="XM_002492446.1"
                     /db_xref="GeneID:8200101"
     CDS             complement(541108..542034)
                     /locus_tag="PAS_chr3_0273"
                     /codon_start=1
                     /product="Non-essential hydrolase involved in mRNA
                     decapping"
                     /protein_id="XP_002492491.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0273"
                     /db_xref="EnsemblGenomes-Tr:CAY70312"
                     /db_xref="GeneID:8200101"
                     /db_xref="GOA:C4R426"
                     /db_xref="InterPro:IPR008594"
                     /db_xref="InterPro:IPR011145"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:C4R426"
                     /translation="MPPIRDLLPGFEFEKILNSDPQTKSIVLLGKIDEQNAIVSLEKS
                     HFQFNDLQLNSLFESDNGVIGQRIRDININDVYHWGMCLVDQDLETAPSAKINVIYPA
                     TETHLKKYAAQQYHLIKETPEAYQRIVEPYIKTMKGDRIQWVRNILFNNYEADKILLR
                     DPDPKTGFVVLPDMKWDGDTLDSLYCVCIVNRGDISSVRDLNHSHVPWLKELNTSLRQ
                     TISKRYNIPRTQLRLFVHYQPSYYHFHIHIVNIRHPGLGDSIAAGKAILLEDIIENLD
                     SGESKSYVSKTLHYVLGENHNLWNLGLKDHTV"
     gene            complement(<542341..>543042)
                     /locus_tag="PAS_chr3_0274"
                     /db_xref="GeneID:8200102"
     mRNA            complement(join(<542341..542951,543009..>543042))
                     /locus_tag="PAS_chr3_0274"
                     /product="R-SNARE protein"
                     /transcript_id="XM_002492447.1"
                     /db_xref="GeneID:8200102"
     CDS             complement(join(542341..542951,543009..543042))
                     /locus_tag="PAS_chr3_0274"
                     /codon_start=1
                     /product="R-SNARE protein"
                     /protein_id="XP_002492492.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0274"
                     /db_xref="EnsemblGenomes-Tr:CAY70313"
                     /db_xref="GeneID:8200102"
                     /db_xref="GOA:C4R427"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR010908"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:C4R427"
                     /translation="MVKSTLIFRNDGLPLSATVDDDQTQNLTEQKNQAKAIVNKVNSN
                     SATEASIRSGNYTIHYLLRESIVFLVIVDKSFSRNLAFAYLQEIANEFINSHGNAALR
                     SDTRPYQFVSFDSFMSKTKKLYQDSRTQSNLDHLNNELSDVKRIMTKNIEDLLYRGES
                     LDDMSDLSYNLRAESKKYRKAARRINLEALIKQYVPVAMVGIFFVFIIWWIFLR"
     gene            <543228..>544370
                     /locus_tag="PAS_chr3_0275"
                     /db_xref="GeneID:8200103"
     mRNA            <543228..>544370
                     /locus_tag="PAS_chr3_0275"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002492448.1"
                     /db_xref="GeneID:8200103"
     CDS             543228..544370
                     /locus_tag="PAS_chr3_0275"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002492493.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0275"
                     /db_xref="EnsemblGenomes-Tr:CAY70314"
                     /db_xref="GeneID:8200103"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C4R428"
                     /translation="MNQQDQSDFMDIEDGSELQIITNYVNNQKLTNDFVLSIENDLDS
                     RYKQSKDDTYEHSILFVADTNFVLSHLKLLSQIHNIALTNEQMMTHLKVVIPITTITE
                     LDGLKSSSRKEDGFNVGMLARSAVDWIYTHLASNDPIVKGQKLYQRIERDLTPDASIL
                     DCALYLQSEYRSSLVVLLSNDKNLCNMALTNQVLTVSYRTGMTAELILSTTFQELQNR
                     GLLDVNNDDHEIIDYEPTVQPADKTSIEDAIATVYSEIKMVALDSLDALMIQEYGDDL
                     EFTGYEKKNIVELSDCFDLISRYGVSTFFHLFKRSRLIDSKMFQRNSATKQKFFKTPP
                     SDAPEFREFVEFWCELLTCLYQAREPSQKKALSQLTARWLAISSRF"
     gene            complement(<544377..>545537)
                     /locus_tag="PAS_chr3_0276"
                     /db_xref="GeneID:8200104"
     mRNA            complement(<544377..>545537)
                     /locus_tag="PAS_chr3_0276"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492449.1"
                     /db_xref="GeneID:8200104"
     CDS             complement(544377..545537)
                     /locus_tag="PAS_chr3_0276"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492494.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0276"
                     /db_xref="EnsemblGenomes-Tr:CAY70315"
                     /db_xref="GeneID:8200104"
                     /db_xref="UniProtKB/TrEMBL:C4R429"
                     /translation="MIPDTWSKWYDRDTGIDYLYGLKSKKPDTAKQDNKDPLLTFILT
                     NIRQTWMLEINNLKDFIELSGNNGVEVSSVDDLYKTMLFLDQNISQLDSKIAQVGFLY
                     PKNGRSMFQLTNISESMPKKETFKWVFPLNLVSDATSLAISQGINFQVFKALSIERFQ
                     RNYILHEIEKKDKLISKLLDSVLETYSFSSGNGESSAENSLQEKNKILNNKTLTKIIP
                     EGHSLRQSLLKFDPATLQGQDPYKNTCIWDLIGELLKERDNWRHSNEYSVSRTVTESI
                     EKRDKNDNNNNNSFYHEYMEVDESPKNKKHIESQFEKNPKKRKFGKVSASVPVLHEAN
                     HDKVNMFGKDSNVNVEDVNAEIYKPKRRKFGVIKSLKRKLDSSSEVAIKSQK"
     gene            complement(<546054..>547532)
                     /locus_tag="PAS_chr3_0277"
                     /db_xref="GeneID:8200105"
     mRNA            complement(<546054..>547532)
                     /locus_tag="PAS_chr3_0277"
                     /product="6-phosphogluconate dehydrogenase
                     (decarboxylating)"
                     /transcript_id="XM_002492450.1"
                     /db_xref="GeneID:8200105"
     CDS             complement(546054..547532)
                     /locus_tag="PAS_chr3_0277"
                     /codon_start=1
                     /product="6-phosphogluconate dehydrogenase
                     (decarboxylating)"
                     /protein_id="XP_002492495.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0277"
                     /db_xref="EnsemblGenomes-Tr:CAY70316"
                     /db_xref="GeneID:8200105"
                     /db_xref="GOA:C4R430"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012284"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R430"
                     /translation="MVEATGDIGLIGLAVMGQNLILNAADHGFTVVAYNRTVQKVDHF
                     LANEAKGKSIIGAHSIEELVANLKRPRRIIILVKAGNPVDAFIQQLLPHLDQGDIIID
                     GGNSHFPDTNRRYEELKQKGIHFVGSGVSGGEEGARYGPSLMPGGAKEAWPHIKEIFQ
                     SIAAKTDGEPCCDWVGDAGAGHYVKMVHNGIEYGDMQLICEAYDLLKRVARLPDSEIS
                     KVFAKWNKGVLDSFLVEITRDILAYNDDDGKPLVEKILDSAGQKGTGKWTAINALDLG
                     MPVTLIGEAVFARCLSAIKDERVRASKILSGPSVPENAITDKAKFIDDLEQALYASKI
                     ISYAQGFQLIREAAKEYKWDLNFPSIALMWRGGCIIRSVFLGEITAAYRENPDLENLL
                     FHPFFNNAISKAQSGWRATLGKAIEFGIPTPAFSTALSFYDGYRSEKLPANLLQAQRD
                     YFGAHTFKVLPEEANERLKVGDWIHINWTGKGGNVSASTYDA"
     gene            <548266..>550068
                     /locus_tag="PAS_chr3_0278"
                     /db_xref="GeneID:8200106"
     mRNA            <548266..>550068
                     /locus_tag="PAS_chr3_0278"
                     /product="Protein with similarity to monocarboxylate
                     permeases"
                     /transcript_id="XM_002492451.1"
                     /db_xref="GeneID:8200106"
     CDS             548266..550068
                     /locus_tag="PAS_chr3_0278"
                     /codon_start=1
                     /product="Protein with similarity to monocarboxylate
                     permeases"
                     /protein_id="XP_002492496.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0278"
                     /db_xref="EnsemblGenomes-Tr:CAY70317"
                     /db_xref="GeneID:8200106"
                     /db_xref="GOA:C4R431"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4R431"
                     /translation="MKTKTSRKSSSDSYSIDSLEATDSNAENQHDILPYFNDVPLQNI
                     SQEPTRRSAISSILEAIDDENQQTRNGATSLYSNDRVIPIDDSTIMEAVDLAVHKVKT
                     GAHECDDDSAEKISLISETPEKNVIDQPPDGGITAWLTVTGACLFVMSTWGANAAYGV
                     FLNYYLTNHIFSGATPYDFALIGGMVIFLAQVLAPVAMILQRTFGYYPAVIFGIVVQF
                     TGWFTASYAKTIWHLYLSQGVCVGLSASFLFVPVSTLIPEYFMKNRAYAMSIAVAGSG
                     FGGVLFSLSVNAVIDRAGDQRWALRMVCFVVTFISVIGLIISRPRVHRPRITNSLDLK
                     AQCKIIFNFRIALKQQVCLVASWFAIVNLGYVVLLFSISPFATMICGLSAKQGSILTA
                     VMNTGQIVGRPCMGLMADRFGRLNFTITINLFVAILIWGWWIPVRSFAALLPFSFILG
                     AVIGIGSVMNAVLTADSVSTTQFPAAWSFVNIVGGCLSLIAEVMALGIRDFSMSNPFL
                     NTQIFSGFAFFIGVILLLALRQWKIYRLLVQRQSHNESQLQEINSKSNLECTELTEDY
                     VPYEIMIKRKQKYDVLLKDGIKAYILRTLYPIKT"
     gene            complement(<550571..>552928)
                     /locus_tag="PAS_chr3_0279"
                     /db_xref="GeneID:8200107"
     mRNA            complement(<550571..>552928)
                     /locus_tag="PAS_chr3_0279"
                     /product="Protein of unknown function, contains two
                     predicted GTP-binding motifs"
                     /transcript_id="XM_002492452.1"
                     /db_xref="GeneID:8200107"
     CDS             complement(550571..552928)
                     /locus_tag="PAS_chr3_0279"
                     /codon_start=1
                     /product="Protein of unknown function, contains two
                     predicted GTP-binding motifs"
                     /protein_id="XP_002492497.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0279"
                     /db_xref="EnsemblGenomes-Tr:CAY70318"
                     /db_xref="GeneID:8200107"
                     /db_xref="GOA:C4R432"
                     /db_xref="InterPro:IPR008803"
                     /db_xref="InterPro:IPR027417"
                     /translation="MTDLEVSAIQVIDENKVFNSLLVDYMKQFYSQNNSSDDKGLNYH
                     IVSVFGSQSTGKSTLLNHLFHTKFDVMDESQRQQTTKGIWLAHANHISSSNESGDFAN
                     NTKNVFVMDVEGTDGRERGEDQDFERKAALFALSTSEILIINIWEHQVGLYQGANLGL
                     LRTVFEVNLSLFAKNKQRCLLLFVIRDHVGNTSLESLSDVLTLDLQNIWSQLNKPQGT
                     EGFELDDFFDLKFVALAHKLLQPDKFIEDISVLGDKFISEDQLFNEGYHRAIPIDGWS
                     MYAEQVWEQIETNQDLDLPTQQILVARFRCDEISSQVYESFHEQFVKSNWDDLSFTEI
                     GNSLKELRQNAVQQYDILAGRYSESVYLQRKKLLVQKVDLSILEVYTSVLQKLIRQSR
                     DLYLKQIESSLTKKEAGIIFYQVLDNAERESLKYFNENTSLISFVDVDDSEARSYDPS
                     PKLRELEEELSNLRTELVNKEQENIKTKIPRKFKSHFKLIVQDELSNIKPSSWEELLD
                     QFRQVSEKLLAKYKSPDSNYDFHLGLSKEKNKELHEQVLIKFWIKFKEILNDFVTETN
                     VLRLLVSKFEDEFRYDEEGLPVVWKNSAEIDVKFAKARNSALDLLPLFSLAHTAEGEI
                     LPDYDIAHDEAEAESDNEEDDGFKESHKFAHLLSARDQDAIRNKFKKQTDALYVETKR
                     SVINSKTEVPLYIYALLLVLGWNEFMIILRNPLLITLLLIGLTGLYLGYKTKLLGPIV
                     QVVQAMIQELQDQAKNKLRDVLVSEPEAPSQVRIGKEVDATKDED"
     gene            <553408..>554412
                     /locus_tag="PAS_chr3_0280"
                     /db_xref="GeneID:8200108"
     mRNA            <553408..>554412
                     /locus_tag="PAS_chr3_0280"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002492453.1"
                     /db_xref="GeneID:8200108"
     CDS             553408..554412
                     /locus_tag="PAS_chr3_0280"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002492498.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0280"
                     /db_xref="EnsemblGenomes-Tr:CAY70319"
                     /db_xref="GeneID:8200108"
                     /db_xref="InterPro:IPR007317"
                     /db_xref="UniProtKB/TrEMBL:C4R433"
                     /translation="MSSPSAKLEKTINRFKARIDAGSYYEAQQTIRTIVNRYIRAKDH
                     DAASELLYHSSLIFSENGRFDEGTDLLNYLLDVYLLQEDDISSYKEIQLPRIIQILAS
                     YPDNDSNIPTLGEKLTSFANKKTGSTLGDSKLNLIIGEKLYYSGNPDSVSNSEKYLLL
                     TDSDKANELLVDLCLQEYLDQENNSHNLHEYLERLIIPYLKINNIKLVKHTVEEFFTK
                     RVSSLKDDYKNFQTVTFEGDTFFLYDVSSSDDSNLTASKRIINYLQLLIALIQRNHPS
                     NAQNFKLLFGRYKEDISQADITAKINELGQAVFNVAVVANNGNFLQDMMSGLLGGGPK
                     "
     gene            complement(<554429..>555028)
                     /locus_tag="PAS_chr3_0281"
                     /db_xref="GeneID:8200109"
     mRNA            complement(<554429..>555028)
                     /locus_tag="PAS_chr3_0281"
                     /product="Polyphosphate phosphatase"
                     /transcript_id="XM_002492454.1"
                     /db_xref="GeneID:8200109"
     CDS             complement(554429..555028)
                     /locus_tag="PAS_chr3_0281"
                     /codon_start=1
                     /product="Polyphosphate phosphatase"
                     /protein_id="XP_002492499.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0281"
                     /db_xref="EnsemblGenomes-Tr:CAY70320"
                     /db_xref="GeneID:8200109"
                     /db_xref="GOA:C4R434"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:C4R434"
                     /translation="MAAEFVPLAVAREGRESQLYSKTSGARLIAGCVPLNEAKDKVIM
                     ISSSKHKDRWILPKGGIEKDEEDDYRNTALRETWEEAGIFGEITKKLKVVFDHRFQKG
                     SGDLKEKDLDIDGERIPRSEFHLYEMIVRELSQEWPESAKRERKWCTYSEAKHELTKS
                     KRWELLDALNDSSIEKDVQSVFIDQKGNHKDAAIHSDHY"
     gene            complement(<555577..>555780)
                     /locus_tag="PAS_chr3_1174"
                     /db_xref="GeneID:8200110"
     mRNA            complement(<555577..>555780)
                     /locus_tag="PAS_chr3_1174"
                     /product="40S ribosomal protein S28"
                     /transcript_id="XM_002492455.1"
                     /db_xref="GeneID:8200110"
     CDS             complement(555577..555780)
                     /locus_tag="PAS_chr3_1174"
                     /codon_start=1
                     /product="40S ribosomal protein S28"
                     /protein_id="XP_002492500.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1174"
                     /db_xref="EnsemblGenomes-Tr:CAY70321"
                     /db_xref="GeneID:8200110"
                     /db_xref="GOA:C4QXU7"
                     /db_xref="InterPro:IPR000289"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR028626"
                     /db_xref="UniProtKB/TrEMBL:C4QXU7"
                     /translation="MDTKTPVTLAKVIKVLGRTGSRGGVTQVRVEFLDDSSRTIVRNV
                     KGPVRENDILCLMESEREARRLR"
     gene            complement(<555949..>557973)
                     /locus_tag="PAS_chr3_0282"
                     /db_xref="GeneID:8200206"
     mRNA            complement(<555949..>557973)
                     /locus_tag="PAS_chr3_0282"
                     /product="Plasma membrane transporter for both urea and
                     polyamines"
                     /transcript_id="XM_002492456.1"
                     /db_xref="GeneID:8200206"
     CDS             complement(555949..557973)
                     /locus_tag="PAS_chr3_0282"
                     /codon_start=1
                     /product="Plasma membrane transporter for both urea and
                     polyamines"
                     /protein_id="XP_002492501.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0282"
                     /db_xref="EnsemblGenomes-Tr:CAY70322"
                     /db_xref="GeneID:8200206"
                     /db_xref="GOA:C4R436"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:C4R436"
                     /translation="MTEFILTQGFGYGIALGLGAAFALLMMATTYTAKKFLGQKQDSE
                     RFTTASRSVKQGLISSCVVSSWTWPGTLLTSSQWAYQYGVVGSYWYAAMGSFQVLLFT
                     LVAIEIKKRCPGIHTIAEVARVRFGRGGHLVYLSYCLGTNVIVSCMLLLGGSQGFSFS
                     TGMHIVAACFLLPMGVCVYTLFGGLQATFLSDWTHTVIIYVIILVCLTTVYGTSDLIG
                     SPGKMYDLLTEIAKESPSSAANGSYLTFDNRAMIFTAWNLLMGGASTVFGDPSYSQKA
                     IAASAKDVMFGYITGGLCWQIIPWGLGTCTGLAALALTNNPASYTYPNALTVEEAEKG
                     LPLVYGMAAIFGKSGAAAAVVMIFMSVTSAMSAELISCSSILTYDFYRSYVNPKASGK
                     QLVTASHIFVIAFSIFMGGLAVVFNYIGVTIGWILNFIGIALGPVLGALLGMLFYPKM
                     TKHAMWFGPTMATLTGVACWLGSCHHFYGELNKDNLAGNYPSAIGNFVSVFTSPLYIF
                     LISLIKPQSFDLSTLNDQFEAGDDAEETELERMKVQETDLDQLNKSLIQTRIFLIIHA
                     SIFVFILPLSLYGSGYIFSKRFFTAWVVITIIWEYLAAMWIIIWPLYESRVTLRYVIM
                     KLLGKEGHLYYGAGEVKEISTSDQSFATPSVAEAKNEHHVNVITDSDHDM"
     gene            <558706..>560385
                     /locus_tag="PAS_chr3_0283"
                     /db_xref="GeneID:8200111"
     mRNA            <558706..>560385
                     /locus_tag="PAS_chr3_0283"
                     /product="Putative amidase"
                     /transcript_id="XM_002492457.1"
                     /db_xref="GeneID:8200111"
     CDS             558706..560385
                     /locus_tag="PAS_chr3_0283"
                     /codon_start=1
                     /product="Putative amidase"
                     /protein_id="XP_002492502.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0283"
                     /db_xref="EnsemblGenomes-Tr:CAY70323"
                     /db_xref="GeneID:8200111"
                     /db_xref="GOA:C4R437"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR015830"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:C4R437"
                     /translation="MPTCIETTTANWESISEQKRNDIISAIPEDWILKNIPSSEKEPN
                     AKLYLDKVLPEAEQSITSLDTIELRDKIANGELSSYEVCFAFCHRAALAHQLVNCCIE
                     IFFDKALERAKELDEILKATGKPVGRLHGVPISLKDQVNLEGFDSSIGYAALVGKPKR
                     ADDVSLLAKILYNEGAVFYVKTAVPTAMMCVETYSNINGYTTNSNNRNLSSGGSSGGE
                     GSLIGCQGSVLGIGTDIGGSIRIPSALNGIYGLRPSHGRIPYMKVFNSYLGQEVMPSV
                     IGPMSVSLKGLKLFTQVVLDSKPWLWDPKSMPIPWRYDQITDQYSNKKLCFGVWKWDK
                     LVMPHPPVLRAVDECVAALKKAGHQVVEWDPPCRKSLVDIGLEVLSADRYKEIEENCA
                     KTGEPLFEALRNLCVDSGSKQPIEVNAWWDISERKYALQQTYSEYWNNTVNSTGTGRP
                     VDGIIAPVWCSASYENDNSYKTPFNYTVPFNVLDFPSVVVPVLRSDKSIDLKDESYVP
                     VDEIDNTVQEYYDAEKFDNMPVSVQVVGRRWEDEKALFMAEVLSESLSSNP"
     gene            <560538..>562466
                     /locus_tag="PAS_chr3_0284"
                     /db_xref="GeneID:8200112"
     mRNA            <560538..>562466
                     /locus_tag="PAS_chr3_0284"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492458.1"
                     /db_xref="GeneID:8200112"
     CDS             560538..562466
                     /locus_tag="PAS_chr3_0284"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492503.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0284"
                     /db_xref="EnsemblGenomes-Tr:CAY70324"
                     /db_xref="GeneID:8200112"
                     /db_xref="GOA:C4R438"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R438"
                     /translation="MSKEAIRISKACEGCRRRKVKCTGGNVCDSCKRWNDICRYREFS
                     RPSKERKKRRKIDPEVKLKKPEEENGVLNLQLPGLLSANSAEFFQNKYFGPASNFSFV
                     THLNQYLQAAGLQDGNNGIDRFGMQLVTLRNFEHVDIESELAKLSYHQAYSLLEFYFE
                     TWHIPYPIFDPELMFGKFKDVWLYLKGDKKSSIVNKYDKAVIYLLMSIGGVVSCFDSN
                     SLAPHIPLARILFEMARREVPNIQLDISYEAVKVLYLFSLSSANFGDTSISYLYSGSA
                     VRSAFILGLHKNALSLDNQFQGKGKKQEMYERHRIWVATWVWEKYWSFCMGRPSCIKD
                     DIPIPHPIPEVYTSAGYTSSKLFPINLPHMKLRVYFTHFCTKIQASLYNTSDEFPTVF
                     KLVESISQKLDEIYPESNENRLCFSDNSLAQNLSDQEWREWFWIRAYYLYLKMLSYRP
                     ILVFSAYLKLRTNCIPKDLRIQLDEGSEKCFAIALQFAEFLIESNRYKKHMRLPIFFI
                     ATYVESACTVLLFYIVSNYNYISPEQVSKVWDTLHKTCAFLEGVSGPYIESSRLIAND
                     AIKSLQTVLLSRQNQAEPYKIPVPPAGLSDDIMINRMKKLHGESVDSSNCIQLDTPIN
                     EEDFESFWQDTINWLSST"
     gene            <562967..>565384
                     /locus_tag="PAS_chr3_0285"
                     /db_xref="GeneID:8200113"
     mRNA            <562967..>565384
                     /locus_tag="PAS_chr3_0285"
                     /product="Glutamine tRNA synthetase"
                     /transcript_id="XM_002492459.1"
                     /db_xref="GeneID:8200113"
     CDS             562967..565384
                     /locus_tag="PAS_chr3_0285"
                     /codon_start=1
                     /product="Glutamine tRNA synthetase"
                     /protein_id="XP_002492504.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0285"
                     /db_xref="EnsemblGenomes-Tr:CAY70325"
                     /db_xref="GeneID:8200113"
                     /db_xref="GOA:C4R439"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004514"
                     /db_xref="InterPro:IPR007638"
                     /db_xref="InterPro:IPR007639"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:C4R439"
                     /translation="MSTTDEELATLFGKVGFDEAKSKEILKNKKVSLSLAQIIEEVEA
                     DEPLSKSKTALLHNLATLVKGENLPKRELITRAIADERLTTNLQVSEAYKYVKEAKES
                     STEEGMNVRSGVGIVITREQVDEEVAKYINDHKQEIETKRYSCVPALLGNIKALPQLK
                     WASPALFKPIIDEQVLKLLGPKDERDVVKKEKKKKAKQPETATKQSAVTGDVKQRSMF
                     SEGFLGDLHKPGENPQMWPELMKEHLKVTGGRVFTRFPPEPNGYLHIGHSKAIMVNFG
                     YAKYHDGVCYLRYDDTNPEAEEEKYFVSIKTMVEWLGFKPWKITYSSDYFDQLYELGE
                     KLIQVGKGYVCHCTAQEVKLQRGMKEDGTPGGKRFACPHRERPVEESLQEFRNMRDGK
                     YQSGEATLRMKQDLESPSPQMWDLVAYRVLNAPHHRTGDKWKIYPTYDFTHCLVDSFE
                     NISHSLCTTEFQLSRESYEWLCDVLHVYRPAQREYGRLNITGTILSKRKIAKLVNEGI
                     VRGWDDPRLFTLEGIKRRGVPPGAILSFINTLGVTTSTTNIQATRFESAVRSYLDVTT
                     PRLMMILDPVLCVIDNVDDTFEEKITIPYKPGDAKLGDRSLTFTKEFYIDRSDYRDET
                     SKDYFRLAPGQPVGLMKVPFTVSVSSVERDDHGKVTTIHVNYDKVEGKPKKPKTYIQW
                     IPKSTKQNSPVHIKETRIHNVLFNSENPSSHPDGFTSDINKDSEEVITTAIIEPAFFD
                     IKSRSPLNLPTVNEEFNIKEQPNTPESIRYQALRVGYFCVDKDTNGDQEIILNRIVTL
                     KEDSSKD"
     gene            complement(<565611..>567137)
                     /locus_tag="PAS_chr3_0286"
                     /db_xref="GeneID:8200114"
     mRNA            complement(<565611..>567137)
                     /locus_tag="PAS_chr3_0286"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492460.1"
                     /db_xref="GeneID:8200114"
     CDS             complement(565611..567137)
                     /locus_tag="PAS_chr3_0286"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492505.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0286"
                     /db_xref="EnsemblGenomes-Tr:CAY70326"
                     /db_xref="GeneID:8200114"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:C4R440"
                     /translation="MAYLGPKVYKTTPLTSNNLAFLNSSSSSNSSNSSNDDTLSSTPD
                     SVLSLNSDSVSTYSSTSSEINQRSHYGWEQMDIKVSSTSTLSRNDSTSSLSTIVDAQN
                     EITSNNNDLIVSPVASPRPKAGGLLKPSLKLPILKRCSSVPNYNEETTKVGAKSVRFS
                     EDLERIKIFNKSSTPMALSTDNSPISSPLRREKMVWDEFSLEYDDDDDQSGVSDAESE
                     SDSVSSVYDYNIWRLISSALPLSGPSINFQRFVNLPPVVIESIKLSSNKTSIIGFIYV
                     KNVSFEKRISIIATTDNWKNTFNFNSCCNYISSNHIFNYEKSHSPSDMYDKFSFIIKI
                     DDLVPHESLGNNLTIQLCAKYETAGQVFWDSDFGRNYRISLTKITKHQVNSAPYDTSF
                     LDVLDYKLGSNASNSQFKNRYQFSLDSNYSVDESYFSARPLFRPSSSSSSSSASSKKS
                     IQRTPLGVPKRSFNTPQGSDPKFFDKSNDSKYNDLVRKYCFYQTASPSSPSTSEPLAG
                     "
     gene            complement(<568785..>569624)
                     /locus_tag="PAS_chr3_0287"
                     /db_xref="GeneID:8200115"
     mRNA            complement(<568785..>569624)
                     /locus_tag="PAS_chr3_0287"
                     /product="Integral membrane protein localized to
                     mitochondria (untagged protein) and eisosomes, immobile
                     patch"
                     /transcript_id="XM_002492461.1"
                     /db_xref="GeneID:8200115"
     CDS             complement(568785..569624)
                     /locus_tag="PAS_chr3_0287"
                     /codon_start=1
                     /product="Integral membrane protein localized to
                     mitochondria (untagged protein) and eisosomes, immobile
                     patch"
                     /protein_id="XP_002492506.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0287"
                     /db_xref="EnsemblGenomes-Tr:CAY70327"
                     /db_xref="GeneID:8200115"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:C4R441"
                     /translation="MGQLFRKIIQWIPLLFFAGSVLLQFFVILSGARTTGVLKDFYWL
                     EVEGTGAIDPQFGTTRWTNYRMCNWENDELSNCEGPQPAYPFSPDNNFSDGENRALIP
                     SDFINHRDTYYYLSRVGWSMLLVGLVFTVFSFFSTLLRIFLKWKLVSGLNWLNSVFAV
                     FFVALGASLMTAAYVKGRNSFNDASEFDASLGVKMFAFLWTSLALLLLSLPIFCFKKP
                     LSSFHGGTGTASHDDSIEYKEDYIPPATGDAYNPEPAGDYPPTQKRKLNFFKINRKTT
                     IED"
     gene            <570416..>570703
                     /locus_tag="PAS_chr3_0288"
                     /db_xref="GeneID:8200116"
     mRNA            <570416..>570703
                     /locus_tag="PAS_chr3_0288"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492462.1"
                     /db_xref="GeneID:8200116"
     CDS             570416..570703
                     /locus_tag="PAS_chr3_0288"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492507.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0288"
                     /db_xref="EnsemblGenomes-Tr:CAY70328"
                     /db_xref="GeneID:8200116"
                     /db_xref="UniProtKB/TrEMBL:C4R442"
                     /translation="MLNKLFIAILIVITAVIGETTTSSTTASLSESPTLVWVTGTDAS
                     GRLATTQSAYTQQFSQLYSSIASPSSGSIGLGTIQGTVGIVRTYETITLAS"
     gene            complement(<570833..>571336)
                     /locus_tag="PAS_chr3_0289"
                     /db_xref="GeneID:8200117"
     mRNA            complement(<570833..>571336)
                     /locus_tag="PAS_chr3_0289"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492463.1"
                     /db_xref="GeneID:8200117"
     CDS             complement(570833..571336)
                     /locus_tag="PAS_chr3_0289"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492508.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0289"
                     /db_xref="EnsemblGenomes-Tr:CAY70329"
                     /db_xref="GeneID:8200117"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:C4R443"
                     /translation="MASSSRSIIRPSDVPDRIISRRNTVTRDRVPRAVSRRNSAPVSR
                     DGKEPSSFLYYLLRKISRKKIENKGAVCRDNLANERTVLAYLRTALTMMTVGITFSVL
                     FQTKLLLLYTESEDEVNDHANATMSTLQTNRAYAALNRFHTPLSCTFIGVGGPHYDVW
                     KFQVLFQ"
     gene            <571585..>572987
                     /locus_tag="PAS_chr3_0290"
                     /db_xref="GeneID:8200118"
     mRNA            join(<571585..572247,572799..>572987)
                     /locus_tag="PAS_chr3_0290"
                     /product="Protein component of the small (40S) ribosomal
                     subunit"
                     /transcript_id="XM_002492464.1"
                     /db_xref="GeneID:8200118"
     CDS             join(571585..572247,572799..572987)
                     /locus_tag="PAS_chr3_0290"
                     /codon_start=1
                     /product="Protein component of the small (40S) ribosomal
                     subunit"
                     /protein_id="XP_002492509.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0290"
                     /db_xref="EnsemblGenomes-Tr:CAY70330"
                     /db_xref="GeneID:8200118"
                     /db_xref="GOA:C4R444"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR006846"
                     /db_xref="UniProtKB/TrEMBL:C4R444"
                     /translation="MADIILAHIYEIETHQQHLVWSMQASVSSLPESRLGYRSITDDD
                     SEVSNRLTGSSRPNASRTLSIQDTVPLTAQTSNNSIRSLTPLVTTAPMKVRLLRGWSN
                     KGVLLLENKGSVARDHLASERTFLSWLRTSLGLASFGIAITQLLSLTDGDNSSDFSGT
                     DSGPMEVEKIIGLSFVALAFVTLLIGFARFFLVQELLLESSFPVSRFSMGTVVFGTTA
                     LFIGKVHGSLSRAGKVKSQTPKVEKTEKPKKPKGRAYKRLLYTRRFVNVTLTNGKRRM
                     NPGPSSQ"
     gene            complement(<573046..>574143)
                     /locus_tag="PAS_chr3_0291"
                     /db_xref="GeneID:8200119"
     mRNA            complement(<573046..>574143)
                     /locus_tag="PAS_chr3_0291"
                     /product="Para hydroxybenzoate: polyprenyl transferase"
                     /transcript_id="XM_002492465.1"
                     /db_xref="GeneID:8200119"
     CDS             complement(573046..574143)
                     /locus_tag="PAS_chr3_0291"
                     /codon_start=1
                     /product="Para hydroxybenzoate: polyprenyl transferase"
                     /protein_id="XP_002492510.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0291"
                     /db_xref="EnsemblGenomes-Tr:CAY70331"
                     /db_xref="GeneID:8200119"
                     /db_xref="GOA:C4R445"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /db_xref="UniProtKB/TrEMBL:C4R445"
                     /translation="MNNHSRYLLLGRHRLGLKWLAQKSVNQKFRLISSSTKKLNTVVQ
                     ETPIFDADKLAAARQARLDGLGVIGKLPEKWIPYAELMRLEKPIGSWLLYSPCTWSIT
                     MAAYSTTAPLSSTLWMLGVFGVGALIMRGAGCTINDLLDRDLDNKVERTIERPLASRR
                     VTPKQAITFLGAQLAVGLGVLLQLPADCFLLGAVSLVPVAVYPLFKRITYYPQVVLSS
                     CFTWGALLGFPAMGVWNWSSMIPLYLSSFAWCMTYDTIYAHQDKKFDVKAGIKSTALA
                     WGDKSKPIMYGLTTIQMATFALSGYMNSMGPGFALGAIIGGYRVFQMVRKVDLDNPKD
                     CWYHFRNNINNGHIFFAGIFLDYILRLLGYI"
     gene            complement(<574232..>578197)
                     /locus_tag="PAS_chr3_1175"
                     /db_xref="GeneID:8200120"
     mRNA            complement(<574232..>578197)
                     /locus_tag="PAS_chr3_1175"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492466.1"
                     /db_xref="GeneID:8200120"
     CDS             complement(574232..578197)
                     /locus_tag="PAS_chr3_1175"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492511.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1175"
                     /db_xref="EnsemblGenomes-Tr:CAY70332"
                     /db_xref="GeneID:8200120"
                     /db_xref="GOA:C4R446"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="UniProtKB/TrEMBL:C4R446"
                     /translation="MARKQRQGRNSGRNKSKPSVSAATSVAASASPSEEGEGESPHCA
                     SRDTSKSNTPTLEEDNVIDGGDKSEVSAILNQPQQLVENVSLSSNGLEKVDDSSKKTT
                     ETYEASGEAHQENQKEEQDMIEGIRHQEGLVGPEQPPEQSPEQSPGGPDVSEVVKVSP
                     SPLDISSQNRVNPLENSANEEGKKSQQDLEEDSVDKKIETREEFLEDDNNRQIEQPAI
                     PKITDEFTTARDVQEIPLGTPEFQEDQIDERYPENHEPNDSEQQELKELHQNNSQEYL
                     KPDDYLAPQQSQESRHVRSSSGSPQLGNQEPRVSPGPFILSSVVKDIPIQNSGILGSN
                     DATITCIEAWDQNLYIGTSVGEILHMFKLDDETGYILISRQSFHTSKVKPIKKILLLP
                     SIDRALVHCGSLVSIFMLPEFSPASVGKIKDVTDVSLDYDSLSIDRVRGNLVHSSQTK
                     SPDFVQVSVFTSKFLRLVNVFKESIKLHKDISYANAITGLIRSHFALISNGIEYDLLD
                     VNNLFKVKLFPVSSGPSPSKIKPLIAPVSQNEFLLSCGTKQDEPAMGMVVDTDGNISR
                     GTIPWNTYPSSLNVDYPFSIGGFSNYIYVHSLHNQQEVQSMKFSHRVKISQVSHLFYT
                     NFKDLKDLVTKIPVNPQSTPAELERITVENDLATKYSQVPSSTVVYSTYEGVKLLQQI
                     PRLMQFMENFTLTQEYTANELSTFIDDIQDEMNVLNKSSGSNTHFESIEWQFLNDLCQ
                     LLFIESGQYQQLLDYSISAFEGDPRVLVNIFQGSDDIIGESIWMFQGLIPKMNQVSDK
                     HINQLSEGTEAYSFFESYLLKWFSKKSFRHDYDKASMIETLEIALMKLYLLNNRVTSE
                     NFSKVQKSLIKNVQRVSAKLEQLLIDGNHWTLLIKYYQRSNENLAALSVWRNLIKGDY
                     KDEIYNELKMQFSIDQFIKYFISQITDETVLWDYGNWLLGYSPSAALRLFSSKDLRIS
                     VPEIKVLHLIDQMSSNKVQTKFEYLDILVNERHELQFLGDYLLELLPPFLLKLQDQNG
                     RLDELVKMYQDLKTPKLVFTTFLRLQAAKPEYKEILATYHTFSKYLSQITRNTASLSN
                     RKTLNVVNECFKLLEPYENQIPYLIAMIESKRDDHEKVIDILLNLTDFHTAEEYAVSF
                     RLAGTFPDTEEGHTSQLEAVQNLVVESDNLFEQDTDISADENTNVHDLLLMSIFDRYL
                     ILNDSQLIEHFLNKYNIFKTEQLDGNSDMLPALVQLDNFNGLLNKIPDNLRIQQINSF
                     LLGNLLSIEDSYNDVLMRKNLTKGKLSAIENLYRDILNSGEEPDNSEESKGRNGHIPE
                     L"
     gene            complement(<578358..>579857)
                     /locus_tag="PAS_chr3_0292"
                     /db_xref="GeneID:8200207"
     mRNA            complement(<578358..>579857)
                     /locus_tag="PAS_chr3_0292"
                     /product="Essential protein possibly involved in
                     secretion"
                     /transcript_id="XM_002492467.1"
                     /db_xref="GeneID:8200207"
     CDS             complement(578358..579857)
                     /locus_tag="PAS_chr3_0292"
                     /codon_start=1
                     /product="Essential protein possibly involved in
                     secretion"
                     /protein_id="XP_002492512.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0292"
                     /db_xref="EnsemblGenomes-Tr:CAY70333"
                     /db_xref="GeneID:8200207"
                     /db_xref="GOA:C4R447"
                     /db_xref="InterPro:IPR012617"
                     /db_xref="InterPro:IPR025160"
                     /db_xref="UniProtKB/TrEMBL:C4R447"
                     /translation="MARKTLAETLAELSQPASGDFDIEDQEGGAVLDYGDNSSFGSES
                     EEDKSNHYVKVGKSRIRENAVKLGGQYEGKKSSRADVFGDEDDEEEDDEDVEHSETED
                     ALSVSGSESESDEKNSDQSQGDSESEEESNSGEDLDYKRSKLQQLISSERKTIVNQLS
                     TSNKQDALKGFAVLNQQKQYDQLVDLRIKLQKGLVASNGLPINKEYYEQNKAPKSSKH
                     LDKLQDKLYNLLDVTLELRGKLLNKSKIVSQEFPPIPSKKRSLQHYLEESSKLDNIVN
                     EYRRNVLVKWSQKVQNASGATALSSSKFKAINQDSSTQVDNYLADMDRLIKRTRLNRR
                     SVVPLGYTETEEVVDDDELIDNDKDNNETKYFSNIDRSLKENKYIYDDDDFYRVLLND
                     LVDKKVSDTQKLTSTSTVITFSKSKLHKSYERKATKGRKLRYTVQDPLLNFEASNPHA
                     YKWNDYQIDEFFASLFGQKVNMNEDEHNEEVQGESEGEDILKDDIKLFG"
     gene            complement(<579957..>581228)
                     /locus_tag="PAS_chr3_1176"
                     /db_xref="GeneID:8200121"
     mRNA            complement(<579957..>581228)
                     /locus_tag="PAS_chr3_1176"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492468.1"
                     /db_xref="GeneID:8200121"
     CDS             complement(579957..581228)
                     /locus_tag="PAS_chr3_1176"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492513.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1176"
                     /db_xref="EnsemblGenomes-Tr:CAY70334"
                     /db_xref="GeneID:8200121"
                     /db_xref="InterPro:IPR007307"
                     /db_xref="UniProtKB/TrEMBL:C4R448"
                     /translation="MGRKKFDKKSAQTFKLVYRSREDPLYYDEDAPDLVLKPLPKGDE
                     AKRPNLRLKTKKELDEELKDQVRKNEGEAALYGIIYDDSSYDYMQHLKPIGEQQGVFI
                     PKKEEPVKKKASDIVIKEPQEFLDPKLFQSDSIKEYDHRTQQDVPDEIKGFKPDMDPR
                     LREVLIALEDEAYIDAEQDAEEGDIFDDLLKSGAAEDQEFENQDFDEWDIDNYADELA
                     EYDSDNNNAEFDWQKDFQKFKIAQKQGKIANTWDSDDDFDSDEEEGDIVGELPDLSKE
                     PKIAATAESSNKKKQKQRRKKGAMTDTSSFSMSSSASYRSEGLELLDDKFELIKRQYE
                     EEDEDEDEEYQPFDMKEERQDLEGMIDDLLGNYELQRGGRRLAKKSEDLAAFKRGADS
                     VSKGRAGRSFKKEQSQVDSLSNGVSSLKLSK"
     gene            <581365..>581784
                     /locus_tag="PAS_chr3_0293"
                     /db_xref="GeneID:8200208"
     mRNA            <581365..>581784
                     /locus_tag="PAS_chr3_0293"
                     /product="Catalytic core subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C)"
                     /transcript_id="XM_002492469.1"
                     /db_xref="GeneID:8200208"
     CDS             581365..581784
                     /locus_tag="PAS_chr3_0293"
                     /codon_start=1
                     /product="Catalytic core subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C)"
                     /protein_id="XP_002492514.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0293"
                     /db_xref="EnsemblGenomes-Tr:CAY70335"
                     /db_xref="GeneID:8200208"
                     /db_xref="GOA:C4R449"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024991"
                     /db_xref="UniProtKB/TrEMBL:C4R449"
                     /translation="MKVTIQNWHSIFAWHWDVPGDEVCGICRVAFDGTCPVCKFPGDQ
                     CPIGKFFDCLFCFVILRSHVGHVLTFCPAIGSCHHSFHMHCILKWLDTDTSKGLCPMC
                     RQIFTLENSNNKEVFEALSGRPSPLEEGILEQEGTPV"
     gene            <581935..>583290
                     /locus_tag="PAS_chr3_0294"
                     /db_xref="GeneID:8200122"
     mRNA            <581935..>583290
                     /locus_tag="PAS_chr3_0294"
                     /product="Gamma-glutamyl kinase"
                     /transcript_id="XM_002492470.1"
                     /db_xref="GeneID:8200122"
     CDS             581935..583290
                     /locus_tag="PAS_chr3_0294"
                     /codon_start=1
                     /product="Gamma-glutamyl kinase"
                     /protein_id="XP_002492515.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0294"
                     /db_xref="EnsemblGenomes-Tr:CAY70336"
                     /db_xref="GeneID:8200122"
                     /db_xref="GOA:C4R450"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001057"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005715"
                     /db_xref="InterPro:IPR011529"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR019797"
                     /db_xref="UniProtKB/TrEMBL:C4R450"
                     /translation="MGENCYTIVVKLGTSSVVDEETREPRIATMSRIVETLVKLRRKG
                     HRIVIVSSGAIAVGMKRVNMKRKPKKLQQVQALAAIGQGRLIGLWDDLFRQLNQPIAQ
                     ILLTRTDLVDYTQFKNAENTLEQLIKMGIIPIVNENDTLSIQEIKFGDNDTLSAITAG
                     MCHADYLFLVTDVDCLYTDNPRTNPDAEPIVLVRNMRNLNVNTESGGSAVGTGGMTTK
                     LIAADLGVSAGVTTIICKSEHPEQILDIVEYSIRADRVENEAKYLVINEEETVEQFQE
                     INRSELRELNKLDIPLHTRFVGHSFNAVNNKEFWLLHGLKANGAIIIDPGCYKAITRK
                     NKAGILPAGIISVEGNFHEYECVDVKVGLRDPDDPHSLDPNEELYVVGRARCNYPSNQ
                     INKIKGLQSSQIEQVLGYADGEYVVHRDNLAFPVFADPELLDVVESTLSEQERESKPN
                     K"
     gene            <583435..>585927
                     /locus_tag="PAS_chr3_0295"
                     /db_xref="GeneID:8200123"
     mRNA            <583435..>585927
                     /locus_tag="PAS_chr3_0295"
                     /product="Vacuolar transporter"
                     /transcript_id="XM_002492471.1"
                     /db_xref="GeneID:8200123"
     CDS             583435..585927
                     /locus_tag="PAS_chr3_0295"
                     /codon_start=1
                     /product="Vacuolar transporter"
                     /protein_id="XP_002492516.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0295"
                     /db_xref="EnsemblGenomes-Tr:CAY70337"
                     /db_xref="GeneID:8200123"
                     /db_xref="GOA:C4R451"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C4R451"
                     /translation="MSSTPKKEPDLTPKKSQPPKNSLGGGKGFSEEGFSQGDFSAKHI
                     LNRRPNTEGSSVASNVISSSSLQRLPSSGSGSVAVGSVLGSSPLTLSGGFHGLDPTKN
                     KIDVPKSKQSRRQSVLSDMISTSHAARNDHSEQQLQTGQQSEQKEEDGSRSSFSVSSP
                     ARDIRHPDVLKTVEKHLANDSEIDSSLQLQGGDVTRGIYQWVTGESSQKDNPPLKRAN
                     SFNDFSSVHGDEVGKADADHDRESVFDEDDISIDDIKVPGGMRRSFLLQKHRDQQLSG
                     LNKTAHQPKQLTKPNFFTNNFIEFLALYGHFAGEDLEEDEDEDLDSGSESVAVSDSEG
                     EFSEADNNLLYDEESLLLAPSTSNYARSRIGSIRTPTYGSFSSNVGSSSIHQQLMKSQ
                     IPKLKKRGQHKHKTQSKIRSKKQTTTVKAVLLLLKAFIGTGVLFLPKSFSNGGLLFSS
                     GMLLIFSCISIVCFIELIQVGKLTQIASYGDIGGFLYGRTMKASILTSIILSQIGFAS
                     AYIVFVAENARVLCDSWLNLGDYSIEVFIFLQLIVFIPLSLTRDINKLSFTALIADLF
                     ILAGLILVYYYSTYHLVVNGISKNVRLYNESEWPLFIGVAVFTYEGIGLLIPINESMA
                     KPEKFNKSLVGVMAVITVVFISIGSIAYMSFGSDVNTVILLNFPQNNKVFSVQLLYAI
                     AIMLSTPLQLFPAIKIIENFVFKKRKHSDSIESKTNRNTVQTDSENVFSGKNNTRIKW
                     SKNLLRLLIVVGASIISYAGSSDLDKFVALIGSFTCIPLIYVYPPLLHIKGNLELGTL
                     SKTNMITDMAICALGATLMLYTGFQGIKSWIG"
     gene            <588983..>589885
                     /locus_tag="PAS_chr3_0297"
                     /db_xref="GeneID:8200124"
     mRNA            <588983..>589885
                     /locus_tag="PAS_chr3_0297"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492472.1"
                     /db_xref="GeneID:8200124"
     CDS             588983..589885
                     /locus_tag="PAS_chr3_0297"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492517.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0297"
                     /db_xref="EnsemblGenomes-Tr:CAY70338"
                     /db_xref="GeneID:8200124"
                     /db_xref="UniProtKB/TrEMBL:C4R452"
                     /translation="MDEFQTSSTNSPRKSGLNLGISVLETRRRSPAPNSSKVTKASST
                     PRKESSGNSSVDSPSLSSNNDNHLSDKLRVLATTEMEILEIKEQIKALLEKKRQKEHR
                     VNKLKTEIERSLYKQVHDQVQSVEKISSNPPPVVTRSPSSSQRPHKLDVEVGVHKDPL
                     RTTNPNEGLKSVDGKQKDTPNSWLSKPLSYLQQFDTLIQHEFEKLNLMDELSAPNSHA
                     TNESNKTQNSMSSQLWTFMNEVKSNLMLNVEEDSTDTQSNIPESWGNSQETQQTDYKD
                     VELHPMEKESSFTTLNSLGKPQDS"
     gene            complement(<590012..>593641)
                     /locus_tag="PAS_chr3_0298"
                     /db_xref="GeneID:8200125"
     mRNA            complement(<590012..>593641)
                     /locus_tag="PAS_chr3_0298"
                     /product="Protein required for proper cell fusion and cell
                     morphology"
                     /transcript_id="XM_002492473.1"
                     /db_xref="GeneID:8200125"
     CDS             complement(590012..593641)
                     /locus_tag="PAS_chr3_0298"
                     /codon_start=1
                     /product="Protein required for proper cell fusion and cell
                     morphology"
                     /protein_id="XP_002492518.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0298"
                     /db_xref="EnsemblGenomes-Tr:CAY70339"
                     /db_xref="GeneID:8200125"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:C4R453"
                     /translation="MAPFFRKHKKSGSTSNSQKETPENSNHAFNQDVQTPQRRVTGES
                     ESSLKTDLSSPATPINPFLKKNQNQNQNQNHQRPPQAPSYQHGISTPPTQYSNFASPN
                     SYPSVATPSVNTPPTSAQHGNLPRSAGNYNNGSYSDLSPRYSQGQQIHNPQIQQHQQH
                     QPMPQDAPQKIGNYRYPPPVSPSTSSPSNAASRGLHHPSGKPLPTVSYNTMIAKTLEP
                     PTPTPWTKKFLYNSPFPRFMHTASSFLTENGSFFVMGGLRDANVYGDIWILQPTNAKS
                     SSNEDSGPSNYCYLAKPIENFEGIPAPRVGHSSVLIGNAYIVFGGDTLQTNEIGELDN
                     NLYFFHVGAYKWTIPNPTGEKPTGRYGHTISIITLSSDPENIQETTPYLYLFGGMLDN
                     DIHNDMWSFDLSNFRRTQWSKVIPSKESPVPPRLTNHTMSIFDEKIYIYGGFDGVKLS
                     NKLWSFDPTEKIWENIQLKGYQPPALREHAAATFNNLLFIYGGKDKNDNPSDEFFCIN
                     LEKFICFRIKNDVFSSPGKRMGHSLTVDLAQEKLIIVGGDPDDSDLTDPYVQKDYVLE
                     GANLAYDKTVLHEFDLNKLPNFIIQEDLELAAKPREQEISKEDSPTQEKEIAEFSSLN
                     ENEFTSSTPLTTPNKQDISSPTHKEESPSNSPEMLTFPNHEEMELSPTKPLVNPAEHK
                     LSSETEESVAKSTTTLNASSPRTANGVQSESSFLKHYANVTDNGEIDNENEADPTETE
                     VKSVPKSEYDELVQLVDQLRFTLDSKVKEANDQVISIEAKKNKEIEGLKIQLADVKSQ
                     IQTPTIPVSSPSNAIIAGSLFSKSTSTRAIQEGTEAPEDQNVTDENSEAKEGAIEDKT
                     IDTAETTTVGLKRQVLTLQNKLVHLEKEKVERDSQLTKFKPLLDNQIVELTSLNSLIK
                     TQESKILELEDYVKDQTSLQKEILEWKNKYEEIQLELEESKKLAFADISINGEKSING
                     EEGDENKEPVGIHKSVHRITQGIDNLINVWSGLSTETGPLDESVDTDEEDLPTRLQKQ
                     IDQLLELNATQEEEKHAFKEELDTLKNELSDVSKEKEVLETKSVTNRDLETNYKQSVQ
                     SLKNTHKALNLSQIELEKQKDLNKKLSSEIEELRLFKLNKRNTSRNVTPVIVNDSDSF
                     QNDTNESKEQRNEDADDDDDNNELNDHYDLKIKDLEADLFILKQERDQLKDEVHQLKK
                     TLYTK"
     gene            <594608..>596191
                     /locus_tag="PAS_chr3_0299"
                     /db_xref="GeneID:8200126"
     mRNA            <594608..>596191
                     /locus_tag="PAS_chr3_0299"
                     /product="Aspartic protease, attached to the plasma
                     membrane via a glycosylphosphatidylinositol (GPI) anchor"
                     /transcript_id="XM_002492474.1"
                     /db_xref="GeneID:8200126"
     CDS             594608..596191
                     /locus_tag="PAS_chr3_0299"
                     /codon_start=1
                     /product="Aspartic protease, attached to the plasma
                     membrane via a glycosylphosphatidylinositol (GPI) anchor"
                     /protein_id="XP_002492519.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0299"
                     /db_xref="EnsemblGenomes-Tr:CAY70340"
                     /db_xref="GeneID:8200126"
                     /db_xref="GOA:C4R454"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C4R454"
                     /translation="MNPSSLILLALSIGYSIAESNFSFKPSKLPLKKHRDSSSPHERF
                     LKRDGPYHPLEADAYFYYTTSILVGSEEEKVEVTVDLGTSDLWVVDYNTGLCDRSFDE
                     TYLKRSLDTSEEDYSAGDLGSSVGVRSARKFLRKRDTNQTEVNEANYGACPNSITFNP
                     ENSSSFQSNDTAFNISYFDGTSASGFWATDTIYFGDLEVSEQFFGLANLTISYGGVLG
                     LGPSNLQTTNANPNGEEFIYSGVLDSMRDQGLINSASFSIYLNPENFRDEDNYSNEGA
                     ILFGAIDNAKIDGSLKLLPYVTSGGHSQIDANFTYITLNNIAVADNDTALIVETNPQL
                     AMLNPKFIYTYFPNEVLTRLVNSIDNLEYDPVEGLYRIRRTNIRDINKKIIEFQFGDE
                     IVIHSPLSNYLSDTWVPSTNYTYLEIQDSREDFFILGNAFFKSAYLFFDNDNSEVGIG
                     QLKVTDKEDIVPVGEFSLDQDSGYSSTWSTFSYETGSAPLGTSTFETSTKTSSDGAAP
                     SVSHINTSSYLFAFVLLFL"
     gene            complement(<596446..>598134)
                     /locus_tag="PAS_chr3_0300"
                     /db_xref="GeneID:8200127"
     mRNA            complement(<596446..>598134)
                     /locus_tag="PAS_chr3_0300"
                     /product="Subunit of the cytosolic chaperonin Cct ring
                     complex, related to Tcp1p"
                     /transcript_id="XM_002492475.1"
                     /db_xref="GeneID:8200127"
     CDS             complement(596446..598134)
                     /locus_tag="PAS_chr3_0300"
                     /codon_start=1
                     /product="Subunit of the cytosolic chaperonin Cct ring
                     complex, related to Tcp1p"
                     /protein_id="XP_002492520.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0300"
                     /db_xref="EnsemblGenomes-Tr:CAY70341"
                     /db_xref="GeneID:8200127"
                     /db_xref="GOA:C4R455"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012721"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C4R455"
                     /translation="MSSLKLPSAPNSGLFKQGYQTQSNADGAINRNIQACREISSMVA
                     TSIGPCGKNKIIVNHLQKIIITNDAATMLRELDVVHPAVKVLVMASDQQEREMGDNSN
                     YVLVFAGELLSLAEKLVILGLTPTEIIQGYTLANKFALKELESLVVDQVDDVTVKSEL
                     LKIVKPIISSKQFGSAEIISELVTEAVLNVLPRGNPQAFNVDSVRVVKIMGSSLESSF
                     VLRGMVFPRPPDSHVKSVKQKSKVAVFTCPIDITTTETKGTVLLHNAQEMLDFSKGEE
                     QQLDTLVKEIHDSGVRVIIAGAGVGELALHYLDRYGLLVIKVPSKFDLRRVCRVCGAT
                     PSPRLGALSPEELGEIDVVETTEIGSDQVTVFKQDKNTSSSLTSTIVIRGATQNNLDD
                     IERAIDDGVSAIKGVLKDSRLLPGAGAVEAELVRRVTAYGEKTPGLLQLAIKKFAEAF
                     EFLPRTIADTAGLDTNEVIPKLYAAHTPAEEQSSSEGLSIGINIEAESLEDSLVDISN
                     EGIYDLFISKKNAIDLATEAVNTVLSVDQIIVAKRAGGPVMPQQPRPGNWDQAD"
     gene            <598400..>601021
                     /locus_tag="PAS_chr3_0301"
                     /db_xref="GeneID:8200128"
     mRNA            <598400..>601021
                     /locus_tag="PAS_chr3_0301"
                     /product="Component of the GARP (Golgi-associated
                     retrograde protein) complex"
                     /transcript_id="XM_002492476.1"
                     /db_xref="GeneID:8200128"
     CDS             598400..601021
                     /locus_tag="PAS_chr3_0301"
                     /codon_start=1
                     /product="Component of the GARP (Golgi-associated
                     retrograde protein) complex"
                     /protein_id="XP_002492521.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0301"
                     /db_xref="EnsemblGenomes-Tr:CAY70342"
                     /db_xref="GeneID:8200128"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:C4R456"
                     /translation="METEDYDPKIDLWKLLDTPNSLRQLDDLLNYTSGYKRVLDNSIS
                     LNITEYKGFQEMMGDETKLENLETDIVDLISSFTKTWELADDTEKAIQSMTGNIRKLD
                     NCKRNLTLSMTVLKRLQMLIGAFYNLTDLLKNNAKNYSMIYQLLSVVLELMQHFQSYK
                     SIDEINDLNRTISRIKNQIVDGIFSDFEDLSSNPNPELLYACKTLDSLGPAYRSKLIN
                     WYVNLQLKEVNSIFGPTEEAGSLSNLGRRFIFFKRLLMQLENQTSKVFPKDWKIELVL
                     AQKFCEATKSDLNRVIARERASNTSGSLDTTLLMNSLEETLDFEAHLNQKFKYYDDSN
                     IESTKAVPVFDRMISEVFEPQLQFWMDYQDSKLNERFSQFLTPDNLLKKTGPLSDDKS
                     ALDDSSINVLDSSTELFRVYRQLLVQLSKLSHGEPLLNLSNMFVKYLYQYKNQVLQPL
                     IPPAKKISSLTTEEASQVLPHICLILNTADYCCSTISQLEERLSKLIEDPKISERMGF
                     DPVKESYLVLINSCLNLLLLKLDRDLDMSWREFTNENWKNLTEVTGESRFLTSVKRTV
                     MENCTVLFRNFDKERYIRNFTDRVIELIITDFTAQIVKIIPIHEIVAEQLLLDLQSLR
                     SLFLDIPNLSPKQTELTNTKPIVSSRMFKKFVDTNVNNLERILKMVMTRTKPFDNFVQ
                     SYFMVIGDKKFDNFFKILILNGTISLPRGFSNAASHHASLQNERLKYQDIFNQQLLAY
                     EDGDTEQEQLEESFAFLDNFDIDRYRKNLYKPTVDTVPQVEGNVTFSPNSTTSPTAKT
                     ISNFFNNIGHSNTDSIDDQFIDSGINSLAKKIDKQAIINTKENLEKNLARTFSGDHKL
                     NINENFKNFSKLFGKKN"
     gene            complement(<602055..>603386)
                     /locus_tag="PAS_chr3_0302"
                     /db_xref="GeneID:8200129"
     mRNA            complement(<602055..>603386)
                     /locus_tag="PAS_chr3_0302"
                     /product="Mitochondrial cell death effector that
                     translocates to the nucleus in response to apoptotic
                     stimuli"
                     /transcript_id="XM_002492477.1"
                     /db_xref="GeneID:8200129"
     CDS             complement(602055..603386)
                     /locus_tag="PAS_chr3_0302"
                     /codon_start=1
                     /product="Mitochondrial cell death effector that
                     translocates to the nucleus in response to apoptotic
                     stimuli"
                     /protein_id="XP_002492522.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0302"
                     /db_xref="EnsemblGenomes-Tr:CAY70343"
                     /db_xref="GeneID:8200129"
                     /db_xref="GOA:C4R457"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C4R457"
                     /translation="MAHFRINMLQKRSVRRQIVIVGAGSYGIALAKELAPLVESMADV
                     VLVSDSEQVIFLPSLVRLDALKNVANLFVGLEGLFAKTKVKLVVDHVVNITKRGVQLE
                     HTGLLQYDYLVIATGAVWDNSILPAPTYNGDTNSFPGEAIQEARDIVIAGGGPLGVEL
                     AGEYASYFQEKSVTLVHSREKLLNDSYLDKVRDRAFLQLHKLGVKIILNRRATIKDQS
                     VFLDDFQLKCDYLINCTGPKANPPPNSFKNFVNDKNEIIIGTKFRSLTNPQVFAIGDV
                     TNFPRKGLEHRAACIKVVVHNLRQVLKGTSSYLIVKWRPDFMPSSAISIGPSGGVGQR
                     HSLLRGVVSMGKRQSAKAKKHERYPQQLEDMICGDYYRFAFAGGCDSGRGGTAKDIRN
                     SWSEVKGSVRRRRGDGGGGAGGGGYVGYGGDGGCGGDGGGGGGGCGGDGGG"
     gene            complement(<604555..>605976)
                     /locus_tag="PAS_chr3_0303"
                     /db_xref="GeneID:8200130"
     mRNA            complement(<604555..>605976)
                     /locus_tag="PAS_chr3_0303"
                     /product="Aspartic protease, attached to the plasma
                     membrane via a glycosylphosphatidylinositol (GPI) anchor"
                     /transcript_id="XM_002492478.1"
                     /db_xref="GeneID:8200130"
     CDS             complement(604555..605976)
                     /locus_tag="PAS_chr3_0303"
                     /codon_start=1
                     /product="Aspartic protease, attached to the plasma
                     membrane via a glycosylphosphatidylinositol (GPI) anchor"
                     /protein_id="XP_002492523.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0303"
                     /db_xref="EnsemblGenomes-Tr:CAY70344"
                     /db_xref="GeneID:8200130"
                     /db_xref="GOA:C4R458"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C4R458"
                     /translation="MLPIRLSKLLLLLSLKLKLGTAEEKYQKLDLKRIDKDYYAVDVK
                     VGSDEQEIKEVLIDTGSSDFWILDKSFCNSPTSEEEENSNGRSNKESCGVYGSFDSNK
                     SETFQATGQVFDAAYGDTTAESTGSSGVRGIDQLRVGDIHIEELYFGLVTNTTSLPPV
                     LGIAQLSEEFSNNSYPNFPYQMKEEGLIDVVAYSLSLGQSKGELLFGAMDHSKYNGTL
                     LKAPILQAGTPGMQVLLTGVALTNGSSSVFNETDNKGFIYFDSGTTASTLPSEHFDDL
                     FNHHGWAYDGDTLTYSIQCDSEGEKSLLDFTLEYTIAGNIVIKVPFEDIIMKNENDGE
                     CLSTVMVSNQTSFSYSDDTPFFVAGDEVLLNAYVVYNLETQELAIAPAVDNPEDTEED
                     IEIISADFDISEARDYSVGLEFRNTTIPATTDYLPSSMSSGSVSEETGSKSESSTSED
                     FAAATLKPFTFWGFVLFFFHFLI"
     gene            <607346..>608284
                     /locus_tag="PAS_chr3_0305"
                     /db_xref="GeneID:8200131"
     mRNA            <607346..>608284
                     /locus_tag="PAS_chr3_0305"
                     /product="Phosphatidyl Glycerol phospholipase C"
                     /transcript_id="XM_002492479.1"
                     /db_xref="GeneID:8200131"
     CDS             607346..608284
                     /locus_tag="PAS_chr3_0305"
                     /codon_start=1
                     /product="Phosphatidyl Glycerol phospholipase C"
                     /protein_id="XP_002492524.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0305"
                     /db_xref="EnsemblGenomes-Tr:CAY70345"
                     /db_xref="GeneID:8200131"
                     /db_xref="GOA:C4R459"
                     /db_xref="InterPro:IPR004129"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="UniProtKB/TrEMBL:C4R459"
                     /translation="MPSKNLISSHRFLLHRRMAITVGAHRGYRKLFPENTILSFDQAV
                     NHGADMIELDLHLSSDQVLVVIHDQSTKAVFGTDYNVCKTSYKDVLSKLRTIRHPPQP
                     MPTFSDVLEWLSDYPDVKLMLDIKRDNPAKDVIRLILEELTKKNTDVNFWRKRIIFGL
                     WSVDYYLLNQELLEGFDVVNIAVDLKKSFQFANTVAAEGGKLHGISFLHLIWYHQKYR
                     TELVKFANSNSLVLYLWTINDPYLVKECGVNLITDDIGMAKKALSGVPVASGPTWRYS
                     VGCYFKAGLFSTVQFLLGRDYNLKYLALAMKKFKLL"
     gene            <608614..>610404
                     /locus_tag="PAS_chr3_0306"
                     /db_xref="GeneID:8200132"
     mRNA            <608614..>610404
                     /locus_tag="PAS_chr3_0306"
                     /product="1,3-beta-glucanosyltransferase"
                     /transcript_id="XM_002492480.1"
                     /db_xref="GeneID:8200132"
     CDS             608614..610404
                     /locus_tag="PAS_chr3_0306"
                     /codon_start=1
                     /product="1,3-beta-glucanosyltransferase"
                     /protein_id="XP_002492525.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0306"
                     /db_xref="EnsemblGenomes-Tr:CAY70346"
                     /db_xref="GeneID:8200132"
                     /db_xref="GOA:C4R460"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C4R460"
                     /translation="MLGFKDFFRLLILFVTAFASDSYEFSSSVKHIASPTTVERIRKL
                     TPTIEAYGSKFFYSNNGSQFFIKGIAYQQDFTEYLRRPESLVDVDAPKTQTLCELNFR
                     NGRHFVDPLAWPDICTRDLPYLQELGVNTLRVYSIDPRANHDVCMERLAEAGIYVILD
                     LSNVDCSINRDDPSWDLEIMDCYTSVIDTMAPYDNVLGFFAGNEVNTDVANTYTMPFV
                     KSSIRDIKSYIKRKNIRKIPVGYSSNDDSLTRNNLADYLVCGENDLAKIDFFGINMYE
                     WCGYSSYATSGYKERTLEMAGYPVPVFLSEFGCNLKRPRPFTEVEAIFNKPMTNVWSG
                     AIMYMYFEERNEYGVVKVKGDYITDPVEKLPDFNLLKAQYRNASPKGVNKQDYSSHGS
                     KDVQCPVASEDWKVSEELPSTPRAPKCDCMMAALKCSIEEVPNRSELAEIVGYICGEI
                     SCHNIVANGTTGWYGEFSDCSFHQKLSYVAQLYYNYHNSTPDACYFEGYGRINAYPNT
                     LEALAMFKTLKGTRCKEELGPVKEISRLITGEPFGSQNRDSPRRILVDSRLKNTNLDT
                     SESKAITAKIISKSSLLTNLIAMFLVILFT"
     gene            complement(<610470..>611204)
                     /locus_tag="PAS_chr3_0307"
                     /db_xref="GeneID:8200133"
     mRNA            complement(<610470..>611204)
                     /locus_tag="PAS_chr3_0307"
                     /product="Constituent of the mitochondrial inner membrane
                     presequence translocase (TIM23 complex)"
                     /transcript_id="XM_002492481.1"
                     /db_xref="GeneID:8200133"
     CDS             complement(610470..611204)
                     /locus_tag="PAS_chr3_0307"
                     /codon_start=1
                     /product="Constituent of the mitochondrial inner membrane
                     presequence translocase (TIM23 complex)"
                     /protein_id="XP_002492526.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0307"
                     /db_xref="EnsemblGenomes-Tr:CAY70347"
                     /db_xref="GeneID:8200133"
                     /db_xref="GOA:C4R461"
                     /db_xref="InterPro:IPR013261"
                     /db_xref="UniProtKB/TrEMBL:C4R461"
                     /translation="MSVRTIRPTFRILNSAIRTQSLKKNFIGPKSGIFLPAYSFLGER
                     NFHISSIRIQQQQNQQQQQQQKKNRSTGPNLFLRIKNAVTFTASTALVIGALGLAGIS
                     LYLLFSELFLPSGDTTTFNHAVTMVEKDPGAQKLLQIDPGTRLKAYGEATGDKWTRNR
                     PLRTSRRIGKDGYERILMRFHVESDNQVGVVSLEAVDKTVFDQEFAYVYLDVPGKKRH
                     YIISPQLPQKTQNTGFLGVKWGPKSN"
     gene            complement(<611464..>613338)
                     /locus_tag="PAS_chr3_0308"
                     /db_xref="GeneID:8200134"
     mRNA            complement(<611464..>613338)
                     /locus_tag="PAS_chr3_0308"
                     /product="Required for a post-incision step in the repair
                     of DNA single and double-strand breaks"
                     /transcript_id="XM_002492482.1"
                     /db_xref="GeneID:8200134"
     CDS             complement(611464..613338)
                     /locus_tag="PAS_chr3_0308"
                     /codon_start=1
                     /product="Required for a post-incision step in the repair
                     of DNA single and double-strand breaks"
                     /protein_id="XP_002492527.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0308"
                     /db_xref="EnsemblGenomes-Tr:CAY70348"
                     /db_xref="GeneID:8200134"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="UniProtKB/TrEMBL:C4R462"
                     /translation="MSQREKVQRSLFTYYKVNGNKNVAYTNNLVKDFIRETSSVIELL
                     SDEETGNEAVDSAGCSNYNVKDEEMPAKIEKNKSEGETVMTSSTMTSISLKQENALFV
                     ASDEEQEVAVDEDEGFDTIKQEDKIEPDFSQGLDSLGCPEQLLEDVKCPVCEIQLDKL
                     SILERTTHVDGCLFLTSTKLVYKSLKAASKQKVKKPKSAPKITSEERIEKSKDAIRNR
                     AKQIPDVKILNFTSCKFAVDAFCYGQHPEITHYFLSHFHADHYMGITKNWHNGIIYCS
                     RITAELLVLKYNVSEEILRILPFNETMEIEDTQVKVTMMDANHCPGSSIFLFRDSKEH
                     CILHCGDFRINKEMIQKLASYKINEIYLDTTYLDPTYNFPKQENVIDVVGTFCENIFR
                     GVYQHPLQQRITDFFTFRKRSKTLKPLICVGTYTIGKERIAIDIAKRLKTKLYAQSSK
                     REILNTFHWEELDTLLTSTPTEANVHLIPMQYMNLEQLEKYFHSYRNDFSQIIAIRPT
                     GWTFVSAKNNSTKWMKELSKSQILARIVKTKNDASRFDLESIEKQFNSDKVTQIYQVP
                     YSEHSSFRELSFFSILLDHTRIIPTVNMNNMQSIKNMDSWIFEWQQARAVQLVTIDDF
                     "
     gene            <613730..>615778
                     /locus_tag="PAS_chr3_0309"
                     /db_xref="GeneID:8200135"
     mRNA            <613730..>615778
                     /locus_tag="PAS_chr3_0309"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492483.1"
                     /db_xref="GeneID:8200135"
     CDS             613730..615778
                     /locus_tag="PAS_chr3_0309"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492528.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0309"
                     /db_xref="EnsemblGenomes-Tr:CAY70349"
                     /db_xref="GeneID:8200135"
                     /db_xref="GOA:C4R463"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R463"
                     /translation="MILSRLSRISGLHFRQQYVLSLSQRSTLIRQVCGTRVRSATASE
                     ETLVARELETPSTVRLRPYQKDCIESIMKVIRGGETRLAVSLATGGGKTVIFSNLLNE
                     IPSNKYNGQKTLILVHRKELADQAARTIKRFFPHMKIEIDMAGLRPTHDDDVDVVVAS
                     VPTLARNNSKNPRLFDYDPNEFKAIIIDECHHAISDSYIKILQYFNALSKDSSDGIIV
                     VGFSATLKRHDAQPLDKVFNTIAYEKDLISMVKEGYLSELSITKVEGAFSLDDVKLDK
                     TGDYQLQSLESSVNTAAVAELVLKTYLERKKVLGLKSSLFFCVNKQHVQDLCELFCAN
                     GIKAGFVSGNTPLLEREQIIKNFIDGKLNVLMNCNVFTEGTDIPNIDSIFLLRPTKSR
                     PLLSQMIGRGLRLHSGKTKCYVTDFVGTTHSGINVDATLEGITKRQMNSLLQFDQEMV
                     HGNRDYSKMLEEVPDYLRYTSFNDITSYINSIPKNLSKENQRSIEYKLYKQHSLPWIQ
                     LGIDSWGVSLADRSYLRIDKTKGKFELKRYIAVPYPKNGIKRKKLIFHSENLEEILTD
                     AERFLKEKGSKPLFLGSYPISNKQYEYLCKEFINVAQGSSGIQMEYFVPFLKRYLRKL
                     TKHQASVLIFAKMAGGAFALQRYIKYKMLSTKNIQDEKVPILKEEVMDKLAQKIKDNK
                     "
     gene            complement(<615821..>617152)
                     /locus_tag="PAS_chr3_0310"
                     /db_xref="GeneID:8200136"
     mRNA            complement(<615821..>617152)
                     /locus_tag="PAS_chr3_0310"
                     /product="UBX (ubiquitin regulatory X) domain-containing
                     protein"
                     /transcript_id="XM_002492484.1"
                     /db_xref="GeneID:8200136"
     CDS             complement(615821..617152)
                     /locus_tag="PAS_chr3_0310"
                     /codon_start=1
                     /product="UBX (ubiquitin regulatory X) domain-containing
                     protein"
                     /protein_id="XP_002492529.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0310"
                     /db_xref="EnsemblGenomes-Tr:CAY70350"
                     /db_xref="GeneID:8200136"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4R464"
                     /translation="MSSVDTFLAITNTEDAAVAQQFIEMAGGDIDTAVSLFFEHGTDA
                     TATDNNPVRSDEQLAQDLQNDAYNDEVRAPIQPVTEQLVDTLYPVSGNGIPIDPSTAI
                     FGSRPTGIFNQTFGGDQEEIDDDVDNQFETIMDEEGNIVQRHRSNYSRGIDVDNMTAT
                     QRRLANLFRPPFDIMEKYNLATAKTEARSKQKWILINIQDPTEFQCQMLNRDFWSNTD
                     IKDIVHENFVFLQYQKDSVNGDDYTNFYHFESFPHIAILDPMTGERLKVWSTVPNISD
                     WIEQVVDFLSSHSLTGATGSVTPLPQQRSNQAELISLDSAWEDAEEDGDEEESAPGSS
                     ESEGSSIQIINNNTTLAIKPIENEEPPQGPDSTRIQIRTSDGKRVVRRFLSSDTVRSL
                     FEFVKFYFKDIIENHEFQLTSQRVNLFESLGNTIEEANLKNASVLLEVIKD"
     gene            complement(<617219..>617971)
                     /locus_tag="PAS_chr3_0311"
                     /db_xref="GeneID:8200137"
     mRNA            complement(<617219..>617971)
                     /locus_tag="PAS_chr3_0311"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492485.1"
                     /db_xref="GeneID:8200137"
     CDS             complement(617219..617971)
                     /locus_tag="PAS_chr3_0311"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492530.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0311"
                     /db_xref="EnsemblGenomes-Tr:CAY70351"
                     /db_xref="GeneID:8200137"
                     /db_xref="UniProtKB/TrEMBL:C4R465"
                     /translation="MTLSKSKDPPHGEDLDLQEKNASESDPEDEILSLSQTETLHKHV
                     DEIDDLDIIEELQCKLKNDYKEISGALAGNYLERIDEMVDQIDSTMNRLNKDLSTFEK
                     KQKQAKRNNELAAANPIDIPIFKHAFQQALEPYVTEMKILENQTRYDFELYDQELHRD
                     RDIIWKQYLADVSKAREEIRERLSKELEEEIKPMPTPSLLNKEDTVWDPSRMFPAQQR
                     SSQGPENSIEDDDELDRDILLLRTLINRKANK"
     gene            <618158..>619693
                     /locus_tag="PAS_chr3_0312"
                     /db_xref="GeneID:8200138"
     mRNA            <618158..>619693
                     /locus_tag="PAS_chr3_0312"
                     /product="Component of the ESCRT-II complex"
                     /transcript_id="XM_002492486.1"
                     /db_xref="GeneID:8200138"
     CDS             618158..619693
                     /locus_tag="PAS_chr3_0312"
                     /codon_start=1
                     /product="Component of the ESCRT-II complex"
                     /protein_id="XP_002492531.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0312"
                     /db_xref="EnsemblGenomes-Tr:CAY70352"
                     /db_xref="GeneID:8200138"
                     /db_xref="GOA:C4R466"
                     /db_xref="InterPro:IPR001876"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR021648"
                     /db_xref="UniProtKB/TrEMBL:C4R466"
                     /translation="MTWKKIKATQSGRPFFDDIDEVIVYIQDDIGLYQDNTKLDKFQT
                     VRFYLTNKRLIFINELFPEENYYILLHEIQEVSLYQGFINSSPKLILDLVKTEGEETK
                     RMYRISWICTICSFSNHVQLDKPLAKFNEANNEINFKCSMCGIKPERLILKDGSSKAD
                     SFEPELKPVEATTASKRKHRCPQCTFVNHPSMLNCEMCNFPLRDKDSFDDSDILLGSK
                     DSTTFKLSFHDKKVQPFSDKLQHYIEKSQHDFLKRFNRMNMNVVQQPASPVGPSKETP
                     KKGIHDLENNSSNFIDSSFLNDSLSGLGRLMRHAEKLIRLSESMKPLMMNLHQCSHEN
                     HQLISLLKSNKPPHKINNGIIVESDTKKSLYHKEVARQLVEFILNYDLVQNDFISLCE
                     LYKLYNKSRGLNLLSPSTFKLICEQLENVNSIVKLYQIEYHNNNSFYIISKTSSTNYN
                     LSNKVNTLLEENPSDLKQLQIAMNNCNFSILKSVVDELCSEGVIVLDQSIGGNVYYIN
                     HYF"
     gene            complement(<619710..>620876)
                     /locus_tag="PAS_chr3_0313"
                     /db_xref="GeneID:8200139"
     mRNA            complement(<619710..>620876)
                     /locus_tag="PAS_chr3_0313"
                     /product="Component of the RAM signaling network"
                     /transcript_id="XM_002492487.1"
                     /db_xref="GeneID:8200139"
     CDS             complement(619710..620876)
                     /locus_tag="PAS_chr3_0313"
                     /codon_start=1
                     /product="Component of the RAM signaling network"
                     /protein_id="XP_002492532.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0313"
                     /db_xref="EnsemblGenomes-Tr:CAY70353"
                     /db_xref="GeneID:8200139"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013878"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028637"
                     /db_xref="UniProtKB/TrEMBL:C4R467"
                     /translation="MAFLFKRNPKAQELVRNLNDSLTKLESYPTDNSNRKKVVADISK
                     NLSQIKIILQGKIDNYEELDDENDDRLDMADSPSDYTDRVGSNTADLSIPGLAGSNVG
                     SPETDSTIDQISQLANECYITDLLYRLLLNIETLEFNSRKDVYILCTSLLRREIGNRS
                     PTIDYLLTHDYVIQLLMKAPEYHSNINILLSNILRECIKFEKVCRYCLNSELFWQYFK
                     YSQQSSFENSTDALITLNDLLANHHGLVQEFFSKQSNLDRFIENINKLITCNNYVTKR
                     QSIKLLSKLILQRSNYNLMTDYVNNSSNLKLIMINLSDKSKNLQYESFQVFKVFVANP
                     KKNRQILDILIKNREKLLFFLKEFNYNDKDTVFNEEKEFLIQQIEELPSKNNST"
     gene            <621802..>623726
                     /locus_tag="PAS_chr3_0315"
                     /db_xref="GeneID:8200140"
     mRNA            join(<621802..621908,622019..>623726)
                     /locus_tag="PAS_chr3_0315"
                     /product="Transporter, member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     c"
                     /transcript_id="XM_002492488.1"
                     /db_xref="GeneID:8200140"
     CDS             join(621802..621908,622019..623726)
                     /locus_tag="PAS_chr3_0315"
                     /codon_start=1
                     /product="Transporter, member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     c"
                     /protein_id="XP_002492533.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0315"
                     /db_xref="EnsemblGenomes-Tr:CAY70354"
                     /db_xref="GeneID:8200140"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C4R468"
                     /translation="MKFNVFRKSQNESASGSPESQNTDTEAQTHVTLLPGRAYTPYAT
                     SSFRQHSMLTTATVVYKIVCVISLPWVARIVDCFSRVTGFFIALVFLIATYVMFAASK
                     NVGMYLASQIFLGIGIPSYVMMERVFIADTTQILNRGLWTALPTAVASIPTLYVASIV
                     AEKMLEHSTWRWGYGMWAIIIPVSLAPLILIMWKLDRRAKRYGVTHNIKSTLNLPEGS
                     WYKKVAHLLYVELDIVGGLLMLTGLSLFFLPFTLTGSASILRWNEATTIVLLVIGFLI
                     LVLFVLWVLSKFPKRPFLSVSILKRPSVLMACTLPLFDAINTSLSGAYFPSVLQVSGH
                     FTVGEAARIPRAANVCQMVGAVLVGLLIKYTKTAKVFMVSGVCLIVLTQGFFCYLANN
                     NGGFGSELHWTVIKVFEGFGRGFYNIPTIISVQANSDPSQIAPSIAMFTMFNQMGAVI
                     GNSISASVWNELVIKRLTQYLPEASKSRAREIFGNIRVAIGYAEGTPEREAIDRAYRE
                     VLQKQGYISLGFLIPALILVFFIKGFDPTQRTSVNVGDDGEVVLTSAPGKDGEAQLNT
                     IAANLSSSPSNSDISEERESSEITSQEKKSELNESEAK"
     gene            <624226..>625249
                     /locus_tag="PAS_chr3_0316"
                     /db_xref="GeneID:8200141"
     mRNA            join(<624226..624261,624314..>625249)
                     /locus_tag="PAS_chr3_0316"
                     /product="Cytoplasmic GTP binding protein"
                     /transcript_id="XM_002492489.1"
                     /db_xref="GeneID:8200141"
     CDS             join(624226..624261,624314..625249)
                     /locus_tag="PAS_chr3_0316"
                     /codon_start=1
                     /product="Cytoplasmic GTP binding protein"
                     /protein_id="XP_002492534.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0316"
                     /db_xref="EnsemblGenomes-Tr:CAY70355"
                     /db_xref="GeneID:8200141"
                     /db_xref="GOA:C4R469"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R469"
                     /translation="MSTNSRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDV
                     EHSNLRFLNNMTLNLWDCGGQDVFIENFLNTSSQNPNSNNNIFKKCEVLLHVFDVESK
                     EVNKDIEIFQRVLKNLHQFSPNVKVFILLHKMDLIQVNKRDELFKIMFDNLQKIANPF
                     HFKLTGFATSIWDESLYKAWSSIICSLIPNISFYQQNLSKINDILNAREIILFEKTTF
                     LVISSTDRKLITNNDELDPKRFEKISNIIKTYKQSVNKIRTNFETIILNGMNTSIYLA
                     ELTNNIFIMIVMDNQRNDDDSTAIEDENLILEDIKIARSLFEKVENV"
     gene            <625496..>626894
                     /locus_tag="PAS_chr3_0317"
                     /db_xref="GeneID:8200142"
     mRNA            join(<625496..625554,625625..>626894)
                     /locus_tag="PAS_chr3_0317"
                     /product="Farnesyl-diphosphate farnesyl transferase
                     (squalene synthase)"
                     /transcript_id="XM_002492490.1"
                     /db_xref="GeneID:8200142"
     CDS             join(625496..625554,625625..626894)
                     /locus_tag="PAS_chr3_0317"
                     /codon_start=1
                     /product="Farnesyl-diphosphate farnesyl transferase
                     (squalene synthase)"
                     /protein_id="XP_002492535.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0317"
                     /db_xref="EnsemblGenomes-Tr:CAY70356"
                     /db_xref="GeneID:8200142"
                     /db_xref="GOA:C4R470"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:C4R470"
                     /translation="MGKLAQLVLHPLELRAAIQFKFFKQSLHPRQPTNERETLKHCYE
                     LLALTSRSFCTVILELNPELRNAIMIFYLVLRALDTVEDDMTIKPDIKIPLLRSFDEK
                     LNLKSWSFDGNSPDEKDRQVLVDFTDVLEEYHRLKPVYQDVIKDITHKMGNGMADYIT
                     DEEFNLNGVATVKDYDLYCHYVAGLVGEGLTHLIVEAGFGDPKLEDNMQLSESMGLFL
                     QKTNIIRDYREDLDDGRSFWPKEIWSKYADSLSDFSKRENYEKGLDCISELVLNTMDH
                     IKDVLVYLSSVYDFSSYNFCVIPQVMAIATLATVFRNEKVFETNVKIRKGTTCYLILK
                     ARTFEGACEIFSYYLRQIHHSCPITDANYIKIGIKCGELEQFLESLNPAPHVPPGATI
                     PQTPHFVKAERKRKLDRELVPTLAIESLKCDVFLSLVALGFLGVIYSISS"
     gene            complement(<626931..>628724)
                     /locus_tag="PAS_chr3_0318"
                     /db_xref="GeneID:8200143"
     mRNA            complement(<626931..>628724)
                     /locus_tag="PAS_chr3_0318"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492491.1"
                     /db_xref="GeneID:8200143"
     CDS             complement(626931..628724)
                     /locus_tag="PAS_chr3_0318"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492536.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0318"
                     /db_xref="EnsemblGenomes-Tr:CAY70357"
                     /db_xref="GeneID:8200143"
                     /db_xref="UniProtKB/TrEMBL:C4R471"
                     /translation="MLIFKRYKHIRPIFKTHAGGNSINVSRKQDLIHRDITEIRKNSK
                     DNNQLNLNICLKMKAYNRTPQTINNVFRLCNVLKQEKDFIPDNRVYYEIIKSINHKCD
                     LIGNTDRLLKDEKIQEIQILANTSLDLAQELISHNGPRCKISAPLREQLEKVVTKCQS
                     VLLLRRYLGLLKTIGTSDKYEYLRILTRFYFNSNQYELCFDSFWIMISKYEAGFTTKP
                     LNNVLNEFHLGYLIRWSSERNDEANILKMIELLEKNNKVHDFITDKTLYRLTTHSVQY
                     NNHKVLARLLQLKDDNSLFFNDYNFNENTLKEFLNCFSENGLVDETLTVIERILLLRN
                     QSTLDNELASHLIQCYANNKETNYLTVWDICKDINVDINTKDLYVLRYPQLATTADIR
                     NNFKALLDDLINHDSPLELKKKLLESIFVHIKTRVQTLALSSVPVELLSPKLLELYSY
                     YFKSTFPSKLTAYQFTILHKSITNEKLSPKCHYHLMLSQCHGNSHSTLNYFLFNYLNE
                     YQYLTPKILELIQMVIEETNDFQLKEFLNYYVQHSNNPDGGRWRELLHPEDDYFSIRI
                     LTRKNHQIIDGFGEYSYGIDHTNATRLASIG"
     gene            <629037..>630023
                     /locus_tag="PAS_chr3_0319"
                     /db_xref="GeneID:8200144"
     mRNA            <629037..>630023
                     /locus_tag="PAS_chr3_0319"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492492.1"
                     /db_xref="GeneID:8200144"
     CDS             629037..630023
                     /locus_tag="PAS_chr3_0319"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492537.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0319"
                     /db_xref="EnsemblGenomes-Tr:CAY70358"
                     /db_xref="GeneID:8200144"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R472"
                     /translation="MLRQIRTFCRSASAKQESKFNVFDRKVKLLQRTRAANDEESLQV
                     EYLRDEIARRTVHRLSFIKREAMNLLDFGCGSGNFVKTLLTPTEDELMKDNIDNVRPK
                     LKHVYMVDSCLPLLERNSFDDSFVTKINADEEEYSHEILQRKDFFDCAISNLSLHWIN
                     NLPGTFRNINDSLKEDGLFMGSMFATDTLFELRTSLQLAEMERRGGISPRISPFVDSS
                     DLGNLLQKANFNLVTVDVEEIIVNYPDVWCLMRDLQLMGENNAIANPPGPITKDMLIA
                     LDPIYRSLHGDEKTGALPATFRIVFMIGWKKSDKQPKPLERGSGQISLKDVL"
     gene            complement(<630044..>633178)
                     /locus_tag="PAS_chr3_0320"
                     /db_xref="GeneID:8200145"
     mRNA            complement(<630044..>633178)
                     /locus_tag="PAS_chr3_0320"
                     /product="Tubulin folding factor D"
                     /transcript_id="XM_002492493.1"
                     /db_xref="GeneID:8200145"
     CDS             complement(630044..633178)
                     /locus_tag="PAS_chr3_0320"
                     /codon_start=1
                     /product="Tubulin folding factor D"
                     /protein_id="XP_002492538.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0320"
                     /db_xref="EnsemblGenomes-Tr:CAY70359"
                     /db_xref="GeneID:8200145"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR022577"
                     /db_xref="UniProtKB/TrEMBL:C4R473"
                     /translation="MENSEIAIAKVADELLDQIDTLLEQVLSKERSSQQEKDLIQKIQ
                     QFQPCPQLIDKSLKKFVSSLLSAYQSNNMLDYLGSTEFSNTIGVIFYEITKLRGYKTV
                     QHCLDSNFYLIDSLIIRLQNSREYGIGWQENCLLLLWLGVLILSPFPLTPEKNQSIFR
                     LGSTFLNKVGKENEAASYLMANFVTRFKNSEVMSLFYESLPLRGTVNDKISFLRCNNL
                     VLKKANHADILPYLDMQFDTFVTELAETEDVVLLKLLIKNIGKIGVIFESTYQVDKVE
                     DIINILLNYIDSKETVIRYTVSRQFGKLSHKLPEEFRKDIVNCLIEELDINLLSTKLN
                     LDIQVDGDVIDINKYHGVLLVFSELALESLIPCEYLQLLTSIICQTIFVVQQRLSYSI
                     GNNVRDSSCFLSWSLIRKQMFHSREDCECLVVLFKQLMFSTCFDTDLMIRRASAAVIQ
                     ELLGRYGDFVLATIAPRSEINKLKIKLIELLDYVKLGNLQRSFQLPIEIGDELEGFMR
                     TDFIEFLKHLVIGWNYTVRCESSDILVKLLIKEGSPPDDIIDYLACMPTTDGSLMAIS
                     KLSSLLTNDKITELASRLKPALDTFEFDFHISPFHKGEEYLLILNSLQYDLTDTNWET
                     TFNIIRQDSREEVYEAFKTLIINLRTEIPKKYTEKWKYYIENKNKITSKALGYCPSIL
                     SSNFEEFLSLVFNQKIDYEVRAGLIGSISYFLSNHDHDLHLERMIDLLEDYTITNQGD
                     VGSYIRMAMMNLIENNLHKFKDFENSIDVQLFRLSVETMERLRWKSLELLLLIHPEWQ
                     GYLQKEPRTNATHFRNILEIYRHEILIPLIGAKNEQLSEISRSFWKGYAFSVGSSRSV
                     GPEVKAALRPLVMMIIAHEFNDDEFSQIIVNIMSNLKLVANPTDKDRANKLYNCTLSL
                     IVKLIDSNILTKIERDSLKTLFVRVYNLQLKAPIMRLGNCLAILKWIYQKAEECSDSK
                     SIEMQHGIMKRLIDLSLKHKSSNVRQISIQVLFELYYWKHQKQGAYDGTLELLEKLDW
                     NDNGLEKYVGRLPF"
     gene            <633575..>634375
                     /locus_tag="PAS_chr3_0321"
                     /db_xref="GeneID:8200146"
     mRNA            <633575..>634375
                     /locus_tag="PAS_chr3_0321"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492494.1"
                     /db_xref="GeneID:8200146"
     CDS             633575..634375
                     /locus_tag="PAS_chr3_0321"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492539.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0321"
                     /db_xref="EnsemblGenomes-Tr:CAY70360"
                     /db_xref="GeneID:8200146"
                     /db_xref="UniProtKB/TrEMBL:C4R474"
                     /translation="MAVVERIFNNMMPQKTKGPKRSGKGKKVGDNADNGNRNQALGHI
                     DEVNSIADIKDKPSLLGCDHYDDYFPKVSPYEIIGLEISTTSKPVPIEVSSIKRLNVC
                     LKSTFKQTLGLEEFSNARNDPIERLVTFKRDQENFIMADQGFNRSQNFTFDKPTASKR
                     SIVDNLEFKFTTNSNSSNGAKTPMSIFKIQNKLFSDVPTKSKRRRNEKLDNSRTISVR
                     TVLRMVDYSLVSDGEFTSMSMSECNTPTKHCNVLINDDDLAQAKRLVF"
     gene            complement(<634558..>638845)
                     /locus_tag="PAS_chr3_0322"
                     /db_xref="GeneID:8200147"
     mRNA            complement(join(<634558..634812,634920..636157,
                     636258..638327,638374..>638845))
                     /locus_tag="PAS_chr3_0322"
                     /product="Essential type II topoisomerase"
                     /transcript_id="XM_002492495.1"
                     /db_xref="GeneID:8200147"
     CDS             complement(join(634558..634812,634920..636157,
                     636258..638327,638374..638845))
                     /locus_tag="PAS_chr3_0322"
                     /codon_start=1
                     /product="Essential type II topoisomerase"
                     /protein_id="XP_002492540.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0322"
                     /db_xref="EnsemblGenomes-Tr:CAY70361"
                     /db_xref="GeneID:8200147"
                     /db_xref="GOA:C4R475"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002205"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR005996"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013757"
                     /db_xref="InterPro:IPR013758"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="UniProtKB/TrEMBL:C4R475"
                     /translation="MSSSEGFSDDDFIVSSASSSPKAKRHKPAAKPTRKTPPASNGSA
                     VNNSENGTTRSSTANNVNVSDQYQKLSQLEHILKRPDTYIGSVEKHESEQWIYNKETE
                     SMERKVVSIVPGLFKIFDEILVNAADNKIRDPSMKNIEVTIKPEENLIEVKNDGKELI
                     FGNLLTSSNYNDDQKKVTGGRNGYGAKLCNIFSTEFIVETYDKSSGKLYTQRWSQNMG
                     KTDKPVIKSIKKATEYTKVSFRPDLAKFNMTELDEDILGVLRRRVFDLCGSVRDISVK
                     LNGEKLKIRNFKQYVEMYVKALEHKNDPIKTEDSSLLPPPSSSSPSQTIVYQTLNDRW
                     EIAFAVSDSTFNQVSFVNSIATTSGGTHVNFIADQIVKKIEKEIKTKNKKAMIKPFQI
                     KNNMFLFINCLVENPAFTSQTKEQLTTRASQFGGKKTEVPDDFIKKILRTGIVDAILD
                     IAAMNADKALKKNDGSRKNRITGYPKLEDANKAGTKEGYKCTLILTEGDSASSLAVAG
                     LAVVGRDYYGVYPLRGKMLNVREASADQIMKNAEIQAIKQIMGFQHKKNYTPENINSL
                     RYGHIMIMTDQDHDGSHIKGLIINFLESSFPGLLKVPNFLLEFITPIVKVTITSGPEK
                     RKVIPFYSMPEYEAWREQNTESFKQKYYKGLGTSLAEEMREYFSQLDKHMKTFHALQD
                     VDPGFIDLAFSKKKADDRKEWLRGFEPGVHLDPDLSIIPISDFINKELILFSMADNIR
                     SIPSMLDGFKPSQRKILYGCYKRNLRSEIKVSQLAGYIGEHSAYHHGDQSLIQSIIGL
                     AQDFVGSNNLNLLQPIGGFGSRAQGGKDASAARYIFTDLSKITKKNFSCQGIGTGWST
                     NIPPFNPVDIVANIRRLMDGQEMEEMIPWYRGWNGSITKISADKFRMEGNIEQIDDET
                     IEITEIPAKTWTINMKEFLLNGIAGSEKQKSWIKDMEEQHGMDLKFVITLTKEEMKKS
                     LQMGLKERFKLITTINVGNMVAFDAAGKIKKYDNVNEIIEDYYHVRLDFYQRRKDHLA
                     EVLGNQLEKISSQARFVKMIIENELRVNNRKRIELIEELQRLNFPKFSKDGKPIWQQV
                     DQEEITEAEIKVEEEEEEEIDDENLLNKSVNIFASYDYLLGMPIWSLTRERYHKLLLQ
                     KAEKEDQLTELLKLSAKQIWNKDLEVFLEEWHAFLKEDEEKRASSFKKSGPAAKKKRV
                     RRVKKENDENDPDFGSKKPKTVAKKVLNPKTKPKSASLMGSLSDITSELDKNLESFMP
                     YFKVTQLRSAIAMPQKYKDTLFKLGLGKRGKISFRKVNPQQAGMLATVKELVKVELSE
                     ENVSQKQLRLQRKSNPGFTLERKD"
     gene            <639080..>640456
                     /locus_tag="PAS_chr3_0324"
                     /db_xref="GeneID:8200148"
     mRNA            <639080..>640456
                     /locus_tag="PAS_chr3_0324"
                     /product="Component of the commitment complex"
                     /transcript_id="XM_002492496.1"
                     /db_xref="GeneID:8200148"
     CDS             639080..640456
                     /locus_tag="PAS_chr3_0324"
                     /codon_start=1
                     /product="Component of the commitment complex"
                     /protein_id="XP_002492541.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0324"
                     /db_xref="EnsemblGenomes-Tr:CAY70362"
                     /db_xref="GeneID:8200148"
                     /db_xref="GOA:C4R476"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C4R476"
                     /translation="MEGQLVERTRGRPSERRSANKWGEVKNRILTRIKYPTNIVGQLT
                     PEQLDAFQLVFRIEEITQKLETHQVVPEEKLRSPSPTPIYNSNGKRINTIDIRYTEKL
                     EKERHVLVERAMKTVPGFTAPINYKRPGKTSEKLYLPTKDYPDINFIGLLLGPRGNTL
                     KKLQDESGAHIGIRGKGSVKTGRNNNAAGSHQSHMDDELHCLITSESQEKIKKAVALC
                     NEIIEKAIVSPEGQNDMKRGQLRELAVLNGTLRTTENRACTLCGELGHLRHDCPKKQS
                     FTQTVVCRNCGQTGHFARDCKFSGFENERAEDREIDQMMNDLNGDAPSYNMKTLNSST
                     EPGSVPIPQQDQINNLFQNPSKRPHIDDEASESKRPAIKAPLGLSVSVDPQPIQSLPF
                     PPGAGNSSFLPPPPPPMAGSSIPPPPPPAVTTKLPPPPPPPVSTRKPPPPPPPSVPTA
                     KPPPPPPQ"
     gene            complement(<640536..>642605)
                     /locus_tag="PAS_chr3_0325"
                     /db_xref="GeneID:8200149"
     mRNA            complement(<640536..>642605)
                     /locus_tag="PAS_chr3_0325"
                     /product="Essential splicesome assembly factor"
                     /transcript_id="XM_002492497.1"
                     /db_xref="GeneID:8200149"
     CDS             complement(640536..642605)
                     /locus_tag="PAS_chr3_0325"
                     /codon_start=1
                     /product="Essential splicesome assembly factor"
                     /protein_id="XP_002492542.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0325"
                     /db_xref="EnsemblGenomes-Tr:CAY70363"
                     /db_xref="GeneID:8200149"
                     /db_xref="GOA:C4R477"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4R477"
                     /translation="MSVMKNKAPADLQITAEQILLEAYESKDPSLKLTEHKINDLEEL
                     QQMQLKKRTEFENALRMNRLNVGQWLRYATFEVEQRDYRRARSVFERCLEVDPTNVTV
                     WIRYSQTELKGKNINHARNVLERATILLPRVDKLWYLYVNLEETLGNVVGTREIFLRW
                     INWRPSASVWKHFIYFESRYGELENCRKIFEKFVVASPKTETWLYWASFEKQHGDAVD
                     IRNVYTLAIDSAMSLGKEFLDESIFVSWCDWETQQKEFARVRALYKFGMDHLTGEKRD
                     RLFEQYTVFEKQYGDREGIEETIMQKRKIKYEQILSENPYDYDNWWLYIELLENYNDT
                     TELLEQAYTKVLGAVPQSESKPDWEKYICLWLKFLFVTELESKDISKAREGYKKLISL
                     IPHKKFTFAKVWTNYAYFEIRQDDLSQARKILGQSLGLCPKRKLFKSYIAMELKLKEF
                     DRVRKLYEKFIETWPRDVSIWIEYAEFENQMDDDERCKAIYEIATSEPEILPDEERKE
                     AFNKLIDYLLSTYQYSEARNAYSRFLILFKHDTVIWIKKAIFELTIPSEEQLNEYLLH
                     SNQNEDLEFQFEVTEESKERSRKEFEKALAFAKATNNKSMRVMLFQAFKEFESVYGTK
                     GSQEEINKRFPSVVRRREGDEEVVDYVFPDDQLDSKQVEDVEDSKPKSAMQKFLENAK
                     KWKEKQS"
     gene            <642694..>643590
                     /locus_tag="PAS_chr3_0326"
                     /db_xref="GeneID:8199855"
     mRNA            join(<642694..642706,642784..643328,643435..>643590)
                     /locus_tag="PAS_chr3_0326"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492498.1"
                     /db_xref="GeneID:8199855"
     CDS             join(642694..642706,642784..643328,643435..643590)
                     /locus_tag="PAS_chr3_0326"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492543.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0326"
                     /db_xref="EnsemblGenomes-Tr:CAY70364"
                     /db_xref="GeneID:8199855"
                     /db_xref="UniProtKB/TrEMBL:C4R478"
                     /translation="MTSLQTAVCTVSLSAVVLGYEFEGVLFLFILLINISLAVPMECK
                     VLSASQRLDDSVVQNVYLEAGDDDALSAETILLRTQRNNVYVSYDGGIVFHQIELRDK
                     GRIIDIIVNKHFPAYVYLITVDGYIYISSNGAVSFKRVKAPSKRSVDFALMKNPLSFH
                     KYDPKKFIYAGMKGCHFWNNVADCRTSSVNSLMLMERHLQIHVCLLALIILNLIDEKC
                     SVILSNPSKLLMSCGTNYR"
     gene            <643646..>644934
                     /locus_tag="PAS_chr3_0327"
                     /db_xref="GeneID:8199460"
     mRNA            join(<643646..644267,644387..>644934)
                     /locus_tag="PAS_chr3_0327"
                     /product="Putative membrane glycoprotein with strong
                     similarity to Vth2p and Pep1p/Vps10p, may be involved in"
                     /transcript_id="XM_002492499.1"
                     /db_xref="GeneID:8199460"
     CDS             join(643646..644267,644387..644934)
                     /locus_tag="PAS_chr3_0327"
                     /codon_start=1
                     /product="Putative membrane glycoprotein with strong
                     similarity to Vth2p and Pep1p/Vps10p, may be involved in"
                     /protein_id="XP_002492544.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0327"
                     /db_xref="EnsemblGenomes-Tr:CAY70365"
                     /db_xref="GeneID:8199460"
                     /db_xref="UniProtKB/TrEMBL:C4R479"
                     /translation="MFPPELGFDGSWAGATCKVFEGEETEHPLFFHLRRSVPSKYLYL
                     FYGALFKSNIEDGSYKLVSDYVNSDRRGVDFELISGLKGTALINIVINHEAIESGTVD
                     EKSTEIKTKITYDDASSWSYITPPPFDLERNEFICKGEEKLLEDCSLNFKGPTERRSI
                     EIKSSCDSGKGLLFGVGNVGKYSDRDPSNLALYFSNDGGVSWRVVAKVFTDKKIKVYD
                     LVYSSSGASRKFIVLENEYSVPDRERNIRNLYTIGFSYGDDDSEFWNSKTVFGGVQYN
                     DKHGTLFTLLSVSILGGAWFVYNRGIKRNGGFSRLNNFAGQNVESSSRPIEENNTDKV
                     VNCIIRVFFSTYQLFQRSVSTVFKELLPNRRSSSQDDVDQPFLGNQMDSERLVTF"
     gene            complement(<645442..>645639)
                     /locus_tag="PAS_chr3_0328"
                     /db_xref="GeneID:8199461"
     mRNA            complement(<645442..>645639)
                     /locus_tag="PAS_chr3_0328"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492500.1"
                     /db_xref="GeneID:8199461"
     CDS             complement(645442..645639)
                     /locus_tag="PAS_chr3_0328"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492545.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0328"
                     /db_xref="EnsemblGenomes-Tr:CAY70366"
                     /db_xref="GeneID:8199461"
                     /db_xref="UniProtKB/TrEMBL:C4R480"
                     /translation="MFIKAATRSKMTSSLFSTTFVVAFGLVASNNLLPCPVDHSMNNE
                     TPQELKPLQAESSTRKLNSSA"
     gene            complement(<645856..>647718)
                     /locus_tag="PAS_chr3_0329"
                     /db_xref="GeneID:8199462"
     mRNA            complement(<645856..>647718)
                     /locus_tag="PAS_chr3_0329"
                     /product="Subunit of the telomeric Ku complex
                     (Yku70p-Yku80p)"
                     /transcript_id="XM_002492501.1"
                     /db_xref="GeneID:8199462"
     CDS             complement(645856..647718)
                     /locus_tag="PAS_chr3_0329"
                     /codon_start=1
                     /product="Subunit of the telomeric Ku complex
                     (Yku70p-Yku80p)"
                     /protein_id="XP_002492546.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0329"
                     /db_xref="EnsemblGenomes-Tr:CAY70367"
                     /db_xref="GeneID:8199462"
                     /db_xref="GOA:C4R481"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR005160"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR006165"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="UniProtKB/TrEMBL:C4R481"
                     /translation="MSVVSKQYDIHEGIIFVIELTPELHAPASEGKSQLQIILENVSE
                     VISELIITLPGTGIGCYLINYDGGQNDEIYPIFELQDLNLEMMKQLYQVLEDHVSGLN
                     PLEKQFPIEHSKPLSATLFFHLRSLFYMAKTHKRTGRHYNLKKIFLFTNNDKPYNGNS
                     QLRVPLKKTLADYNDVDITLIPFLLNKPSGVKFDKTEYSEILFYDKDACSMSIEEIRQ
                     RISRHKEIKRVYFTCPLKIANNLCISVKGYSMFYHETPRKIKFVVNEGSTFKDVETKS
                     QFVDPTSGKEFSSEQLIKAYPLGADAYIPLNSEQVKTINRFNDIINIPSLEILGFRDI
                     SNWLPQYQFGKASFLSPNNYGDFTHSQRTFSCLLQSMTKKSKFAVLFGTLKNNAAPRL
                     FGMIPSTLPQYESCNLPQGFFLIKLPYLDDVRQLPPKIAPVDADLDVLVSLFSNLVGK
                     IHIKNGYQPQEYENPSLQWHFKMLRDDYLQLEHDIDISDPLEKQKYINSLDETKTKIM
                     KLRDYVKETADDDDPSRLANTLKELNQELNKISNFDIIANKKPKTPTTVDPVPTDDDI
                     INAWKAGTLNGFKVDQLRKYVRSRNNFLETASKKADLIANIDKYFQQKFKETKA"
     gene            complement(<647848..>648675)
                     /locus_tag="PAS_chr3_0330"
                     /db_xref="GeneID:8199463"
     mRNA            complement(<647848..>648675)
                     /locus_tag="PAS_chr3_0330"
                     /product="Trans-aconitate methyltransferase"
                     /transcript_id="XM_002492502.1"
                     /db_xref="GeneID:8199463"
     CDS             complement(647848..648675)
                     /locus_tag="PAS_chr3_0330"
                     /codon_start=1
                     /product="Trans-aconitate methyltransferase"
                     /protein_id="XP_002492547.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0330"
                     /db_xref="EnsemblGenomes-Tr:CAY70368"
                     /db_xref="GeneID:8199463"
                     /db_xref="GOA:C4R482"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R482"
                     /translation="MATFTSTEFNSENYDRFRPVYPDELYQQLVDYHVGAKGLCVDVG
                     CGSGQATFTLKKYFDKVIGSDISENQLAVARKRQPAGIEFRLGTGEDFSWLTETPDVI
                     TAAECLHWVDPQKFVANVANSLRDHGTLSYWLYTEPIFQNERANQVYNKFTYGSDYLG
                     PYWDPGRTHFRNHLKELNHILLDSELFDEVKISNFKQEEGVKNGDILYLEKEMTISDF
                     INFVSSWPSVFSWKQQRGKEGILDDFYNELNDCFEGGNMKVIWNSVLVFARRKQRVV"
     gene            <648941..>653278
                     /locus_tag="PAS_chr3_0331"
                     /db_xref="GeneID:8199464"
     mRNA            <648941..>653278
                     /locus_tag="PAS_chr3_0331"
                     /product="Protein involved in bud-site selection and
                     required for axial budding pattern"
                     /transcript_id="XM_002492503.1"
                     /db_xref="GeneID:8199464"
     CDS             648941..653278
                     /locus_tag="PAS_chr3_0331"
                     /codon_start=1
                     /product="Protein involved in bud-site selection and
                     required for axial budding pattern"
                     /protein_id="XP_002492548.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0331"
                     /db_xref="EnsemblGenomes-Tr:CAY70369"
                     /db_xref="GeneID:8199464"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR012966"
                     /db_xref="UniProtKB/TrEMBL:C4R483"
                     /translation="MNSLEMEGAIPLLKPSRGSSSSNLYETRNDSMEKLLQDIDDETK
                     SMATTNSGLERSNSKLRGPRILMNEEEEVCSLAIAEPGNNSETADLLDLSPSKKSVTI
                     DISPPEVLEYELQSSEEEIEEKYLGYCSDDEAIRGKRSELNWKPVPLKIDTQHIGKPL
                     PPIVPSPSEVSLKDEADQDLDDSIDDATIKQIVTKSTMDEKIEALLSEPLRAQDFDHQ
                     SYLEDERLGQLKTPTRIHNNRLKKKNYVQEILLSKNTSTNDMEENLIGLTNIFETDVR
                     NTPNNGSLILQLNRSNSVASQASIISGDRKLETSTTNKVSVPITLSDGIKGLSNEIVE
                     QLIPELQPAELFDQDLLESPRTLVGSVSIGEEDLDKVEGVVTSEVSNDIESSILQLLD
                     TNEAEPDNSHNEEDKESKDTKLKNRLEESGLSKQLEQLKEIKPVEESEESEDSEQSDH
                     SALSSHPVEEEEVPKETDHTHSRSPSITQFLYNVGKGFKEIITPTSSSKNLDQLAEKS
                     PENNEPELHTKEGEEFKPPEVIKVVTPNTSSLESLHGSEIVNTIDYSICNPVTIEHKS
                     SSDVREVKLEDTILNENDSILGNSTGINNIDEPEPISLENKESDDSEQTLASVSSLKK
                     DETFGLPELEQDSSFGRDLKVFIEDTGEKKVYDDDEEPPLLKKPKKHLPDEYSPQQEV
                     MSIWQTQPVAHHAVPKTFKPDIPSKISTLMNKKFRVLSNESTVVYEDTQVQGTSTRNS
                     SGSSGYRSISNNSCFSQLSNVSLGSDFGSQFQQFKYRKESNTNPVPKPNNIRRPSLKV
                     SQIWNRGSPYSSSNQLDQSMEGNFELHRLKKLVSNTDTDQIAFRKIQVGAKNNQKQDF
                     DMISERGSIMCLDNSLEIEDFNTMAPPKATSVFNTQAKNSSYLPTSLTEEIDKDLEYT
                     RKRRVSGLLQSPLLAYDNELRKQNHLEASANMNVRRTIEKNSPTKSVISNMSNHTMKK
                     QLYYPTTPTSRMVDESAQLPFVSQSAKSNVHTGSSKFLNRIRAESDEVVEPHTPIVNS
                     YSPSKEDQHLTSVVIPQKSTASKFNINVEKNTKVLSTPQSRSKPTLAEMKRKAMSSPS
                     KPRPLSADLVSGERGRFFLNIKGIKDIELPELQEHNATFTMTLDNTIHTIKTPPSSLL
                     EGSIDQEFEFIVPSSPLEVFLTFKLEYTKQKEILTEVTETKLVKSGNFFGRLFGFKHK
                     ITTTKVVPKKTKADSWEHKVAIDGSFAKGYISFQDYETSTCGKLRAFTLNLFNEWETY
                     KDIGVQERKRKKPYCIAKLEMEMLFIPRTNVYEIIPPSIESAQEQIRQYNQIHDAFHE
                     GFLYQEGGDSPIWTRRFFKLEGSDLIAHTETSKKPRARINLRRVTDISYPGKVYEGAE
                     SEKRVFSDSLVLNDGFKLVFIDGEVIYFGADSKAERDIWVDKLEFALARHRFGLQPWV
                     KLMSQQSHD"
     gene            <653646..>654776
                     /locus_tag="PAS_chr3_0332"
                     /db_xref="GeneID:8199465"
     mRNA            <653646..>654776
                     /locus_tag="PAS_chr3_0332"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492504.1"
                     /db_xref="GeneID:8199465"
     CDS             653646..654776
                     /locus_tag="PAS_chr3_0332"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492549.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0332"
                     /db_xref="EnsemblGenomes-Tr:CAY70370"
                     /db_xref="GeneID:8199465"
                     /db_xref="GOA:C4R484"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:C4R484"
                     /translation="MTVSGKLEITPLPNKPLGASVTLPRGVTDPSKLSDEDFKTLQAA
                     LETYLVLVIPNQAELPPTSQYDLTVRFDPSCQGSYGHDEKLFHHKESVLAKDGKCIPD
                     RTEVVMVGNGSFEAGHAPGMKAFELEHPSQSTFHKDVLTEEEKANGQTRFYRWHIDSA
                     LYGLSPPKVTTLLGIQVPKCDEKQKIIYEDNGEEFELVKGATAFASGATAFKLLSPED
                     KEKALNTTVVYAPHPYIFIGKTKATSDGLTIVSEGKEIGLDKLPPWEESKVKKLPMVW
                     TNPTTGEHHLQVHGCCVYQLINNKTGEVTELEEARKEVHRLMRPAISPQHIYAHAWNK
                     GDLAIFFNQGVWHSVTGEFQPHENRLMHQCNVASGYDPVTKV"
     gene            complement(<654855..>655799)
                     /locus_tag="PAS_chr3_0333"
                     /db_xref="GeneID:8199466"
     mRNA            complement(<654855..>655799)
                     /locus_tag="PAS_chr3_0333"
                     /product="Subunit of cleavage polyadenylation factor
                     (CPF)"
                     /transcript_id="XM_002492505.1"
                     /db_xref="GeneID:8199466"
     CDS             complement(654855..655799)
                     /locus_tag="PAS_chr3_0333"
                     /codon_start=1
                     /product="Subunit of cleavage polyadenylation factor
                     (CPF)"
                     /protein_id="XP_002492550.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0333"
                     /db_xref="EnsemblGenomes-Tr:CAY70371"
                     /db_xref="GeneID:8199466"
                     /db_xref="InterPro:IPR007854"
                     /db_xref="UniProtKB/TrEMBL:C4R485"
                     /translation="MDEDDEYLYGSDDEQPQQIGAPETKTASSEKSSTAVKTETGPVS
                     DDEDDNDNSDYSDSDSDIDIVIGALEPSTQPAASTTASSAVPEDNPGENDDAATQVPS
                     AAGKLRIATGSLDVDKVGEYDGKPITQLELQDLKEKPWRLPGSDLADYFNYGFDEFSW
                     SYYCSKQDKTRKEFNPAKLMNELLPAGGFPPSGMPPMPGMPGMPPMPGFMPGMPGMPP
                     MQGMQGMQGMPPMQGMPSMPSMPSMPGMPPMFNNNPANGSSSSSAQQQQAPKRPVNER
                     DSADRERERNRERDRERDAYRDRDRDRDRDRDRRRRRN"
     gene            <655890..>656438
                     /locus_tag="PAS_chr3_0334"
                     /db_xref="GeneID:8199467"
     mRNA            <655890..>656438
                     /locus_tag="PAS_chr3_0334"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492506.1"
                     /db_xref="GeneID:8199467"
     CDS             655890..656438
                     /locus_tag="PAS_chr3_0334"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492551.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0334"
                     /db_xref="EnsemblGenomes-Tr:CAY70372"
                     /db_xref="GeneID:8199467"
                     /db_xref="UniProtKB/TrEMBL:C4R486"
                     /translation="MNICFAECLVELFNERDINKLVNQLLRDTRGYDGLLTWNSLLKG
                     NAQVLTESVLDNYDNQGYDICSFLQELMVKLSQELDLVKGMRGKRCRYQFQSTFASIK
                     GGSHQYLIESHDLAKADVILSRCLFVLNEQENIFINGDYNLVGSIYYNTELQHYFYVK
                     GECRSNPNDLRRVDVFLESSWS"
     gene            <657295..>657771
                     /locus_tag="PAS_chr3_0335"
                     /db_xref="GeneID:8199468"
     mRNA            join(<657295..657296,657495..>657771)
                     /locus_tag="PAS_chr3_0335"
                     /product="60S ribosomal protein L43"
                     /transcript_id="XM_002492507.1"
                     /db_xref="GeneID:8199468"
     CDS             join(657295..657296,657495..657771)
                     /locus_tag="PAS_chr3_0335"
                     /codon_start=1
                     /product="60S ribosomal protein L43"
                     /protein_id="XP_002492552.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0335"
                     /db_xref="EnsemblGenomes-Tr:CAY70373"
                     /db_xref="GeneID:8199468"
                     /db_xref="GOA:C4R487"
                     /db_xref="InterPro:IPR002674"
                     /db_xref="InterPro:IPR011331"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:C4R487"
                     /translation="MSKRTKKVGIAGKYGVRYGSSLRKQCKKLETQQHAKYDCAFCGK
                     KTVKRQATGIWSCKACKKTVAGGAYTVSTAAAATVRSTIRRLREMAEA"
     gene            <658126..>658866
                     /locus_tag="PAS_chr3_0336"
                     /db_xref="GeneID:8199469"
     mRNA            <658126..>658866
                     /locus_tag="PAS_chr3_0336"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492508.1"
                     /db_xref="GeneID:8199469"
     CDS             658126..658866
                     /locus_tag="PAS_chr3_0336"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492553.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0336"
                     /db_xref="EnsemblGenomes-Tr:CAY70374"
                     /db_xref="GeneID:8199469"
                     /db_xref="UniProtKB/TrEMBL:C4R488"
                     /translation="MSSKNIENTTSSRGSDNTVIVQDSFTDVLTGWKVEQQDPSGTVT
                     ARDGILEIIQPSGATIWLKQKLVGNYEITFDATPIPFTIEGTKFIDRISDLNMFWNAT
                     DPTTEDGDVTKNHFDASLNSYNSLNLYYVGFGANSNGTTRLRRNDGSVGRPQITGYST
                     DEHRTVDDHAGPMSEYTRLYANTPTRVKIASIRPTKDDPVNLKWYANEKLIFGYEDAK
                     PYLEGWFGFRTITSHWKISNFKVTRLNE"
     gene            complement(<659902..>660771)
                     /locus_tag="PAS_chr3_0337"
                     /db_xref="GeneID:8199470"
     mRNA            complement(<659902..>660771)
                     /locus_tag="PAS_chr3_0337"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492509.1"
                     /db_xref="GeneID:8199470"
     CDS             complement(659902..660771)
                     /locus_tag="PAS_chr3_0337"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492554.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0337"
                     /db_xref="EnsemblGenomes-Tr:CAY70375"
                     /db_xref="GeneID:8199470"
                     /db_xref="UniProtKB/TrEMBL:C4R489"
                     /translation="MFNLKTILISTLASIAVADQTFGVLLIRSGSPYHYSTLTNRDEK
                     IVAGGGNKKVTLTDEGALKYDGGKWIGLDDDGYAVQTDKPVTGWSTNGGYLYFDQGLI
                     VCTEDYIGYVKKHGECKGDSYGMAWKVLPADDDKDDDKDDDKDDDKDYDDDNDHGDGD
                     YYCSITGTYAIKSKGSKHQYEAIKKVDAHPHVFSVGGDQGNDLIVTFQKDCSLVDQDN
                     RGVYVDPNSGEVGNVDPWGELTPSVKWDIDDGYLIFNGESNFRSCPSGNGYSLSIKDC
                     VGGTDIGLKVWEK"
     gene            complement(<661108..>661725)
                     /locus_tag="PAS_chr3_0338"
                     /db_xref="GeneID:8199471"
     mRNA            complement(<661108..>661725)
                     /locus_tag="PAS_chr3_0338"
                     /product="Flavin-linked sulfhydryl oxidase localized to
                     the endoplasmic reticulum lumen"
                     /transcript_id="XM_002492510.1"
                     /db_xref="GeneID:8199471"
     CDS             complement(661108..661725)
                     /locus_tag="PAS_chr3_0338"
                     /codon_start=1
                     /product="Flavin-linked sulfhydryl oxidase localized to
                     the endoplasmic reticulum lumen"
                     /protein_id="XP_002492555.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0338"
                     /db_xref="EnsemblGenomes-Tr:CAY70376"
                     /db_xref="GeneID:8199471"
                     /db_xref="GOA:C4R490"
                     /db_xref="InterPro:IPR017905"
                     /db_xref="UniProtKB/TrEMBL:C4R490"
                     /translation="MITFNKRIATLAATLFSFIVLYTLFNSGAQFSNQLDQPVPLKTP
                     ELIIPNQSTENDPPLPFMPKMANETLKAELGNASWKLFHTILARYPESPSENQKSTLN
                     DYIYLFAQVYPCGDCARHFNLLLQKYPPQLSSRQVAAVWGCHIHNQVNKRLEKPQYDC
                     SNILEDYDCGCGSDEKEVDDTLNNETIEHLQSIKITEKESEQFGR"
     gene            <662065..>663132
                     /locus_tag="PAS_chr3_0339"
                     /db_xref="GeneID:8199472"
     mRNA            <662065..>663132
                     /locus_tag="PAS_chr3_0339"
                     /product="Protein that interacts physically and
                     genetically with Tap42p, which regulates protein
                     phosphatase 2"
                     /transcript_id="XM_002492511.1"
                     /db_xref="GeneID:8199472"
     CDS             662065..663132
                     /locus_tag="PAS_chr3_0339"
                     /codon_start=1
                     /product="Protein that interacts physically and
                     genetically with Tap42p, which regulates protein
                     phosphatase 2"
                     /protein_id="XP_002492556.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0339"
                     /db_xref="EnsemblGenomes-Tr:CAY70377"
                     /db_xref="GeneID:8199472"
                     /db_xref="InterPro:IPR007303"
                     /db_xref="UniProtKB/TrEMBL:C4R491"
                     /translation="MTDRKINIDSIHIDNARKMSQLTQKSRIPARPGQSMTTNLTQKW
                     SSSPKVAHHVSVPALSTKTSTSSHNSCSNPQCDHCGSVIVPAPVATLPLTDAPSISIG
                     NWEVFTTRKPILNSQDTEQLEKTLGFPIPEMTFGHNKVQVFKLSEDRSIEWSIDFNAI
                     DALKMVRKNVDPSELLQVSYAQDWVNARQHRKGDEIMEIFRPFDWSYTSDYKGTITSE
                     VPMTIDNSKAIPTSKLQTGSILFFNDMILFEDELGDNGISLLNIKIRVMKDCLLILQR
                     LFLRVDNVIFRVYDTRVYIDFEKLEVIREFKRLEASYQEIRLQINVGTGDPRALMRDT
                     AWVADHCKEVFKEREYVQLSG"
     gene            complement(<663233..>665257)
                     /locus_tag="PAS_chr3_1177"
                     /db_xref="GeneID:8199473"
     mRNA            complement(<663233..>665257)
                     /locus_tag="PAS_chr3_1177"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492512.1"
                     /db_xref="GeneID:8199473"
     CDS             complement(663233..665257)
                     /locus_tag="PAS_chr3_1177"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492557.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1177"
                     /db_xref="EnsemblGenomes-Tr:CAY70378"
                     /db_xref="GeneID:8199473"
                     /db_xref="GOA:C4R492"
                     /db_xref="InterPro:IPR000195"
                     /translation="MSQNSSIGKGNQSPPLFDLYEGHQEGSETEATSAAKYPNLFKSE
                     TTITDLPELVKLLHKFLETKNVTGLALIARQKGLPPSMRAKVWPLLLRTHPFVLKPYI
                     TSDDDDGDDVDGEEEEQEDDLHSSTPDNSTTSSNDTEGSDNEYPSSIPIHRIRSELQR
                     YTIRSNYNKDIIMSLSPQVRQLFEVQEQIFHTIERAVARFLKKWGSIVHYDPGLVWLG
                     LALAEWIPPLPEYSYILCGREHVARNGTKLRDINDDNFQRLYVNDDISSIILNYQSED
                     AKFSINENKEPSNDKSNKHQKNLSFAELYERMVLVVLHSPEQSDVVETDSMHERTNNI
                     LQTIPTKGGSISERVSFFLHCFRHLLPELSNYFSEEDILNGYNNSDEWVIWWLKWGGA
                     RAWSRFDRGRVWDYLLGWRNGLPANPNSKTEILRHQEELEEVRSCLDSHTLELLGPDL
                     FWNPLVKEDVDSTKKPEPESCALSRKESLKSMLSTLSLTNNTALEWSSSSVGLDERER
                     QSNHRDTLLQIPYSQIDPHSALVFIAVAFLKSKEFALLELESTEILEFLNKSSSLKFN
                     GFQSLISDPKWDTEDADVRKIMDSYNNSPEDRDVRHLPSSGISYTAEKDSKTNSKGKR
                     AFSPSPPSDLSLTGRYRSQPKRSPRGIENVITEAGELWRKWSWQELVEDN"
     gene            complement(<665692..>668235)
                     /locus_tag="PAS_chr3_0340"
                     /db_xref="GeneID:8200209"
     mRNA            complement(<665692..>668235)
                     /locus_tag="PAS_chr3_0340"
                     /product="Subunit of the core complex of translation
                     initiation factor 3(eIF3)"
                     /transcript_id="XM_002492513.1"
                     /db_xref="GeneID:8200209"
     CDS             complement(665692..668235)
                     /locus_tag="PAS_chr3_0340"
                     /codon_start=1
                     /product="Subunit of the core complex of translation
                     initiation factor 3(eIF3)"
                     /protein_id="XP_002492558.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0340"
                     /db_xref="EnsemblGenomes-Tr:CAY70379"
                     /db_xref="GeneID:8200209"
                     /db_xref="GOA:C4R493"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR027512"
                     /db_xref="UniProtKB/TrEMBL:C4R493"
                     /translation="MAPNYNHYNFRPENILKRAEDLIQVDQSDAALETIYEFFTSKRV
                     RTGQVSEFEPIALLFVKLSVDLRNGKLIKDGLHQYKRIVQNSENGFQSVETVVKKFLQ
                     LAEEKLVNAQEKADDLAADEEDDEDQDVSPEAILLSAVSTDDTKGRSDRALVNPWIRF
                     LWESYRSVLDVLRNNKNLEVFYSVVAQQAFQFCLKYQRKNEFRKLSEILRYHLLGVQP
                     QQGIVKNDYNVDLNDPETLKRSLDLRFQQLNVSVKLELWQDAFKSVSDVHNLMTVSKR
                     QPNPAMMVSYYENMAKIFAVSDNLLFHAAAWRKFFNLFSQSPFATKEQLNHYSSIYLL
                     AALSVPDEISSEESASSSLKLASLLNSSTIPSREYILQNLVSRKILQHVDEELLQLYN
                     YLEVDFNLITLKQRIAPILSKIESNDSYKAYVKPLSQILLRKLIRAVGDVYDTIKLEY
                     LVALATFEGSFKLSPQEVEDVVLDVAREGAIHVKINHDSKIVTFKWNPFDELDLADSK
                     KSSLSPANLIRYQLSALAETLSVAVDRTKGGALEVEKAKSHSLVEERINSQFPSEHKE
                     ISSRHEVLGERAKQLKAREEERKAQEAKLEQERLLAEKKAQEERAEAEALRKQEEMLK
                     LEREKIIMSEKKKVADEINKKGIIKVTDEQLKEMSANDLKALQLQQLSKDKEQLDIML
                     RSLSKKSDYLERALRKYEAPLLVKKLEEKEAEDEAAAELIKKEIVSKAKEAHDRKVET
                     HNRLKRMEGEFGQFVGELRREFLDAKRDKARQALEKAKQERIAEVIAERKKEIAEEAS
                     RKAAEEARKVAEESRRVAEEARKAAEAEAAKPKPMTFAQKMALKRQGRI"
     gene            <668691..>669209
                     /locus_tag="PAS_chr3_0341"
                     /db_xref="GeneID:8199474"
     mRNA            <668691..>669209
                     /locus_tag="PAS_chr3_0341"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492514.1"
                     /db_xref="GeneID:8199474"
     CDS             668691..669209
                     /locus_tag="PAS_chr3_0341"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492559.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0341"
                     /db_xref="EnsemblGenomes-Tr:CAY70380"
                     /db_xref="GeneID:8199474"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:C4R494"
                     /translation="MAKRLTVGKGEDPYNEPIPDSELKFYQRKGAKRKRPIPKFLSKH
                     DQKVLKQVRNKAYCLDLVFNLCGFRFGWSAIVQLIPVIGDVISLMLGLRLIRAAQKIE
                     GGLPQVLVSQMTMNSIFDFAIGLIPFVGDIINIAYKANSRNFMILEKHLTKGHRKEFE
                     KLVSLQEEEPPV"
     gene            complement(<669237..>671513)
                     /locus_tag="PAS_chr3_0342"
                     /db_xref="GeneID:8199475"
     mRNA            complement(<669237..>671513)
                     /locus_tag="PAS_chr3_0342"
                     /product="ATPase required for the release of Sec17p"
                     /transcript_id="XM_002492515.1"
                     /db_xref="GeneID:8199475"
     CDS             complement(669237..671513)
                     /locus_tag="PAS_chr3_0342"
                     /codon_start=1
                     /product="ATPase required for the release of Sec17p"
                     /protein_id="XP_002492560.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0342"
                     /db_xref="EnsemblGenomes-Tr:CAY70381"
                     /db_xref="GeneID:8199475"
                     /db_xref="GOA:C4R495"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:C4R495"
                     /translation="MEKLGFTKRNAPKVHVLKIVNSPGNEFAIMNTLAVHPNDFPDNH
                     YVICDNRYVLTTKTSNKLEPGTVGAYINQRLWASWSIGQEIPVSSFDMFKSTGQQSYL
                     GSMNLEISFRSKGKATQREFDQEELAEQFIARFESQIFQPTQLMIFEFQGNLFDIGVK
                     SVQIVDLGQISLDSVPTSTSITSKGILIKQTQINFFKGSDGLVNLKASSTRPNADAVI
                     RPDFKFEDMGIGGLDLEFTKIFRRAFASRIFPPGLIDKLGITHVKGLLLYGPPGTGKT
                     LIARRIGSMLNAREPKIVNGPEILSKYVGSSEENIRNLFKDAEVEYKAKGDASSLHII
                     IFDELDSIFKQRGSRGDGTGVADNVVNQLLSKMDGVDQLNNILVIGMTNRRDLIDEAL
                     LRPGRFDVQVEIHLPDEAGRKQILEIKTKKMRENNMLAPDVNLDELAHVSKNFSGAEL
                     EGLVKSASSFAINKHIKVGTVGDISGNLANVQVTRKDFFGALDEVKAAFGVHEEDLHT
                     SIAGGILKFSTTIDEILSHGQRYIKQVKESRNTKFISLLMHGPSGSGKTALAASIALA
                     SKFPFVRLISPEAMVGMSESSKINYIDNTFRDAYKSPLNILVIDNLEGLIDWVPIGPR
                     FSNPVLQALKVYLKRQPPDGHRLLIISTSSSYSVLKQLDILNCFHNELAVPNLKSLEE
                     FKSVMDAAEFMNDEIRRTVVKQLYGVFGTNKLDIGIKRALVNIDTAQFDEDEVNELVE
                     LMAPSLVRENQSGSPSHY"
     gene            complement(<671904..>672437)
                     /locus_tag="PAS_chr3_1178"
                     /db_xref="GeneID:8199476"
     mRNA            complement(<671904..>672437)
                     /locus_tag="PAS_chr3_1178"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492516.1"
                     /db_xref="GeneID:8199476"
     CDS             complement(671904..672437)
                     /locus_tag="PAS_chr3_1178"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492561.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1178"
                     /db_xref="EnsemblGenomes-Tr:CAY70382"
                     /db_xref="GeneID:8199476"
                     /db_xref="UniProtKB/TrEMBL:C4R496"
                     /translation="MATTLQSLVTLFLFLGSTFAYQLKAIDFAQNSFNLATLEFDSKW
                     KLHTGEQLDLPSDLYRICLDEGCFNYKRLSSPIAQDIKLTINKHNDIENVAFFDASQK
                     GLNLIVEQIRQAPIPKLPRKEKKIKKIRSDNKLELKEVIDEEAEVNVDNRSFIQKYWM
                     YIVPALLIMLISGNQNQ"
     gene            <672548..>673711
                     /locus_tag="PAS_chr3_0343"
                     /db_xref="GeneID:8200210"
     mRNA            join(<672548..672652,672710..>673711)
                     /locus_tag="PAS_chr3_0343"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492517.1"
                     /db_xref="GeneID:8200210"
     CDS             join(672548..672652,672710..673711)
                     /locus_tag="PAS_chr3_0343"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492562.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0343"
                     /db_xref="EnsemblGenomes-Tr:CAY70383"
                     /db_xref="GeneID:8200210"
                     /db_xref="UniProtKB/TrEMBL:C4R497"
                     /translation="MVNRPLDIMIKVLLFLLSLSSLVKALDDSIDKNSVYTINYLNHA
                     ISPTSEKIVTLRSTDDQYFECLFNDEIDTDQKLHQKQILKTLPAQYNLSEIPELQTEI
                     NSAFNILENYNLNDAQPTKDRYWTYQIINGKLYQYNGNLRIVLANIPKNLTREDIVLE
                     KNMHQSVFLSLSLQNGAICDLTFTPRKTNIRFQYVNKLNTLGIVSADEIQTCEYEILI
                     NVPKFKDTIFQYGFLEPLKKIDCYSSDSSMINLADYQISVLSHKWFLGAKDFRLILIT
                     DVSNPPVISIEELNLIFQTFPKYGPPELGITGEISPHDTFIFRIPVYSYNRTKFGDVL
                     VEQNIRGEKRFLFTEDRIPHDTPNFRVYNGVNVN"
     gene            complement(<673741..>675261)
                     /locus_tag="PAS_chr3_1179"
                     /db_xref="GeneID:8199477"
     mRNA            complement(<673741..>675261)
                     /locus_tag="PAS_chr3_1179"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492518.1"
                     /db_xref="GeneID:8199477"
     CDS             complement(673741..675261)
                     /locus_tag="PAS_chr3_1179"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492563.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1179"
                     /db_xref="EnsemblGenomes-Tr:CAY70384"
                     /db_xref="GeneID:8199477"
                     /db_xref="UniProtKB/TrEMBL:C4R498"
                     /translation="MTRTNESSKDIFNEFTADYFEVVKHLQKPQNFITELQFPKVINV
                     QDPSLIAGSYYQLVDGKDLKPTELVTISDRIKSGHYKTIYSIFHDLTLVCLILINERN
                     RDSEDYVKIDLFYKSMVELLIREAGRFLFNYRQLRESVDSRVLDDYTSEFEESMTKDF
                     NKVSTFFVSSNGECLTTFITPNAPLFSSLNNKSSLDAREAVVNEGDFNLTKVIPHVPS
                     ISSQPLNKISPQYNNEPHPATKPTDLLPNLFHLNWYALPMGQWLTHNKGNDFSFAPTI
                     DEEKSAISSELKGLRWLEQAGFRKLGDIAEKLSRPSKNETDNELQKDEPKRIEKELPA
                     PVDQETKNGHTGTDTSTKLENTDKEVQVNGSEDYKIKLDNLLSWTPGSFVEEDEIEAI
                     RSNKEQELISKLLIDLSQLRQERYKASPKIDPANPVTVLKPSLKEKRLYFKIKRLIQL
                     VIQTRNVTPKDLKLDVSFKLPICQTTYSGTLPASVPIYTKNPSSRVSALTKKRRKY"
     gene            complement(<675417..>679229)
                     /locus_tag="PAS_chr3_0344"
                     /db_xref="GeneID:8200211"
     mRNA            complement(<675417..>679229)
                     /locus_tag="PAS_chr3_0344"
                     /product="Essential DEAH-box ATP-dependent RNA helicase
                     specific to the U3 snoRNP"
                     /transcript_id="XM_002492519.1"
                     /db_xref="GeneID:8200211"
     CDS             complement(675417..679229)
                     /locus_tag="PAS_chr3_0344"
                     /codon_start=1
                     /product="Essential DEAH-box ATP-dependent RNA helicase
                     specific to the U3 snoRNP"
                     /protein_id="XP_002492564.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0344"
                     /db_xref="EnsemblGenomes-Tr:CAY70385"
                     /db_xref="GeneID:8200211"
                     /db_xref="GOA:C4R499"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R499"
                     /translation="MGKYRKRFNEKARSGMLLKQATLKRARNKQFFRQPDEIPEDSPD
                     QNESKDEIVDTNAEYLKPETDKEKEERKRQMHEMLFEQHKESKVSRNKRKRMEKYIDH
                     QLKREEKQILLQKLQETKFDTSLLQSSKRLGSSKLTRKEEIVEALSLEKQGRGNDRTN
                     DILYEEREVKQWDEINDGDDISEDSGKDEKEDMAAARVSGFIDHRPTALGGTGSGFSF
                     QNIPKVAKRKNEVIKKYNWRQRLEEEESKKKRQELENDFHDSDEDGNENENDSEVPDE
                     ASESSQPDGSGLDDEDDDFRGFSDNSDNENGFDQDNAIENLEDTSDSDSSTSEDSQHS
                     SFEEDSDQTEIPTSSRGKSFKDWAESQLKEINGEANIIQTELPHRDYTPLDRPEDKED
                     DLEDSYIPIDGNNKRKVFYVTVNRSETIQNIRSKLPVFGEEYRIMEAIHNNDCVVICG
                     ETGSGKTTQVPQFLYESGYGHPDSETPGMIGITQPRRVAAVSMAERVGTELGDHGSKV
                     GYQIRFDATIKEDTAVKFMTDGVLLREMMNDFLLLKYSAIIIDEAHERNINTDILIGM
                     LSRILKLRAKYHEQDPSKFKKLKLIIMSATLRVSDFSENRVLFEVPPPILKVDARQFP
                     VSIHFNRRTAFNYVEEAVRKSIKIHKNLPKGGILIFLTGQNEINQVVKKLRNQFPTGN
                     SQESVPQVAVHPENAVVEPEEVDLDVNIAEMEDDYDSEGDREEGEEEGFTEELEEDQT
                     SNDPLYVLPLYSLLPTREQMKVFKAPPNGARLCVVATNVAETSLTIPGIRYVVDCGRS
                     KERRFNEDTGVQSFEVDWISKASADQRSGRAGRTGPGHCYRLYSSAVYENDFPQFSIP
                     EILRMPIESVVLSMKSIGIDNIVNFPFPTPPDRNALSSAEKLLWYLGALTRDKKITSL
                     GKTINFFPLSPRYSKVLITGNQHGCLPYLIAIMSALSVGDPFLYEHELGIDSRIQQKD
                     EDDDSSDSDEDTKKERPVRESVEDIEARRNLRRKFNESRNQFSQLDKNSDAFRLLSVV
                     CAAGHVPRDKLGQFYQENFVRPKIMEEIEKLRKQITHIVKVNTSKDRIGIVEEVDLKL
                     GVPTKVQIAAMKQMIASGFIDQIAIRGDLASQDCSVTNKTAIMNIPYATLFPSKTYDQ
                     EDIDQFVYIHPSSIICSSASVPPDYLVYFSLNLGSNRRAVNKLRMKPLVNIAGKPLSN
                     VAKSSGLITFSKPLEYPYAPKYITSQKRECYVIPRFGASIGSGGIGWDLPAMKVIQEK
                     ENGTWVVK"
     gene            <679743..>680726
                     /locus_tag="PAS_chr3_0345"
                     /db_xref="GeneID:8199478"
     mRNA            <679743..>680726
                     /locus_tag="PAS_chr3_0345"
                     /product="Histone acetyltransferase (HAT) catalytic
                     subunit of the SAS complex (Sas2p-Sas4p-Sas5p)"
                     /transcript_id="XM_002492520.1"
                     /db_xref="GeneID:8199478"
     CDS             679743..680726
                     /locus_tag="PAS_chr3_0345"
                     /codon_start=1
                     /product="Histone acetyltransferase (HAT) catalytic
                     subunit of the SAS complex (Sas2p-Sas4p-Sas5p)"
                     /protein_id="XP_002492565.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0345"
                     /db_xref="EnsemblGenomes-Tr:CAY70386"
                     /db_xref="GeneID:8199478"
                     /db_xref="GOA:C4R4A0"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C4R4A0"
                     /translation="MSDNEGYYGVTQKRNIRRVRLGDNEFDTLYGNSVYFLEGHHDML
                     GYEAVNAHQRIHHRKHSEPQINGDTDSYWLDTLYVCDLCFKYTRDEALLNSHLSVCKH
                     NYRFPGKTMYKDNFTIKKVSGYRHTILCQNLCLFAKLFLDSKSVYFSIENFDFYVVLG
                     ESNGRRVPMGFFSKELLSWDENNLACILIFPPFQRKRLGHLLIEFSYELSRFEGKVSG
                     PEFPLSAFGKIGYLKYWSKVICRELLYGRFSDCQSITLQKLSKFTCIRVKDLISTLDY
                     MGSWFTTSDIENSKSLDQYPLAISRSVLKQWIKGESSNCQKLIQEDSLVLY"
     gene            complement(<680762..>684073)
                     /locus_tag="PAS_chr3_0346"
                     /db_xref="GeneID:8199479"
     mRNA            complement(<680762..>684073)
                     /locus_tag="PAS_chr3_0346"
                     /product="DNA helicase"
                     /transcript_id="XM_002492521.1"
                     /db_xref="GeneID:8199479"
     CDS             complement(680762..684073)
                     /locus_tag="PAS_chr3_0346"
                     /codon_start=1
                     /product="DNA helicase"
                     /protein_id="XP_002492566.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0346"
                     /db_xref="EnsemblGenomes-Tr:CAY70387"
                     /db_xref="GeneID:8199479"
                     /db_xref="GOA:C4R4A1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014905"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R4A1"
                     /translation="MASDQPKRPRFFDDRLEQLDPDEDSPKKVKLFVSDLASDEESPS
                     REDLHSDDEFVLFQSEISSIVTNISETAIMRLYDKVKGHSNILESALNLFYDQPETFT
                     ETDESKRKDLKEIRTIESKINNLANQRFTEKQKEKYKYIGTLVCDGWCSRPRVQKIQY
                     GSRLNISTPPKSSPAKTSKKKASASLVRLTIPDTSNQNYQREVGRLPENIAKTISPLI
                     EMGIGKFEVTVIFTDQRTIRMGDSFLIQLDCFIKDSAFTSPDSEHCLTSDERKDVLKK
                     GAKELDTEVLMRKKQKSLFDLFQLLGLKELTEHNKLEGENSEPVNLDSGSDNEDEKAP
                     KSSTADHLDLNQLNQFYKSAQLSHEKVHLPDTTPNKTAFSLDLRTYQKQGLSWMLRRE
                     ASYSLIGNPEGSQDARLVNSFKDHDLNKLHPLWKAYKWPEDRSWSNVKLSENSHDSSF
                     SSSKEFYYNIYSGNFSFTKPLLKNASKGGILADEMGLGKTITSLSLILTSSEDTELAN
                     ESNIPNDYAYKTTLIIVPMSLLSQWEQEFDRCNADSQKRCFIYYGNETLGDMKQLLCN
                     SKDPPVVVLSTYGTIQNEWARGHKVTDGNLLNEGLFSVKFFRIILDEGHSIRNRSTKT
                     SRSIFDLKASRRWVLTGTPIVNRLDDLYSLVKFLRLEPWDNISIWKHFITIPFETRKN
                     LDQSLEVLSAILEPIILRRTKNQKDEFGNPLVVLPSKEVVIDRLKFNEKELTLYNWFR
                     YRAETTFKESLFKGTVLQSYSDILTHILRLRQICCSIKLVGNLFKDSFMEDDNFTLDQ
                     KLILTQSDESVEVLASFEKKMEEEKLGPDEIISIKEGIYKLYPSFEDTECAICTTSPI
                     SIEDCMITECKHCFCIGCLMEHFEFQQRKQENEVLCPNCRSKISKLRLFKTHLVEDSE
                     RGYSVTLFHPYGSSSKINALLRHLKTIHETKEHVVVISQFSSFLDLIQAELSKYKKEF
                     KVMKFDGQLSLSERQVVLKEFNDNPENGGINVLLLSLKAGGVGLNLTNASRAFMMDPW
                     WSPSVEAQAIDRLHRIGQSKNVNVVRFIMEGSIEEKMLKVQERKKQLGEAVGDDEERR
                     QRRIEEIKLLFNDDE"
     gene            <684535..>687855
                     /locus_tag="PAS_chr3_0347"
                     /db_xref="GeneID:8199480"
     mRNA            <684535..>687855
                     /locus_tag="PAS_chr3_0347"
                     /product="Serine/threonine protein kinase involved in
                     regulation of exocytosis"
                     /transcript_id="XM_002492522.1"
                     /db_xref="GeneID:8199480"
     CDS             684535..687855
                     /locus_tag="PAS_chr3_0347"
                     /codon_start=1
                     /product="Serine/threonine protein kinase involved in
                     regulation of exocytosis"
                     /protein_id="XP_002492567.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0347"
                     /db_xref="EnsemblGenomes-Tr:CAY70388"
                     /db_xref="GeneID:8199480"
                     /db_xref="GOA:C4R4A2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001772"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:C4R4A2"
                     /translation="MDREQGILPQDPFSNSVHVPKLRASSGGQPQKPVIQNSAPATAR
                     MLRNASSSTSAALLKELNTHEHSQRQHTPQKQPSLDAPAALVPVESATKQFHRTSIGD
                     WEFSNTIGAGSMGKVKVAKHRVTHEVCAIKIVIRSAKIWQRNHQNDPEPETEEKRKKL
                     RDEYKKELERDERTVREAALGKIMYHPNICRLFECYTMSNHYYMLFEIVQGVQLLDYI
                     VSHGKLKETRVRQFARSIASALDYCHSNNIVHRDLKIENIMINNKGEIKLIDFGLSNM
                     YDRRNLLKTFCGSLYFAAPELLSCRPYIGPEIDVWSFGVVLFVLVSGKVPFDDDSVPK
                     LHAKIKRGKVEYPEFISPLCHSLLSQMLVVNPDHRVTLKAAMEHPWMTLGFAGPPSNY
                     LPQRSPIVLPLDLSVVREIANLGLGNEEQIARDITNLISSREYEACVERWKLDQQKAN
                     IKGYSARDDSAIIAFHPLLSTYYLVDEMRKRKLAKGALKGQTSVLDTVKVSPDIPKTP
                     AIPQKLETTDVEQPLLATVPPAYTSPHGQPAELEAMIEPAQPLSSAHPFEMDMTQQQH
                     ASRKTHIKHAPERQDRGGYNVHKNNSGGLNSLFRRLSGKRPHKNEAEWEPSSPPPQVH
                     PFSVNDADRTSVRGVSPITQPAAVKNVTSNNSKNYLDPVDDSKLVRRVGSLRITNKEK
                     QQVTSDFPRLPNFTIPEQPPKNAPIPIHAQPTTTGTTFQSNDHEIKKKLQASTSPNEQ
                     RGPPTLAPSQQRRLHPTARAKSLGHSRKQSLNFKFGGPANNQLPALPTKENYDVFEDA
                     QITDNNLLNPEGKYSANTNVHIKPMTESQILFEAEHAPPGTMPSVEYPRTLFLKGFFS
                     VQTTSSKPLPVIRYNIIAALCKLNIQFTEVNGGFVCVYRKTENLQIGDIRSPVIESRV
                     TDDTDSDVANSSKLSSSSTANTRVNVIEDDSSSPSSARLKHRRKFSLGNGILNHIRKP
                     TLDGTEFDDYDATVNTPVTPAPANVHSRSSSYHTESDNESMESLHDIRGGSDMILKNV
                     PERNARQIDTVKEEETDDDDLGSINEGSTHRTPLKFEIHIVKVPLVGLYGVRFKKILG
                     NAWIYKRLASKLLQELNL"
     gene            complement(<687934..>689223)
                     /locus_tag="PAS_chr3_0348"
                     /db_xref="GeneID:8199481"
     mRNA            complement(<687934..>689223)
                     /locus_tag="PAS_chr3_0348"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492523.1"
                     /db_xref="GeneID:8199481"
     CDS             complement(687934..689223)
                     /locus_tag="PAS_chr3_0348"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492568.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0348"
                     /db_xref="EnsemblGenomes-Tr:CAY70389"
                     /db_xref="GeneID:8199481"
                     /db_xref="GOA:C4R4A3"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C4R4A3"
                     /translation="MLTPQYRQHVLSPFEYVKPGTAIVNNSPDVTMTHNTIDNSTSDF
                     TSEMDFETAYNMLMTHDTLPSMGTSPSSSHGFGTLATSPGAGQQVFNGFQGYSSSSPD
                     QQQKVKTPSNQIIPDPSAEFEYHRKQILKNSGANGSQPYSTANGVSPNTRNLLHSINS
                     KSYKNMFGMFSNTPTSSSSGPSSDLLSLSESSVLTEFLDSLVDDVKLSSLSKHWSSID
                     PLATEKPLETGSPLNTMTLPELKLQNSDLKTNLASIPSMHKINLNFSNNSSADTSRCQ
                     SPSILSFKTKSDSLQPPLTSVKTEITHERIPRSPNKSTATKRRATTCTNANKRKRSND
                     GRPLLSEDEKRRNHTSSEQRRRMIIKEAFEEFCSLTVRPDEKIRTAPSASSKPAAQKT
                     RGKDAKKSLSKYLIMTKAINEIERLVEVNQKLKELLS"
     gene            <690318..>691127
                     /locus_tag="PAS_chr3_0349"
                     /db_xref="GeneID:8199482"
     mRNA            <690318..>691127
                     /locus_tag="PAS_chr3_0349"
                     /product="NADP(+)-dependent dehydrogenase"
                     /transcript_id="XM_002492524.1"
                     /db_xref="GeneID:8199482"
     CDS             690318..691127
                     /locus_tag="PAS_chr3_0349"
                     /codon_start=1
                     /product="NADP(+)-dependent dehydrogenase"
                     /protein_id="XP_002492569.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0349"
                     /db_xref="EnsemblGenomes-Tr:CAY70390"
                     /db_xref="GeneID:8199482"
                     /db_xref="GOA:C4R4A4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C4R4A4"
                     /translation="MSYGLAAASRLAGKVILITGASSGIGEATALEYANAAKGEIKLA
                     LSARRFEKLEGLKEKLTTQWPNIKVHIALLDVSNIAKLTEYVESLPEEFKAVDVLVNN
                     AGKALGIDRVGQILQEDIDGMFQTNVIGLISLTQLILPGMKARNRGDIIQLGSIAGRD
                     PYPGGGIYCATKAAVRSFSHSLRKELIDTKIRVIEIDPGAVQTEFSLVRYKGSKESAS
                     KVYEGAEPLNALDIAELIVFASTRRENTVVAETLVFPTNQAGAGYVYRKKD"
     gene            complement(<691149..>692522)
                     /locus_tag="PAS_chr3_1180"
                     /db_xref="GeneID:8199483"
     mRNA            complement(<691149..>692522)
                     /locus_tag="PAS_chr3_1180"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492525.1"
                     /db_xref="GeneID:8199483"
     CDS             complement(691149..692522)
                     /locus_tag="PAS_chr3_1180"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492570.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1180"
                     /db_xref="EnsemblGenomes-Tr:CAY70391"
                     /db_xref="GeneID:8199483"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R4A5"
                     /translation="MRAISRVTTLFRCYSTIPIPKAGLPLGDCTIEWVKSLISQEVML
                     QDQQDKLMKFAMPYYGQEKGVDGFKAVNEKIVINGSGDTINGIRVENLKDQDTMGKKP
                     LPLVMLHGYGAALGLFFKNFHGLVKDQPGSTVYALDLPGFGLSSRKPELDVMDETLKH
                     LHIQFDSQTVEHYKHIHRSLRMPDMFSLDYNEFENYKKGQKELIEHVESIYIDVLKRW
                     LDAKLIDKIDLLGHSFGGYMSIAFALKYPERVNKLVLVSPGGIERSPYAITNKLRKPK
                     EGTLVELKPSGNPADYRFLGRLPVMSSTFMKFWEKDITMFDLLRLSGPIGAQKLTEYI
                     FSKYNRNNQFNSYEELKTMSLYMYHCFSKASFSDRTILKIFSPTVVAKYPMLDRIHEL
                     KVKESLWIYGEFDWMFNSCGEEAVKELTGYGKSAKFDVVSRSGHNLYLDSPEEFNQKV
                     KKFLQWK"
     gene            complement(<692788..>695094)
                     /locus_tag="PAS_chr3_0350"
                     /db_xref="GeneID:8200212"
     mRNA            complement(<692788..>695094)
                     /locus_tag="PAS_chr3_0350"
                     /product="Ferric reductase and cupric reductase"
                     /transcript_id="XM_002492526.1"
                     /db_xref="GeneID:8200212"
     CDS             complement(692788..695094)
                     /locus_tag="PAS_chr3_0350"
                     /codon_start=1
                     /product="Ferric reductase and cupric reductase"
                     /protein_id="XP_002492571.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0350"
                     /db_xref="EnsemblGenomes-Tr:CAY70392"
                     /db_xref="GeneID:8200212"
                     /db_xref="GOA:C4R4A6"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:C4R4A6"
                     /translation="MKVLLLLFMGCFFKLGSSKGISDETGAACLFVASNFSNYPFDCA
                     QPDLEYKCRCLSPEFLGTVLLCIDDNTDEIDELTRAFDYIKEVCGVQGSKKYSFTQLI
                     DVFDNATSHAIPVSVVNGLNKSQLHNPVIPDAQRFASSQESVRRLLNHRYKSTKYGVG
                     LIGYWGLSLILATTNNVLQWCFPYIYMNMNGDTTRWLREHVICPQLISESHFRKNSRI
                     NTFVNSLLRSFPIRVQSITVAFYMALVTIFCTVDYQLYRPNSIFPWKNAQLFAYIADR
                     TGILAITQLPMLILFSGRNNVLQLITGWPYRTFNIFHRWIARTVWILVLLHAVFYVAF
                     TASCSNYRERWMINKWRWANTAFVAASISIFLSSRYFRRKCHQLFVSSHQILAIIFVL
                     GCWYHCLTLGWMEFLYITVAIWALEYFSRFGKIMLSGGIVQGKCTLVLNKKLEPHSLR
                     ITVHHSGWWRSFPGAYSYLYFLKPKFFWQSHPFTILGPARQEDFNKLVFLIRIKNGIT
                     KKLGNYIMRQENLMCTLPMLVEGPYGSTIPFKAYQHSIFFAGGVGITVVYTFAMDLAH
                     TYLADKAKNHSINVIWSAPTISAIEEFVDEIEALSRFEMVKVIIYLTRELEAILPIDD
                     QELKIAPKEMGDPIELVNSCTDLSNNELVHLLDPLSTGSKELPTELNQRMNEIISTTE
                     ERVSPVEYDATREKLQNVFFRCKVNLGRRPSIKKELPGLLKLIPDTTAVVSCGPDKMN
                     RDVRNAVAKSLREPNKGRIDYFEEELVW"
     gene            complement(<695252..>696274)
                     /locus_tag="PAS_chr3_0351"
                     /db_xref="GeneID:8199484"
     mRNA            complement(<695252..>696274)
                     /locus_tag="PAS_chr3_0351"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492527.1"
                     /db_xref="GeneID:8199484"
     CDS             complement(695252..696274)
                     /locus_tag="PAS_chr3_0351"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492572.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0351"
                     /db_xref="EnsemblGenomes-Tr:CAY70393"
                     /db_xref="GeneID:8199484"
                     /db_xref="GOA:C4R4A7"
                     /db_xref="InterPro:IPR021264"
                     /db_xref="InterPro:IPR023278"
                     /db_xref="UniProtKB/TrEMBL:C4R4A7"
                     /translation="MEDPENKFDDYIVIGQVRDKLEIQASPRFQKYLDNLSLVFQYLL
                     ENPNRNILNDLTSKTSPIELRSPPPTNGFQPPMNEPTQMFTIDLQNKFSMNEQYKMYF
                     NLLQQIVCKEIAKLWIKVIEPKKQTKFPYKGGYCTRPPWWPNEVPHREPDHLNKSDRI
                     TLLITICHLDVTYLQDLYKSTQSVEFTPEKRELYNELFYLLYKEFDFQRHRTDSKVVV
                     SLFSRKQKQLSKNRTAKSQPRRKSISKPPLKKANDENLQMAKLLYEHLNLTANPENPS
                     SINDIDITNEYLISSAPSHSNVNFNNSFGLGFNEGHDLPDQTDHYSIYNKSPILPTDK
                     QPNIPL"
     gene            <696575..>697663
                     /locus_tag="PAS_chr3_0352"
                     /db_xref="GeneID:8199485"
     mRNA            <696575..>697663
                     /locus_tag="PAS_chr3_0352"
                     /product="Putative SCF-ubiquitin ligase F-box protein"
                     /transcript_id="XM_002492528.1"
                     /db_xref="GeneID:8199485"
     CDS             696575..697663
                     /locus_tag="PAS_chr3_0352"
                     /codon_start=1
                     /product="Putative SCF-ubiquitin ligase F-box protein"
                     /protein_id="XP_002492573.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0352"
                     /db_xref="EnsemblGenomes-Tr:CAY70394"
                     /db_xref="GeneID:8199485"
                     /db_xref="GOA:C4R4A8"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C4R4A8"
                     /translation="MTLDSQLQTLSIKSDGAVDLSKLDDKQRRAYDLFHQANEKEMEG
                     AMSDAVELYRKAYKLDEKVDRWYRYQDITKQASPHNKNTIEKPAVDLELVKKINVQEL
                     LNSFNEDQITPEEENEPSPLHLLSDDLLIYIMELLCDADSSSWFYFAITCKKLSYLGF
                     HNKSIWEKLCKIVYSRQRYDEDTPCSQDQICQNTWKGDWHLMLSQRPFLKFNGAYISI
                     INYYREGGRPDMSNSWSNPIRCVTYYRFVRFYPDGTCQRLLTFLSPKIVVPRLNKNYH
                     ELGLENVFRGTWKMTMDGQVLITGEGSVEGYSFSETLQIKNLGRMKHHKLHWISAYFQ
                     NKDDGEMKHFSLAKERPFTFSRVKSYSV"
     gene            complement(<697676..>698075)
                     /locus_tag="PAS_chr3_0353"
                     /db_xref="GeneID:8199486"
     mRNA            complement(join(<697676..697865,697909..>698075))
                     /locus_tag="PAS_chr3_0353"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492529.1"
                     /db_xref="GeneID:8199486"
     CDS             complement(join(697676..697865,697909..698075))
                     /locus_tag="PAS_chr3_0353"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492574.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0353"
                     /db_xref="EnsemblGenomes-Tr:CAY70395"
                     /db_xref="GeneID:8199486"
                     /db_xref="InterPro:IPR004910"
                     /db_xref="UniProtKB/TrEMBL:C4R4A9"
                     /translation="MGLRNSVLLEAPQVVFGEKCITFGCKNCSTHLSQSKQVISDKYR
                     GRLGNAFLVNKVVNILRGQAERRHMTTGLYMVCDIKCHQCKKVIGWEYLSADDDTQQF
                     KVGKFILEANGIIYVQ"
     gene            <698438..>700133
                     /locus_tag="PAS_chr3_0354"
                     /db_xref="GeneID:8199487"
     mRNA            join(<698438..699964,700032..>700133)
                     /locus_tag="PAS_chr3_0354"
                     /product="Phosphatidylinositol 3-phosphate [PI(3)P]
                     phosphatase"
                     /transcript_id="XM_002492530.1"
                     /db_xref="GeneID:8199487"
     CDS             join(698438..699964,700032..700133)
                     /locus_tag="PAS_chr3_0354"
                     /codon_start=1
                     /product="Phosphatidylinositol 3-phosphate [PI(3)P]
                     phosphatase"
                     /protein_id="XP_002492575.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0354"
                     /db_xref="EnsemblGenomes-Tr:CAY70396"
                     /db_xref="GeneID:8199487"
                     /db_xref="GOA:C4R4B0"
                     /db_xref="InterPro:IPR010569"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C4R4B0"
                     /translation="MEYIKIAQVPDAVLHKKGNTVKGVLHLTTHHLIFTLPQVETAPR
                     GSQELWLCYPMIERVTFTKGSALLYAPDKDESFQLTKGANLRIICRDYTFLAFDFKDV
                     KQCNDVFESLLKLTCVNSLENLYAFLYSPVKIEAPLNGWKIYEPVREFARQGLKLNSP
                     NSSSEHPGDKMWRMSNINESYRVCTSYPSVIVTPASISNSVLHHASKFRSKGRMPALT
                     YYHKYNGCSIIRCSQPLVGLKQNRSMQDEKLLLEVTKTNDASSVLIVDARPVANAIAQ
                     TALGAGSEIVEYYPNAKKVFLNIDNIHVIRDSLNKVTEALKNTDISMEPPNQDLLIKS
                     GWLKLIYTVLTGLDMIVKSLHLNKQHLLLHCSDGWDRTSQLAALAQLLLDPYYRTLEG
                     IMVLIEKDWLSFGHRFNERSGHLQSETKFVDNSEYSSTNQAQHAIKQVTTHFRHRKHV
                     KYTSPIFHQFLDCIYQLLKQNPTIFEFNERFLRRLLYHLYSCQYGTFLYDSELERRQA
                     KTIKGWMKLYIPIFRRFRFGTNCLDGLTRNSMVS"
     gene            complement(<700288..>701073)
                     /locus_tag="PAS_chr3_0355"
                     /db_xref="GeneID:8199488"
     mRNA            complement(<700288..>701073)
                     /locus_tag="PAS_chr3_0355"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492531.1"
                     /db_xref="GeneID:8199488"
     CDS             complement(700288..701073)
                     /locus_tag="PAS_chr3_0355"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492576.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0355"
                     /db_xref="EnsemblGenomes-Tr:CAY70397"
                     /db_xref="GeneID:8199488"
                     /db_xref="GOA:C4R4B1"
                     /db_xref="InterPro:IPR003779"
                     /db_xref="InterPro:IPR029032"
                     /db_xref="UniProtKB/TrEMBL:C4R4B1"
                     /translation="MSVITPQRLVHLSTQYKSLTDSWFLISIVALNICNLPEEIPKVY
                     HYALELYANNGSPTIQTAERSLKTCQTLIDRYAVSLEFQNDKDLIKQKHVTSRAREAL
                     LKSAALGGLPKCINSMMLLKEATPLSLRETAVKRDFLLSEEAVRTERERGRQFWNSVY
                     GKISNRVMGQMNTAYPDLWHYTFNHVYAPLLSFTDVLSVKETSLVVISCLIPQDVNPQ
                     LKGHLKGAVNNGCTLEEIRDARLLTIQLSNWCGVKWKGEVASL"
     gene            complement(<701254..>701883)
                     /locus_tag="PAS_chr3_0356"
                     /db_xref="GeneID:8199489"
     mRNA            complement(<701254..>701883)
                     /locus_tag="PAS_chr3_0356"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492532.1"
                     /db_xref="GeneID:8199489"
     CDS             complement(701254..701883)
                     /locus_tag="PAS_chr3_0356"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492577.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0356"
                     /db_xref="EnsemblGenomes-Tr:CAY70398"
                     /db_xref="GeneID:8199489"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C4R4B2"
                     /translation="MSLAPKFIPSHIYKASSGTVPANVHRIQLFLDYDCPFSAILFFK
                     FYKSVIPETEKLYPGKFQFVFYNVPQPWHPTSSLLHEVSLAVAAVAPSKFWDYSNILF
                     ENQSQFFDTETYNETRKETYQRLIDLATPLGIEAAELWKFVEIKASDSPSNAGNLIGK
                     DFKYFIRLHRTIGVHVTPTIAINGILNTSLESSTSVDDYLKVFGQQLES"
     gene            complement(<702047..>703576)
                     /locus_tag="PAS_chr3_0357"
                     /db_xref="GeneID:8199490"
     mRNA            complement(<702047..>703576)
                     /locus_tag="PAS_chr3_0357"
                     /product="ceramide glucosyltransferase"
                     /transcript_id="XM_002492533.1"
                     /db_xref="GeneID:8199490"
     CDS             complement(702047..703576)
                     /locus_tag="PAS_chr3_0357"
                     /codon_start=1
                     /product="ceramide glucosyltransferase"
                     /protein_id="XP_002492578.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0357"
                     /db_xref="EnsemblGenomes-Tr:CAY70399"
                     /db_xref="GeneID:8199490"
                     /db_xref="GOA:C4R4B3"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R4B3"
                     /translation="MIMQLGLTSLAFLALKCDAYNIAPKIDTPNVEPFAPSGGLKLLA
                     IVAIIWYVVVLLVAYYGFFEIMQKFSKRKTLPVPPQVEGVTILRPIKGIDPEMELCLQ
                     SAFDQDYPKFEIIICVESENDPGIGVAEALIRKYPHVDARILKGDSHNPDHFGPNPKV
                     NNLAKGYSAGKYDIMWILDSNVWVCSGALSRSVDALNRSLDNGRSTFDFQTGKGRKVN
                     LVHHVPMAISINPQTGTNLDEMFLFTSHSKFYISINKAALAPCVNGKSNLYRRSELDL
                     AVKRLGKGSEPSLDGTTGILAKDAAYYGSKPGQGLRFFARYIGEDNMIATALWFQNGG
                     RTGLTGDAAIQPLGGVNSTSLKNYLLRRIRWLRVRKHMVLEATLLEPTTECLLCGTFG
                     TFAISTLFLQSYFNWKFFIFHLLVWMVTDYTQFHILLTNASQDTATCNVPYFAEPNFN
                     AYGSPFESSNLRTFHRWVLYWLLREVLALPIWISAMLGTRIIWRNRPFRINVDLSAEE
                     L"
     gene            <703775..>704566
                     /locus_tag="PAS_chr3_0358"
                     /db_xref="GeneID:8199491"
     mRNA            <703775..>704566
                     /locus_tag="PAS_chr3_0358"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492534.1"
                     /db_xref="GeneID:8199491"
     CDS             703775..704566
                     /locus_tag="PAS_chr3_0358"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492579.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0358"
                     /db_xref="EnsemblGenomes-Tr:CAY70400"
                     /db_xref="GeneID:8199491"
                     /db_xref="UniProtKB/TrEMBL:C4R4B4"
                     /translation="MMPSVRISTRCKAPNVRFLSAQVAPKKKLSAAQLRKERNILAKS
                     SLRDILDSIVPGSVQDDDVTKYDPTPVYDDYRKYDSLSYPQQRYIIDSFKDDKFRKPW
                     GKIPKSMKRLNYYISYGNYGPRDGFQPVESDQPNFDLPFRLPSIITTHNPKPSTLVRK
                     LPPVNYKTCGEKRKEQYEKERRMDPISKIIIFSTLILTVINFKRDRKVVNTDHVPVNE
                     YEEYQKVLEQEERDYREMLEARDNPQPFNPDSKAQKRRWYYLWIR"
     gene            complement(<704742..>705322)
                     /locus_tag="PAS_chr3_0359"
                     /db_xref="GeneID:8199492"
     mRNA            complement(join(<704742..705224,705281..>705322))
                     /locus_tag="PAS_chr3_0359"
                     /product="Ubiquitin-conjugating enzyme (E2)"
                     /transcript_id="XM_002492535.1"
                     /db_xref="GeneID:8199492"
     CDS             complement(join(704742..705224,705281..705322))
                     /locus_tag="PAS_chr3_0359"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme (E2)"
                     /protein_id="XP_002492580.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0359"
                     /db_xref="EnsemblGenomes-Tr:CAY70401"
                     /db_xref="GeneID:8199492"
                     /db_xref="GOA:C4R4B5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C4R4B5"
                     /translation="MSTPARRRLMRDFKRIQQDAPGGVSASPLPDNVMTWNAVIVGPA
                     DTPFEDGTFRLVIQFDEQYPNKPPSVKFISDMFHPNVYASGDLCLDILQNRWTPTYDV
                     SSILTSIQSLLNDPNISSPANVEAANLYKDHRSQYIQRVRDTVEKSWSEDILDEDEDD
                     EDEDEGEVDNEDAQ"
     gene            <705392..>706903
                     /locus_tag="PAS_chr3_0360"
                     /db_xref="GeneID:8199493"
     mRNA            <705392..>706903
                     /locus_tag="PAS_chr3_0360"
                     /product="Mitochondrial protein kinase"
                     /transcript_id="XM_002492536.1"
                     /db_xref="GeneID:8199493"
     CDS             705392..706903
                     /locus_tag="PAS_chr3_0360"
                     /codon_start=1
                     /product="Mitochondrial protein kinase"
                     /protein_id="XP_002492581.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0360"
                     /db_xref="EnsemblGenomes-Tr:CAY70402"
                     /db_xref="GeneID:8199493"
                     /db_xref="GOA:C4R4B6"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:C4R4B6"
                     /translation="MEARPYGVVFLHNQNLSLDLELKHSLNLSQRPIHMPKLSTIADN
                     IFRLGPYPEYSMLLNKYHFYQNSMLLHWAERNAHPVTLKHLANYGKTLNKDKIIMSAN
                     FVRNEIPVRLALRIKSLQKLPFDVVNNFHFAQVYECYYHCFNSFRKYSRIDNLEENDK
                     FCEFIKDTLDEHLTVLPHLMMGALENSILNSLPQKELDEFMSSMLRSRVSRRVILEEH
                     ISLTTRFQKNKSSDSLGDLFSECSAFEQLEICTGILINYLRGLYPNLQLPELIIEGED
                     AKFPFMLSHLHFIFGEILRNSYKAVITNCLRINDHLGEDQLSKIKPPPIVVSVANNAK
                     DVVFRFSDQGGGMPKEVLQDIWSFGKSPKKAQVYLNTFHSLPGLDLNPHFQVKDSFSG
                     QHKKQPPLDGSANALLKNITHMEEIVTQRMGIQDKESQEGLYSRKKSFMRSLIARPFD
                     LTLGVSLPMCKVYTDYWNGDLRMHSLEGYGSDTYLRLSKLGSFNSDKVQLDRA"
     gene            <707000..>707659
                     /locus_tag="PAS_chr3_0361"
                     /db_xref="GeneID:8199494"
     mRNA            <707000..>707659
                     /locus_tag="PAS_chr3_0361"
                     /product="Nicotinamidase"
                     /transcript_id="XM_002492537.1"
                     /db_xref="GeneID:8199494"
     CDS             707000..707659
                     /locus_tag="PAS_chr3_0361"
                     /codon_start=1
                     /product="Nicotinamidase"
                     /protein_id="XP_002492582.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0361"
                     /db_xref="EnsemblGenomes-Tr:CAY70403"
                     /db_xref="GeneID:8199494"
                     /db_xref="GOA:C4R4B7"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:C4R4B7"
                     /translation="MSKSALLIIDLQNDFLEGGSLAVPDGNEIIDPIIELAQKKDWDL
                     VIATKDWHPQDHTSFASNHGVKPYTELEFTNPENEAEKKIQVVWPDHCVQNSNGSEFP
                     PKFKAFWEQFTGPKELVKKGYLSDREYYSAFSDVWKLHKTELDSLLKGHGIRNVTIVG
                     LALDFCVFHTASDALRENYSVTLVTNLTRSVADREGPPSKLQSLGAHLAEYNGSEIII
                     K"
     gene            <707697..>708175
                     /locus_tag="PAS_chr3_1181"
                     /db_xref="GeneID:8199495"
     mRNA            join(<707697..707811,707871..>708175)
                     /locus_tag="PAS_chr3_1181"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492538.1"
                     /db_xref="GeneID:8199495"
     CDS             join(707697..707811,707871..708175)
                     /locus_tag="PAS_chr3_1181"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492583.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1181"
                     /db_xref="EnsemblGenomes-Tr:CAY70404"
                     /db_xref="GeneID:8199495"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:C4R4B8"
                     /translation="MTVKPITKIIFLSVLLSIGILLVVLSCALFHNYHPLYVIAVFLV
                     APIPNAIFSNLNANYQSDFLSDSAPNGNPFKDFGEFVTGIFVFSGLVLPIVFWHVQLI
                     VFWSMIMSLSGGFIVYASIILFSMFFHMSDDDEGFDF"
     gene            <708252..>709109
                     /locus_tag="PAS_chr3_0362"
                     /db_xref="GeneID:8200213"
     mRNA            <708252..>709109
                     /locus_tag="PAS_chr3_0362"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492539.1"
                     /db_xref="GeneID:8200213"
     CDS             708252..709109
                     /locus_tag="PAS_chr3_0362"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492584.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0362"
                     /db_xref="EnsemblGenomes-Tr:CAY70405"
                     /db_xref="GeneID:8200213"
                     /db_xref="UniProtKB/TrEMBL:C4R4B9"
                     /translation="MSRLIVALHTVLKRFKEMGLFTDSDKDNSDKLSESSSSTSSNWL
                     DRYLSIAREAKHSLASKIEDVALPGEDGTLFNKNIDTNRPDSIFRAVFGDDFETTFNK
                     VDSLVNAIAPVFDQDVWSELFTGSKLVSSKYGLWAYPIPSHQLYKDCNSKQGLSVWDE
                     HGYWRCLFPKAQLPENYKSIDSNIISKEDVEQDDSHKLGRFFTNFSDYLNWRSVMEEN
                     IKKQRVSFSKPQKSSGSSTSYSERTLPNGEIEKIEKKHEWFVDGTERSKETKTIIHPD
                     GSVTTENIK"
     gene            complement(<709157..>709585)
                     /locus_tag="PAS_chr3_0363"
                     /db_xref="GeneID:8199496"
     mRNA            complement(<709157..>709585)
                     /locus_tag="PAS_chr3_0363"
                     /product="Conserved ubiquitin-like modifier"
                     /transcript_id="XM_002492540.1"
                     /db_xref="GeneID:8199496"
     CDS             complement(709157..709585)
                     /locus_tag="PAS_chr3_0363"
                     /codon_start=1
                     /product="Conserved ubiquitin-like modifier"
                     /protein_id="XP_002492585.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0363"
                     /db_xref="EnsemblGenomes-Tr:CAY70406"
                     /db_xref="GeneID:8199496"
                     /db_xref="GOA:C4R4C0"
                     /db_xref="InterPro:IPR007242"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C4R4C0"
                     /translation="MSDDIKEASPPVNNPTLSESAVLDKVPKTSSLLDEIKERHAQEV
                     CKISIRFIPIGSAPEITPKVFKISSSNNFGALLSFLDKRLGNNLIYKNQINHLTGGRI
                     FGYLHNSFAPSPDENLDNLYKNFGINGELVVSYSDRVAFS"
     gene            <709831..>711768
                     /locus_tag="PAS_chr3_0364"
                     /db_xref="GeneID:8199497"
     mRNA            <709831..>711768
                     /locus_tag="PAS_chr3_0364"
                     /product="Protein required for oxidation of specific
                     cysteine residues of the transcription factor Yap1p"
                     /transcript_id="XM_002492541.1"
                     /db_xref="GeneID:8199497"
     CDS             709831..711768
                     /locus_tag="PAS_chr3_0364"
                     /codon_start=1
                     /product="Protein required for oxidation of specific
                     cysteine residues of the transcription factor Yap1p"
                     /protein_id="XP_002492586.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0364"
                     /db_xref="EnsemblGenomes-Tr:CAY70407"
                     /db_xref="GeneID:8199497"
                     /db_xref="InterPro:IPR013877"
                     /db_xref="UniProtKB/TrEMBL:C4R4C1"
                     /translation="MTDSNSTDSELEKSSKELLTVDTICHYLDDAAQDALETKDYLSY
                     LTVIDIHLATDPEKFSVEERIQLLEKLLKILQENDELLYEIGWDIPALLFQYHGLEWD
                     DLRIELKNSKGRMAMFHIFELLAEKGNAKELLLKCCELLPRCVDSSSENNDIIFKLRF
                     HSLFELMVASQRRIVSNYPSRFLAMMIPPVINLLSNKLESPIFVLRRIYTLLRDYHPC
                     LRPDVSENTTAEDIRELSLLHTQENYLQRKLLTTFLTHSIELQSNTIKVLVAPTVFEK
                     LEKSVHSQKLGLHLNSEFHRENMILLGRFVTLSQSYDINLEEEIKKQIEETETLFSQL
                     DHNQELDTLNDKIFSLVIENFNGTGLHDKDLKELPLSSIGCIILYTFNVLIENPSAKS
                     YSILDFEKVVKLSLRFLLPSMLNPNLTSYSLDDALYAWAWVTVSKENNLSQIPEILIT
                     TYLQLLITKSTINFSDYLAPLEAKSRNIILYTLISRVLSLVHESTSWNFLKDSLTTCP
                     FNNARSVLLSILKDLCLRSRNITVASLNDKLEKVDLNTKPTIPARDIPYITLSQARGD
                     DIVRLATDTVNKTLAGKEVKEDEVILLLSYINFITALKSKIEPQSINRFIELVNKKLK
                     NIDPEDNNGHLIKLAVERVSQ"
     gene            complement(<711790..>713361)
                     /locus_tag="PAS_chr3_1182"
                     /db_xref="GeneID:8199498"
     mRNA            complement(<711790..>713361)
                     /locus_tag="PAS_chr3_1182"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492542.1"
                     /db_xref="GeneID:8199498"
     CDS             complement(711790..713361)
                     /locus_tag="PAS_chr3_1182"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492587.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1182"
                     /db_xref="EnsemblGenomes-Tr:CAY70408"
                     /db_xref="GeneID:8199498"
                     /db_xref="InterPro:IPR014840"
                     /db_xref="UniProtKB/TrEMBL:C4R4C2"
                     /translation="MNSQLGTVKSEEPSRQLQQDSSEKPASINSSTAPRLDSFNTFNL
                     GNGFICPPVNLDVADRNHPLDKVQSETKPATTDHNLPPAKLKSSKISLASIINPPDPE
                     ITAFSSGLLIAPRPPSTALSIHELTSNPEPVKHARIWESTQSSPKPIAQKRKSPEKED
                     LVSTKAPSTPTGPEPKKRKQKTTTSKDTAVTAGSAETATKPVPPILSKTPSVKSTTKN
                     ATKQPTKQPTRPKKKSQNTTPKLISATTGGTNTAAIGPKLQGSTSVDEKKTNSTATST
                     TQQKSLVELPVPSLLDTESIKGKNIPAEEPVVALNILLSDSDKPNPGSAQLVFNLMKV
                     CEEKYGFKAMHPNAKFVVESDEDDDDIAEDDEQTETDTKEVATPPPAIPKTPVAAPIR
                     EDYNDAERRLRNQNRKIGKYDIMDPFIDDSELQFEEERAATKDGFFVYYGPLIEEGQM
                     ARIERADGTLKKGTQGTSSRGKKVSKKATTSTSTGNITQKKTVTQSTAPQAVAPQAIA
                     PKEDKQLLGSVLAKD"
     gene            complement(<713546..>715489)
                     /locus_tag="PAS_chr3_0365"
                     /db_xref="GeneID:8200214"
     mRNA            complement(<713546..>715489)
                     /locus_tag="PAS_chr3_0365"
                     /product="Mitochondrial matrix ATPase"
                     /transcript_id="XM_002492543.1"
                     /db_xref="GeneID:8200214"
     CDS             complement(713546..715489)
                     /locus_tag="PAS_chr3_0365"
                     /codon_start=1
                     /product="Mitochondrial matrix ATPase"
                     /protein_id="XP_002492588.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0365"
                     /db_xref="EnsemblGenomes-Tr:CAY70409"
                     /db_xref="GeneID:8200214"
                     /db_xref="GOA:C4R4C3"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C4R4C3"
                     /translation="MLSNFSRNIRSPVSRAALQAVRYNSNAKISGQVIGIDLGTTNSA
                     VAVMEGKSPKIIENAEGARTTPSVVAFTKEGERLVGVAAKRQAVVNPENTLFATKRLI
                     GRRFEDAEVQRDIKQVPYKIVKHTNGDAWLEARGERYSPSQIGGFVLNKMKETAEAHL
                     GKPVKDAVVTVPAYFNDSQRQATKDAGAIVGLNVARVVNEPTAAALAYGLEKTDANVV
                     AVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIALVRYIVDAFKKESGIDL
                     HDDRMAIQRIREASEKAKIELSSAASTEVNLPFITADASGPKHINLKMSRSQLEQLVD
                     PLIKRTVEPVKKALKDASLSTSDVSEVILVGGMTRMPKVVETVKQLFGKEPSKAVNPD
                     EAVAIGAAIQGAVLSGEVKDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQVF
                     STASSGQTSVEIRVFQGERELVRDNKLIGNFTLAGIPPAPKGVPQIEVTFDIDADGII
                     NVSAKDKASGKDNSITVAGSSGLSESEIEKMINDAEKFAEEDKVRKEAIETANRADQL
                     CNDTENSLNEFKDKVDKTEAEEISKKISELKEIIAKVNSGEAIEAATVKEKTEDLQNA
                     SLKLFEKMYKDNASSSGSEEPKN"
     gene            <716053..>717210
                     /locus_tag="PAS_chr3_0366"
                     /db_xref="GeneID:8199499"
     mRNA            <716053..>717210
                     /locus_tag="PAS_chr3_0366"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492544.1"
                     /db_xref="GeneID:8199499"
     CDS             716053..717210
                     /locus_tag="PAS_chr3_0366"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492589.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0366"
                     /db_xref="EnsemblGenomes-Tr:CAY70410"
                     /db_xref="GeneID:8199499"
                     /db_xref="GOA:C4R4C4"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:C4R4C4"
                     /translation="MPGTKSLPVIDLNLALSEDTKPKLVEDLRRALTEVGFFYVINPP
                     IENFPQLINGVKEQAFKFFHDLPADEKDKIEMINSKHFLGYTRLGNEVTSNKVDIREQ
                     IDLATELPAPKIASHDEIWKNIEGPNLWPNQELLPDFRPTIENYLEKVYQFSQWFSEL
                     VREALQLPEGAFSKYFKPRQQCKMKLIKYPEYKDAESRLDLLPENEGVPLDETQGCGP
                     HRDSDFLTYLFQATAHEALQVQDIYHSGEWITVPPIENSLVVNVGQTLEYLTKGVCHA
                     TIHRVITPRNGSGDRLSIPVFQTIDVNCYKSQLKDIPQELLDLRDKRDKEIKGEAIGY
                     QFSVADDTSEDVRPVGWTVFQNRLKSHRNVAAKWYPKEYKDTMKQIGVFLA"
     gene            <717360..>718256
                     /locus_tag="PAS_chr3_0367"
                     /db_xref="GeneID:8199500"
     mRNA            <717360..>718256
                     /locus_tag="PAS_chr3_0367"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492545.1"
                     /db_xref="GeneID:8199500"
     CDS             717360..718256
                     /locus_tag="PAS_chr3_0367"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492590.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0367"
                     /db_xref="EnsemblGenomes-Tr:CAY70411"
                     /db_xref="GeneID:8199500"
                     /db_xref="UniProtKB/TrEMBL:C4R4C5"
                     /translation="MDLESEASLLKKVVRQTFNALSIHFSKSFNAPYLHSLSPHVDRL
                     CGFTVSLDHYLKIYNMNDSIFELTITDEGNYIINFSKDMQGIPNLSRIRLIKSRVELF
                     NATLDSYLQSHSTISAYSTARLPVIPDPYTIDYTKKSNTKKRLRNDSAKFNFKERKVE
                     TSNFGDYKMSVLDRIRLKEKSTKETSSRMEEKLKHENYVRSQMLKFYEILYQLSPKPS
                     SKVTLKTFSTKQLISTIQDSISLPLSDSICLDVLIKLCDTLNQPEKLSIIEKNAIKVV
                     KISLLDREGDHKIISSHNPHHH"
     gene            complement(<718315..>721968)
                     /locus_tag="PAS_chr3_0368"
                     /db_xref="GeneID:8199501"
     mRNA            complement(<718315..>721968)
                     /locus_tag="PAS_chr3_0368"
                     /product="P-type ATPase, ion transporter of the ER
                     membrane involved in ER function and Ca2+ homeostasis"
                     /transcript_id="XM_002492546.1"
                     /db_xref="GeneID:8199501"
     CDS             complement(718315..721968)
                     /locus_tag="PAS_chr3_0368"
                     /codon_start=1
                     /product="P-type ATPase, ion transporter of the ER
                     membrane involved in ER function and Ca2+ homeostasis"
                     /protein_id="XP_002492591.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0368"
                     /db_xref="EnsemblGenomes-Tr:CAY70412"
                     /db_xref="GeneID:8199501"
                     /db_xref="GOA:C4R4C6"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C4R4C6"
                     /translation="MSSIVNNPTVLDAKLLVPKALVARPYVWPWTIIYPIWGNIYFNH
                     YDEYIKGPEWTFVYFGTILSLQLLFWLMPHWNLNIRAKFQYNPVDKISEATHIRITPA
                     PNTGLGEICEIRTDKFEDGETQVSFLYQKRRHLLHSDNVFSPPQFIVDENPQLGVFQE
                     STGLSGPLSKMQRLYGKNLFDIPIPTFLELFKEHAVAPFFVFQIFSVALWCMDEMWYF
                     SLFSLFMLVSFECTTVFQRRSTMNEFHSMGIKPYLIYVFRNKTWVNIQSDDLLPGDLV
                     SITRTAEDSAIPCDLILVDGSCIVNEAMLSGESTPLLKESIKLRPATDSFDPEGLDKN
                     SILHGGTSCLQVSSPEDPSVPLAPDGGALAIVTKIGFETSQGSLVRVMIFSSERMSVA
                     NKEAFFFILFLLVFAIVASWYVWVEGSKMGRIQSKLILDCIMVITSVVPPELPMELTM
                     AVNSSLASLGKYYVYCTEPFRIPLAGRIDVCCFDKTGTLTAEDLVFEGLAGFDESDVH
                     SLKKPNDVPEETLHVLGAAHALVKLDDGEVVGDPMEQATLKAAGWKLGDKDQLYKTDG
                     KKQEKIKILRRFQFSSALKRSSSIATVHKKNFVAVKGAPETIKERLVDAPKHYENTYK
                     TFTRAGSRVLALAYKPLPDNLSSNKITKFTREEVETDLLFAGFIVFHCPMKGDAIETI
                     RMLNESSHRCVMITGDNPLTAVHVAKEVEISKRPTLILDLPEAHHGDHELIWRSVDES
                     ELIPFSSTDKIDESIFDKSDICLTGYALAKLMDHPQLTKLIRHTWVFARVSPSQKEFI
                     LNSYKEMGYKTLMCGDGTNDVGALKQAHVGIALLNGTEESLKKIQENKKIEAIQKMYQ
                     KQVDLMKRWNSPPPKVPPLIAHLYPPGPLNPHYLTALEKNGKTITDEIRASVAAANDG
                     QVSAAVGASLNASSLADSLTGSMTDLEEEMEAPTLKLGDASVAAPFTSKLANVNTVTH
                     VIRQGRCALVSTIQMYKILALNCLISAYSLSVLYLAGIKFGDMQATVSGMLLSVCFLS
                     ISRGKPIEKLSKQRPQPGIFNIYIMGSIIGQFAVHIITLIYIAIEIYKLEPREPQVDL
                     EKEFKPSLLNTAIFLLQLAQQVATFAVNYQGKPFRESISENKGMYYGLVGVSFLCISG
                     ATEFVPELNQGMKFVPMDKLFKTKLTSCILLDVGLCFFIEQVLKYFFSDFKASDIAIH
                     DEDEEEIEIKKNI"
     gene            <722218..>723814
                     /locus_tag="PAS_chr3_0369"
                     /db_xref="GeneID:8199502"
     mRNA            join(<722218..722310,722357..>723814)
                     /locus_tag="PAS_chr3_0369"
                     /product="Protein involved in the inositol acylation of
                     glucosaminyl phosphatidylinositol (GlcN-PI)"
                     /transcript_id="XM_002492547.1"
                     /db_xref="GeneID:8199502"
     CDS             join(722218..722310,722357..723814)
                     /locus_tag="PAS_chr3_0369"
                     /codon_start=1
                     /product="Protein involved in the inositol acylation of
                     glucosaminyl phosphatidylinositol (GlcN-PI)"
                     /protein_id="XP_002492592.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0369"
                     /db_xref="EnsemblGenomes-Tr:CAY70413"
                     /db_xref="GeneID:8199502"
                     /db_xref="GOA:C4R4C7"
                     /db_xref="InterPro:IPR009447"
                     /db_xref="UniProtKB/TrEMBL:C4R4C7"
                     /translation="MSTLKERKEEFVSDLTGGSISEIYVVTFVSLLSYIAWCWLKQRT
                     SVFDTRSILGSLLDFALNWNSLLLSITLYSARPLTLNVLIILPCLALSFIKWKKGNEP
                     SNRHIRGALSLQSLSVKQFLPHKPFITVYRSQMMVITCLAILAVDFKIFPRRFAKVET
                     WGTSLMDLGVGSFVFSMGLVSCRSVLAATFTKSKTFTASQLIHTLVGVTPVFVLGLFR
                     SISVKSLDYQEHVTEYGKHWNFFFTLGFLPPIAVLLSPLTKFIPHFWLSLLIGGFYEF
                     ILVNTNLLHYILLAPRVDLISDNKEGIFSLFGYLSIFLGGQATGLFLLPVCKTRNNLF
                     WPSSKNEVVRFQSSPHPFKLLSLSVSPFQGLVYLATFYHVSFYVINTCYIYTVSRRVA
                     NLLYILWVCGYNTTFLAGYVLVDQYFWPNSDVKFTDQPLTPLQEERYNNVSKLIYVQR
                     TPPILHALNNNSLLIFLAANLSTGVINMALNTLDCTDGKAIVVLIGYELFLASLSGLL
                     LYFNIVIR"
     gene            complement(<724700..>726679)
                     /locus_tag="PAS_chr3_0370"
                     /db_xref="GeneID:8199503"
     mRNA            complement(<724700..>726679)
                     /locus_tag="PAS_chr3_0370"
                     /product="Alpha-1,2-mannosyltransferase, responsible for
                     addition of the first alpha-1,2-linked mannose"
                     /transcript_id="XM_002492548.1"
                     /db_xref="GeneID:8199503"
     CDS             complement(724700..726679)
                     /locus_tag="PAS_chr3_0370"
                     /codon_start=1
                     /product="Alpha-1,2-mannosyltransferase, responsible for
                     addition of the first alpha-1,2-linked mannose"
                     /protein_id="XP_002492593.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0370"
                     /db_xref="EnsemblGenomes-Tr:CAY70414"
                     /db_xref="GeneID:8199503"
                     /db_xref="GOA:C4R4C8"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R4C8"
                     /translation="MFGKRRQVRKLLIWVVLLLIVYFFGLQFRAKNSAHQSSIRSFYA
                     DNKEFFDRQYSRYDEYDIIDNMNSHNELLQEQFRNGKLAAGLRGVAEEPNSDEVTDDT
                     AIEEDEQAAMINFPKRSPQREKSLVELRKFYKNVLSIIINNKPAMPIENPRDPTPNEN
                     ALKRKFGKSGIINIALHDTDPSLPILSEAYLRDSLQLSPSFIASLSKSHSAVVKAFPP
                     SFPANAYNGTGIVFIGGQKFSWLSLLSIENLRKTGSKVPVELIIPFAHEYEPQLCEEI
                     LPKLNATCVLLQETVGIDLLKSGHLKGYQFKSLALLASSFEQVLLVDSDNIIVENPDP
                     IFDSEVFQRTGLVLWPDFWRRVTHPDYYKIAGIKLGSERVRHVVDSYTDPSLYTSSSE
                     DPFTDIPLHDREGAIPDGSTESGQILISKTKHCQTILLSLYYNFFGPDYYYPLFTQGA
                     SGEGDKETFLAAANYYKLPFYNIKKGVDVIGYWKPDQSAYQGCGMLQYDPIVDYQNLQ
                     TFLKTHKGSRVNKLEQSELDKPGLLSRLIPKFFFRKTFDEHQLQSHFTKDRSKIMFIH
                     SNFPKLDPFGLKLHNYLFVDQDTHKPRIRMYADQTGLSFDFELRQWIIIHEYFCEYPD
                     FNLKYLENANVKPQDLCMFIKEELNFLQNNPIQLT"
     gene            <727363..>728514
                     /locus_tag="PAS_chr3_0371"
                     /db_xref="GeneID:8199504"
     mRNA            <727363..>728514
                     /locus_tag="PAS_chr3_0371"
                     /product="Delta(24)-sterol C-methyltransferase"
                     /transcript_id="XM_002492549.1"
                     /db_xref="GeneID:8199504"
     CDS             727363..728514
                     /locus_tag="PAS_chr3_0371"
                     /codon_start=1
                     /product="Delta(24)-sterol C-methyltransferase"
                     /protein_id="XP_002492594.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0371"
                     /db_xref="EnsemblGenomes-Tr:CAY70415"
                     /db_xref="GeneID:8199504"
                     /db_xref="GOA:C4R4C9"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013705"
                     /db_xref="InterPro:IPR025810"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R4C9"
                     /translation="MTTSTTEQESQPLAPKNYEQDREFAKALHGKDAAKKTGLGAWVT
                     KDASAQEVAVDGYFKHWNGKTDQEAEHSRKSDYSELTKHYYNLVTDFYEYGWGSSFHF
                     SRYYRGEAFRQATARHEHYLALKMGITENMKVLDVGCGVGGPAREIARFTGCSVVGLN
                     NNDYQVERAEFYSKKYNMTKQLSYVKGDFMQMDFEPETFDAVYAIEATVHAPVLEGVY
                     SEIYKVLKPGGAFGVYEWVMTDAYDETNPEHRAIAYGIEVGDGIPKMYKRQVAEDALK
                     NVGFEVEYQKDMADMDDDIPWYYPLSGQLKYVQTLGDIFTIFRTSKIGRTVTTETVGL
                     MEKLGLAPKGSRQVTNALEDAAVNLVKGGELKLFTPMMLYVARKPLDAK"
     gene            complement(<728614..>729522)
                     /locus_tag="PAS_chr3_0372"
                     /db_xref="GeneID:8199505"
     mRNA            complement(<728614..>729522)
                     /locus_tag="PAS_chr3_0372"
                     /product="Putative vacuolar Fe2+/Mn2+ transporter"
                     /transcript_id="XM_002492550.1"
                     /db_xref="GeneID:8199505"
     CDS             complement(728614..729522)
                     /locus_tag="PAS_chr3_0372"
                     /codon_start=1
                     /product="Putative vacuolar Fe2+/Mn2+ transporter"
                     /protein_id="XP_002492595.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0372"
                     /db_xref="EnsemblGenomes-Tr:CAY70416"
                     /db_xref="GeneID:8199505"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="UniProtKB/TrEMBL:C4R4D0"
                     /translation="MAVVTLKNAILSLFPANTSDSQNEPLLGEDSTGNAGYAARDVQG
                     LESEIESNSTKTQNISEDNQNQTVLWGLFEKVDPRVMSDIIIGLSDGLTVPFALTAGL
                     SSLGDSKLVITGGMAELVSGSISMGLGGFLAARSESEFYKSQVRKEKQLFFNNKELLE
                     EELEDIFLDIGMSETTTESAIRDLSKSPKAMIDFIIRHGKGLEEPADGRQVTSALTIG
                     LSYFLGGFVPLVPYFFTAIVQTGLIISVLVMGVTLFWFGYLKTAISMGEDCSLWMRVS
                     EGLQMVLIGSIAAGSAWGLVRVIDTN"
     gene            <730544..>732433
                     /locus_tag="PAS_chr3_0374"
                     /db_xref="GeneID:8199506"
     mRNA            <730544..>732433
                     /locus_tag="PAS_chr3_0374"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492551.1"
                     /db_xref="GeneID:8199506"
     CDS             730544..732433
                     /locus_tag="PAS_chr3_0374"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492596.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0374"
                     /db_xref="EnsemblGenomes-Tr:CAY70417"
                     /db_xref="GeneID:8199506"
                     /db_xref="GOA:C4R4D1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4R4D1"
                     /translation="MTVETNQFTYLQGSTFDKKMTTLSLKQTAYEFVEGMTGDYHYLK
                     NLDASDSNLRYLKDYSFPTLQELNLSNLSYLKKLVSDGDQLSGLEKLTADGSNIELID
                     IKGDVLASISCSNTKELKAIKGELPAINYIYADNSSLESVSLLPYEDEKFQFKRMFFL
                     YLVNCPNLISFQRGQYPKLRTVDLSNSTIQVLHSSLIKHLGALYLGNATIKEFVIDDN
                     DNEDELTLRQLKTLNLSNSRIPTNMTDFLLRHIFRKKSNPWDKEWSSLIWQSVNTDQE
                     VQEVQSFIKRIPQLKKLDISNSSKANSLLSNLVSDIPEFWNSLEDLDVFNSNTEGFNF
                     SNSKSLIHLGCSDPDATVLKVDDMPALKALDVLGPSNIETVKLSNCIRLEKVDFTGCY
                     ALKRFESDSLSLLQLKFSNNSLETWSLNDSSIRSITLENNTGFRRLEGNFPNLETLDI
                     SNSAVEVINIHDGSKLKKLSILRTRSVEEIQIDNLSTLQELRYDTKDEKNTKAVKEFA
                     DKILSKREPSFTAKVLQRVRFEHRGLFTGGFRFFDRRTEELVCCFKDINISENKINAK
                     CGICEENYEEGQKCQILYCKHAFHTDCVEQMLQMGNDRCRHCNDEIDIASVGLSSDPL
                     PFRWL"
     gene            complement(<732875..>734404)
                     /locus_tag="PAS_chr3_0375"
                     /db_xref="GeneID:8199507"
     mRNA            complement(<732875..>734404)
                     /locus_tag="PAS_chr3_0375"
                     /product="Cyclin (Bur2p)-dependent protein kinase that
                     functions in transcriptional regulation"
                     /transcript_id="XM_002492552.1"
                     /db_xref="GeneID:8199507"
     CDS             complement(732875..734404)
                     /locus_tag="PAS_chr3_0375"
                     /codon_start=1
                     /product="Cyclin (Bur2p)-dependent protein kinase that
                     functions in transcriptional regulation"
                     /protein_id="XP_002492597.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0375"
                     /db_xref="EnsemblGenomes-Tr:CAY70418"
                     /db_xref="GeneID:8199507"
                     /db_xref="GOA:C4R4D2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R4D2"
                     /translation="MSQGSTPQKSYPQRRFYGISALRDYKIVGKLGEGTFGEVSKALQ
                     RRTGRVCALKKLMVLNSKDGFPITSFREVSILKKLKHKNVLQLVDMIYEKPEKQESPG
                     IFYTVSPYMASDLTGLLNNPRVHLTQSQIKGIVYQMLEGINYVHQNHYFHRDIKASNI
                     LIDSQGIVKIADFGLARIYYGPKPTPNGGPGGYDSATGMGLASYTGLVVTRWYRPPEL
                     VLGEKNYTTSVDIWGIGCIFAELFKRKPILEGKTEIDQGHLIFNLCGPLTPTSFPNAD
                     KLPGYNNYVSARYTRTLEQNYRKHLCSEGLRLLASLLEIDPVKRINALDALAHPYFKA
                     HPHPAPTKRLADFEESHELDVKRFKEERKTTDLQPPPPQQTRGFHSAQQGYRKDRRLN
                     NHHQNYSNGRNANFFPSGPRIGRSAQSQYTHSNDEANQHRTNYDHSRNQDRHRGGSFR
                     KSNSVTSLTSINPETDTASTQVVKSYGFVGLSKGKNQETRSEIVKKSSPKHQESNENP
                     E"
     gene            complement(<734925..>735296)
                     /locus_tag="PAS_chr3_1183"
                     /db_xref="GeneID:8199508"
     mRNA            complement(<734925..>735296)
                     /locus_tag="PAS_chr3_1183"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492553.1"
                     /db_xref="GeneID:8199508"
     CDS             complement(734925..735296)
                     /locus_tag="PAS_chr3_1183"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492598.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1183"
                     /db_xref="EnsemblGenomes-Tr:CAY70419"
                     /db_xref="GeneID:8199508"
                     /db_xref="UniProtKB/TrEMBL:C4R4D3"
                     /translation="MVSLRNAFAPFDLEMLLKHFERSSTLHNLFSMVTKALILMIPYL
                     LHIYGNEAIVKLGQFQQFHTGHGEYFSTLPQILSVCATMTIGLISLVCLTIFHGLCQI
                     ENLKKNTKVVSMLLRQLLDWE"
     gene            complement(<735564..>737525)
                     /locus_tag="PAS_chr3_0376"
                     /db_xref="GeneID:8200215"
     mRNA            complement(<735564..>737525)
                     /locus_tag="PAS_chr3_0376"
                     /product="Cytoplasmic and mitochondrial glycyl-tRNA
                     synthase"
                     /transcript_id="XM_002492554.1"
                     /db_xref="GeneID:8200215"
     CDS             complement(735564..737525)
                     /locus_tag="PAS_chr3_0376"
                     /codon_start=1
                     /product="Cytoplasmic and mitochondrial glycyl-tRNA
                     synthase"
                     /protein_id="XP_002492599.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0376"
                     /db_xref="EnsemblGenomes-Tr:CAY70420"
                     /db_xref="GeneID:8200215"
                     /db_xref="GOA:C4R4D4"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002315"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR027031"
                     /db_xref="UniProtKB/TrEMBL:C4R4D4"
                     /translation="MTSQETTAFTFSREKLESVLKRRFFFAPAFEIYGGVSGLYDYGP
                     PGCAFQANIVDVWRKHFILEEDMLEVDCTMLTPLEVLKTSGHVDKFSDWMCRDLKTGE
                     IFRADHLIEEVLEARLKGDQEARGQVVSEGKSDDKKRKKKVKEIKAIKLDDDVKEEYE
                     QILAKIDGYSGEEMGELIVKHNIGNPATGDPLEPPIEFNLMFETAIGPSGNLKGFLRP
                     ETAQGQFLNFSKLYDFNNEKMPFASASIGKSFRNEISPRAGLLRVREFLMAEIEHFVD
                     PEDKSHSKFDLVKDIKLNFLSKSTQIEGKTECAIKSIGEAVSEKMVDNETLGYFIARI
                     YQFLITIGVDPSRLRFRQHMDNEMAHYAQDCWDAELLTSYGWIECVGCADRSAYDLSV
                     HAARTNEKLCVREKLPEPITVDRLEIDIEKKKFGPKFRKNAGAVEKWLLARTECELET
                     LQKDLSTDGKILVEIPGIEEKIELDDSLIHIERRTRTEHIREYTPNVIEPSFGIGRII
                     YSIFEHAFYPRPDDADRCVLKLPPIVAPTKVLLVPLQTNAEFKPIVKEISQVLRKEKI
                     PFKVDDSGASIGKRYARNDELGTPFGITIDFDTIADGTVTLRERDSTTQVRGSVADIV
                     KAIKTITYDGLSWETGTKDLKPFESKSEE"
     gene            complement(<737866..>739095)
                     /locus_tag="PAS_chr3_1184"
                     /db_xref="GeneID:8199509"
     mRNA            complement(<737866..>739095)
                     /locus_tag="PAS_chr3_1184"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492555.1"
                     /db_xref="GeneID:8199509"
     CDS             complement(737866..739095)
                     /locus_tag="PAS_chr3_1184"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492600.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1184"
                     /db_xref="EnsemblGenomes-Tr:CAY70421"
                     /db_xref="GeneID:8199509"
                     /db_xref="GOA:C4R4D5"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R4D5"
                     /translation="MTVSDLKETNLFKPIKVGNVNLTTRVTYAPTTRRRATVDFIPSQ
                     LQLQYYGDRSKDNGGLIITEATFVSKQGGLYDQAPGIWSERQAKAWRAITDKVHENNT
                     AISVQLWNLGRVASPKLAKEHGLKLLGPSAFYESEASEKAAQEAGIEIQAATIEDIEN
                     FKKEYVVAAKLAVEVAGFDFIEVHGAHGYLFDQFLQGKGVNERTDQYGGTIENRARFL
                     LEVIDLLIDTVGAEKLAVRLSPWAEVQGSAGVNGDPHPIVLYGYVLSELEKRAKQGNR
                     LAYISIVEPRVSGVTDVSAEEAQRKGIASNDFVLDIWKGVVVRSGAYLSTPGFPSLIK
                     DVNANDRTLIGASRFWTSNPDLVQRLKNGKKLTPYDRSTFYLHTNYGYNTWKKYGDDT
                     VVSEDDPEAKKTPVALA"
     gene            complement(<739916..>741145)
                     /locus_tag="PAS_chr3_0377"
                     /db_xref="GeneID:8200216"
     mRNA            complement(<739916..>741145)
                     /locus_tag="PAS_chr3_0377"
                     /product="Widely conserved NADPH oxidoreductase containing
                     flavin mononucleotide (FMN)"
                     /transcript_id="XM_002492556.1"
                     /db_xref="GeneID:8200216"
     CDS             complement(739916..741145)
                     /locus_tag="PAS_chr3_0377"
                     /codon_start=1
                     /product="Widely conserved NADPH oxidoreductase containing
                     flavin mononucleotide (FMN)"
                     /protein_id="XP_002492601.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0377"
                     /db_xref="EnsemblGenomes-Tr:CAY70422"
                     /db_xref="GeneID:8200216"
                     /db_xref="GOA:C4R4D6"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R4D6"
                     /translation="MTVPDLKETNLFKPIKVGNVNLTTRVTFAPTTRTRATDDFIPSQ
                     LQLQYYGDRSKDNGGLIITEATFVSKQGGLYENVPGIWSERQAKAWRAITDKVHENNT
                     AISVQLWNLGRVASPKLAKEHGLKLLGPSAFYESEASEKAAQEAGIEIQAATIEDIEN
                     FKKEYVVAAKLAVEVAGFDFIEVHGAHGYLFDQFLQGKGVNERTDQYGGTIENRARFL
                     LEVIDLLIDTVGAEKLAIRLSPWAEFQGSAGVNGDPHPIVLYGYVLSELEKRAKQGNR
                     LAYISIVEPRVSGIIDVSAEEAKRKGIASNDFVLDIWKGVVVRSGTYLSNPGYPTLIR
                     DVNANDRTLIGAGRYWTSNPDLVQRLKNGQKLTHYDRNSFYRNDNYGYNTWKKYGDDT
                     VVSEDDPVSKKTPVALA"
     gene            complement(<742440..>743636)
                     /locus_tag="PAS_chr3_0378"
                     /db_xref="GeneID:8199510"
     mRNA            complement(<742440..>743636)
                     /locus_tag="PAS_chr3_0378"
                     /product="Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin)"
                     /transcript_id="XM_002492557.1"
                     /db_xref="GeneID:8199510"
     CDS             complement(742440..743636)
                     /locus_tag="PAS_chr3_0378"
                     /codon_start=1
                     /product="Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin)"
                     /protein_id="XP_002492602.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0378"
                     /db_xref="EnsemblGenomes-Tr:CAY70423"
                     /db_xref="GeneID:8199510"
                     /db_xref="GOA:C4R4D7"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C4R4D7"
                     /translation="MFAFLDVTIGGSKIGRIVLQLDNVNCPLASTNFLNLCNQVGKTF
                     HSKEYGDIKLTYQGIRFHRIMKNFIVQAGDLVFGRDDSFNQEQVGGGGVSTYINDLSN
                     NEKGPIYGKFDDEALDNNPVSKFDRPFVLAMANSGPNSNSSQFFITTYPCPHLQGKHT
                     AFGSVVHGKSVVRDIEKVDTTKENNSPLQPVVIVACGEWKEGDPVPVFNCSNSQIGGD
                     VFEEYPDDDDNFDKDSLEKALEAVEIIKESGSLLFKQNQIQNALFKYKKSYRYLNEFS
                     PDQDQSPQLYNRFLALKKKLYLNLSLVYYRLGQFSRARDYAEYLLEMEDNQAITDKDR
                     AKAFFRKGLAQIALNDFENGLHALKAAQDLTPTDSMISNEILKASKSFELFKKREKNK
                     LEAFFK"
     gene            <743857..>745023
                     /locus_tag="PAS_chr3_0379"
                     /db_xref="GeneID:8199511"
     mRNA            <743857..>745023
                     /locus_tag="PAS_chr3_0379"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492558.1"
                     /db_xref="GeneID:8199511"
     CDS             743857..745023
                     /locus_tag="PAS_chr3_0379"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492603.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0379"
                     /db_xref="EnsemblGenomes-Tr:CAY70424"
                     /db_xref="GeneID:8199511"
                     /db_xref="GOA:C4R4D8"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="UniProtKB/TrEMBL:C4R4D8"
                     /translation="MLGRRRFHAAARRLNVHAVHQQFTSPPDLQYRQSVMKARTDCTE
                     MLNKFDKSSYLLAHYIPEPARDTWMAIRCFLLEVNKISDSNTRANSQFRANVGVGLLD
                     VKFKFWEELLQKVFLGGYQKPLGEPVATLLRDGINKELNLDIGMFQQILTSRLHYLKN
                     TSKLGFKNMDEVCSYGEGIYSQSNYLTQRLLLSPNISPSAVELLEQAPFLETNLTEVA
                     AHLGQATGVATMLIGLKYYATTQNHIPLPLDLMAKHDLSQEQLLRLFHGYLEGSDLAR
                     ASDQLSNVVFDVATTANDHILTARQKFDQLKQDICQVLDVDQAHNEFLQSRAQNWTKK
                     VPDVLYVPFMSSIPTQLYLSKLEKYNFDINNGNLQSKDWKLAWKSYSNYSRRSI"
     gene            <745156..>746313
                     /locus_tag="PAS_chr3_0380"
                     /db_xref="GeneID:8199512"
     mRNA            <745156..>746313
                     /locus_tag="PAS_chr3_0380"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492559.1"
                     /db_xref="GeneID:8199512"
     CDS             745156..746313
                     /locus_tag="PAS_chr3_0380"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492604.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0380"
                     /db_xref="EnsemblGenomes-Tr:CAY70425"
                     /db_xref="GeneID:8199512"
                     /db_xref="GOA:C4R4D9"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R4D9"
                     /translation="MNSGIVFQKPMEDNDDSKKATLSNKNTQVVSASTAGIRAVLVQF
                     SSLYLRTPAKLFRPTRFDYMAPIRIFFGAHLKGKPYSPFSHSNPALLLRAVKTHGWEL
                     IPNKVLPPLVANSVMGIVLYTTYLSCLQSYTDGQEGRSIANPRLVDVFRAGFLAGAAQ
                     SLVAAPIDAIYARSNASEIIGGKNDNLWIYGLHKLKTSGFLGVFAGYSLSLVKESTSF
                     AIYFTTFEAIKNRGYRITENTMERIDRMKNSLLGRPQGDTVKTKSENILRTTFILLAG
                     ASAACSLLAVQYPFSKVQSIHLARLEALDIFNENSWDKKSKFRLYYRSYLDTFHQLVS
                     LHEKSKLSWTRWFYKGFVRNALTTIPATSVGLLVFEILRQKLSDEIEDRFS"
     gene            complement(<746353..>747144)
                     /locus_tag="PAS_chr3_0381"
                     /db_xref="GeneID:8199513"
     mRNA            complement(<746353..>747144)
                     /locus_tag="PAS_chr3_0381"
                     /product="Orotidine-5'-phosphate (OMP) decarboxylase"
                     /transcript_id="XM_002492560.1"
                     /db_xref="GeneID:8199513"
     CDS             complement(746353..747144)
                     /locus_tag="PAS_chr3_0381"
                     /codon_start=1
                     /product="Orotidine-5'-phosphate (OMP) decarboxylase"
                     /protein_id="XP_002492605.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0381"
                     /db_xref="EnsemblGenomes-Tr:CAY70426"
                     /db_xref="GeneID:8199513"
                     /db_xref="GOA:C4R4E0"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /db_xref="UniProtKB/TrEMBL:C4R4E0"
                     /translation="MARSYAERANTHQSPVARRLFALMEQKQSNLCASVDVRTTKELL
                     ELLDKLGPFICLAKTHIDIIDDFTYDGTILPLLELSKKHKFLIFEDRKFADIGNTVKH
                     QYQGGVYKIAQWADITNAHGVIGSGIVKGLKEAATETTDQPRGLLMLAELSSKGSIAH
                     GKYTEETVEIAKSDKEFVIGFIAQNSMGGQDEGFDWIIMTPGVGLDDTGDALGQQYRT
                     VSQVFSTGTDIIIVGRGLFGKGRDPLKEGERYRKAGWEAYQNILR"
     gene            <747315..>747578
                     /locus_tag="PAS_chr3_0382"
                     /db_xref="GeneID:8199514"
     mRNA            <747315..>747578
                     /locus_tag="PAS_chr3_0382"
                     /product="Mitochondrial intermembrane space protein"
                     /transcript_id="XM_002492561.1"
                     /db_xref="GeneID:8199514"
     CDS             747315..747578
                     /locus_tag="PAS_chr3_0382"
                     /codon_start=1
                     /product="Mitochondrial intermembrane space protein"
                     /protein_id="XP_002492606.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0382"
                     /db_xref="EnsemblGenomes-Tr:CAY70427"
                     /db_xref="GeneID:8199514"
                     /db_xref="GOA:C4R4E1"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:C4R4E1"
                     /translation="MDALNAKEQQEFQKLVEQKQMKDFMRLYSDLVSKCFTDCVNDFT
                     SNKLTSKEEGCINKCAEKFLKHSERVGQRFQEQNQLMMQQLRR"
     gene            complement(<747615..>749321)
                     /locus_tag="PAS_chr3_0383"
                     /db_xref="GeneID:8199515"
     mRNA            complement(<747615..>749321)
                     /locus_tag="PAS_chr3_0383"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492562.1"
                     /db_xref="GeneID:8199515"
     CDS             complement(747615..749321)
                     /locus_tag="PAS_chr3_0383"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492607.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0383"
                     /db_xref="EnsemblGenomes-Tr:CAY70428"
                     /db_xref="GeneID:8199515"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:C4R4E2"
                     /translation="MTALPVLYKVITLQNLHSLYIQSYQRQEKEITLDMDKLRSNINA
                     SPLIDPAYDLCQIDTQKVHKDNQTSQVISGEQIVEIINEFFSENGGQALIPISTNVFK
                     ISETISINTIKDRLIKVLNHYKNTTLREVAALEAQYHLLRTQKEKVIASEVLKEDEDE
                     SIDEVEDNKPEEAETARKDYKVDEPQEEQQDEDEKSPAPKEPSKSELSTGGEFSNGSK
                     EEENMEQAEILKEEDTSEEHKENKNEEPVKELEETENTKDENTEKKVESTAESQIEQQ
                     HDIDVKSEKADDEIGEKSDLSEKTEENHSEKEELVDSTFNSGIQPTETTDSDQQMVAD
                     RTKQDQAIGEKKPIDNDFDGDSSSKEKSSEVISETLNGESSPEKSQEEDNNQEANATE
                     ESPEEQEGQPEESRAEEKLSVETTDDKSLLDRESPSKESERKRSHDADESEQEISPSK
                     RQKKEDTQKSIKKFQTIASNLISQISSNRFASTFLAPVNKSEEPEYYKIVKQPQDLKT
                     ILKHCRNGEITTFDELTKVLQIMFTNAIIYNDEDSDVSKLTIEMMEETTKIIELFRES
                     LD"
     gene            <749438..>750337
                     /locus_tag="PAS_chr3_0384"
                     /db_xref="GeneID:8199516"
     mRNA            <749438..>750337
                     /locus_tag="PAS_chr3_0384"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492563.1"
                     /db_xref="GeneID:8199516"
     CDS             749438..750337
                     /locus_tag="PAS_chr3_0384"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492608.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0384"
                     /db_xref="EnsemblGenomes-Tr:CAY70429"
                     /db_xref="GeneID:8199516"
                     /db_xref="GOA:C4R4E3"
                     /db_xref="InterPro:IPR004181"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR026846"
                     /db_xref="UniProtKB/TrEMBL:C4R4E3"
                     /translation="MKTEPTGNGGLAGLSAIKLPTSFPLVPEAQQELSKVNLYDTQFR
                     SMVSRYTDQLEQTASKFISNKLEMEALQLIDDPLEKVRESIQKDCKNLIDEFTSSGRK
                     ITEEELERSRYQVALTAIKAQKRINYRESAEVSLDNLDVLRDQREEISCADQLESLLS
                     TLEVDSATFETANNRLQLLQEHLFVTLNPESELPDAEDDDVAISGGKVSLICPISKRP
                     MKNPVKITVCGHCFERTHILEFLQQSQGSGFCPECRTLFKKQDLIDDDLMKLRLEAHN
                     RDLLILQYREKKSSQIGKKENGT"
     gene            complement(<750346..>751086)
                     /locus_tag="PAS_chr3_0385"
                     /db_xref="GeneID:8199517"
     mRNA            complement(<750346..>751086)
                     /locus_tag="PAS_chr3_0385"
                     /product="3'-to-5' phosphorolytic exoribonuclease that is
                     a subunit of the exosome"
                     /transcript_id="XM_002492564.1"
                     /db_xref="GeneID:8199517"
     CDS             complement(750346..751086)
                     /locus_tag="PAS_chr3_0385"
                     /codon_start=1
                     /product="3'-to-5' phosphorolytic exoribonuclease that is
                     a subunit of the exosome"
                     /protein_id="XP_002492609.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0385"
                     /db_xref="EnsemblGenomes-Tr:CAY70430"
                     /db_xref="GeneID:8199517"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:C4R4E4"
                     /translation="MELYSPEGLRVDGRRWNELRRFYCRINTHPIVADGSAYVEAGNT
                     KIVCLLNGPHEPTRSQMNTQKGSLDIKLHVSPFSTTERRKVTRNDRRIQELSTILKNT
                     FEQVVILKNYPRTIIEVNVRVLAQDGGLLAACCNAITLALVDAGIALYDYISAVSAGV
                     FDNQILLDLNRLEEQDLSSVTIGVVGKTKKLSLVLSETRLPQDRLAKVFEVAVNGCHQ
                     LKDQMDAQVAKKGREKAITEELKTNWVQ"
     gene            complement(<751239..>752480)
                     /locus_tag="PAS_chr3_0386"
                     /db_xref="GeneID:8199518"
     mRNA            complement(<751239..>752480)
                     /locus_tag="PAS_chr3_0386"
                     /product="Glycosylphosphatidylinositol-alpha 1,4
                     mannosyltransferase I"
                     /transcript_id="XM_002492565.1"
                     /db_xref="GeneID:8199518"
     CDS             complement(751239..752480)
                     /locus_tag="PAS_chr3_0386"
                     /codon_start=1
                     /product="Glycosylphosphatidylinositol-alpha 1,4
                     mannosyltransferase I"
                     /protein_id="XP_002492610.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0386"
                     /db_xref="EnsemblGenomes-Tr:CAY70431"
                     /db_xref="GeneID:8199518"
                     /db_xref="GOA:C4R4E5"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="UniProtKB/TrEMBL:C4R4E5"
                     /translation="MEINSRNLLTIGILLRVGFFIYGLYQDSHLEVKYTDIDYYVFTD
                     AAKFIANDRSPYARETYRYTPLLALLLLPTTLGGFYFQFGKVLFMLFDLLTGILILRI
                     LELTKTRERNRLVLASLWLLNPMVITISSRGSSESILSALVLASIYSLLKGNIFACGL
                     ALGLSIHLKIYPIIYLPTMIVFLSRDGKVVKGMKEMSQYFTKDAIYLVCVAGFTFSSL
                     TVLMFHLYGMAFLRETYIYHFIRIDHRHNFSLYNTALYFVSSLEHQGLKGDLLSFEKW
                     AFIPQLGFSAVLIPWYLTKKDVTSTFFIQTFVFVLFNKVITSQYFVWYLCLLPFYLRQ
                     YSSWKQWPEWAGLVIWSASQGLWLYFAYQLEFKGRSTFYPQLFGAASLFFAGNIYLTG
                     LFVKRTKSLSEADQDKEKKLR"
     gene            complement(<752705..>753313)
                     /locus_tag="PAS_chr3_1185"
                     /db_xref="GeneID:8199519"
     mRNA            complement(<752705..>753313)
                     /locus_tag="PAS_chr3_1185"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492566.1"
                     /db_xref="GeneID:8199519"
     CDS             complement(752705..753313)
                     /locus_tag="PAS_chr3_1185"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492611.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1185"
                     /db_xref="EnsemblGenomes-Tr:CAY70432"
                     /db_xref="GeneID:8199519"
                     /db_xref="GOA:C4R4E6"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005873"
                     /db_xref="UniProtKB/TrEMBL:C4R4E6"
                     /translation="MSEVQIAPKEVIYCEVCSFPPEYCEFGGTFNKCKAWLEKEHPQL
                     FQSLYSADALAAATSSLSLEKEEKISQDLQKKRRKEEKKQERELQQKLASKVLIKKIA
                     RTKRKQVIAISGLEVFNIDMKKLAKTFASKFATGASVTKNLEKKDEIIIQGDVGDEVE
                     QYILELLEKDGLTEVKVEQVDEKPKKKKPTAPGTGTGTATST"
     gene            <753542..>754069
                     /locus_tag="PAS_chr3_0387"
                     /db_xref="GeneID:8200217"
     mRNA            <753542..>754069
                     /locus_tag="PAS_chr3_0387"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492567.1"
                     /db_xref="GeneID:8200217"
     CDS             753542..754069
                     /locus_tag="PAS_chr3_0387"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492612.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0387"
                     /db_xref="EnsemblGenomes-Tr:CAY70433"
                     /db_xref="GeneID:8200217"
                     /db_xref="InterPro:IPR022036"
                     /db_xref="UniProtKB/TrEMBL:C4R4E7"
                     /translation="MIGSLPISWDQLIEIVNRNDIDKLYRSRDCKKCYDMHKQHLIYQ
                     GSSVENYVLQKLKWHKGDDGNYFGESSRPYHVERNQFPYFFTPDLVHLVAWLKTEIPP
                     DPHSPLGDISEETRKRLDALITELFVLRVGIDRSRLIWFRNWGALQSIKAVPHIHIVV
                     KNLSKEEEFKISTEL"
     gene            <754197..>755315
                     /locus_tag="PAS_chr3_0388"
                     /db_xref="GeneID:8199520"
     mRNA            <754197..>755315
                     /locus_tag="PAS_chr3_0388"
                     /product="Methionine aminopeptidase"
                     /transcript_id="XM_002492568.1"
                     /db_xref="GeneID:8199520"
     CDS             754197..755315
                     /locus_tag="PAS_chr3_0388"
                     /codon_start=1
                     /product="Methionine aminopeptidase"
                     /protein_id="XP_002492613.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0388"
                     /db_xref="EnsemblGenomes-Tr:CAY70434"
                     /db_xref="GeneID:8199520"
                     /db_xref="GOA:C4R4E8"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002467"
                     /db_xref="UniProtKB/TrEMBL:C4R4E8"
                     /translation="MIHSCASAECSKATESTLKCPLCLKQGQIQYFCNQKCFKNGWKI
                     HKAVHAKDGDIDGSYNPFPNFAYTGELRPAYPLSVRREVPENITLPDYALDGVPVSEI
                     KNNRMNKINLVTEPEDLAKLKNVCRLAREVLDAAAASIKPGVTTDEIDEIVHSETIKR
                     EAYPSPLNYFNFPKSVCTSVNEVICHGIPDRRPLQDGDIVNLDVTLYKDGFHADLNET
                     YYVGEKAKTNKDLVNLVETTREALAEAIRLVKPGMPFRQIGTVIENYVTERGCETVRS
                     YTGHGINTLFHTEPTIPHYARNKAVGVAKPGVVFTIEPMLTLGTHRDVVWPDNWTAVT
                     ADGGPSAQFEHTLLVTEDGVEILTGRTETSPGGAISRL"
     gene            <755564..>756016
                     /locus_tag="PAS_chr3_0389"
                     /db_xref="GeneID:8199521"
     mRNA            <755564..>756016
                     /locus_tag="PAS_chr3_0389"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492569.1"
                     /db_xref="GeneID:8199521"
     CDS             755564..756016
                     /locus_tag="PAS_chr3_0389"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492614.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0389"
                     /db_xref="EnsemblGenomes-Tr:CAY70435"
                     /db_xref="GeneID:8199521"
                     /db_xref="GOA:C4R4E9"
                     /db_xref="InterPro:IPR013251"
                     /db_xref="UniProtKB/TrEMBL:C4R4E9"
                     /translation="MFLESCINSLEASVELLDSSTEVLSRATTSFPKLSTILKTNRVF
                     GLIPEADVLQSKKTLRHSVEPNIVLLLNRLDHELVKLERKRNSLIRKCELNKIRLENV
                     SSLRKKRLSSGIPSRLELLRSKRRQLEYQVQERNSLQENKHTEEIRED"
     gene            complement(<756405..>757493)
                     /locus_tag="PAS_chr3_0390"
                     /db_xref="GeneID:8199522"
     mRNA            complement(<756405..>757493)
                     /locus_tag="PAS_chr3_0390"
                     /product="Subunit of RAVE (Rav1p, Rav2p, Skp1p)"
                     /transcript_id="XM_002492570.1"
                     /db_xref="GeneID:8199522"
     CDS             complement(756405..757493)
                     /locus_tag="PAS_chr3_0390"
                     /codon_start=1
                     /product="Subunit of RAVE (Rav1p, Rav2p, Skp1p)"
                     /protein_id="XP_002492615.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0390"
                     /db_xref="EnsemblGenomes-Tr:CAY70436"
                     /db_xref="GeneID:8199522"
                     /db_xref="InterPro:IPR028241"
                     /db_xref="UniProtKB/TrEMBL:C4R4F0"
                     /translation="MSCRVFVPYGITETDPKLISKSNKEKEGPWFIENIILRQIPSIQ
                     ETLVSCKDMIVDESNEIKLPISSRNSDVIKGVIIRKQCEIVGINLILKGFPVKHLELK
                     ANERVVIPQLNDGVHEIDQALISIDRLFQLYSDGTHFERYLDVLTEFHGHIKLAKDSL
                     KLPSPDYLFPRYRNVKALEPELPVSMSLDFYINNGDICLEINKLHQSHAVPWSIIVNK
                     TKRQSFVDVVRTQISKNREDSINEIVDMEYKKLLRWLDSESGTAIEDDNNHHKKSLQG
                     RGVGGVLSGLFFNGGSSFRNCNKYLQNYLTYLDNDNQPIVVMVEEKFEVLSSDPILIS
                     TSTKLETLERVVEKMIENFQVVNYKDNR"
     gene            <757649..>761806
                     /locus_tag="PAS_chr3_1186"
                     /db_xref="GeneID:8199523"
     mRNA            <757649..>761806
                     /locus_tag="PAS_chr3_1186"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492571.1"
                     /db_xref="GeneID:8199523"
     CDS             757649..761806
                     /locus_tag="PAS_chr3_1186"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492616.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1186"
                     /db_xref="EnsemblGenomes-Tr:CAY70437"
                     /db_xref="GeneID:8199523"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024986"
                     /db_xref="InterPro:IPR026003"
                     /db_xref="UniProtKB/TrEMBL:C4R4F1"
                     /translation="MDLPSVLVNYPVPLVALQDMVSLASPYQVDIGGPSVSHFSCECE
                     DSVLQTTAHRIQDMDPQLEGLRFRKPIVKSRELNCNSGQPHRDNLLIRQVLQTYNRSS
                     SPKIVKPKLKVKRLKMNVEPIDVKELYFTKKPLLELKTATEDTIAASSSSLIFQPDQE
                     NEKYTQEIISTLQEIVLEEHLEHHHLLRIMDLLYQLDTNRAELKLDTQVLRNVQKATL
                     QLITESLENEQDWDLTFKGFYCLLINLTILNLDNDKLLHLDTCLKSLVTFFCTKYEDI
                     IEPLSTLSIGESTVTTDSFSLIFELCKQSIVALSIYCVNHRLDDYLFTRLEYVCITII
                     THHTDHKRKNLLMDYSRFSPLKVAASDLLLSIFRFFPDQREFILTEFCYAIHKLDERN
                     SKVYRVQSVILDVFTVTLIRMIQVETLDFRQLSLSEVTKVHDEIQNILQIVFATLMER
                     VVDHPKLRSKLEYLIQDVLQVLSDPHFPGASLLIKRFMKGLSESSDNDISILIAGLIA
                     KSLNEKLNFENREKSFDLSMLPNLLLQLDWSAATTILVNCIVSSPSPEDTLSKLDFSN
                     STGKAPPDVDVNIYSLYDEVLNSQSLLQLYDRFLVMMLNNLDSKKPKTRLKAMKTVSL
                     LLSREVLDYSTVKKIFIKGLRDSSPIINNWIIQEASKYIDKEPYLTDFYLLILDKLFD
                     ESISVRKGALKCLKSMYIVTQDVSIQVQIAEGALKLLEDEEESMVMLAGETLLELWFY
                     SLDVMNNEDNPAAYRLGVHARVEIMAQLLARSNKNKDSFVEFIRSFLNDEKNNDTNSS
                     RMVLRSIKAIADSSLESIVENEGNGKAEHMMCLTSTLVLINGEILNQDQLVFLKPYLD
                     EHSNTVTCYYTLKLFKHSLPLMKNLASSFTYECLTLLLEKLTKFNVKELFEAMPTVYY
                     LSKLQNDTRYVNAAISCLRLLRPFVNSNHEGDLNAKLTRLLYLAGSFGRCCYFETYRD
                     LFEKNNITIQPNEPVVSVFVRSLLLFTKPPMSRKIRRIAIRNLMELCVTHPKFFLSKP
                     LVTIMDEELQSDYVDTKEVIIQGIFEFLSQHEETSINNSDHSNKNSKQISLDVEVFHG
                     KSPSFVNESLGVSLVHKYMPYILKMCIFDEGYYSLLPVRFIDFVVRLGMANPKVCIST
                     IVCLESSSNRTIRSLALQIHRELHNKHESLIESSYVEGVRMATEYRKAHSKDMWKETF
                     FLPLFLTILGDNKSSRRKFFSNLLRSFINDVRILTESDSQAYRDYVCFVVLNLANVSF
                     ITLEEVYLIIRGIDGLLSKQGAPLSAEIDNQENEHDGEGLSWRGLSFLVTAFLTLEQF
                     KEFLISRYGVLEEKLLEFRPQKVDKELRQPIRQFNEKKLFDQNKVLHRFDMDPKELSL
                     QFSRNWS"
     gene            <762084..>764024
                     /locus_tag="PAS_chr3_0391"
                     /db_xref="GeneID:8200218"
     mRNA            <762084..>764024
                     /locus_tag="PAS_chr3_0391"
                     /product="Catalytic epsilon subunit of the translation
                     initiation factor eIF2B"
                     /transcript_id="XM_002492572.1"
                     /db_xref="GeneID:8200218"
     CDS             762084..764024
                     /locus_tag="PAS_chr3_0391"
                     /codon_start=1
                     /product="Catalytic epsilon subunit of the translation
                     initiation factor eIF2B"
                     /protein_id="XP_002492617.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0391"
                     /db_xref="EnsemblGenomes-Tr:CAY70438"
                     /db_xref="GeneID:8200218"
                     /db_xref="GOA:C4R4F2"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R4F2"
                     /translation="MPPKNKKQKEIVQDERLQAIILTDSYQTRFEPVSSQSPRCLLPL
                     ANVPLIEYTLEFLANSGVDEVYVMCRSHASQIQDYLEKSKWSQRNSPFKVQTVLSLES
                     RSVGDAMRDLDNRGLITGDFVLISGDVVTNMSLEPVLKTHRQRRSQDKDHMLTMVLME
                     ASPYHRSRSNTEPATFMVDRATGKCLYYEQIGGAKKAVSIDPELLTGIDKFEIRNDLV
                     DCHVDICAPQVPLIFQENFDYQELRNDFVRGILASDILQKTVYAHITNQYAARVESWS
                     TYHAISQDIMERWTYPVAPESNVIDGTSYIHVGEHIYKENDVILAQTSRLQRCVVIGG
                     GSFVGAETNIVCSCVGKNVRIGEGVQLKNSYIWDDVVLENGVEATGAVVASGAIIRAG
                     AKLLPGAIVGFNEEVPAGAEVAASESKMPQLKFSESAAHDDGLFDLSDTSITSLPGTG
                     SRRKGRTLSTTSYYSEFDSDADGLRDEDDFDKEAMATVTRSMENNHDLDTALLELNTL
                     RMSMNVSYHELRLATTKALLARIEHFVATQTLSLTEATNKIFRKWGLLFRRQVFETEE
                     QIDLLNVLQQQCLELENRSDAASILMRALYILYDEDIVEEDQIYAWWDAPESNASEEL
                     IEVKAPAGKWVQWLREAEEESD"
     gene            <764283..>765320
                     /locus_tag="PAS_chr3_0392"
                     /db_xref="GeneID:8199524"
     mRNA            <764283..>765320
                     /locus_tag="PAS_chr3_0392"
                     /product="Putative nucleotide sugar transporter"
                     /transcript_id="XM_002492573.1"
                     /db_xref="GeneID:8199524"
     CDS             764283..765320
                     /locus_tag="PAS_chr3_0392"
                     /codon_start=1
                     /product="Putative nucleotide sugar transporter"
                     /protein_id="XP_002492618.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0392"
                     /db_xref="EnsemblGenomes-Tr:CAY70439"
                     /db_xref="GeneID:8199524"
                     /db_xref="GOA:C4R4F3"
                     /db_xref="InterPro:IPR004853"
                     /db_xref="UniProtKB/TrEMBL:C4R4F3"
                     /translation="MALTHLFPANSNPIVFSILAWYLFSLSISLYNKWMFGPDLGFEF
                     PVIITSLHQMVLFILSGSCLLLTPQFRLAHDSKLSYSMPWQMYVRTILPCALASAADI
                     GAGNSSFRFITLSLYTMVKSSSLVFVLLWGVAFKLETLSTRLVLIVAIMTGGVVMMVY
                     GHDSKDGDNRPTHIFIGCSLVLISAVMSGLRWALTQLLLKRHSHTQNPILTIFYLSPA
                     MSIALFITGGFLEGFGSFAASKVWDIKGVPVTLCLLVIPGILAFLMTLSEFILLSYAS
                     LLTLSIAGIFKELLTILLGHLVFGDSLSLINGVGLLITLLDILWYNYYRLTESSTVPT
                     LTDVELEEVNE"
     gene            <765681..>767492
                     /locus_tag="PAS_chr3_0393"
                     /db_xref="GeneID:8199525"
     mRNA            <765681..>767492
                     /locus_tag="PAS_chr3_0393"
                     /product="Transcription factor"
                     /transcript_id="XM_002492574.1"
                     /db_xref="GeneID:8199525"
     CDS             765681..767492
                     /locus_tag="PAS_chr3_0393"
                     /codon_start=1
                     /product="Transcription factor"
                     /protein_id="XP_002492619.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0393"
                     /db_xref="EnsemblGenomes-Tr:CAY70440"
                     /db_xref="GeneID:8199525"
                     /db_xref="GOA:C4R4F4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R4F4"
                     /translation="MSSIFISFFKLVQLRFRYYWNVLASFFPLLTLLSDGLNHVLPPT
                     RKISSDSEESHELDDKKSLFPESQQRITQIKVFKNVHPCSLTFNTKLVPFKNSNGEME
                     WKFVEDNESAEKSPSLMEDGLSESLSPFMADSTQDSDVHLMFGTPFLVKEEQQQHKQE
                     QQQLQEQEQEHQHQQHQQNLPSSSNSKDGSQDHSSLAESSKELNIHKRNRRKRVSSVV
                     TSVTNGETYYHCSECPSKFKFRGYLTRHSKKHSQRKAYHCPFYESGHGKCSLGEGFSR
                     RDTYKVHLKAMHFKYPKGVKCADRTGMMGWCGSCGQSFQNNEIWVERHIEKGVCRGLP
                     EGYSSRIMTRNRKKTGKQSSLLNVANNGVNENPMLKLVMDGEVVSAPKLEDVTHLLGE
                     SGSTNTWTENSENASRTSSIHDLSDHSSASDSLSGHTSGESLAGSTNDSSSQSLDEAI
                     NPIGHPVDRSLFAHPNSNGEMFGRSWTARESSLHSVVDPFGGQVQAQVQAQIYMKSQA
                     DSQVSQSDSQKQVNFQTNFQQIPQNFENSVPLAMPIGDDDFPALDGENAYIALLQQHR
                     QLPDSRPERAKPAHLGQDPLFHPNMHVSWLSQPDLTF"
     gene            <767712..>769460
                     /locus_tag="PAS_chr3_0394"
                     /db_xref="GeneID:8199526"
     mRNA            <767712..>769460
                     /locus_tag="PAS_chr3_0394"
                     /product="Putative GPI-anchored aspartic protease"
                     /transcript_id="XM_002492575.1"
                     /db_xref="GeneID:8199526"
     CDS             767712..769460
                     /locus_tag="PAS_chr3_0394"
                     /codon_start=1
                     /product="Putative GPI-anchored aspartic protease"
                     /protein_id="XP_002492620.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0394"
                     /db_xref="EnsemblGenomes-Tr:CAY70441"
                     /db_xref="GeneID:8199526"
                     /db_xref="GOA:C4R4F5"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C4R4F5"
                     /translation="MYQALLVLSLICFSSANFVKLRSNAGMFYDTMAGVPRSDEEFWL
                     RLDINQGLSWTLDSSYYSCNGSNVSSSLCFNSAQNVYDASNSPTADFVDVYANTTVNN
                     TDEASAERVNLTNNLFADGVYMEDNFYVTLNNGARMTATDLKFLNAHNSSAAVGSLAL
                     GSYTSQDVPTFLQRLQSGGLIESNSFSLALNEIDSSYGELYLGTINSTKYVEPLVEFD
                     FIPVSDPNGVFGFDWEDTFPTVPISGLSMSSNDKQRTVFFPNEWNNTVLTGTYPLPMM
                     LDSRNIFIHLPFSSIIHIAVQLNALYLDTLHKWAVNCSVGQLDATLNFHMGNLTVHAP
                     IKELIYPAYQGDKRLSFANGEDVCILAMAPDVYIGYPLLGTPFLRNAVVAVNHDSKKV
                     AVANLNRDSIPPASNVSVSESMGVYVPPPVSTSRTSERPSTLDETSTANFDKREESAI
                     SSSSVTNSSSRNSSTITSSGTQTEQTSGIATIETDSIPGALGNNLTDYSTLTLTIYTN
                     SEVDELNPNIATAFISNGSIYSEPYPFSGTAVAESFSASPSQAEGSNSSSSGSSLVLC
                     FFTSLASLLTVSCLLL"
     gene            complement(<769531..>772464)
                     /locus_tag="PAS_chr3_0395"
                     /db_xref="GeneID:8199527"
     mRNA            complement(<769531..>772464)
                     /locus_tag="PAS_chr3_0395"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492576.1"
                     /db_xref="GeneID:8199527"
     CDS             complement(769531..772464)
                     /locus_tag="PAS_chr3_0395"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492621.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0395"
                     /db_xref="EnsemblGenomes-Tr:CAY70442"
                     /db_xref="GeneID:8199527"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR013914"
                     /db_xref="UniProtKB/TrEMBL:C4R4F6"
                     /translation="MPQTPWLKKTKDPFESPNMSKSFDNSVLKETQVTPVPAARSKTA
                     HGIFEQLRKNHAVVQEFEVLDGIVVDGVDMEDQSTSSLKLNDRSLKQNDTFDSTLSHD
                     TPRHRIPFDATQKDILPSSDTLAVSEKDIVPILDTQSSTQKDSHSNWESQEKLGPMLK
                     DTQVIDTSNMPTSTQADDGHKYMTKEYLLGGASQLAPTQVIEKSTQNIHGTPNQKFIQ
                     VPGTAEREIASTNASRFSRRHELTDPENSQIIESSFSNIKSQNGDEEENDEASAFPNN
                     LLFDTLERLTPKRNKSGSGSTSFSPGKQNVSTPKEKEFLSSEVTEELTDIEDERALNF
                     KHARHLKAQQTPSSFDKMEEQNKHIGSNYLSPRKPNYSQNADFMFSQQSFKGSPTRRN
                     LFDANEVEEEIHSDYEKHQTLDTNSRTSSLSDLIENHDVIFDSFQSPQSKDLRVSNKF
                     DIELGQKEVIHRKEKHEDYILSQTDIANKAAVWVRIGSKIIPGNIVDFAGTSVDVSDG
                     VDVFRIREMNVLGILDIKIGDVIKWKSLKRRTCIVTGLAFKGSIASDNTDIQCARGFN
                     TVYLKEHKKGVDLEKDEEKKVNLNEIYLSGTLFRCPTRSKLFNDTDFFKDYLCQVKES
                     LGLTSKYLNNDHGVFSGCLFAITGTTDKKGKEILDLKAEIDSNGGKILENGFRPFLLD
                     SRTQFIDSEHNLQLTPKDSLDSFSFAAIISNGVVRTPKYLEALALGWPVLGHEFIGDC
                     LKDSKTFSRWKAYLLPAGKTKLVSGLKSIEISRFINNFEAGKSLVSQLRANNYKMNGM
                     RLLVIQDGDQVKAGVVEFLAYCFGVKSLDKPANYEEALSIIEKYHPSNGREDKCECAL
                     YDDKTIKEITGALNLAYDKIDNQTPNDQTEELASGATTKKRGIDSQDLITTRRRRTVK
                     KINYNEDSDDEPEIKSKRSKSVSKLQARNLPESKRTRIQLLNWEWMTEVIVSGEVWPP
                     SGNYN"
     gene            <772852..>774759
                     /locus_tag="PAS_chr3_0396"
                     /db_xref="GeneID:8199528"
     mRNA            <772852..>774759
                     /locus_tag="PAS_chr3_0396"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492577.1"
                     /db_xref="GeneID:8199528"
     CDS             772852..774759
                     /locus_tag="PAS_chr3_0396"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492622.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0396"
                     /db_xref="EnsemblGenomes-Tr:CAY70443"
                     /db_xref="GeneID:8199528"
                     /db_xref="UniProtKB/TrEMBL:C4R4F7"
                     /translation="MKTQFDVLCRRLDELYNDRCFFEVVWLVTPEMLFEPIPLEQRVQ
                     IGLALIQLKKYGVGVQQLILACEFSSGMSKQDKWLLLAQQLKKLGYVEKARLCLNEAY
                     LISLDTKILQLVIEVQRTNNVKVEPNEDELQLIQKIRKMEQLHQKEYYQSRITQLEEI
                     EYISNQLILFSISNFLERQKIIDDCLLGRVFKVASKFPPWSFFSLLEEHKPTLQSLIK
                     EEEDIYFEINLTAPAKPFCKSLKALSRSQHKEKLVKICRLAVLHRFTQSIISFLNDDL
                     ERSSSIMREVLLLFEMLSMHFDMINKTRNEFIEQFGFNEVFMVCAIYAAQYALQRNHK
                     TSREEIEHLQKVLNKCLDDSSVNLITNKQLAGHLFKMLGLIHQRLAVYNLRWIRSSPS
                     MFENHQPVEVPDNLIKLNEENLDCMVTNLIWAATMKQNHDPELVRIYDQILWAMLLSG
                     GVHVKCFWFFKFVRDYYKLENDISPLTLDCYQPQTCYHKESITERLVEYYCHGQFFSI
                     ENEAQKLLDHIYNIKDSFSSDEKSQMWDVTQENVFLAPHVFLHQDSFKCLMMDGYFSY
                     AEFQSLQQHHLRPILRRLMRYPQEETTEEVSKSIHKSRDWIVLWIQQFKVFNGREIPE
                     VISNFWYENIE"
     gene            complement(<774803..>775774)
                     /locus_tag="PAS_chr3_0397"
                     /db_xref="GeneID:8199529"
     mRNA            complement(<774803..>775774)
                     /locus_tag="PAS_chr3_0397"
                     /product="Component of the septin ring of the mother-bud
                     neck that is required for cytokinesis"
                     /transcript_id="XM_002492578.1"
                     /db_xref="GeneID:8199529"
     CDS             complement(774803..775774)
                     /locus_tag="PAS_chr3_0397"
                     /codon_start=1
                     /product="Component of the septin ring of the mother-bud
                     neck that is required for cytokinesis"
                     /protein_id="XP_002492623.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0397"
                     /db_xref="EnsemblGenomes-Tr:CAY70444"
                     /db_xref="GeneID:8199529"
                     /db_xref="GOA:C4R4F8"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R4F8"
                     /translation="MNTFTSISPEEMRRRKMVKRGLDLSIMVCGVRGTGKSSFINTLC
                     GQQVIEPTSETPADNNVSFKTYKAEITEINSTPINLEIVTTPGFGDKINNEESSLEVL
                     KYLEAQYDTILDEECRVERNTKAKDKRIHVVFYLIRPTGKPLRELDLEFMKMVGTRAN
                     VIPLLSKADLLTEEELQLNKQLVMDDIKDHNIPIYDFTLSYDSVADSDYYNEGLEIQK
                     MLPFAVIGGNNVEIINGQKFHTRDYPWGTVRVEDPDHCDFLPLRNILFGSYLQDFKDS
                     THSVLYEKYRTERLAGTKSKDLTFKSDALFDSVKRESASQHLDISVT"
     gene            complement(<776046..>777311)
                     /locus_tag="PAS_chr3_1187"
                     /db_xref="GeneID:8199530"
     mRNA            complement(<776046..>777311)
                     /locus_tag="PAS_chr3_1187"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492579.1"
                     /db_xref="GeneID:8199530"
     CDS             complement(776046..777311)
                     /locus_tag="PAS_chr3_1187"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492624.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1187"
                     /db_xref="EnsemblGenomes-Tr:CAY70445"
                     /db_xref="GeneID:8199530"
                     /db_xref="GOA:C4R4F9"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="UniProtKB/TrEMBL:C4R4F9"
                     /translation="MITPQENFKGKKDSLKRPSDTEVSPAPDSSPSKRSKPASKVDPI
                     SSTTWPPVVDIVENNWKFTFDELRDRSPSRVKQVPYHVELERRWKGVNFINQLARALN
                     LSRSVAITGSTLFHRFYMRRDFNMHHQYPVAAACLFIATKTEEARRPLKNVVIEAVKI
                     SSKDPQKQVDEQTKDFWQWRDTIIRNEEIVLLYLCFDVSPESPYRKSQQAVREAEFPK
                     QLNAGIPLKVSPELIFRESCSFYEECCKLALLVLFGANVVAGVGLVHACIQEDARFSP
                     QFLQKSLNTSINDCWRCYKVFVEMMRILKDRIPPSVKERYGQYPKDRFFRVAGEDIPQ
                     EKNKTIPVDKSAGAVELDAISTKTAPQELNEEVKNNDGDDISKNTNGTTKENPKGNDF
                     DDYPNSTKETVKEFSDSETNATTPAPNGT"
     gene            complement(<777404..>779515)
                     /locus_tag="PAS_chr3_0398"
                     /db_xref="GeneID:8200219"
     mRNA            complement(<777404..>779515)
                     /locus_tag="PAS_chr3_0398"
                     /product="Translation termination factor eRF3"
                     /transcript_id="XM_002492580.1"
                     /db_xref="GeneID:8200219"
     CDS             complement(777404..779515)
                     /locus_tag="PAS_chr3_0398"
                     /codon_start=1
                     /product="Translation termination factor eRF3"
                     /protein_id="XP_002492625.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0398"
                     /db_xref="EnsemblGenomes-Tr:CAY70446"
                     /db_xref="GeneID:8200219"
                     /db_xref="GOA:C4R4G0"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR003285"
                     /db_xref="InterPro:IPR004160"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R4G0"
                     /translation="MQSVLISVVFRQLSVNFPSSSSATVNKNFTRTVSFPFSKEMSKQ
                     QDNNDLSQGVGNIDLNRKNEQRFNPNSASSFQPSFNPQAQNFVPGQYQESQSYQNYQG
                     YQSYQQNQGFQAQPGYQQPYQQGYQAYQGYNNFYQPPAEPQTKAMSLEDYNKQKEQSK
                     NSLNAKPKRTLKLSSSSGIKIGGKKEEPKTETKPETKTEAKTDPKPAQKEEPKVEVPK
                     AKSENKIESNTESKTDSKAGSKTESKSASKVESKASLAADTLPKEDDINEEVINDLFG
                     GKDHISILFMGHVDAGKSTMGGNLLYLTGSVDKRTIDKYEKEAKDAGRQGWYLSWVMD
                     TNKEERNDGKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGGASQADVGILVISAR
                     KGEYETGFEKGGQTREHALLAMNQGVSKLAVVVNKMDDTTVNWSKERYDECTAKLAAF
                     LKAIGYKKEDVLFMPVSGYTGAGLKEPVNPTECPWYKGPTLLSYLDSIDIQNRKVNGP
                     FMLPIAGKMKDLGTVVEGKIESGHIKKGSTLIMMPNRVSVEVLTIYNETEEEADQAIS
                     GEQVRLRIKGVEEEDVSNGYVLTSPNTPIKTVTRFEAQIAFVELPSIVSTGFSCVMHV
                     HTAIEEVTIVQLKHKLEKGTNRRSKKPPAFAKKGMKVIAVLETPEPVCVETYEDYHQL
                     GRFTLRDQGATIAIGKITKLL"
     gene            complement(<779590..>781059)
                     /locus_tag="PAS_chr3_0399"
                     /db_xref="GeneID:8199531"
     mRNA            complement(<779590..>781059)
                     /locus_tag="PAS_chr3_0399"
                     /product="Minor sphingoid long-chain base kinase"
                     /transcript_id="XM_002492581.1"
                     /db_xref="GeneID:8199531"
     CDS             complement(779590..781059)
                     /locus_tag="PAS_chr3_0399"
                     /codon_start=1
                     /product="Minor sphingoid long-chain base kinase"
                     /protein_id="XP_002492626.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0399"
                     /db_xref="EnsemblGenomes-Tr:CAY70447"
                     /db_xref="GeneID:8199531"
                     /db_xref="GOA:C4R4G1"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:C4R4G1"
                     /translation="MSDKPLLQTLSRAIITQSGIQLSGNWHESNYHPLFCCSGSSSDS
                     SIHRTIPYHDILFAEELDSSASDGDFGTREIELTYVARNNKIDLKKEIVIVTDYEPNL
                     SQTILQKAYGQTDRTHPQRILVLINPHGGKGKALRLFEDKAEPILNAAQCEYEVCTTL
                     KHQHATELIRTRKDILDFDTIVCASGDGIPHEVINGLYQRDDRAECFEHLTVTQIPCG
                     SGNAMSLSCLDTNDPAEAALSVLKAPSVRIDLMAITQPSQSVRLSFLSLTYGMIADGD
                     IGTEWLRFLGPFRFEVGIVTKLLQNAKYPCDLSVDFCAKDHQLLSQHYCDNIKSDYSK
                     TQHLPITDQSFELKSPSLENPPPTDWERLDSQITDNLSIFYVGKMPIVSADTNFFPAA
                     IPDDGCMDLVITDNRSSVLDTANLLLQVDKGTHVLQKDVIHSKVKAFRLTPRIPKGYI
                     SVDGESFPFETTQVEVLPTLLKTVMKEGTYAETGFPSYS"
     gene            complement(<781291..>782445)
                     /locus_tag="PAS_chr3_1188"
                     /db_xref="GeneID:8199532"
     mRNA            complement(<781291..>782445)
                     /locus_tag="PAS_chr3_1188"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492582.1"
                     /db_xref="GeneID:8199532"
     CDS             complement(781291..782445)
                     /locus_tag="PAS_chr3_1188"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492627.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1188"
                     /db_xref="EnsemblGenomes-Tr:CAY70448"
                     /db_xref="GeneID:8199532"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R4G2"
                     /translation="MFRQARFVSTFPLKSDINITKSGKTLLSVGQGGRSSRTGFTATV
                     FGGTGFLGRVVVSKLAKHGTNVVVPFRNDRARRQLKVNGDLGVVNFVEFDIRNLKSIE
                     DSVKYSDIVINLIGTEHFSKNFSIEDVNIGAAERIAKAAKEAGVSRLIHVSSYNANPS
                     SSSDFYATKGIGEQVVRDNFGPDATIVRPAPMYFRNSPFLNELLQIKALGGNVIFKKE
                     VYPVHALQVGEAIERIAFDDATAGQTYELFGKERYSKKELREMIKHIIHIGQRGYYPY
                     SAGFYLPAPEPFLYAFALIRQYISSQPRFNVDQLKRSHINQEIDQSAKTFTDLGMVPD
                     ELSEYLYRYVKPHISYTSQTQNRTVYSKEDIEKLRDYVNTPNDSFNLFNV"
     gene            complement(<782572..>783606)
                     /locus_tag="PAS_chr3_0400"
                     /db_xref="GeneID:8200220"
     mRNA            complement(<782572..>783606)
                     /locus_tag="PAS_chr3_0400"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492583.1"
                     /db_xref="GeneID:8200220"
     CDS             complement(782572..783606)
                     /locus_tag="PAS_chr3_0400"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492628.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0400"
                     /db_xref="EnsemblGenomes-Tr:CAY70449"
                     /db_xref="GeneID:8200220"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R4G3"
                     /translation="MTNPSLARDKQLFTDLKSTELNDGSLENHRTSTDIITLEFNKGN
                     RLAYSRSDKTLCIWKRFKENVWDSLLQINTTSNKPVYCIAWDTVDELIFVTVAKDSTA
                     QIWQLNGSNTQCKCLKTIQTPSPKNSNFIAKISPDGKYLVIASFNNTISFYDFQSKHE
                     PVFLFQYTFNENVYDLQWDSKSRFLLFTLSNGTAPIYSITKDSGGLRFSLLQTLSGHN
                     ASVTSVAITGDRIILGTNEGIVSIWDLSTLVCISVDSSIDVPVTSVQASYDGDYLLIT
                     YEHHNARIIRLSPFSKDSETILELENSSRGIYSAKFSSTRLALAYTGMNNNCVVLGRK
                     EHSKRRYRGS"
     gene            <783718..>783906
                     /locus_tag="PAS_chr3_0401"
                     /db_xref="GeneID:8199533"
     mRNA            <783718..>783906
                     /locus_tag="PAS_chr3_0401"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492584.1"
                     /db_xref="GeneID:8199533"
     CDS             783718..783906
                     /locus_tag="PAS_chr3_0401"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492629.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0401"
                     /db_xref="EnsemblGenomes-Tr:CAY70450"
                     /db_xref="GeneID:8199533"
                     /db_xref="GOA:C4R4G4"
                     /db_xref="InterPro:IPR010580"
                     /db_xref="UniProtKB/TrEMBL:C4R4G4"
                     /translation="MAPQTPRQRIANEKFVKRAEAQQGKVKKARSKREFPVSTKWVII
                     LLFLLIGGGVLEILRLFF"
     gene            <784321..>786237
                     /locus_tag="PAS_chr3_0402"
                     /db_xref="GeneID:8199534"
     mRNA            <784321..>786237
                     /locus_tag="PAS_chr3_0402"
                     /product="Mitochondrial matrix ATPase"
                     /transcript_id="XM_002492585.1"
                     /db_xref="GeneID:8199534"
     CDS             784321..786237
                     /locus_tag="PAS_chr3_0402"
                     /codon_start=1
                     /product="Mitochondrial matrix ATPase"
                     /protein_id="XP_002492630.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0402"
                     /db_xref="EnsemblGenomes-Tr:CAY70451"
                     /db_xref="GeneID:8199534"
                     /db_xref="GOA:C4R4G5"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:C4R4G5"
                     /translation="MLSSRWCSCKKQSPSRQVGQLLRYMSSKVIGIDLGTTNSAVAVF
                     EGKEPKILENEEGKRTTPSIVAFTPETVLVGEPAKRQSILNYQNTFYATKRLIGRKYS
                     DPEVQRDISNVPYSIIEHENGDAWLQNMHSGQKYSPSQIGSLILGKMKEIAELNLSQS
                     ISQAVVTVPAYFNDSQRQATKIAGDLVGLKVLRVINEPTAASLAYGLNRKNDGIIAVY
                     DLGGGTFDISILDIEAGVFEVIATNGDTHLGGEDFDHLLVDYILQQFQSQTGQDLSTD
                     RLALQRIRQAAEKAKIDLSTVKTTTIELPFITKTQHINLELTEDQLDEMSLHLINRTV
                     QPVKKCLRDADLTNSDIDEVILVGGMTRMPKIRKVVEETFGKKPNTSVNPDEAVALGA
                     AIQGAVLSGEIKDVLLLDVTPLTLGIETFGGIFSPLIPRNTKVPCKVQQMYSTAVDGQ
                     NSIEVNVYQGERSLVRDNKMIGQFKLSDLEPQPKGVPQIKVSFEIDADGIIKVNAKET
                     TTNQDASITVSGSTGLTSEEVERIVAESKSNSETDRIRKEIYTKANNLELLLFDCDNA
                     LSQWGGYMDDSDRQELTKRISDLREVIRQARDEKLEDISVLESSQQLLQTETLKAVGK
                     AAQKMRTLSKNKND"
     gene            complement(<786329..>788347)
                     /locus_tag="PAS_chr3_0403"
                     /db_xref="GeneID:8199535"
     mRNA            complement(<786329..>788347)
                     /locus_tag="PAS_chr3_0403"
                     /product="acetate--CoA ligase"
                     /transcript_id="XM_002492586.1"
                     /db_xref="GeneID:8199535"
     CDS             complement(786329..788347)
                     /locus_tag="PAS_chr3_0403"
                     /codon_start=1
                     /product="acetate--CoA ligase"
                     /protein_id="XP_002492631.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0403"
                     /db_xref="EnsemblGenomes-Tr:CAY70452"
                     /db_xref="GeneID:8199535"
                     /db_xref="GOA:C4R4G6"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR011904"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:C4R4G6"
                     /translation="MTFPEPREHKVVHEANGVRAIKTPQSFYDKQPVKSLEALEHYQE
                     LYQKSIEDPEEFFGQMAKQFLDWDKDFGKVSSGSLKEGDAAWFLGGELNASYNCVDRH
                     AFSHPDRPAVIFEADEESESRTITYAELLREVSRVAGVLQSWGVRKGDTVAIYLPMTT
                     EAIVAMLAVARLGAVHSVIFSGFSSGSIRDRVNDAGSKAIITCDEGRRGGRIVNNKKI
                     VDAAVDSCPTVEKILVYKRTGNPEIKMVEGRDFWWQEEVEKFPGYIAPVPVNSEDPLF
                     LLYTSGSTGSPKGVVHSTGGYLLGAALTTRYVFDVQDEDIIFTAGDVGWITGHTYSLY
                     GPLVLGVPTIVFEGTPVYPDYGRLWKICAKHKATHFYIAPTALRLLKKAGEEEIKKYD
                     LSRLRTLGSVGEPIAPELWEWYNEKIGNGNCHIADTYWQTESGSHLIAPLAGAVPQKP
                     GAATVPFFGIDACIIDPVSGKELEGNDVEGVLAVKSTWPSMARTVWRNHAKYLDTYMR
                     PYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIESALLENGKVAEAAVI
                     GISDELTGQAVIAFVALKDATDSENLDALRRALVLHVRGEIGPFAAPKSVIVVDDLPK
                     TRSGKIMRRVLRKISCHEADQLGDMSTLANPESVDSIIGAVDNQFFKK"
     gene            complement(<789468..>790007)
                     /locus_tag="PAS_chr3_0404"
                     /db_xref="GeneID:8199536"
     mRNA            complement(<789468..>790007)
                     /locus_tag="PAS_chr3_0404"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492587.1"
                     /db_xref="GeneID:8199536"
     CDS             complement(789468..790007)
                     /locus_tag="PAS_chr3_0404"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492632.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0404"
                     /db_xref="EnsemblGenomes-Tr:CAY70453"
                     /db_xref="GeneID:8199536"
                     /db_xref="InterPro:IPR000614"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:C4R4G7"
                     /translation="MGEIHHAEYANFSSSDKREALEQVLQSYDALVEGQTNWVCNLSN
                     ASSLIWHAYQSLNVPVNWAGFYVLNPEVPGELILGPFQGKVACQTIKIGHGVCGTAVS
                     QSETQVVPDVNKFPGHIACDGETQSEIVVPIISSNSSGEKTVQGVLDIDCLALQGFDS
                     IDQEILEKIVNRIAQTCKW"
     gene            complement(<790186..>791286)
                     /locus_tag="PAS_chr3_0405"
                     /db_xref="GeneID:8199537"
     mRNA            complement(<790186..>791286)
                     /locus_tag="PAS_chr3_0405"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492588.1"
                     /db_xref="GeneID:8199537"
     CDS             complement(790186..791286)
                     /locus_tag="PAS_chr3_0405"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492633.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0405"
                     /db_xref="EnsemblGenomes-Tr:CAY70454"
                     /db_xref="GeneID:8199537"
                     /db_xref="UniProtKB/TrEMBL:C4R4G8"
                     /translation="MDKEDSISLTPVKKFATLNLSSAQKGRKPLYPSLEGFPDTHESP
                     NQIQHHLSLSMGFDTDKSLESLFPRRLNKSVLEELNDRTEKIKGSLSYRQKLQGSSLK
                     SSSLKEKSRFSLAHSSIFDKMESIKDHCAAQRLERRVVEQSDQGDGRPSLLQTATKRR
                     RTLRGPQEIREPLKETNTLRTSTKSYNLNEILHKPSDGIPKSRSRLQLKNGSSREVAS
                     GTKEASAPGLKKIPPSIVRAKTGDFGYPRLDPNSGNPSRHTRLQERKPKTIAKPTNNT
                     PILQRHQKTLLKANSSRKLEQEPAVPARTDSIKSIPRSVSSKGFDRFSRTAMQTLGSI
                     PRSRTMHNELNISSSLEKSTSTSSRKTRPAWR"
     gene            <791729..>792811
                     /locus_tag="PAS_chr3_0406"
                     /db_xref="GeneID:8199538"
     mRNA            join(<791729..791757,791806..>792811)
                     /locus_tag="PAS_chr3_0406"
                     /product="D-aspartate oxidase"
                     /transcript_id="XM_002492589.1"
                     /db_xref="GeneID:8199538"
     CDS             join(791729..791757,791806..792811)
                     /locus_tag="PAS_chr3_0406"
                     /codon_start=1
                     /product="D-aspartate oxidase"
                     /protein_id="XP_002492634.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0406"
                     /db_xref="EnsemblGenomes-Tr:CAY70455"
                     /db_xref="GeneID:8199538"
                     /db_xref="GOA:C4R4G9"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:C4R4G9"
                     /translation="MTDSKYVIIGAGISGLYTAWSLIDKGTGPSDIKVVAEFLPGDQS
                     TLYTSPWAGGNFSLITSTDERSMKFDKFTYTNLHRIQELLGGPECGLDMLPSTEMFEQ
                     ELDHAKLDSISQYLKEYRPMTKEEMPEGVVSGVKFLTWNFNCPLFLANFQKHLAAIGV
                     TFERSKIDHISSVFSPSVDAVFNCTGIGAASLGGVKDENVFPTRGQVVVVRAPHIREN
                     RFRWRPDSDTYVIPRPFSDGSIVMGGFFQEGNWSGNTYGYETEDILKRGLELYPEIGK
                     RNELKIIREAAGLRPSRKGGVRIEVEHFDQVNGKDRYIVHNYGASGYGYQSGLGMANE
                     ATDMYFEAAK"
     gene            complement(<792918..>795731)
                     /locus_tag="PAS_chr3_0407"
                     /db_xref="GeneID:8199539"
     mRNA            complement(<792918..>795731)
                     /locus_tag="PAS_chr3_0407"
                     /product="Putative transcription factor containing a zinc
                     finger"
                     /transcript_id="XM_002492590.1"
                     /db_xref="GeneID:8199539"
     CDS             complement(792918..795731)
                     /locus_tag="PAS_chr3_0407"
                     /codon_start=1
                     /product="Putative transcription factor containing a zinc
                     finger"
                     /protein_id="XP_002492635.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0407"
                     /db_xref="EnsemblGenomes-Tr:CAY70456"
                     /db_xref="GeneID:8199539"
                     /db_xref="GOA:C4R4H0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R4H0"
                     /translation="MPNGKREKRAEAKRQRVAKACDYCRSKKVRCDGEQPCNNCISCK
                     TSCTYNHVKKRRTTDKKSSPKRSKEVDDRLERLELMIESLVTQLGSSNSVVPVSRIQH
                     NEETTDDDESDSTQAENDAHLQPSTNKKTDQKELNGLSREVTPFSSNGKTSCSDATLQ
                     FAHRKTECFDSFFAEYCSFSLFSKEGQEWLVSKMKSEHLEIINKNLRHMFANYVSYSF
                     TLWIEPIQPSDLQPLFPKNISLGLLKFLFSYVSQSLYPIDTNEQLALLEVYCESQGRG
                     KGKSHHLSYANLMMLNMFLAFSLALYRDSVLKTSVRIEGLDISPEKSREYESGFLRNT
                     IFYYQRLFLVGDGLNSILAILLLYKYCEGTLAFHAAYMLLSTGVRLAQEMGLHRAESY
                     AGLSQKEQDSRAIIWWDCYTEDKLYSIKSGKPSIINDLDVSAPLPSYWRKLVVLPHKV
                     DEFRRAIDEEYGPGLAIPEYIRINALNTSYNKGKAAVLHYFLSLSFLVSYIYQTVFSV
                     STTNHRSLEEQMIQFEVINEKLEQWRLSLPEQCRPKSRKELNNEDIYKNLTVEGVERV
                     LHEQNKYSTSSVINPFEIDGPTESVHFRLLLKDLHLAYYTILSSVCKVFIDKSSKLVS
                     ANHSHSRVVGEYVAMRVNSCREVLFMSKEVGEGTTFFANIFSFYLLAAFIPLFCNILR
                     NPDSETTAFDFALLYYSEKHYFERLEGPHTAEPTLSRHPLSLLTAFFLLVAHNLTKRS
                     SNFASISTKFDEFERKNFDIFKTIGLTSYSQSKSNKLSSKSDPSLTVSASEDFHQDLT
                     SRLDFKQDNKITSDSVTFEASRDNYLPTYTKDSLINGHSLYREPNFASQIVPPIMPPD
                     TLLQHEESNLADANFQSIHPMVNSTESAYIPIEYQNQPGISENSKLVNDLNHESFLQD
                     DSADERACLFQTVFDVPGFYLDS"
     gene            <796803..>797891
                     /locus_tag="PAS_chr3_0408"
                     /db_xref="GeneID:8199540"
     mRNA            <796803..>797891
                     /locus_tag="PAS_chr3_0408"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492591.1"
                     /db_xref="GeneID:8199540"
     CDS             796803..797891
                     /locus_tag="PAS_chr3_0408"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492636.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0408"
                     /db_xref="EnsemblGenomes-Tr:CAY70457"
                     /db_xref="GeneID:8199540"
                     /db_xref="GOA:C4R4H1"
                     /db_xref="InterPro:IPR002680"
                     /db_xref="UniProtKB/TrEMBL:C4R4H1"
                     /translation="MLKLYAIRPIRPIKPCLVASTFRHYSVKVDTSNKADVIKDSQTD
                     TTSKPGAEHGHTLGQYITKKLMVRQRLPTEKRDDSFLTPPAMPHHGYRQDLMEKIHYE
                     HREPTLIRDKLAFGLMRSLRVCFDFFSGYKHPKTKEGLEKLTPATYQMTPEKWLTRFI
                     ILESIAGVPGSVASFLRHLQSLRLLKRDKAFIQTLQDEAYNERMHLLTFLEIGKPGPF
                     MKVLLYASQGVFCNLFFFTYMLAPNACHRFVGYLEEEAVYTYTTCLEDIERGLLPDIE
                     HFKVPKIAKDYWHLSEDAKMRDLISYIRADEAKHREVNHTFANLKLDGTDRNPFALQV
                     DSVPESAQPNNRLSTHKAVGWERDELVL"
     gene            <798138..>800768
                     /locus_tag="PAS_chr3_0409"
                     /db_xref="GeneID:8199541"
     mRNA            <798138..>800768
                     /locus_tag="PAS_chr3_0409"
                     /product="Na+/H+ antiporter involved in sodium and
                     potassium efflux through the plasma membrane"
                     /transcript_id="XM_002492592.1"
                     /db_xref="GeneID:8199541"
     CDS             798138..800768
                     /locus_tag="PAS_chr3_0409"
                     /codon_start=1
                     /product="Na+/H+ antiporter involved in sodium and
                     potassium efflux through the plasma membrane"
                     /protein_id="XP_002492637.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0409"
                     /db_xref="EnsemblGenomes-Tr:CAY70458"
                     /db_xref="GeneID:8199541"
                     /db_xref="GOA:C4R4H2"
                     /db_xref="InterPro:IPR006153"
                     /db_xref="InterPro:IPR013928"
                     /db_xref="UniProtKB/TrEMBL:C4R4H2"
                     /translation="MAIWEHLAPSKTHIAYACIGVFSTIFSLCSLFIKEKLYIGEASV
                     AVIFGLIVGPHCLNWFAPEDWGNLDLITLEISRMVLIIQIFAVAVELPTKYMKKHWVS
                     VFIFLVPIMTFGWLIVGLFLWIIIPGFNFSEALLVSGCVTATDPVLASAIVGKGKFAE
                     RVPGHLRNILSAESGCNDGMAFPFIYLALNLIIHEGNGGLIVQDWICVTLLYECLLGC
                     VLGWAIGLSGRYAIKFAENKGLIDRESFLAFYIVLSFVCAGFGAILGVDDLLTSFAAG
                     TTFAWDGWFSEKTEESQVSTVIDLLLNLAYFVYFGSIIPWEDYNNASIGTPIWRLILI
                     ALVIIFLRRIPGMLMLKPVTPDVKTWREALFCGHFGPIGVGAIFASILAKSELESHYT
                     GSTGPLAELPDSSTPHFQLLVSIWPIVTFIIITSIVVHGSSVAVLTLGKHLHTMQFTM
                     TFTHTEGNKNSSNWLNRLPKIDAKGRDISLERIDTLNPSMLSSAATLENSGSNINISG
                     MTAKPAGGMKRRKKTKRSRIRNRFHEETGIGKEQNARRVPEVEDLDLGTMHRRSKEET
                     STETPSGENTPKVDDTDQDQEAISKVPTTGYTEGNRLIVEDEHGEVIDEYELKDHTPK
                     SQTDQTSVHSYGSFKRALNKISTELEPEVPQKLQRILSTSSQSIKNAKKVLVGCGTKT
                     EGGDRRKLYAFVVGDQVVIENKDGEILRRYKINPHKGESELSDSQLRAGLNNSDIRGL
                     RDNSNAEQPDLEKQENDIVPEEEEVNNPTLTRKMSQKLDNTVQSLIAPFRRTKTASFS
                     VRKKPSELELTESVNTSSNAPLNQQSSSETLSISSEPAENEVKESKVERARRLAALHT
                     SVRDDKDEEGPPVKATKPMK"
     gene            complement(<800865..>802169)
                     /locus_tag="PAS_chr3_0410"
                     /db_xref="GeneID:8199542"
     mRNA            complement(<800865..>802169)
                     /locus_tag="PAS_chr3_0410"
                     /product="L-ornithine transaminase (OTAse)"
                     /transcript_id="XM_002492593.1"
                     /db_xref="GeneID:8199542"
     CDS             complement(800865..802169)
                     /locus_tag="PAS_chr3_0410"
                     /codon_start=1
                     /product="L-ornithine transaminase (OTAse)"
                     /protein_id="XP_002492638.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0410"
                     /db_xref="EnsemblGenomes-Tr:CAY70459"
                     /db_xref="GeneID:8199542"
                     /db_xref="GOA:C4R4H3"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR010164"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R4H3"
                     /translation="MSPNYNISSETAVQYENEYSAHNYHPLPVVFHKAKGAHVWDPEG
                     KEYLDFLSAYSAVNQGHCHPKIIEALVDQASKLTLCSRAFSSDVFGVYAKYITEYFGF
                     ESVLPMNTGAEAVETAIKIARRWGYVKKGIPQDEAIVLAAQNNFHGRTIGIISMSTDP
                     EATQDFGPYLKNVGPQIPGEAEGTPLRYGVIEDVERAFSNAGDKIAAILLEPIQGEAG
                     IVVPPADYLPKVQELCKKHNVLLICDEIQTGIGRTGKLLCYEHSKGVRPDMILLGKAI
                     SGGVLPVSAVLSSKDIMSVIQPGSHGSTYGGNPLACRVAIAALDVVKDERLVDRASEL
                     GDFLFHELSKLQRESNGVISEIRGKGLLTAIVIDDSKANGRTAWDLCLLMKNHGVLAK
                     PTHDHIIRLAPPLVISKEDLLKGVDAIRTSLAELPNAPHVEH"
     gene            <802520..>802927
                     /locus_tag="PAS_chr3_0411"
                     /db_xref="GeneID:8199543"
     mRNA            <802520..>802927
                     /locus_tag="PAS_chr3_0411"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492594.1"
                     /db_xref="GeneID:8199543"
     CDS             802520..802927
                     /locus_tag="PAS_chr3_0411"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492639.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0411"
                     /db_xref="EnsemblGenomes-Tr:CAY70460"
                     /db_xref="GeneID:8199543"
                     /db_xref="InterPro:IPR013900"
                     /db_xref="UniProtKB/TrEMBL:C4R4H4"
                     /translation="MSDPSRYKKQNMYSELPKRQDESTEALQTVGMRIRKAVADGYQV
                     PPPEPVTTPFGPRRTALPDHLQEPPSLLYGGSTASSLSEWQNDVTLTNKRKFEDYDDS
                     KDFQGPDSDFLTKNRDLQGFQQVYGTLRFDEDF"
     gene            <803200..>806157
                     /locus_tag="PAS_chr3_0412"
                     /db_xref="GeneID:8199544"
     mRNA            <803200..>806157
                     /locus_tag="PAS_chr3_0412"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492595.1"
                     /db_xref="GeneID:8199544"
     CDS             803200..806157
                     /locus_tag="PAS_chr3_0412"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492640.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0412"
                     /db_xref="EnsemblGenomes-Tr:CAY70461"
                     /db_xref="GeneID:8199544"
                     /db_xref="InterPro:IPR026705"
                     /db_xref="UniProtKB/TrEMBL:C4R4H5"
                     /translation="MASLEEKLRFKSEVFRLTKQTSSISVDDPYWGIFWNCPTCASDI
                     FDLLSATDIRNIRETNKSNFITLIRVIALQLVHQSNTVTSLDENTALLNCIRVLTKFL
                     PSLYEDPSLEEVEKSLFWSLDTLYNRDATSGSQCSDVATVATEISSSSVLSNQLHDSS
                     STSAQVEFQSSQNHIEQASIKANVGSPDYSTVPLGAKLVFTLVQLLFTQNFCIKSQSS
                     VRSKGAKPIVDFSIWEPGIGFNGPFKPPNTFIDSNRYETMKLLITLCSRCLYIPSSEL
                     VAQGSRFLTVLVTAIPRLQILTLLSSLLNLTARAARDPKESGLEMNNSQLNNLRTLNV
                     TAAIHLLTLMFVYPLPKNNLLFLQELRIYDSTPINLVRYYMGRLHKESELAFLKVSLF
                     GILKAPLIEMSKLENSTSLTAMIKAKTYTIQPSLWCTEIVILVWELYQSNKKFSQLIS
                     AKHSVELSLILLFYINYYRKDEHHRNQVRICSYFFLYLTNDEQITFNLLKPFNSAIYS
                     SLPQSFKTPTTPITYRDFFIVRICTMLLDDEPGILTSILIEMLYNLIPITRADYLSSH
                     TDEVTVFRKRPFNNSVTVCEQNGQISHSASANLMHVIVKLSRPQYLASNSLHSDLLGL
                     VLRAIAHYLGKNFHGVDSSDLGDVAAMAYTLTKNYRIFNEVKKVIESVGHISELDTKK
                     TLSVHSTESNVYDLESIDPSEDESEDEEAKYNLMNLKMPVGMSTKVKGKQPLDAPLKK
                     TWTGTKALKSILNFTNYLNKEHTELLHITDFNTVVVSIANTSIKQKSWEKLIHREFLP
                     SYRPWSCLKFVWNNASLGWYESILWGLIYNSNEIIHRNKVLLDLNNSISAITKATSDW
                     SFGMWKSPRAESTYPSIEKQVERASSSMVDTGTWNGTYVKTFRIKGSGQHSKLLNHRG
                     AINTMTDSLVKKISDFRISSPSANGPASQQHQNPHPESHHNLAETVQLKVTPRNYIHR
                     KDSTLSTLSTLST"
     gene            complement(<806205..>806837)
                     /locus_tag="PAS_chr3_0413"
                     /db_xref="GeneID:8199545"
     mRNA            complement(<806205..>806837)
                     /locus_tag="PAS_chr3_0413"
                     /product="Protein with a potential role in pre-rRNA
                     processing"
                     /transcript_id="XM_002492596.1"
                     /db_xref="GeneID:8199545"
     CDS             complement(806205..806837)
                     /locus_tag="PAS_chr3_0413"
                     /codon_start=1
                     /product="Protein with a potential role in pre-rRNA
                     processing"
                     /protein_id="XP_002492641.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0413"
                     /db_xref="EnsemblGenomes-Tr:CAY70462"
                     /db_xref="GeneID:8199545"
                     /db_xref="InterPro:IPR019398"
                     /db_xref="UniProtKB/TrEMBL:C4R4H6"
                     /translation="MSLQIDETDFVEASEGADSLKFLNEKSHALFELGVSMLVHKWDA
                     LSVAVVNQWGGPNSKDKRDWISAVVVDLFLQNSVVDVAMIEETLLYAMQDEFDVMVED
                     DSALPLAAQVLDCYRNVAIGEVDKIKESYAKWQAKQSSNSDVKYQVTVGEDPSNPDVS
                     ENEVDDYDSDIDAHAPGTQQDEDSEMTEATESVPQAIVDDDGFTIVQRKR"
     gene            <807077..>808816
                     /locus_tag="PAS_chr3_0414"
                     /db_xref="GeneID:8199546"
     mRNA            <807077..>808816
                     /locus_tag="PAS_chr3_0414"
                     /product="Calcineurin A"
                     /transcript_id="XM_002492597.1"
                     /db_xref="GeneID:8199546"
     CDS             807077..808816
                     /locus_tag="PAS_chr3_0414"
                     /codon_start=1
                     /product="Calcineurin A"
                     /protein_id="XP_002492642.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0414"
                     /db_xref="EnsemblGenomes-Tr:CAY70463"
                     /db_xref="GeneID:8199546"
                     /db_xref="GOA:C4R4H7"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R4H7"
                     /translation="MNIMLGKKLAQKRLANENTAKLDNALKVLKNKDEEGLVKRDYSI
                     HITKDGQSLKTTERQVSSVPPPIATKPSDSELFLENGLPDHEFLRTHFIGQGRLHEYQ
                     AIRIIEMATSQFIKEPNLLEVPAPVTVCGDIHGQYYDLMKLFEVSGHPKDTSFLFLGD
                     YVDRGCFSIECLIYLYSLKLNYSDTFWMLRGNHECRHLTEYFTFKAECLHKYSEDLYE
                     VCVRSFQGLPLAAIMNKQFFCVHGGISPHLKSIDDVNRIDRFREPPTKGLMCDLLWAD
                     PIEEYDEDDATEDHFVPNTLRGCSYAFSYEASSAFLKKTGLLSIVRAHEAQDAGFRMY
                     KRTKTMGFPSLLTMFSAPNYLDSYNNKAAVLKYQDNVMNIRQFSSSPHPYYLPKFMDV
                     FTWSLPFAGDKMVDMLVSILNVCSQKELDEETPLAKVPASALENVDKLIKQKKANASK
                     TTQESQIDPMDLEAKKVVLRNKILAIGRVSRMYQVLRQESENVQKLKSLSVDGQLPPG
                     SLLNGPEGIRQKIHSFDEARKMDLKNEALPPLPTDFAYQQKLEDERIRRDIEQQVKQD
                     RKFNTLAQRLSDF"
     gene            complement(<809206..>810387)
                     /locus_tag="PAS_chr3_0415"
                     /db_xref="GeneID:8199547"
     mRNA            complement(<809206..>810387)
                     /locus_tag="PAS_chr3_0415"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492598.1"
                     /db_xref="GeneID:8199547"
     CDS             complement(809206..810387)
                     /locus_tag="PAS_chr3_0415"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492643.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0415"
                     /db_xref="EnsemblGenomes-Tr:CAY70464"
                     /db_xref="GeneID:8199547"
                     /db_xref="UniProtKB/TrEMBL:C4R4H8"
                     /translation="MSIEPLQTIQSPKFTGFTGPSRHIFSDEQKLKFAEIFVHLTKEN
                     GNNCNFPVTQSIRQFIRQEMNKSILHCTPVTDRNVVSLKDMLKKVMKGYCQLSNDPSF
                     VYNSTTCFIEYPDYKWKLSEERYGRSVICQIRNKNCLYLEQLKPFFKESLAVGNAEKK
                     GFFTVNMRKLASDYTSEPQNTPREAQAERRYVHLSPNQQPQTQHTSLPLKIAHQQSEP
                     DAQRMVEFLPHYANSSSMQQLNISQLPVSPSPLSDYRTISPTIAHQSHQQQHENLDDS
                     VVPRKRHRQSQTFPQIMPEISSVFMTPQSSLPRARPSDPSNRNDEYSNEESRFEVDIR
                     KKIAKKLGELCKRDSLSYEIFSWILKQKLSFLISNVAPLLDNVDDTLLVRFLNDLYIE
                     K"
     gene            <810648..>811406
                     /locus_tag="PAS_chr3_0416"
                     /db_xref="GeneID:8199548"
     mRNA            <810648..>811406
                     /locus_tag="PAS_chr3_0416"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492599.1"
                     /db_xref="GeneID:8199548"
     CDS             810648..811406
                     /locus_tag="PAS_chr3_0416"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492644.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0416"
                     /db_xref="EnsemblGenomes-Tr:CAY70465"
                     /db_xref="GeneID:8199548"
                     /db_xref="UniProtKB/TrEMBL:C4R4H9"
                     /translation="MFIVRCIHERPTIENSVPSKAFQSSFPEGALPSDSEDKQVIYGG
                     GFFRLAFISKDFEIQGVQNTECSECFVYVLNTCLVLWFESGRFGLSIPYQLVLLAALQ
                     SDPEGIYLQIEPRGDLTASPESTLGSNTALVELKVTYDGVRSDALLDQFPNSINQTYE
                     AIAQCSSFHEDPSSDTEDDREDNSLQQKDAFTTDLTNGEADDLAPLSHSPTLGKSASM
                     AVNILGQIVGIRTRDDDESDQDGVHYINKKTHTH"
     gene            complement(<811467..>812867)
                     /locus_tag="PAS_chr3_0417"
                     /db_xref="GeneID:8199549"
     mRNA            complement(<811467..>812867)
                     /locus_tag="PAS_chr3_0417"
                     /product="Ornithine decarboxylase"
                     /transcript_id="XM_002492600.1"
                     /db_xref="GeneID:8199549"
     CDS             complement(811467..812867)
                     /locus_tag="PAS_chr3_0417"
                     /codon_start=1
                     /product="Ornithine decarboxylase"
                     /protein_id="XP_002492645.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0417"
                     /db_xref="EnsemblGenomes-Tr:CAY70466"
                     /db_xref="GeneID:8199549"
                     /db_xref="GOA:C4R4I0"
                     /db_xref="InterPro:IPR000183"
                     /db_xref="InterPro:IPR002433"
                     /db_xref="InterPro:IPR009006"
                     /db_xref="InterPro:IPR022643"
                     /db_xref="InterPro:IPR022644"
                     /db_xref="InterPro:IPR022653"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:C4R4I0"
                     /translation="MTVPSIVNSFSDVANDKFRTSLLNSECNDHNHTYAVDGLNNVIT
                     KRVSKPNTAEALAKSRKMVGQALYDHISAIDLDTCLPEEEESFFVCDLGEVLRLYKNW
                     CEKLPRIKPYYAVKCNNDPKLLEVLATLGTGFDCASTGEINTILNLGVSPDRIAYANP
                     CKSISSVRNAKKVNVNLTTFDNSDELYKIAKYHPESRLLLRISTDDESAQCRLSTKFG
                     ASMSESFDLLRLAKKLQLNVAGVAFHVGSGASDFSAITQATKDSSILFEEGTRLGFKM
                     NILDVGGGFVLQTFDESSRYLREACDQYFPEKLFPELKIIAEPGRYFAASAFTLACNV
                     IARRMTTQSSDTTTPTAHAMLYVNDGLYNNLNCVLYDHQLPKGKALTINGRFVYDLQF
                     SLPESEKKIPVSIWGPTCDGLDCISEMTYVSSLMEVGDWIFFDEIGAYTSAAATAFNG
                     FQKESHTIYTCSESLI"
     gene            complement(<813667..>815250)
                     /locus_tag="PAS_chr3_0418"
                     /db_xref="GeneID:8199550"
     mRNA            complement(<813667..>815250)
                     /locus_tag="PAS_chr3_0418"
                     /product="Zinc-finger inhibitor of HO transcription"
                     /transcript_id="XM_002492601.1"
                     /db_xref="GeneID:8199550"
     CDS             complement(813667..815250)
                     /locus_tag="PAS_chr3_0418"
                     /codon_start=1
                     /product="Zinc-finger inhibitor of HO transcription"
                     /protein_id="XP_002492646.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0418"
                     /db_xref="EnsemblGenomes-Tr:CAY70467"
                     /db_xref="GeneID:8199550"
                     /db_xref="GOA:C4R4I1"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C4R4I1"
                     /translation="MSVLMSNNNHFKNHPDLSNIFHVRSRSDPATSLTSPSQPRCIKQ
                     AKHEPNSSKHVKSTSSCPASVANFSIPSCAIDQRALPKKEKRRFSEVHHTESPLSSKR
                     RLEPSEVNQSRKRVSLPPATPLFKSKVENESVSSVPAVARILANLKPTPASSHSIRNS
                     SLLYPDTAYSYINYTTSSCHNFEVIQNTSNNEWRANMVSNLKSGNLQGFKRYKDYCLE
                     NYKVTDDKAGANLRTDYEKSRNIPRTRNKMVRFIEAQLRDKESASEAGIYNTANIINY
                     PFVSNYTYQKDGYLDDVSMLCNNVELYKNLDTSHDDKKSEVQHEKHPDGGRLQLYQTI
                     DTPVNQPLSIPASHMVTPPLSSKSSALTTSEDAKSTQPKMSTFKYVSPNSSPMKSNSC
                     SDQITVFRAAKSPQSPKKSPKSPSTRLATISHPNRVCISCHSNHSPCWRPSWSALEGQ
                     LCNSCGLRYKKTGARCTNRSCLRIPAKGEWTLMKNKGKLAIPVYGNNEHGEFTLLGEE
                     LKYKCLHCEGTVEVGESER"
     gene            complement(<815861..>817465)
                     /locus_tag="PAS_chr3_0419"
                     /db_xref="GeneID:8199551"
     mRNA            complement(<815861..>817465)
                     /locus_tag="PAS_chr3_0419"
                     /product="Putative metalloprotease with similarity to the
                     zinc carboxypeptidase family"
                     /transcript_id="XM_002492602.1"
                     /db_xref="GeneID:8199551"
     CDS             complement(815861..817465)
                     /locus_tag="PAS_chr3_0419"
                     /codon_start=1
                     /product="Putative metalloprotease with similarity to the
                     zinc carboxypeptidase family"
                     /protein_id="XP_002492647.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0419"
                     /db_xref="EnsemblGenomes-Tr:CAY70468"
                     /db_xref="GeneID:8199551"
                     /db_xref="GOA:C4R4I2"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:C4R4I2"
                     /translation="MLYKTTLSIAHTSVILLSLITAISCFELHLPQKVSHIVDSLQYT
                     CGQFLQKQQIFALYNKQNFTEIVNQNIKGIEERVLSELLEERLENESQNDYYTANSQN
                     WPIDLDQYSESFVIRITSEDEFIKYLIFKEAKALHISIWEQSVGLIDLKVDRDQMHRL
                     LYNVESRILERRTRSVDSPVSEYKVQLMIGDLPQRIYETYPSTKVTSLQALGEFPSFQ
                     NLSNAFFEDFRTLETIYDWFEEIQKEFPKLVSINWIGQTYEGRDLKALHVRGKHSGNK
                     TVVVTGGMHAREWISVTSACYAVHKLLQNYADGHHKEAKYLDKLDFLFVPVLNPDGYE
                     YSFNEDRLWRKNRQETYMPRCFGIDIDHSFDYHFVKSEDLPCGEEYSGESPFESIESE
                     VWNNFLNRTKEEHKIYGYIDLHSYSQTVLYPYAYSCEILPRDEENLIELGYGIARAIR
                     KSTGKKYQVLKACEDRDADLLPDLGGGTALDYMYHNRAYWAFQIKLRDSGNHGFLLPK
                     KFIYPVGTEVYASIQYFCSFVLNLEG"
     gene            <817643..>819919
                     /locus_tag="PAS_chr3_0420"
                     /db_xref="GeneID:8199552"
     mRNA            <817643..>819919
                     /locus_tag="PAS_chr3_0420"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492603.1"
                     /db_xref="GeneID:8199552"
     CDS             817643..819919
                     /locus_tag="PAS_chr3_0420"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492648.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0420"
                     /db_xref="EnsemblGenomes-Tr:CAY70469"
                     /db_xref="GeneID:8199552"
                     /db_xref="InterPro:IPR021861"
                     /db_xref="UniProtKB/TrEMBL:C4R4I3"
                     /translation="MLSGYDEYSSSIIPALETDLVVLRERFSSDQIFSSSINNHPDLT
                     AIYTKHFEDKFTEEDQTSTISFKSAVIENVVLNVLFNVIEKNESTEVLVTEILILLDL
                     AIHGYNKQVYKSLPLIIVLQAFAKLDIDIICDKLGPILLGPHSNERKRILQQNGSLIG
                     KKSPGLVLLSYSQKILNRLFKHIESHELFGGYFRTFIRTSFALDDSLLPTRKWETNVN
                     TKTFLTGLQKQLRQTRGVSSAENKLNRKMQEDFKRFVDLMIFLNDPVPLIEADKRGRT
                     FRHLSDMENSLNFVFEFLKTLIDMDKKQKHGIRLQNQSFFLPETQRSDREIAQVVEHY
                     TRKLLQLEIPVTAELFQKQLNDYTFRQLILLQVVVGATYILSLKKKEVDDRIARLRKA
                     TKDPKLAQQLHNKMPAVIYDRDLSDACSNLRNTILKHYKEFDSNFYETLQSIAASEES
                     WIDWKLLQYSLAIIETGKFDSHVTLFNEQLPSLYEYAPQYSHKLGTPQLSRIWKIETS
                     LPHLKNHSFDKEEFVEDIRMELYPLDSQLQQPDLDSKHKEEIQGQKDYLNWKSMRFLR
                     SNNEWLKLKQTNEKVGLEGMFDDGLLMDEDFEEEIPSEVKEMMEKIQQEENEKIEKQK
                     KEEADELEQEQTKNEADKLETQESQVAPEEKRDEETTNDAAEKGLPEKLEPSQIDESP
                     VENKSPAIQSPRTASPASETPKLSYEDTKLQSDDESSTKQPSSTSQADLSNDLEGVQK
                     KRKLSTDSELPTAKKLKP"
     gene            complement(<819979..>822840)
                     /locus_tag="PAS_chr3_0421"
                     /db_xref="GeneID:8199553"
     mRNA            complement(<819979..>822840)
                     /locus_tag="PAS_chr3_0421"
                     /product="Member of an oxysterol-binding protein family
                     with seven members in S. cerevisiae"
                     /transcript_id="XM_002492604.1"
                     /db_xref="GeneID:8199553"
     CDS             complement(819979..822840)
                     /locus_tag="PAS_chr3_0421"
                     /codon_start=1
                     /product="Member of an oxysterol-binding protein family
                     with seven members in S. cerevisiae"
                     /protein_id="XP_002492649.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0421"
                     /db_xref="EnsemblGenomes-Tr:CAY70470"
                     /db_xref="GeneID:8199553"
                     /db_xref="GOA:C4R4I4"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C4R4I4"
                     /translation="MEALDIRSKSYFIKWVEAPAKSVLHWEIKPLKKSIDFGIYSCKK
                     GESSHETKNNSASSFNTESPSFRASIPPIIDEGDQFNLSSGSAVLPLERNPSLKESSN
                     ATGTGRRRSDSNISAISSTNSLSLEQRLKQSNLKKEQWVGKCQGNELIQGTFQVQDSC
                     LLAFVFDNTFSKTTAKKVFFNQYVEDPSMPKKDLDSTIYRNNNKTNSTLSLKKIDTSS
                     STGVRFDLPNDHDKKIDNSTVLHVKGGRYLQGFLLKKSRKGRQKSFHKRFFVLNFKYG
                     ILNYFANDNSKQVRGNMLIRSAAIFADEKTKVIILDSGLELWVLKSSNENDWSTWIQA
                     FNFLKGSSSLNEEAKPQITRVNTLDSTLPSFVDRDIFLKIHDNISALRSKSSNLVSVL
                     DDQQTTQDSIRSSNRKSSFWKKFKREKDDVNGDQLSMSSFTSDPLSLAKDIKSRIDTL
                     MSFMDNAKNLQSSQQISRSNTVTTGGASIFSQEFYDAQEYLQEITGEVVFLNEQNDTT
                     ISTNGHGHGALPLKNIEEIATDSSDYSSLEETEESLSSESSTERELVKSIMSQQDNLE
                     INDLYPLGETENVTRRTDIPESASTPPSILSFIRKNVGKDLSNVAMPVTANEPLSMLQ
                     KYSEFVEYCDLINDALDSDKASGSRLMKIAAFATSYFSSLRVKERNSRKPFNPMLGET
                     FELVREDLGIRLISEKVVHRPVILAINVDSKRWNLNYSPSPSQKIWGKNAEVTVEGVA
                     RLTDRTTGDVYHWSLPNCLLKNLIAGEKYMEPTGSMTVKCSDGHKAVVAFKSGGVFSG
                     RSEQLSITLTDSKNNIVGPKATGTWTESISWNGVNIWKVGPLVPSPNLKFGFTQFAAC
                     LNEITSLEEGKIPPTDSRYRPDLRMYENGDVDGAEDKKIELEEFQRARRKANEIANEE
                     HQPSFFHKGKDDCWIPIQGENNYWERRKRSDWDDVLKLW"
     gene            <823588..>824601
                     /locus_tag="PAS_chr3_0422"
                     /db_xref="GeneID:8199554"
     mRNA            <823588..>824601
                     /locus_tag="PAS_chr3_0422"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492605.1"
                     /db_xref="GeneID:8199554"
     CDS             823588..824601
                     /locus_tag="PAS_chr3_0422"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492650.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0422"
                     /db_xref="EnsemblGenomes-Tr:CAY70471"
                     /db_xref="GeneID:8199554"
                     /db_xref="GOA:C4R4I5"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:C4R4I5"
                     /translation="MENPLQIIDISNIDIPTAREVVSAAGSQGFLMLEGHGFSQEEVA
                     ELFKVSKGFFEEPLEEKKKYTIPANDNHGYTTFGGENLDESNPDKPQGDPKEGYNFSN
                     LNLLEGTWNGSTPEYFQNSEHAKVVQSVIKKHSLLVHKLLTLFAIGLEIDKEAGGADW
                     FVQRHKLTDPSGTTFRLLHYPSPKSLNPEETIRAGAHTDYGGVTLLFQQDGQAGLEIH
                     SPLTKKWTPVPFVDASAQFKEKGAAAPIIVNIGDQLSYWTNGLLKSTVHRVKFPEESV
                     REGKSRYSIVFFSHPADDTLLEPVPSPFIRAVNGRGAGAQSKAITAKEHLLKRLAATY
                     GWY"
     gene            <824773..>826155
                     /locus_tag="PAS_chr3_0423"
                     /db_xref="GeneID:8199555"
     mRNA            <824773..>826155
                     /locus_tag="PAS_chr3_0423"
                     /product="Putative membrane protein of unknown function
                     involved in Mn2+ homeostasis"
                     /transcript_id="XM_002492606.1"
                     /db_xref="GeneID:8199555"
     CDS             824773..826155
                     /locus_tag="PAS_chr3_0423"
                     /codon_start=1
                     /product="Putative membrane protein of unknown function
                     involved in Mn2+ homeostasis"
                     /protein_id="XP_002492651.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0423"
                     /db_xref="EnsemblGenomes-Tr:CAY70472"
                     /db_xref="GeneID:8199555"
                     /db_xref="GOA:C4R4I6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R4I6"
                     /translation="MGLRTRASSTLRNVDVMLLLLAWCAVFWFHQTYIPRKVIEQCSF
                     HQSNSTTFTVLMIADPQLIDNHTYPGRNKILLGLSKHTVDTYLTRNFRHLISTLHPDS
                     VMFVGDLMDNGRSSEDNYYEREYSRFKNIFPDSDSYEMLTNVPGNHDVGWANGVKKHA
                     VGRFNMHFGESNTVITRGNHEFIFLDSLSLSNTNDESIYGPSSRFMQEFKNRRKDKPR
                     ILLTHVPLFRNPDIDCGPMREGGKFPLTQGYQYQTVLDNELSEEILASFKPDLILTGD
                     DHDYCEYNHEYHVNETSYIAKEITVKSISMAMGIQRPAVELLTLQNEKLYFSICHLER
                     PYREVITYVLLAALTVVIIFFWNNTHIRGRRYQPLANRSIRNKLANYVKGIEVDNFGP
                     ATTILVGQADQETPASNNFATSWWNLKHHTRAPIGSSLFTKLNFGVFIKKCAIMSLCV
                     AILYINMVGI"
     gene            complement(<826169..>826657)
                     /locus_tag="PAS_chr3_0424"
                     /db_xref="GeneID:8199556"
     mRNA            complement(<826169..>826657)
                     /locus_tag="PAS_chr3_0424"
                     /product="Membrane anchor subunit of succinate
                     dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p)"
                     /transcript_id="XM_002492607.1"
                     /db_xref="GeneID:8199556"
     CDS             complement(826169..826657)
                     /locus_tag="PAS_chr3_0424"
                     /codon_start=1
                     /product="Membrane anchor subunit of succinate
                     dehydrogenase (Sdh1p, Sdh2p, Sdh3p, Sdh4p)"
                     /protein_id="XP_002492652.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0424"
                     /db_xref="EnsemblGenomes-Tr:CAY70473"
                     /db_xref="GeneID:8199556"
                     /db_xref="GOA:C4R4I7"
                     /db_xref="InterPro:IPR007992"
                     /db_xref="UniProtKB/TrEMBL:C4R4I7"
                     /translation="MLRLNPILTRRSLFRPQVFSRCISLKPDFSKLKLKEQPPGYVVG
                     TVNDAYVPPEPDHFHGGYHWTYEKIITIAMIPLFITPFAAGAEYPLVDSIFSVLLVFH
                     CRAGFESCIIDYIPKRVYGVWHKMALYLLDAATGLSLYGVYVLETENNGIFDLIQKLW
                     GA"
     gene            complement(<826863..>828722)
                     /locus_tag="PAS_chr3_1189"
                     /db_xref="GeneID:8199557"
     mRNA            complement(<826863..>828722)
                     /locus_tag="PAS_chr3_1189"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492608.1"
                     /db_xref="GeneID:8199557"
     CDS             complement(826863..828722)
                     /locus_tag="PAS_chr3_1189"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492653.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1189"
                     /db_xref="EnsemblGenomes-Tr:CAY70474"
                     /db_xref="GeneID:8199557"
                     /db_xref="UniProtKB/TrEMBL:C4R4I8"
                     /translation="MSTIGSTRNFSSVSLQSLPEEGFNELSLEDDKVFMEDKRGAKHT
                     KHPSPSSLLNGRSKSYTSVRRLGSNTQINSGLGIKVRRPDVTGTLKRSTSGVESEDSE
                     CSRSNTSIDTASLTMTTLASNDPPPLANRPFYSRVAHSTPVLVTMKSKPKPKPVSRRK
                     SQMEAEKIPVSFSDDEIPDDQLMYNVPVTNGCALSFYGSNNMPAKIVKLALQSVDDLQ
                     SMPPSPLPGRLEQFSDGSEPSTPTIENYERKFHALSPEAKNLTKFYENSSTNFVQNEL
                     LKRKEYNKLKLPSGSETVEDAGLEKLDLISKEKLDTLCKTRPLWLPPKSFKEAKRHEK
                     QASAMLDSAARKQKRMVSIRRQSERDLLIWKERLPYILSHETWKSSYKNEVVKNTWKF
                     PIQDELKSQVWIKFLTDMKGDKVVPEKYQEYDDLIKMDHLILKKLPKDISEESMKRLN
                     QILTARSKSNQDLKNGDETIIATIFLLPGFSNNDVFEIMRLLNANLRSGAFVSKFDRK
                     VSKIVSFIKHRVAKDQYTTFKTQSSEVLNFQFIFNELLLNHFSKDDMIRILELFILTE
                     DYRLLYALFITVYLHYHYGFSQISDLLSKENQNFTIEVDSKFWERLYYYYSKV"
     gene            <829742..>830800
                     /locus_tag="PAS_chr3_0425"
                     /db_xref="GeneID:8200221"
     mRNA            <829742..>830800
                     /locus_tag="PAS_chr3_0425"
                     /product="Sphinganine C4-hydroxylase"
                     /transcript_id="XM_002492609.1"
                     /db_xref="GeneID:8200221"
     CDS             829742..830800
                     /locus_tag="PAS_chr3_0425"
                     /codon_start=1
                     /product="Sphinganine C4-hydroxylase"
                     /protein_id="XP_002492654.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0425"
                     /db_xref="EnsemblGenomes-Tr:CAY70475"
                     /db_xref="GeneID:8200221"
                     /db_xref="GOA:C4R4I9"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:C4R4I9"
                     /translation="MDKFSQYIPKNTTGFLNQPYPPTSVVIRRPDLIQGVPDGILSLC
                     VPIVLYWSYSTFFHIVDTYELAEKYRIHPSEEVLQRNKVTLRVVIQDVIVQHIIQTLV
                     GLVFYKLDPVPTTGYEQREMWYLKQRLPPFFKWNDTIANLFVYYGYWYGLSATKIIIA
                     FVIIDTWQFFLHRLMHVNKTLYRKFHSRHHKLYVPYAFGALFNDPFEGFLLDTVGAGL
                     AAIFTGLTPRESMVLYGFSTLKTVDDHCGYSLPFDIFQIIFPNDSIYHDIHHQHFGIK
                     SNFSQPFFTFWDKFFGTTFHGVDQYKQSQQKITLERYKEFLASRQKSRIQKQQQQHSK
                     VERYSDSEDEPDHQKKEQ"
     gene            complement(<830888..>831502)
                     /locus_tag="PAS_chr3_0426"
                     /db_xref="GeneID:8199558"
     mRNA            complement(<830888..>831502)
                     /locus_tag="PAS_chr3_0426"
                     /product="Protein involved in homologous recombination in
                     mitochondria and in transcription regulation in nucl"
                     /transcript_id="XM_002492610.1"
                     /db_xref="GeneID:8199558"
     CDS             complement(830888..831502)
                     /locus_tag="PAS_chr3_0426"
                     /codon_start=1
                     /product="Protein involved in homologous recombination in
                     mitochondria and in transcription regulation in nucl"
                     /protein_id="XP_002492655.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0426"
                     /db_xref="EnsemblGenomes-Tr:CAY70476"
                     /db_xref="GeneID:8199558"
                     /db_xref="InterPro:IPR024629"
                     /db_xref="UniProtKB/TrEMBL:C4R4J0"
                     /translation="MSTKLRSAKWIQKNGFAPQVFLFRNIETNQVLYSQLPHISNYQI
                     KQQFWRPNWQDRKPQKRRDIWRCMAVADFHNYDNALKAYHALVELRYLRQVTKKEEAM
                     AMRRRNKDGNIWFSAQFRPVHSQEAVADLSTVIDEFNMPSKIYWESLWRRGDEKYWNK
                     DLTTHEEMDLRDPRFRTVVLNDIKEKSKAEIGLNQARAATSKLQ"
     gene            complement(<831663..>833261)
                     /locus_tag="PAS_chr3_0427"
                     /db_xref="GeneID:8199559"
     mRNA            complement(<831663..>833261)
                     /locus_tag="PAS_chr3_0427"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492611.1"
                     /db_xref="GeneID:8199559"
     CDS             complement(831663..833261)
                     /locus_tag="PAS_chr3_0427"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492656.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0427"
                     /db_xref="EnsemblGenomes-Tr:CAY70477"
                     /db_xref="GeneID:8199559"
                     /db_xref="InterPro:IPR015672"
                     /db_xref="InterPro:IPR022535"
                     /db_xref="InterPro:IPR025969"
                     /db_xref="UniProtKB/TrEMBL:C4R4J1"
                     /translation="METEPNDLQQFGQEPGSTGVSFFGIIPLLGLATFYFFWSSKVLY
                     PLVPKLFGLTHVDMSKLKTITTISLEGYYDKKTVLPNEYTPMVYIAKLVFSIVVSASL
                     MVISLVLFEIQGFFDLDSKIVIWKFSLPLLVFFLIFVVPMLFVYHLINNWELRREFKF
                     NSNIKAVLLMAITVIWLLALQFLKKAFFWIDDSGEGYLVRFLNQLALLGIMSLGALSG
                     IISVSTPYNAYRKDQQYISVLDLKNKARQLESIQDQLNTKLSRLETKPKASRFRLFSF
                     SSNDSNYSRIEVESLTSMRDSLKQELHQLYEKYQVQKNKDSFLGKIGIMWTKVFSIYC
                     VYKFTSVLLYKIPVSYYKTYSRPSDEEPNVASDALSATLSKLIVSLNISSFQPDEKEL
                     TNQITFLLSLGLFASSISSLHSTFHSIKKALPSHLSVSVSSPDSTNNKSVFRSLFISE
                     TLGIYTISTLVLLKTNIPESLSKSFVSFLGKSSYFNGARVDFLFDKVFATSCTVSLVI
                     LLLSSFFGNEDEIYDEEILLEKEL"
     gene            complement(<834712..>835011)
                     /locus_tag="PAS_chr3_0428"
                     /db_xref="GeneID:8199560"
     mRNA            complement(<834712..>835011)
                     /locus_tag="PAS_chr3_0428"
                     /product="Protein required for cytochrome c oxidase
                     assembly"
                     /transcript_id="XM_002492612.1"
                     /db_xref="GeneID:8199560"
     CDS             complement(834712..835011)
                     /locus_tag="PAS_chr3_0428"
                     /codon_start=1
                     /product="Protein required for cytochrome c oxidase
                     assembly"
                     /protein_id="XP_002492657.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0428"
                     /db_xref="EnsemblGenomes-Tr:CAY70478"
                     /db_xref="GeneID:8199560"
                     /db_xref="InterPro:IPR010625"
                     /db_xref="UniProtKB/TrEMBL:C4R4J2"
                     /translation="MSANPGNKLSSWNPTPPQRGAFPLDHFGDCTEPMKKYMECLKLV
                     KNDNAPNCRQLAKKYLDCRMNNELMDRVPWEDLGFNDEPKRKDAPVKQDAGTKEN"
     gene            <835261..>835488
                     /locus_tag="PAS_chr3_1190"
                     /db_xref="GeneID:8199561"
     mRNA            join(<835261..835293,835354..>835488)
                     /locus_tag="PAS_chr3_1190"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492613.1"
                     /db_xref="GeneID:8199561"
     CDS             join(835261..835293,835354..835488)
                     /locus_tag="PAS_chr3_1190"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492658.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1190"
                     /db_xref="EnsemblGenomes-Tr:CAY70479"
                     /db_xref="GeneID:8199561"
                     /db_xref="GOA:C4R4J3"
                     /db_xref="InterPro:IPR012621"
                     /db_xref="UniProtKB/TrEMBL:C4R4J3"
                     /translation="MSGLALSEESKERIVKILDTTTTVVHYGWIPFVLYVGWISTPNR
                     PSLIKYVYFPV"
     gene            <835801..>836718
                     /locus_tag="PAS_chr3_0429"
                     /db_xref="GeneID:8200222"
     mRNA            <835801..>836718
                     /locus_tag="PAS_chr3_0429"
                     /product="Protein required for transport of flavin adenine
                     dinucleotide (FAD)"
                     /transcript_id="XM_002492614.1"
                     /db_xref="GeneID:8200222"
     CDS             835801..836718
                     /locus_tag="PAS_chr3_0429"
                     /codon_start=1
                     /product="Protein required for transport of flavin adenine
                     dinucleotide (FAD)"
                     /protein_id="XP_002492659.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0429"
                     /db_xref="EnsemblGenomes-Tr:CAY70480"
                     /db_xref="GeneID:8200222"
                     /db_xref="GOA:C4R4J4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R4J4"
                     /translation="MFDQPIFGIKSVEIISGLNAGLCSTLVNHPLDLIKLRLQLNSHQ
                     TSLSGGISSVVKDIVHLSTKNGKLDPKVLVKEFYRGITPNLVGNMASWALYFMCYNEY
                     KTFFRNPTSSTYLMSGFLAGWSTSILTNPVWVLKTRMVATHHSTPEGYNSLWEGASQI
                     LKKEGISGFWKGLTPALLNVSQGALQFTLYDTLKDSLYPENQKVLSTYQYIYVSGISK
                     IIATVAFYPLQVLRSRMQGFELLKNRQSMSHLVIEIITKEGVPGLYKGLVPNMMRVLP
                     ATCITLTVYENTKNLLNGTSNRKNNIDNN"
     gene            complement(<838189..>839649)
                     /locus_tag="PAS_chr3_0431"
                     /db_xref="GeneID:8199562"
     mRNA            complement(<838189..>839649)
                     /locus_tag="PAS_chr3_0431"
                     /product="Subunit of the Nsp1p-Nup57p-Nup49p-Nic96p
                     subcomplex of the nuclear pore complex (NPC)"
                     /transcript_id="XM_002492615.1"
                     /db_xref="GeneID:8199562"
     CDS             complement(838189..839649)
                     /locus_tag="PAS_chr3_0431"
                     /codon_start=1
                     /product="Subunit of the Nsp1p-Nup57p-Nup49p-Nic96p
                     subcomplex of the nuclear pore complex (NPC)"
                     /protein_id="XP_002492660.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0431"
                     /db_xref="EnsemblGenomes-Tr:CAY70481"
                     /db_xref="GeneID:8199562"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:C4R4J5"
                     /translation="MFGNSNKNPANSGGMFGNASGSNVGAFGGSSSGNTGGLFGAKPA
                     TNTNNTGGLFGNNASTNSGGNSGGLFGSTNASGSTNTGGMFGNNSGNTNTNQSGSLFG
                     ANTNTGNTQSQGLFGGNTASNSNQSGGLFGGNASNTQSKGLFGGNTNTNSNTQQGGLF
                     GGNSGNTQSGGLFGTNSNNTQSGGLFGGSNTANSNAQTGGGLFGNANKPAQSGFSGSN
                     NPSGNTGGLFGSNNTNANTTTGSLFGNNTNSNAGGLFNSSNNNNSLLGNNAAPNNPNN
                     ASQPQITSLTRVTDLPDAYQKEIEQLDQYIQQQMDIAESLKDDQANHKELIESVPRDI
                     NFLENKYSSVSQAIHNDLNFVMSFKCKVLESFNDWVEKVIKLYLQLTNPVLLKEITNN
                     DKTLNIKEAEPPNSAILHTFYVHKVKEIQQNIQKYHSVLQEIENAVDELDKVSSNGID
                     NSWDLIIQTLKEEFRLYLELANNLADVHHEIKRISV"
     gene            <839909..>844264
                     /locus_tag="PAS_chr3_0432"
                     /db_xref="GeneID:8199563"
     mRNA            <839909..>844264
                     /locus_tag="PAS_chr3_0432"
                     /product="Evolutionarily-conserved 5'-3' exonuclease
                     component of cytoplasmic processing (P) bodies"
                     /transcript_id="XM_002492616.1"
                     /db_xref="GeneID:8199563"
     CDS             839909..844264
                     /locus_tag="PAS_chr3_0432"
                     /codon_start=1
                     /product="Evolutionarily-conserved 5'-3' exonuclease
                     component of cytoplasmic processing (P) bodies"
                     /protein_id="XP_002492661.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0432"
                     /db_xref="EnsemblGenomes-Tr:CAY70482"
                     /db_xref="GeneID:8199563"
                     /db_xref="GOA:C4R4J6"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR016494"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:C4R4J6"
                     /translation="MGIPKFFRYISERWPMISEPIEDSQIAEFDNLYLDMNSILHNCT
                     HSNDGSVDLMKEEEMFSAIFAYIEHLFTLIKPGKTFFMAIDGVAPRAKMNQQRSRRFR
                     TAIEAEKSVEIAQKNGLITSKDENFDSNCITPGTEFMAKVTTNLKFFIHQKISSDAKW
                     QKVQVILSGHEVPGEGEHKIMDYIRFLKAQEGYDPNTRHCIYGLDADLIMLGLVIHDP
                     HFAILREEVVFGRGSKASSTDVSEQQFYLLHLSLLREYLALEFKDLEDQIKFDYDLER
                     ILDDFIFIMYVIGNDFLPNLPDLHINKGAFPRLLATIKETMIDSDGYLQEGGVINMER
                     FGLWLDHLSQFELQNFEQVDVDVEWFNKQLENISLDGERKRERAGRKLLLRRQQELIS
                     KLRPWILEFYSSRDNIYSAHDDDSLIPTLQLDTELMEEEIKLPFIKQFALDVGFFIVH
                     SKSQNTYHAKIDIDGINVNESDEEFEARVLYIRKKIKEYENSIFVEDENTLEEQKNIY
                     DTKFVNWKNKYYKEKFGFTLSDTEDILKLTESYIQGLQWVLFYYYRGVPSWQWYYPYY
                     YAPRISDIKLGIKACLEFDKGTPFKPFEQLMAVLPARSKQLVPACYRPLMTDPNSPII
                     EFYPDEVEIDKNGKTASWEAVVKINFVDEKRLLEALEPYNSKLNAEERQRNSLGTNIE
                     FSYHPQVNQVHSSPIPTIFPDITEDHCYEIVVEFDKLHSSTYAKPMKGAKQGINLLAG
                     FPTLKTIPFTSQLMLAECHIFNQPTKSESMILSTQNPFEGLTVEQFAAQNLGQTIYVN
                     WPYLKEAKVVAVSDGLNVFEPGNKSIRTTRMESSEVSEFASDVRYISETLFKRKGVLL
                     VNYTEEELQGTPEPRRSPHNDDAIQGIVFVKKVNGVIRTRSGAYVKTYSDKIEKYPIN
                     LLVDDVVNKDRRLLEKPPVPLEEEFPKGTTLISLGAFAYGTPATVVDHQNDLMTVRFV
                     NQPIKHEFNYGEIQAQREAHTNVYYPSFKVAKIVGITALALSRITSSYRIVNGAKKTV
                     NIGLDLKFEGRKLKVLGYTKRNEKHWSYSALAVNLLQQYQKRFPSVFKIISLRNDSSI
                     PEAKELFPQVPASQVDEKVNELVAWVKEQKKSFVVATLESESLTKVSIGKIEQEVIKF
                     VSKPHEHIPQKGLKGVPREATLDISNSSQFLSKQTFNLGDRVIYVEDSGKVPNFSKGT
                     VIGVRSVGTKVTLNVLFDLPLLSGNTFDGRLATPRGVTVDSSLVLNLTKRQLIYHDRK
                     PAKKEGKPGVKKTSQDSKKQTVKLQNGSGKAKQAQDAELSVTTTPVPVPAANTAPVTA
                     SVQATSVVTATVPTSKPSNNSEDEHELLRLLKGNKDSSESQGSQEPLARTSIQQIYGT
                     VFNQVLSAQPQLQPVRGFSNPVPETPVNGVQANEQHSDSTPQNHSRDENQGRGRGRGR
                     GNRRGRGRGRGKGGQ"
     gene            complement(<844334..>844885)
                     /locus_tag="PAS_chr3_0433"
                     /db_xref="GeneID:8199564"
     mRNA            complement(<844334..>844885)
                     /locus_tag="PAS_chr3_0433"
                     /product="Subunit of the RES complex"
                     /transcript_id="XM_002492617.1"
                     /db_xref="GeneID:8199564"
     CDS             complement(844334..844885)
                     /locus_tag="PAS_chr3_0433"
                     /codon_start=1
                     /product="Subunit of the RES complex"
                     /protein_id="XP_002492662.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0433"
                     /db_xref="EnsemblGenomes-Tr:CAY70483"
                     /db_xref="GeneID:8199564"
                     /db_xref="InterPro:IPR018609"
                     /db_xref="UniProtKB/TrEMBL:C4R4J7"
                     /translation="MSLQDYLDSKYGKSKSKKRDKSLKPKPKSSIQKPTKPAKPENAT
                     IYRDLSGNVLSHEEMLEQQRQKSQQEKQKAKEASEKLRNMNLPEVTQTATKRVAPPSY
                     VDDPLLAFSPDKVKSLQKDRYISQTGRKLYKSSFPDNRFSIMPGYRWDGIDRSNGWEQ
                     KVFKTTALRQEKKVLSYTMQDDY"
     gene            <845551..>847927
                     /locus_tag="PAS_chr3_0434"
                     /db_xref="GeneID:8199565"
     mRNA            join(<845551..845681,845956..>847927)
                     /locus_tag="PAS_chr3_0434"
                     /product="Mitochondrial amino acid transporter"
                     /transcript_id="XM_002492618.1"
                     /db_xref="GeneID:8199565"
     CDS             join(845551..845681,845956..847927)
                     /locus_tag="PAS_chr3_0434"
                     /codon_start=1
                     /product="Mitochondrial amino acid transporter"
                     /protein_id="XP_002492663.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0434"
                     /db_xref="EnsemblGenomes-Tr:CAY70484"
                     /db_xref="GeneID:8199565"
                     /db_xref="GOA:C4R4J8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R4J8"
                     /translation="MLNEHCKHSANDGFNECLDFSGFYWPSLVDRCLISISSSGSVGF
                     FHSALSSIEERMPELTQSLTEIFDSYSKEGKLDYNGFIDILSNESYASQYFNNFLRIP
                     NSSLGLLYLLVDKDANGQISLDNWLAFSEKLLNEEESSITYKLFQNLDSSFKDKSEDE
                     FKSLVSTNLNDQFKSQFDRVVSDDGKILPEDFRNIVSSIYSSRLPTAAIDQIGRLCTE
                     SLTFNEAASLFDFVQAIPKLNYYTFRASNNFKDTLCKEDFIAALKETINTEDNVSDSF
                     LDYYYQLTTFIVNSTNQNHLLKGDLLAILTDDMVTTEETVDGGFSLYPILNSAYSFLL
                     GSIAGSIGATIVYPIDLVKTRMQNQKGNAKYSSYFDCFKKTFRSEGLRGFYSGLLPQL
                     VGVAPEKAIKLTVNDIVRSIGVKQSANGEITMPWEILAGCSAGAAQVVFTNPLEITKI
                     RLQVQGEALKQSLAEGTNVVEKTAVDIVRELGIRGLYKGASACLLRDVPFSAIYFPCY
                     ANLKKHLFDFDPKDPTKNSSLESWQLLVSGALAGMPAAYFTTPCDVIKTRLQVEHKAG
                     DMHYTGISNAFKTILKEEGFSALFKGGLARVFRSSPQFGFTLASYELFQTYIPLSAFY
                     PDPNQTKTLGKVAGAITDGKGNSLNSLTPVDISKLDNARDVHYSISEHARKVVNTSFD
                     LNPKLNSFNYFNYVNEKK"
     gene            complement(<847996..>849114)
                     /locus_tag="PAS_chr3_0435"
                     /db_xref="GeneID:8199566"
     mRNA            complement(<847996..>849114)
                     /locus_tag="PAS_chr3_0435"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492619.1"
                     /db_xref="GeneID:8199566"
     CDS             complement(847996..849114)
                     /locus_tag="PAS_chr3_0435"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492664.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0435"
                     /db_xref="EnsemblGenomes-Tr:CAY70485"
                     /db_xref="GeneID:8199566"
                     /db_xref="UniProtKB/TrEMBL:C4R4J9"
                     /translation="MSRRVLLSQRCLPRLQRLPQLFTQASIGPMSDTIRLAKEIDETS
                     RKQSLLLGQLLDRLDEKEANEQRLLAKIRVLESNHSLLLSKISECPSCSGFNDQRFYS
                     SQTQVSMTQESQLQRVPSSKRPKYQPRSPLKEITNLEPTLNMNVNTNSFDSSSSGSIE
                     YVAVASPELITSDIEEIISDSQPDVTHDDILTHNTPKINPYITPITDSKIKIDLSTNP
                     KFNREWFLEDFKRNPASKSSHTDNCMCNDCSKLFQLAPVSNLKNGIKWDSNSAESGET
                     PSKRSIPAGFKRRHGNGGDNTIWDDPCTPPGFNRSEFPTTQELKEDRKESSKRVKSIA
                     LYRLKEALKVDEHGKQIGKFIFKNNEFNVIVNNGNFLT"
     gene            complement(<849187..>851832)
                     /locus_tag="PAS_chr3_0436"
                     /db_xref="GeneID:8199567"
     mRNA            complement(<849187..>851832)
                     /locus_tag="PAS_chr3_0436"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492620.1"
                     /db_xref="GeneID:8199567"
     CDS             complement(849187..851832)
                     /locus_tag="PAS_chr3_0436"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492665.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0436"
                     /db_xref="EnsemblGenomes-Tr:CAY70486"
                     /db_xref="GeneID:8199567"
                     /db_xref="GOA:C4R4K0"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R4K0"
                     /translation="MIGGPQVISESESKLRYFCQHPKCDKNFTRKEHLSRHELNHNPK
                     VLYKCQLPECGKSFVRNDLLKRHIRRHELRRDKFQRRNNKAAVHFNNTPIVLSGPGLK
                     TSHENSSSSEIDAFTRSSIDTSAPLEARPSISEQGNMKHDDSTPNGSSQPTQAHVTSI
                     PQRSTLVTPKNDGLRGVQKSTSSGNLLSWLFDDLSSNDNNIEPAMRTRNDFSDFMLSE
                     DMLFQEAPGVSGGFAHINGVDMAWSARLPPITSPLAAGLGNETTNDSTALDNRRINAP
                     IENSPASPSDHISSLVLNDLLNVIPSLSQHPDFTGPKIDFFLFNYWSLYHPAFPILHK
                     PSFSSARCESLLLLCMLMIGAHVIAASPSGTAGCHFLDICDPRSLADCIAEPVRWALF
                     TSPDFHPPAKLYVIQSLLLLEWYEKNCSTRRIHERGHLHHGTTINLLRRTPSLGGNPL
                     KSSQELEPNEPETVYSQWLEMESMKRATLMCFYMDAVDAISFGHQLVLHCHQIQLTMP
                     CDDALWEAPLPVRRIPKSMPFLLAMKSTLNRTSFNATPFGRRMVLAGLCAILFQMQQL
                     DLQSAIGLEEGMHPIKNWREVIMRAFTFWRNELGESKGLDSKGRPSRIIAGSLANSSS
                     TCTSPYGSLCTSSILEQLEADTSCKHPVFHMAYVFMSISHFDLTTFAGAPWRMNVRPS
                     DSDHAAVNRRVKDWARSLHGRIAVIHCYLMLFELFLSPEDAPYEYNHPFDPNSDLFCR
                     SNILALLTVVIWNYNYAVDGTESNILFGSSDKKLSDITPVENGYAYLRRIRKELSQLS
                     GVMIHTKVKHISGDEFFKLTCRYADLLPKVRNKQNMSGLCVMVSSMLMQSSFALPKEL
                     AKLLNLCAERSLGSPRNTELHMYDQ"
     gene            <853612..>855378
                     /locus_tag="PAS_chr3_0438"
                     /db_xref="GeneID:8199568"
     mRNA            <853612..>855378
                     /locus_tag="PAS_chr3_0438"
                     /product="Member of the PUF protein family, which is
                     defined by the presence of Pumilio homology domains"
                     /transcript_id="XM_002492621.1"
                     /db_xref="GeneID:8199568"
     CDS             853612..855378
                     /locus_tag="PAS_chr3_0438"
                     /codon_start=1
                     /product="Member of the PUF protein family, which is
                     defined by the presence of Pumilio homology domains"
                     /protein_id="XP_002492666.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0438"
                     /db_xref="EnsemblGenomes-Tr:CAY70487"
                     /db_xref="GeneID:8199568"
                     /db_xref="GOA:C4R4K1"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R4K1"
                     /translation="MTKNLLSVGGSSPQGQNSLANALSPGIPPIGAGSTANTVSFQSQ
                     FRHQPSLSVNSINSINSLNSLNSFNSNTSTSIHDSAYQFGGEPLTPPEIANNSTKHFS
                     PWNTNNNGALKSNSTTQFPAQVFPFSNTAGNPGVGAAPSVTNTNPRSRLLSLPQLQPA
                     VTFNIDKSLASLSLQNNNNLDTFNPTSSSTTPIYPKKSHEKELVTRLNSTPFEALTDE
                     IVSLSKDQYGCRFLQRKLDENSTMYFPTIFGQICAHASELMVDPFGNYLVQKLLNYCT
                     NHEKDLLLEQSAPDLFSVALNQHGTRALQKIIDCLGTNYQFSLVRDSLKNHVVELIQD
                     LNGNHVVQKCINKFSHKDFQFIIDAICLHIVRISTHKHGCCVLQKCLNKCNQQQLVQL
                     GDEIIANAIVLMKDQFGNYVVQYLLSMNNLPINEKLVYQILPSISMLSVQKFSSNVME
                     KCLKNAPNRSSQNAMLEEILRPQNLNALIKDQYGNYVVQTAIDVADDEYKFRLIQTVK
                     PMLPFIKSTPYSRRIQSKISVVLNQNANLNAMLTTYQQYFASTAAPDQYLSFYKQQQQ
                     QQQQQQHQYQNQQFQGLHNNQN"
     gene            <856281..>857939
                     /locus_tag="PAS_chr3_0440"
                     /db_xref="GeneID:8199569"
     mRNA            <856281..>857939
                     /locus_tag="PAS_chr3_0440"
                     /product="Lactate transporter"
                     /transcript_id="XM_002492622.1"
                     /db_xref="GeneID:8199569"
     CDS             856281..857939
                     /locus_tag="PAS_chr3_0440"
                     /codon_start=1
                     /product="Lactate transporter"
                     /protein_id="XP_002492667.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0440"
                     /db_xref="EnsemblGenomes-Tr:CAY70488"
                     /db_xref="GeneID:8199569"
                     /db_xref="GOA:C4R4K2"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R4K2"
                     /translation="MSHSIHSAAHKSVMTDIEKQHDRIHPHDHPVTPLEKPDLSAKSI
                     KHYFATRLSTLVPKAEDFKDKRYIFNPFMVLRELTPKNWNFFMCGFAAWTWDAVDFFS
                     VSLNVTNIAKDLNVTTKDVTWGLTLVLMLRSVGAISFGLWADRKGRKWPFIFNMILLI
                     VLQIGLGFVNTYKQFLGVRAVFGIAMGAVFGNASSLALDDCPPRAKGIVSGIFQQGYA
                     FGYLLVVVFQRAITDNASKSWRALFWFSAGPPVLIILWRLVLPETDAFIAQQNLRMET
                     SDGQTASQQFVKQGKDALRVYWLMLIYMIIMMAAFNFSSHSSQDLYPTLLTVQYEFGK
                     DRSTVTNVVANLGAIVGGIFWGHMSNFIGRRLAVLLCCIVGGAFIYPWAFINGSGINA
                     GAFFLQFAVQGGWGVCPVHLAEMSPPHFRAFVTGTTYQLGNLASSGSSTILADIGERF
                     PIYDENGVRKEGVYDYAKVMAIFMGAVFAFLFIVMLLGPERRGASNLDDLQDYIDDWE
                     QKDLDNKKGIETEFIEDVQLMEAVSNEDLSEKGNEKVEAFEGNK"
     gene            <859462..>859935
                     /locus_tag="PAS_chr3_0442"
                     /db_xref="GeneID:8199570"
     mRNA            <859462..>859935
                     /locus_tag="PAS_chr3_0442"
                     /product="Lsm (Like Sm) protein"
                     /transcript_id="XM_002492623.1"
                     /db_xref="GeneID:8199570"
     CDS             859462..859935
                     /locus_tag="PAS_chr3_0442"
                     /codon_start=1
                     /product="Lsm (Like Sm) protein"
                     /protein_id="XP_002492668.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0442"
                     /db_xref="EnsemblGenomes-Tr:CAY70489"
                     /db_xref="GeneID:8199570"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C4R4K3"
                     /translation="MTQNQNRSQTAGLSDVFQNDSEKDLYLESYMYTTAAALVGSIDK
                     IVTVTLREGRVFIGILRTFDQFANLVLQDTVERIYIGDDKYAEAPQGVFLIRGENVSL
                     VGEIDLDQQDKDLEKRSQIPFPEAQRIRKELVAAKQAKTTKERELMLSKGFEPQS"
     gene            <860100..>861197
                     /locus_tag="PAS_chr3_0443"
                     /db_xref="GeneID:8199571"
     mRNA            <860100..>861197
                     /locus_tag="PAS_chr3_0443"
                     /product="Subunit of tRNA (1-methyladenosine)
                     methyltransferase"
                     /transcript_id="XM_002492624.1"
                     /db_xref="GeneID:8199571"
     CDS             860100..861197
                     /locus_tag="PAS_chr3_0443"
                     /codon_start=1
                     /product="Subunit of tRNA (1-methyladenosine)
                     methyltransferase"
                     /protein_id="XP_002492669.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0443"
                     /db_xref="EnsemblGenomes-Tr:CAY70490"
                     /db_xref="GeneID:8199571"
                     /db_xref="GOA:C4R4K4"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R4K4"
                     /translation="MSFLYYKDVIEEEDLVMAFISRNDIKPMIVKSGETLNTRYGVFP
                     HDLMIGARYGEQIASAKGYGFIHLLQPTPELWTLSLPHRTQIVYTFDSSYVVQRLRVL
                     PGSRVIEAGTGSGSFSHAFARTIHSNGRLFSYEFHKPRYEEAKGEFECHKLPNITLTH
                     RDVCTDGFKVDGVNVDGDAVFLDLPAPWEAIEHLDEVVAKDRRVSICCFSPCIEQVVK
                     TIEALTAKNWNGIEMVEVSGRKWEAHREMVRDVDEAVARLKDIKKRAVAGLERKRKLN
                     QTSDEFENEDIDIQTTEENDISHKEPAGKGETDLKPKSDQNTKDRGYNPFGKGMRIRE
                     GDPAYNWINVTRSEPEVKSHTSYLTFAYRNQ"
     gene            complement(<861204..>862121)
                     /locus_tag="PAS_chr3_0444"
                     /db_xref="GeneID:8199572"
     mRNA            complement(<861204..>862121)
                     /locus_tag="PAS_chr3_0444"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492625.1"
                     /db_xref="GeneID:8199572"
     CDS             complement(861204..862121)
                     /locus_tag="PAS_chr3_0444"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492670.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0444"
                     /db_xref="EnsemblGenomes-Tr:CAY70491"
                     /db_xref="GeneID:8199572"
                     /db_xref="InterPro:IPR013744"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R4K5"
                     /translation="MVEFTLQKSEPVTGIVHSIHTQIPPKAFEFVDSSFKDIVLFVGG
                     LTNGILGVGYLPLLAKALAPLGFGLVQALLSSSDRGWGTSSLKKDAAELAQLVKYLRT
                     KAGKRNIILMGHSTGCQDTIHYLLHQNPTEPTLRVNGAIFQAPVSDREAFSNELPVEE
                     LDALNEEARAILESKGPNELLPQKFRELAFNTPITAYRWLSLMAQRGDDDYFSSYLTD
                     EEFSNTLGAINVPFLLLYSGSDEFVPQTVDSNKLVDRWKAIVQRNGLSDWSQYSGIID
                     GATHDLGPQSDAGVDRVVNFIKNLSWDKN"
     gene            <862254..>863105
                     /locus_tag="PAS_chr3_0445"
                     /db_xref="GeneID:8199573"
     mRNA            <862254..>863105
                     /locus_tag="PAS_chr3_0445"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492626.1"
                     /db_xref="GeneID:8199573"
     CDS             862254..863105
                     /locus_tag="PAS_chr3_0445"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492671.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0445"
                     /db_xref="EnsemblGenomes-Tr:CAY70492"
                     /db_xref="GeneID:8199573"
                     /db_xref="UniProtKB/TrEMBL:C4R4K6"
                     /translation="MLPLLIPRRLAIHSKGVIFNKRVPINLSFKRALFHFNSPLITYP
                     VVRAIITRSYSQHRGNNPWSSRSTKKLNQLVPDPLKVLIGLVGTASLLFVVAAPLLFV
                     ILPPILLGGYFTTRLRLRRIESQMQQRWQRALSSSLKFTPRDDLTVSQIELSRAVLDR
                     LVLAVDDNEQHLKDLLGLKVDQDGVLPRLALGEAERIEYDSRYSSPGVEEILMVLFFP
                     LTDGKHRLANVVVSLAGNSLSPSESRKMVLEIQVGNFVRPVFITNDRQFEDDLVIDVK
                     GKTTTRD"
     gene            complement(<863723..>864787)
                     /locus_tag="PAS_chr3_0446"
                     /db_xref="GeneID:8199574"
     mRNA            complement(<863723..>864787)
                     /locus_tag="PAS_chr3_0446"
                     /product="Putative dihydrokaempferol 4-reductase"
                     /transcript_id="XM_002492627.1"
                     /db_xref="GeneID:8199574"
     CDS             complement(863723..864787)
                     /locus_tag="PAS_chr3_0446"
                     /codon_start=1
                     /product="Putative dihydrokaempferol 4-reductase"
                     /protein_id="XP_002492672.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0446"
                     /db_xref="EnsemblGenomes-Tr:CAY70493"
                     /db_xref="GeneID:8199574"
                     /db_xref="GOA:C4R4K7"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R4K7"
                     /translation="MVSKVLLTGASGYIAQHITNELLSHGFHVIGTVRRQEQADQLHK
                     QFTEENPALQRDPSLLTYVLVPDIGAPDAFDEVLKSTSDITYVLHTASPVALNDDRAL
                     EDVYLKPAVEGTKNILSAIKKFANVSVKNVVVTASLACIMNLDKAEDKSFIHTEKVWN
                     NNTWDQTKGGDKIVAYIVSKKEAEKAAWDFVEKEKPNFKLTTVNPPYVFGPQKFDASA
                     KKESLNTSAEIVGSLLRTKYPSDDKLFDDPVSISVDVRDVALYHVLPLLDADLASKRL
                     FVVQSKFSAQRILNIINENFPDLKGKIAVGKPEETARLEALKAPEYNNSVTVGLTGVD
                     PIPLEKTIVDSVKQILRANK"
     gene            complement(<866032..>867096)
                     /locus_tag="PAS_chr3_0447"
                     /db_xref="GeneID:8199575"
     mRNA            complement(<866032..>867096)
                     /locus_tag="PAS_chr3_0447"
                     /product="Putative dihydrokaempferol 4-reductase"
                     /transcript_id="XM_002492628.1"
                     /db_xref="GeneID:8199575"
     CDS             complement(866032..867096)
                     /locus_tag="PAS_chr3_0447"
                     /codon_start=1
                     /product="Putative dihydrokaempferol 4-reductase"
                     /protein_id="XP_002492673.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0447"
                     /db_xref="EnsemblGenomes-Tr:CAY70494"
                     /db_xref="GeneID:8199575"
                     /db_xref="GOA:C4R4K8"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R4K8"
                     /translation="MVSNVLLTGASGYIAQHVTSELLSHGFRVIGTVRRQEQADQLHK
                     QFSEENPALQKDPSLLTYVLVPDIGAPDAFDEVLKSTPDITYVLHTASPLIFNDDRAL
                     EDVYLRPAVEGTKNILSAIKKFANDSVKNVVVTSSFAALMNPDKFEDKSFIHTEKVWN
                     NKTWDDTKPRDEFLGYVVSKKEAEKAAWDFVKKETPNFKLTTVNPSYVFGPQKFDVAA
                     RKESLNASAEIVNLLLRTKYPSDEKLFDDLVSISVDVRDVALYHVLPLLDADLASKRL
                     FVVQSKFSAQRILNIINENFPELKGKIAVGKPEETARLEAIKGPEYNNSLSIALTGVD
                     PIPLEKTIVDSVKQILRANK"
     gene            complement(<867597..>868661)
                     /locus_tag="PAS_chr3_0448"
                     /db_xref="GeneID:8199576"
     mRNA            complement(<867597..>868661)
                     /locus_tag="PAS_chr3_0448"
                     /product="Putative dihydrokaempferol 4-reductase"
                     /transcript_id="XM_002492629.1"
                     /db_xref="GeneID:8199576"
     CDS             complement(867597..868661)
                     /locus_tag="PAS_chr3_0448"
                     /codon_start=1
                     /product="Putative dihydrokaempferol 4-reductase"
                     /protein_id="XP_002492674.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0448"
                     /db_xref="EnsemblGenomes-Tr:CAY70495"
                     /db_xref="GeneID:8199576"
                     /db_xref="GOA:C4R4K9"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R4K9"
                     /translation="MASKVLLTGASGYIAQHITSELLSHGFKVIGTVRRQEQADQLHK
                     QFSDDVPALQKDPSLLTYVLVPDMGAPDAFDEVLKSTPDITYVLHTACPVGPNDDRAL
                     EDVFFKPVVEGTKNIFNAIRNLANDSVKNVVLTSSFVTLMNADKAEDKSFIYTEKSWN
                     NNTWDQIKNRDELLAYTVSKTEAEKGAWDFVDREKPNFKLTTVHPPLVFGPQKFDVAA
                     KKESLNFSAEIVGSLLRTKYPSDDKLFDDVVTLSVDVRDVALYHVLPLLNADLASKRL
                     AVVQGKFSAQRILNIINENFPELKGKIAVGKPEETARLEALKAPEYNNSVTVGLTGVD
                     PIPLEKTVVDSVKQILRARK"
     gene            complement(<869184..>870248)
                     /locus_tag="PAS_chr3_0449"
                     /db_xref="GeneID:8199577"
     mRNA            complement(<869184..>870248)
                     /locus_tag="PAS_chr3_0449"
                     /product="Putative dihydrokaempferol 4-reductase"
                     /transcript_id="XM_002492630.1"
                     /db_xref="GeneID:8199577"
     CDS             complement(869184..870248)
                     /locus_tag="PAS_chr3_0449"
                     /codon_start=1
                     /product="Putative dihydrokaempferol 4-reductase"
                     /protein_id="XP_002492675.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0449"
                     /db_xref="EnsemblGenomes-Tr:CAY70496"
                     /db_xref="GeneID:8199577"
                     /db_xref="GOA:C4R4L0"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R4L0"
                     /translation="MVSKVLLTGASGYIAQHITNELLSHGFKVIGTVRRQEQADQLHK
                     QFSEESSVLQKDPSLLTYVLVPDIGASDAFDEVLKSTPDITYVLHTASPFIFNDDRAL
                     EDVYLKPAVEGTRNILSAIKKFANDSVKNVVVTSSFAAILNADKFEDKSFIHTEKVWN
                     NNTWDQTKSGDRGVAYIVSKKEAEKAAWDFVEKEKPNFKLTTVNPPYVFGPQKFDASA
                     KKESLNTSAEIVGSLLHTKYPSDDKLFDDPLNLSVDVRDVALYHVLPLLNADLASRRL
                     LVVQSKFSAQRILNIINENFPELKGKIAVGKPEETARVEAIKGPEYNNSVTVGLTGVD
                     PIPLEKTVVDSVKQILRANK"
     gene            complement(<870572..>871382)
                     /locus_tag="PAS_chr3_0450"
                     /db_xref="GeneID:8199578"
     mRNA            complement(join(<870572..871298,871348..>871382))
                     /locus_tag="PAS_chr3_0450"
                     /product="Alpha 4 subunit of the 20S proteasome"
                     /transcript_id="XM_002492631.1"
                     /db_xref="GeneID:8199578"
     CDS             complement(join(870572..871298,871348..871382))
                     /locus_tag="PAS_chr3_0450"
                     /codon_start=1
                     /product="Alpha 4 subunit of the 20S proteasome"
                     /protein_id="XP_002492676.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0450"
                     /db_xref="EnsemblGenomes-Tr:CAY70497"
                     /db_xref="GeneID:8199578"
                     /db_xref="GOA:C4R4L1"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C4R4L1"
                     /translation="MSGYDSALSIFSPDGHVFQVEYALEAVKRGTCAIGVKGKDVVVL
                     GAERRTTLKLQDPRVTPSKINNVDKHVLLAFAGLNADARILIDKARVEAQSHRLNLED
                     PVSIEYLTKYVAGVQQRYTQSGGVRPFGISTLIAGFDGNDNVPRLYQTEPSGIYSAWK
                     AVAIGRSSKTVNEFLEKNYLQLEESDVTLDRDRTIKLTIKALLEIVQTGAKNIEISVM
                     APNETIQLSNDEIAAVVEQVEAEKAAEAEKKQKKK"
     gene            complement(<872015..>872434)
                     /locus_tag="PAS_chr3_0451"
                     /db_xref="GeneID:8199579"
     mRNA            complement(<872015..>872434)
                     /locus_tag="PAS_chr3_0451"
                     /product="Mitochondrial outer membrane protein"
                     /transcript_id="XM_002492632.1"
                     /db_xref="GeneID:8199579"
     CDS             complement(872015..872434)
                     /locus_tag="PAS_chr3_0451"
                     /codon_start=1
                     /product="Mitochondrial outer membrane protein"
                     /protein_id="XP_002492677.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0451"
                     /db_xref="EnsemblGenomes-Tr:CAY70498"
                     /db_xref="GeneID:8199579"
                     /db_xref="GOA:C4R4L2"
                     /db_xref="InterPro:IPR013262"
                     /db_xref="UniProtKB/TrEMBL:C4R4L2"
                     /translation="MADIEIEIDLPVEPVVEDFPSNAESPLSQEELFESSDSQQTEAE
                     LEDSEITTKINLSNVWSAVSSVAINLVLPFINGMMLGFGEILAHEVAFRYKWRGAKIQ
                     PPSRMLRAASNSSAAVQSEKSYKEESPAISQRRSLVL"
     gene            <872702..>874414
                     /locus_tag="PAS_chr3_0452"
                     /db_xref="GeneID:8199580"
     mRNA            <872702..>874414
                     /locus_tag="PAS_chr3_0452"
                     /product="Sensor of mitochondrial dysfunction"
                     /transcript_id="XM_002492633.1"
                     /db_xref="GeneID:8199580"
     CDS             872702..874414
                     /locus_tag="PAS_chr3_0452"
                     /codon_start=1
                     /product="Sensor of mitochondrial dysfunction"
                     /protein_id="XP_002492678.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0452"
                     /db_xref="EnsemblGenomes-Tr:CAY70499"
                     /db_xref="GeneID:8199580"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="UniProtKB/TrEMBL:C4R4L3"
                     /translation="MSTVELQANEAEIVARSLVAIVDIGSNGIRFSVSSTASHHARIM
                     PCVFKDRLGISLFDAQLDKGSASSISTRKPIPQEAITEICLAMKRFQLICEDFGVSND
                     NVKIVATEATREAPNSKEFRDAIAKTTGWEVELLSKEDEGRCGAFGVASSFHNISGIF
                     MDVGGGSTQLSWVSTVNGDVRLAEYPISLPYGAAALTQRLLYEDEREVYEEVRQAYEL
                     ALEKIKIPTELIEEAEKNGGFNLYTCGGGFRGVGHLLLHEDPNYPIQTIINGYTTGFK
                     KVELLANYLLLKKEVPNFSEGSPKIFRVSERRKQQLPAVGLLMSAAFQVLPKIRTVSF
                     SEGGVREGVLYSRISPSIRSEDPLLTATRPYAPLLSEQYRKLLLGALPEEVPSEITQT
                     IVPALCNIAFVHCSYPKELQPTAALHMATSGIIAGTHGLSHKVRALIGLACCERWGFD
                     LPESEEVFYGKLEKLVIQSDPNDGERLLYWTKYCGKIMFVICGVHPGGNIRPGVIDFN
                     VIPRAEANKTNTAVQVGMSANDVKSSYTVKNRIASLQRKIKKLNKSYKGKDRVVVEVE
                     YRMS"
     gene            <874605..>876773
                     /locus_tag="PAS_chr3_0453"
                     /db_xref="GeneID:8199581"
     mRNA            <874605..>876773
                     /locus_tag="PAS_chr3_0453"
                     /product="Subunit (90 kDa) of TFIID and SAGA complexes"
                     /transcript_id="XM_002492634.1"
                     /db_xref="GeneID:8199581"
     CDS             874605..876773
                     /locus_tag="PAS_chr3_0453"
                     /codon_start=1
                     /product="Subunit (90 kDa) of TFIID and SAGA complexes"
                     /protein_id="XP_002492679.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0453"
                     /db_xref="EnsemblGenomes-Tr:CAY70500"
                     /db_xref="GeneID:8199581"
                     /db_xref="GOA:C4R4L4"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR007582"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4R4L4"
                     /translation="MKQEPGDSSDKSAPSGSITPQPKPPQQANVSNQQPQKPQQFSAA
                     DLNRIVLEYLNKKGYHKTESMLRMESSHIPAPPTNIPTPQTTNISRPTAPGRAPEYSD
                     DPATIKRGYSILKSWCESSLDFYRPELEKFLYPVFVHCYLDLIARGYPSHAREFYDKF
                     SKDHSVLHEYEISKLGGISLKEHLQENDVAKIFRSHKFKVLIGRTTFNLLLYFLNEND
                     AVGGGVVLRLINQYIEPVITTEAIAVEREGELNLSEGIVELHTLNNTSIGGEQREISS
                     VDAFNKKPVKLGKLQVDPEYSKELEAELKLKDEHEQAAQKKVSTTLLEEYRENFKVDP
                     SDENNPSKDTLPLPLKSAQDLRNDIAMIQDSRAKIKLSAAQASLPSVCMYTFHNTNND
                     LTCLKFNDDSTMVASGFQDSFIKLWSIDGSPLRSLLKNDPYNQQNNDGVAVKGSRRLV
                     GHSGAVYGVDFSPDNRYLISCSEDKTVRLWSLDTYTCLVSYKGHSSSVWDVKFSPMGH
                     YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVEFHPNSTYLFTGSSDKTARMWDI
                     ARGECVRVFMGHSGAINCLAVSPDGRWLASAGEDSVVCLWDISTGRRIKAMRGHGRSS
                     IYSLAFSREGTVLVSTGADNSVRVWDVKKNTNSPSAQPEPINDVTAQGIQKKTEDLRR
                     RKEIVATNDHMSVYFTKKTPVYTVHFTRRNLCLAGGVFGG"
     gene            complement(<876797..>877660)
                     /locus_tag="PAS_chr3_0454"
                     /db_xref="GeneID:8199582"
     mRNA            complement(<876797..>877660)
                     /locus_tag="PAS_chr3_0454"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492635.1"
                     /db_xref="GeneID:8199582"
     CDS             complement(876797..877660)
                     /locus_tag="PAS_chr3_0454"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492680.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0454"
                     /db_xref="EnsemblGenomes-Tr:CAY70501"
                     /db_xref="GeneID:8199582"
                     /db_xref="GOA:C4R4L5"
                     /db_xref="InterPro:IPR009450"
                     /db_xref="UniProtKB/TrEMBL:C4R4L5"
                     /translation="MARHPWKKLLWLKQDYADNYTDSSFLSQLKKNTTVANYSYFKLV
                     NDFALIVLHSSTIVLVSIVFYGVYHENWNPVIPTLVSTSITFIFWVVYMVISYINHLE
                     VASVVGTLKSSLLILFILLTLSPVLKSLTDSTSSDSIWALSCWICVVNVLFNDYVIEF
                     SGATHTSNLSKNLALSNAILLASRLYSNLAAFSFILFCIQVQGLFPMFNNFTRRCQML
                     AFHRFQLIAIVGGVNYLVYSILGMSALSCWAALQGIILFVGPSYFIRLQKYKEELQGP
                     WDPVKPRISVA"
     gene            <877889..>878200
                     /locus_tag="PAS_chr3_0455"
                     /db_xref="GeneID:8199583"
     mRNA            <877889..>878200
                     /locus_tag="PAS_chr3_0455"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492636.1"
                     /db_xref="GeneID:8199583"
     CDS             877889..878200
                     /locus_tag="PAS_chr3_0455"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492681.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0455"
                     /db_xref="EnsemblGenomes-Tr:CAY70502"
                     /db_xref="GeneID:8199583"
                     /db_xref="UniProtKB/TrEMBL:C4R4L6"
                     /translation="MADNIETIRPGINYQDKLLTEIDILDDVKQLSTQMEQEGKGFVF
                     PKDHYSKIKSLKGLQVKLLKEMQELAEIQQSRHQDETAYRQKLQDLEDTTSELRNVAL
                     T"
     gene            <878576..>880258
                     /locus_tag="PAS_chr3_0456"
                     /db_xref="GeneID:8199584"
     mRNA            <878576..>880258
                     /locus_tag="PAS_chr3_0456"
                     /product="Glycolytic enzyme phosphoglucose isomerase"
                     /transcript_id="XM_002492637.1"
                     /db_xref="GeneID:8199584"
     CDS             878576..880258
                     /locus_tag="PAS_chr3_0456"
                     /codon_start=1
                     /product="Glycolytic enzyme phosphoglucose isomerase"
                     /protein_id="XP_002492682.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0456"
                     /db_xref="EnsemblGenomes-Tr:CAY70503"
                     /db_xref="GeneID:8199584"
                     /db_xref="GOA:C4R4L7"
                     /db_xref="InterPro:IPR001672"
                     /db_xref="InterPro:IPR018189"
                     /db_xref="InterPro:IPR023096"
                     /db_xref="UniProtKB/TrEMBL:C4R4L7"
                     /translation="MPSLLQEDNATFKLASELPAFEELKELYKSKGKNFSAKQAFQKD
                     PARSSKFSHTFKNFDGTEVFFDFSKNLIDDEILAKLFDLARQANVEKLRNEMFAGEHI
                     NVTEDRAVFHVALRNRANRPMYVDGKNVAPEVDSVLQHMKEFSTQVRDGTWKGYTGKQ
                     ITDVVNIGIGGSDLGPVMVTEALKPYAQEGLHVHFVSNVDGTHIAETLKYLDPESTLF
                     LIASKTFTTAETIRNANTAKDWFLSKTGNKSEAIAKHFAALSTNAEEVAKFGIDTKNM
                     FGFENWVGGRYSVWSAIGLSVAIYIGFDNFEDFLKGAEAVDRHFLETPLEQNIPVIGG
                     LLSVWYTNFFGSQTHLVTPFDQYMHRFPAYLQQLSMESNGKSVTKGNVFANYSTGPVV
                     FGEPTTNAQHSFFQLVHQGTHLIPADFILAAKSHNPVANNAHQILLASNFLAQAESLL
                     LGKTEEEVAAAGATGGLIPHKVFSGNRPTTSILTQKITPATLGSLIAYYEHVTFTEGA
                     IWNINSFDQWGVELGKVLAKAVQKDLQDDSANVEESHDSSTAQLIKKFKAWA"
     gene            <880411..>881640
                     /locus_tag="PAS_chr3_1191"
                     /db_xref="GeneID:8199585"
     mRNA            <880411..>881640
                     /locus_tag="PAS_chr3_1191"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492638.1"
                     /db_xref="GeneID:8199585"
     CDS             880411..881640
                     /locus_tag="PAS_chr3_1191"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492683.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1191"
                     /db_xref="EnsemblGenomes-Tr:CAY70504"
                     /db_xref="GeneID:8199585"
                     /db_xref="GOA:C4R4L8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:C4R4L8"
                     /translation="MAEEVDPVSLGDQTILRYKIWKKNSPYLYDYFQSKSLLWPSLSV
                     EFLPDIERNDEDEFDYQRLIFGTFTSGASNEFLNFGMFSRHNEVSLRESLRNSLDNFD
                     SVKGEISPLVLPSSKDSKNSNRSCEKLSIIQRIAHNGEVNKCKYLPQNPDIIATINNY
                     GSVSIFDRTKHPSQPLSGTIKPDIYCTYHKDEGSCLSWNPSVEGELLSGSMDGTVVLW
                     DIKKYTRDKDSLDPYKIFIAHDNGCNDLKFIPRHTSIFGSVGEDGFFKLWDTRQGLDP
                     VKSTRLHQTGINSLSFSDQVPFTLATGDAEGQIKLLDLRNLENTIQDIKAHEESISTL
                     EWNPHNSLLGSCSMDKTVKIWDFGDNEQPLKFTHGGHMFGVNDISWNPWDETMISSVG
                     EDNSLHIWKPSKSIIGV"
     gene            complement(<881649..>882854)
                     /locus_tag="PAS_chr3_0457"
                     /db_xref="GeneID:8200223"
     mRNA            complement(<881649..>882854)
                     /locus_tag="PAS_chr3_0457"
                     /product="Essential, non-ATPase regulatory subunit of the
                     26S proteasome"
                     /transcript_id="XM_002492639.1"
                     /db_xref="GeneID:8200223"
     CDS             complement(881649..882854)
                     /locus_tag="PAS_chr3_0457"
                     /codon_start=1
                     /product="Essential, non-ATPase regulatory subunit of the
                     26S proteasome"
                     /protein_id="XP_002492684.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0457"
                     /db_xref="EnsemblGenomes-Tr:CAY70505"
                     /db_xref="GeneID:8200223"
                     /db_xref="GOA:C4R4L9"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019585"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C4R4L9"
                     /translation="MATYASGIPKIPDFDVSKLSFLAQIADGDGDAALVDKVIQGVET
                     NEMAPYYHYLYHQIALPGLEWDQGLYDKLVLQNEKKVEELTNKIKVVDEDDEGEVENA
                     ECWAELGNYYAQIGDKNKAIETLGKATDLAPSIGAKIDIKLTLSRIGFFYDDKQFTKK
                     YLDEANALIEKGGDWERKNRYKVYTGIHDLSMRKFKEASDLLIGALPTFTSTELLTYE
                     DLALYALIAGVISLDRKNLKKQLIDSPEILSIESHSSLFKPIFSLLKALYDCKYDSFF
                     KHLLETNDQILTKNVNLAPHANYYLRELRVKAYSQLLESYKSLSLKSMSEEFGVSIEF
                     LDHDLCQFIPNKQLNCVIDRVNGIVETNRPDNKNNQYNLLIKSGDALLTKLQKYGATV
                     RLSGTEKAN"
     gene            <883230..>884762
                     /locus_tag="PAS_chr3_1192"
                     /db_xref="GeneID:8199586"
     mRNA            join(<883230..883268,883335..>884762)
                     /locus_tag="PAS_chr3_1192"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492640.1"
                     /db_xref="GeneID:8199586"
     CDS             join(883230..883268,883335..884762)
                     /locus_tag="PAS_chr3_1192"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492685.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1192"
                     /db_xref="EnsemblGenomes-Tr:CAY70506"
                     /db_xref="GeneID:8199586"
                     /db_xref="GOA:C4R4M0"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:C4R4M0"
                     /translation="MVHLGAKKPQHRKLSPELRKAYKEVEAQFVVSTPRLKQIVDQFV
                     AELKEGLKSSSSNIPMLPTWVMDFPTGEETGDYLAIDLGGTNIRVILVRLLGNRKFDT
                     IQSKYVLPKWIRTSTSNELWLFIAQCVKTFIDEEFDYRESPEDPIPLGFTFSYPAFQS
                     RINSGVLQRWTKGFDIPDVEGHDVVPMLQDALESLGLSVVVVALINDTTGTLVASTYT
                     DPETKMGLIFGTGVNGAYYDTISSVSKISNALPPDIQEDASMAINCEYGAFDNNISVL
                     PRTKYDDTIDLESPRPGQQSYEKMISGYYLGELLRLVLVDLHHQGHIFKGQTIGKLNE
                     PFIMDTSFPARIEEDPFENLCETGELFNSLGIETTVPERELIRRICELIGTRAARLSV
                     CSIAAICKKRGYKKAHCAADGSVFTRYPYFPDRAARALRDIFQWGHSTPDLVTVVPAE
                     DGSGVGAAIIAALTKQRMANGESVGLDEYHPQDGKDSN"
     gene            <884875..>886195
                     /locus_tag="PAS_chr3_0458"
                     /db_xref="GeneID:8200224"
     mRNA            join(<884875..884890,885048..>886195)
                     /locus_tag="PAS_chr3_0458"
                     /product="Essential component of the Arp2/3 complex"
                     /transcript_id="XM_002492641.1"
                     /db_xref="GeneID:8200224"
     CDS             join(884875..884890,885048..886195)
                     /locus_tag="PAS_chr3_0458"
                     /codon_start=1
                     /product="Essential component of the Arp2/3 complex"
                     /protein_id="XP_002492686.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0458"
                     /db_xref="EnsemblGenomes-Tr:CAY70507"
                     /db_xref="GeneID:8200224"
                     /db_xref="GOA:C4R4M1"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:C4R4M1"
                     /translation="MEQPIVLDQGTGFVKIGRGGTNFPDHTFPSIVGRPILRAEERTG
                     TVEIKDIMCGDEASSVRSALQISYPMENGIIKNWEDMEHLWDYAFYERMKIDTTDRKV
                     LLTEPPMNPLKNREKMCDVMFEKYHFGHVYVAIQAVLALYAQGLSSGVVVDSGDGVTH
                     IVPVYESVVLSHLTKRLDVAGRDVTRNLINLLLRRGYAFNRTADFETVRQIKEKLCYV
                     SYDLDFDTKLANDTTTLVESYELPDGRVIKCSSERFEAPECLFQPNLVDVEQPGVGES
                     LFNVIQSADVDIRSTLFKSIVLSGGSSMYPGLPSRLEKELKQQWFHKVLRGDPTRLEK
                     FKVRIEDPPRRKQMVFIGGAVLANIMADKDHMWISRQEWEEQGPRVLEKLGSR"
     gene            complement(<886269..>887993)
                     /locus_tag="PAS_chr3_0459"
                     /db_xref="GeneID:8199587"
     mRNA            complement(<886269..>887993)
                     /locus_tag="PAS_chr3_0459"
                     /product="Dual-specificity kinase"
                     /transcript_id="XM_002492642.1"
                     /db_xref="GeneID:8199587"
     CDS             complement(886269..887993)
                     /locus_tag="PAS_chr3_0459"
                     /codon_start=1
                     /product="Dual-specificity kinase"
                     /protein_id="XP_002492687.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0459"
                     /db_xref="EnsemblGenomes-Tr:CAY70508"
                     /db_xref="GeneID:8199587"
                     /db_xref="GOA:C4R4M2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R4M2"
                     /translation="MKSLSGLGLSPDSNRSEEILPPELNVVTMSMLDDVSFKPTLKPR
                     RERTSVYKDPSIFDKYSNEYFTPHTQTRAPITPPSQQCMESLGRGSSRLSKKYNRIGL
                     GAPKRLSQKLTDEFSLENIMQRGTKTQQRRQQLDQKLQDKDLDPDNLQEIQKDLESHR
                     SKYLNELKRQNHSPPLTTTKAQLPDVAPYFDRNTPAQKTPSREPLRPISSNVRCQELN
                     TATTTNKTSVQPQAPQDNIQRSKPIVQINNKHYEKLELIGRGGSSKVYKVKSFANNKA
                     YAIKRVTLDQFDSNAIKGFKGEIQLLQKLSNSDRVVKLIDYNFSDTTIHLVMELGEID
                     LAHVLTSQNSLDLNAVRFYASELFKCVQAVHQSGIVHSDLKPANFLFVRGVMKIIDFG
                     IANALDDVTCNIYRDSQIGTPNYMAPEALIECSSKGVASLGPESSTWKIGKGSDIWSC
                     GCILYQMVYGRPPYAHFNGNQRLMAIMNPQVQIEYSEKGLDDVRVPSALKSLMQGCLE
                     RDLTKRITCEEALNSNFLNPKTVSREFICDLVDHALKYGARNQNVTPDVMSSLCEEVW
                     SKVCQSNN"
     gene            <888430..>889128
                     /locus_tag="PAS_chr3_0460"
                     /db_xref="GeneID:8199588"
     mRNA            <888430..>889128
                     /locus_tag="PAS_chr3_0460"
                     /product="Subunit b of the stator stalk of mitochondrial
                     F1F0 ATP synthase"
                     /transcript_id="XM_002492643.1"
                     /db_xref="GeneID:8199588"
     CDS             888430..889128
                     /locus_tag="PAS_chr3_0460"
                     /codon_start=1
                     /product="Subunit b of the stator stalk of mitochondrial
                     F1F0 ATP synthase"
                     /protein_id="XP_002492688.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0460"
                     /db_xref="EnsemblGenomes-Tr:CAY70509"
                     /db_xref="GeneID:8199588"
                     /db_xref="GOA:C4R4M3"
                     /db_xref="InterPro:IPR008688"
                     /db_xref="InterPro:IPR013837"
                     /db_xref="UniProtKB/TrEMBL:C4R4M3"
                     /translation="MSLARVSFRAARQSTIGLRAFQPCAVRLQSSQVEPKAKANSIID
                     ALPGNNILSKTGIVATSVAGAVYAISNELYVVNEESILLLTFAGTVGVVAKVLGPLYN
                     EWASSTIQNITDILNSSRTKHVEAVKGRIDQVGNLKDIVSTTKALFELSKETAQLEAE
                     AFALKQQVDIAAEAKSVLDSWVRYESQVRQLEQQQLASSVISKVQEQLKDPKFQQKVL
                     LQSLEQVEQVFAKK"
     gene            complement(<889189..>889497)
                     /locus_tag="PAS_chr3_0461"
                     /db_xref="GeneID:8199589"
     mRNA            complement(<889189..>889497)
                     /locus_tag="PAS_chr3_0461"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492644.1"
                     /db_xref="GeneID:8199589"
     CDS             complement(889189..889497)
                     /locus_tag="PAS_chr3_0461"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492689.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0461"
                     /db_xref="EnsemblGenomes-Tr:CAY70510"
                     /db_xref="GeneID:8199589"
                     /db_xref="UniProtKB/TrEMBL:C4R4M4"
                     /translation="MSSPPDDPNALGRRSIFYEPQWNPSGKAPKGFKNVPYPLKNPKD
                     YPSDPRAEKIPLPEGPPPKYYKRKTTAIEAPEERRDLYKETLQFVPRTIASTQKPKTP
                     "
     gene            <889696..>892641
                     /locus_tag="PAS_chr3_0462"
                     /db_xref="GeneID:8199590"
     mRNA            <889696..>892641
                     /locus_tag="PAS_chr3_0462"
                     /product="Cytoplasmic alanyl-tRNA synthetase"
                     /transcript_id="XM_002492645.1"
                     /db_xref="GeneID:8199590"
     CDS             889696..892641
                     /locus_tag="PAS_chr3_0462"
                     /codon_start=1
                     /product="Cytoplasmic alanyl-tRNA synthetase"
                     /protein_id="XP_002492690.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0462"
                     /db_xref="EnsemblGenomes-Tr:CAY70511"
                     /db_xref="GeneID:8199590"
                     /db_xref="GOA:C4R4M5"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:C4R4M5"
                     /translation="MLKFPHKGISSIKSKPRIGIIAMSTLASKEWTANKVRSTFFDFF
                     KSKDHTYVPSSSVIPYDDPTLLFTNAGMNQYKPIFLGTVDPSSDFATLKRATNSQKCI
                     RAGGKHNDLEDVGRDSYHHTFFEMLGNWSFGDYFKKEAIGYGWELLTKVYGLEKERLY
                     VSYFGGDAGLGLEPDLEAKEYWKALGVAEDHILPGSVEDNFWEMGDQGPCGPCSEIHY
                     DRIGGRNAASLVNQDDPDVLEIWNIVFIQFNREADGSLKPLPSKHIDTGMGFERLVSI
                     LQNVRSNYDTDVFDPLFTKIQEITGVRPYSGHFGKEDMDGIDTAYRVLADHVRTLTFS
                     LADGGVPNNEGRGYVLRRILRRGARYARKYMNYPIGKFFSQLAPALIEQVKETFPEVD
                     KNFDTIAEILDEEEASFSRTLDRGERLFEQYAIIASKTPEQTLAGRDVWRLYDTYGFP
                     VDLTRLMAEETGLKIDDEGFEIAKEASREASKGNGKTQGKELVKLDVHVLGELEKNSE
                     VPKTDDSYKYGTKNIEASIVAIYNGKELIQSTSEVADDQQLGILLDKTPFYAEQGGQI
                     YDTGKIVIDGVAEFNVENVQSYAGYVLHTGYVEEGVLSVSDKIIAGYDELRRWPIKNN
                     HTGTHILNFALRDVLGDDVEQKGSLVAPEKLRFDFSHKKALTLSELQKVEDISNEVIK
                     KNVPVFASDVTLAVGKEINGLRAVFGETYPDPVRVVSIGVPVEELVKNPSNAEWHNAS
                     IEFCGGTHVAKTGDIKDFVIIEESGIAKGIRRIVAVTSTEAHTVQRIAREKNDQLDAI
                     AKMSFGEAKEKKLKEFNVALGKLQISVLAKNDLKTKFTNIEKVVKDELKVRQKAESKK
                     TLDTVKDYFNEHEDSPFFVAHVPVSSNAKLLTEAFSYIKKEIPDKSLYLIVGNESEPK
                     IAQGCYVSDNALSKGVVASEVTNVASEFIGGKAGGKGNICQGVGTNPEGINKAIEAVT
                     KILKEKLSI"
     gene            <892906..>893973
                     /locus_tag="PAS_chr3_0463"
                     /db_xref="GeneID:8199591"
     mRNA            <892906..>893973
                     /locus_tag="PAS_chr3_0463"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492646.1"
                     /db_xref="GeneID:8199591"
     CDS             892906..893973
                     /locus_tag="PAS_chr3_0463"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492691.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0463"
                     /db_xref="EnsemblGenomes-Tr:CAY70512"
                     /db_xref="GeneID:8199591"
                     /db_xref="InterPro:IPR018865"
                     /db_xref="UniProtKB/TrEMBL:C4R4M6"
                     /translation="MAPNTMKLTASKSSKLSHRSLIESQLKKTKLQNQGYIDKKQPEY
                     YLPSEQAIVNEINQEKLLKKEEFDKQQKLQVLNYDCRIFDNLDLELEADGGVDDYLAE
                     YYGSKREDPLITAIDQIQLSQFDNNYPPIAKGGLTKKSKLEIETKREAYPRLVLVNQL
                     YSVFPSNPTFVDQAIQKLVDTGKIKQLRINHKDFHDNVVIKNEDYMTIVETFSDDGNV
                     SNFSKFLTENRSANNVTLKDSEKYGFRIDDLISKGFLNISTGKSTINTENYYLSVPNI
                     GGFLKLIQESKKFVFKVIGTTKWKEALESKLEERWNYKNRKWYYFKGLNLKWVLSYCA
                     GAGTLEVFNTPVGKGWKITGK"
     gene            complement(<893999..>895111)
                     /locus_tag="PAS_chr3_0464"
                     /db_xref="GeneID:8199592"
     mRNA            complement(<893999..>895111)
                     /locus_tag="PAS_chr3_0464"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492647.1"
                     /db_xref="GeneID:8199592"
     CDS             complement(893999..895111)
                     /locus_tag="PAS_chr3_0464"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492692.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0464"
                     /db_xref="EnsemblGenomes-Tr:CAY70513"
                     /db_xref="GeneID:8199592"
                     /db_xref="InterPro:IPR012879"
                     /db_xref="UniProtKB/TrEMBL:C4R4M7"
                     /translation="MLAILSLLAVASAQQVSQPYYEHTYEELKEMGLLQRLITYNWKL
                     ELVTVSFTLAYLLTHFLGASYNARLVGKWVSSAEEVLDKQFASLGCSVKEKVVKDDNE
                     HYTYFATGRKNIESLTVRFTLKPRHNLLLLVTETILSFFISSIEKSIDSVNIIVKYND
                     EAESNIDDFIWAIVNKDGMNQARIENYFLSLTKTSESSKLPTEYVFMSETADITEEVY
                     NDAENSGLTSSPTLLKYVAFTDQSIVKPTTLEEAASSKKAILFTNFPSTASELKANQD
                     LLTSFLSLVDNVVENVKFRPETLKRVKKTREAEIQKIKKALDEVQKEELESKRVEEQR
                     KERERISKLSPEEQRKIEKKRQEKKQRKQMKQQRVR"
     gene            complement(<895426..>895968)
                     /locus_tag="PAS_chr3_0465"
                     /db_xref="GeneID:8199593"
     mRNA            complement(<895426..>895968)
                     /locus_tag="PAS_chr3_0465"
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /transcript_id="XM_002492648.1"
                     /db_xref="GeneID:8199593"
     CDS             complement(895426..895968)
                     /locus_tag="PAS_chr3_0465"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /protein_id="XP_002492693.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0465"
                     /db_xref="EnsemblGenomes-Tr:CAY70514"
                     /db_xref="GeneID:8199593"
                     /db_xref="GOA:C4R4M8"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:C4R4M8"
                     /translation="MLLQSFKALRATRSSLISTPIIQTAGYKTQYLGQKVVKVYQPLP
                     KLREGTPLMKYVKENQYKKLDPNGVKKSLLDKSNPSLLRSGDIVRITYNNKQPPLVGM
                     VIAVKRNGCDSNILLRNSYAKLGVEIRVPIFNPVIERVDILKRPTKYRSRNKLYYIRG
                     TKLDVTDIESSLKKQQRRSN"
     gene            complement(<896113..>896922)
                     /locus_tag="PAS_chr3_0466"
                     /db_xref="GeneID:8199594"
     mRNA            complement(<896113..>896922)
                     /locus_tag="PAS_chr3_0466"
                     /product="Protein involved in bud-site selection"
                     /transcript_id="XM_002492649.1"
                     /db_xref="GeneID:8199594"
     CDS             complement(896113..896922)
                     /locus_tag="PAS_chr3_0466"
                     /codon_start=1
                     /product="Protein involved in bud-site selection"
                     /protein_id="XP_002492694.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0466"
                     /db_xref="EnsemblGenomes-Tr:CAY70515"
                     /db_xref="GeneID:8199594"
                     /db_xref="GOA:C4R4M9"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R4M9"
                     /translation="MSRPEQLAPAEVFYNETESRKYTNNTRIQHIQAKMTLRALELLN
                     LPKDTANFILDIGCGSGLSGEILTEEGDMWIGMDISPDMLATALDREVEGDLLLADIG
                     NGIPFRAGTFDAVISISAIQWLCNADTSNADPKRRLLRFFNTLYASLKRGGKVAAQFY
                     PMNDNQLDQIQSAAKVAGFQGGVVIDDPESKKNKKYYLVLSAGTPDVQINLEGVVMDA
                     PTKERKLNKKQMKLMETRKDYIQRKKEVMKRRGKSVANDSKFTARKRRPRF"
     gene            <897081..>898661
                     /locus_tag="PAS_chr3_0467"
                     /db_xref="GeneID:8199595"
     mRNA            <897081..>898661
                     /locus_tag="PAS_chr3_0467"
                     /product="Acyl-CoA:sterol acyltransferase, isozyme of
                     Are1p"
                     /transcript_id="XM_002492650.1"
                     /db_xref="GeneID:8199595"
     CDS             897081..898661
                     /locus_tag="PAS_chr3_0467"
                     /codon_start=1
                     /product="Acyl-CoA:sterol acyltransferase, isozyme of
                     Are1p"
                     /protein_id="XP_002492695.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0467"
                     /db_xref="EnsemblGenomes-Tr:CAY70516"
                     /db_xref="GeneID:8199595"
                     /db_xref="GOA:C4R4N0"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="UniProtKB/TrEMBL:C4R4N0"
                     /translation="MMPIPVARVDSDTQMQAIKRNAKKERSKIHNFPLKGQEIGSSMT
                     GFEEDLKEYDIMEDLKSHDLVLIKKNAQISTRYDKKGELRSRFGDISFNQSRSIFDSS
                     IMETPFRGFFILAWMAVGMLALKTLVEYERNNTRIYTSNIIRIMQKDLIKVGFADLLM
                     YLSMYATFFLQKLIKNGYLDWDNTGMYLQHVYQCGFLFFWLLTAKRMEFPWIGKIFLL
                     LHSLVMLMKMHSYAFYNGYLFKIQKELDFSQRHLNNKKQKLDKETTAALQKSVEFCKF
                     ELTSQSTTSPFPSNVNLKNWFWYTMYPTVVYEIDYPLTNEIRWKYVGTKMLGIFGVIF
                     LMILVAESWLYPLALEAIQLRKLPVSQRVSPYVFILLEMAPPFLLMYMLVFYLIWELI
                     LNAVAELTGFADRSFYSEWWNSVSWDEFARDWNLPVHRFLLRHVYHSSISAFQLSRYN
                     ATLFTFLLSSFVHELTMYVIFGKFRGYLLYFQMAQIPLTYLSRTKFMADRKILGNSIF
                     WLGISTGPSLLCSLYLVF"
     gene            complement(<898697..>899365)
                     /locus_tag="PAS_chr3_0468"
                     /db_xref="GeneID:8199596"
     mRNA            complement(<898697..>899365)
                     /locus_tag="PAS_chr3_0468"
                     /product="Putative metalloprotease of the mitochondrial
                     inner membrane"
                     /transcript_id="XM_002492651.1"
                     /db_xref="GeneID:8199596"
     CDS             complement(898697..899365)
                     /locus_tag="PAS_chr3_0468"
                     /codon_start=1
                     /product="Putative metalloprotease of the mitochondrial
                     inner membrane"
                     /protein_id="XP_002492696.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0468"
                     /db_xref="EnsemblGenomes-Tr:CAY70517"
                     /db_xref="GeneID:8199596"
                     /db_xref="GOA:C4R4N1"
                     /db_xref="InterPro:IPR019165"
                     /db_xref="UniProtKB/TrEMBL:C4R4N1"
                     /translation="MPEPNDEPPSGFNWWRRTLSYKTGLGLTQEEKVKYENDLKLKKS
                     KDDCAKCYEYRDWMLRYSPTVKFLMDQISQAGGQISAKDIVCDECDDLKGGGFHPEIG
                     ILICQNRLIDKWHLEDIVSHELIHAYDNTKFKVDWFNLRHHACSEIRASSLSGECRIM
                     QQFWRSSISRFNSGHQDCVRRRAVLSLQANPNCKDKEQAESIVDEVFESCFNDTRPFE
                     MIYR"
     gene            <900140..>902333
                     /locus_tag="PAS_chr3_0469"
                     /db_xref="GeneID:8199597"
     mRNA            join(<900140..900209,900259..>902333)
                     /locus_tag="PAS_chr3_0469"
                     /product="Signal transducing MEK kinase"
                     /transcript_id="XM_002492652.1"
                     /db_xref="GeneID:8199597"
     CDS             join(900140..900209,900259..902333)
                     /locus_tag="PAS_chr3_0469"
                     /codon_start=1
                     /product="Signal transducing MEK kinase"
                     /protein_id="XP_002492697.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0469"
                     /db_xref="EnsemblGenomes-Tr:CAY70518"
                     /db_xref="GeneID:8199597"
                     /db_xref="GOA:C4R4N2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR029458"
                     /db_xref="UniProtKB/TrEMBL:C4R4N2"
                     /translation="MEQLNLSSWLNELQCSAYLDRFEENGITTDLLCDLDKGALIDLG
                     IDKVGPRIRLENEIQRLRLKRLRTILPLERLSEIILPDYASETSLSEKDALGNQVSPL
                     SPTKQLVQKSPRNQLRRSHSSLKSTTDEKSSKSLATFINLDGSKKQIDIRGCFNAMSI
                     KRKALKGLDLKMDPDLCAAYFVNDDEELHLMYDIELVTVCHSADRVERNRIILCKKTE
                     SPTLAAIETSTAAMKLARNSDKGLAQENDNSVIKESTEGKPSLNNFFGQRPPSELIST
                     NLAEYFPDTKVNKLQETVRNSVRNSMRISRLMSSQFSNASIFSDHSGNHSRLSSSLSR
                     YAMSNIAGDRASIISSSTRKTIGKVLADRITKEDGDTVEPEYNEHTVRSNHEANSSNE
                     LSDSVHERHNEFNEGDSSIIELFEECDDDDTGDDEYMLKQLSIEEERGPQSWLKGARI
                     GAGSFGTVFLGINSFTGELMAVKQVELPTARSVNDAHGQNMLESLKQEISLLRELDHE
                     NVVRCIGSSIDDEFLNVFLEYIPGGSVSSMLNNYGPFEEPLIRNFVKQVLSGLAYLHE
                     KQIIHRDIKGANVLIDTKGTVKISDFGISKRMSDLKPSSKRASLQGSVYWMAPEVVKQ
                     TVYTNKADIWSVGCLIIEMFTGKHPFPDFSQMQAIFKIGMQTRPEIPPTASDLARSFL
                     ESCLESDYTKRSSATDLSHHEFVKTALLDRHN"
     gene            complement(<902330..>903103)
                     /locus_tag="PAS_chr3_0470"
                     /db_xref="GeneID:8199598"
     mRNA            complement(<902330..>903103)
                     /locus_tag="PAS_chr3_0470"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492653.1"
                     /db_xref="GeneID:8199598"
     CDS             complement(902330..903103)
                     /locus_tag="PAS_chr3_0470"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492698.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0470"
                     /db_xref="EnsemblGenomes-Tr:CAY70519"
                     /db_xref="GeneID:8199598"
                     /db_xref="InterPro:IPR019410"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R4N3"
                     /translation="MSLSDFTLIGKDDVYDHVYLLYSDSKLNNDLGYYPSKADKFVIP
                     IGDLDIEVEQSKSGVYSRHGTGTTGFYLWNVSPLFAEWMLYHKHPLSDMFNGCGVVVE
                     LGSGVVGVLASTLSTRCELFVATDQKHVLKLLAKNIENNRQPKANTKIVEFDWENIEF
                     GVSNLESTLERRQVDFVLAFDTIYNSFLLDHFIAATKTICNSETIVVVGIQLRDEDVL
                     SEFLEKMLDKSFQCYHVDQEWLSSDLKNGYSIYCFKLCS"
     gene            <903300..>904370
                     /locus_tag="PAS_chr3_0471"
                     /db_xref="GeneID:8199599"
     mRNA            <903300..>904370
                     /locus_tag="PAS_chr3_0471"
                     /product="Aspartic beta semi-aldehyde dehydrogenase"
                     /transcript_id="XM_002492654.1"
                     /db_xref="GeneID:8199599"
     CDS             903300..904370
                     /locus_tag="PAS_chr3_0471"
                     /codon_start=1
                     /product="Aspartic beta semi-aldehyde dehydrogenase"
                     /protein_id="XP_002492699.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0471"
                     /db_xref="EnsemblGenomes-Tr:CAY70520"
                     /db_xref="GeneID:8199599"
                     /db_xref="GOA:C4R4N4"
                     /db_xref="InterPro:IPR000319"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR005676"
                     /db_xref="InterPro:IPR012080"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R4N4"
                     /translation="MKKAGVLGATGSVGQRFILLLSDHPEFELSVLGASSRSAGKRYE
                     DAVVWKQTDLLPESARNIIVQECKAEAFKDCDIIFSGLDADYAGEIEKEFVSSGLAVV
                     SNAKNYRREADVPLIVPIVNPEHLEIVEQKVKSGQKGFQICISNCSTAGLVAPLKPLV
                     EKFGPIDLLTTTTLQAISGAGFSPGVPGIDILDNIVPFISGEEEKMEWETRKILGGLS
                     EDKMECRLVSEDAMKVSAQCNRVPVIDGHTECISLRFERRPPPSVEAVKQCLRDYVCE
                     ASKLGCPSAPKNTIHVLEQNDRPQPRLDRVRDNGFGVSVGRIREDPVLDFKMVVLSHN
                     TIIGAAGSGVLIGEILLKKGLI"
     gene            complement(<904425..>905099)
                     /locus_tag="PAS_chr3_0472"
                     /db_xref="GeneID:8199600"
     mRNA            complement(<904425..>905099)
                     /locus_tag="PAS_chr3_0472"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492655.1"
                     /db_xref="GeneID:8199600"
     CDS             complement(904425..905099)
                     /locus_tag="PAS_chr3_0472"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492700.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0472"
                     /db_xref="EnsemblGenomes-Tr:CAY70521"
                     /db_xref="GeneID:8199600"
                     /db_xref="InterPro:IPR013239"
                     /db_xref="UniProtKB/TrEMBL:C4R4N5"
                     /translation="MSLQSIGRNMAVSHPVSINVTGQQPLETENVQELLDEFIAKADE
                     ETAQELNFMALNDGTTATATNNNAAKISQLKRLQRELRGLPPLLDAPTFGEKPRKAGF
                     EGATADTGKIEAGVKLNKKIKFDDEPVTVEPVINTVTNSQKHVIEEEEEEVLKEVETD
                     EQPKPEASDSESEEQERKRRKKEKKEKKDKKEKKEKKEKKDKKEKKEKKDKKEKRKEK
                     KQESKV"
     gene            <905336..>905698
                     /locus_tag="PAS_chr3_0473"
                     /db_xref="GeneID:8199601"
     mRNA            <905336..>905698
                     /locus_tag="PAS_chr3_0473"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492656.1"
                     /db_xref="GeneID:8199601"
     CDS             905336..905698
                     /locus_tag="PAS_chr3_0473"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492701.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0473"
                     /db_xref="EnsemblGenomes-Tr:CAY70522"
                     /db_xref="GeneID:8199601"
                     /db_xref="GOA:C4R4N6"
                     /db_xref="InterPro:IPR000271"
                     /db_xref="UniProtKB/TrEMBL:C4R4N6"
                     /translation="MLRVVNQKMASNVASGMYRANGNMFRTLGQIMQRPQLANPTNIQ
                     SQSLVQEVSPLSFINNFVGSFSQRRWGTRGGNRGNTYQPSTLKRKRRLGFLARMRSIS
                     GRKVIRRRQLKGRWYLSH"
     gene            <905867..>906688
                     /locus_tag="PAS_chr3_0474"
                     /db_xref="GeneID:8199602"
     mRNA            <905867..>906688
                     /locus_tag="PAS_chr3_0474"
                     /product="mitochondrial 54S ribosomal protein MRPL1"
                     /transcript_id="XM_002492657.1"
                     /db_xref="GeneID:8199602"
     CDS             905867..906688
                     /locus_tag="PAS_chr3_0474"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein MRPL1"
                     /protein_id="XP_002492702.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0474"
                     /db_xref="EnsemblGenomes-Tr:CAY70523"
                     /db_xref="GeneID:8199602"
                     /db_xref="GOA:C4R4N7"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023673"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:C4R4N7"
                     /translation="MSLARSIPGRGFVAVSSYCRLFSTTGLAYAPKKQASQDNSKKKE
                     AKRMALLRLQAKQPANKSPLYMTIPEALRYLRAAEVGFPINEAVISICSVIVNDKGAP
                     PINGSVKLPRPLKETKLAVFSDDPALQEEATKFGASLVGGSELIEDIKNGKVQLDFDK
                     AFATPDIVPSLNQIARILGPRGLMPNAKRGTVITDVQKAVVESHGSLPFRQRNNLLSL
                     PVARTNFTDEETLENIIEANAAIKESISRIRTKKPILFGETTITSTHGPGIVIDF"
     gene            <906864..>908342
                     /locus_tag="PAS_chr3_0475"
                     /db_xref="GeneID:8199603"
     mRNA            <906864..>908342
                     /locus_tag="PAS_chr3_0475"
                     /product="Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex"
                     /transcript_id="XM_002492658.1"
                     /db_xref="GeneID:8199603"
     CDS             906864..908342
                     /locus_tag="PAS_chr3_0475"
                     /codon_start=1
                     /product="Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex"
                     /protein_id="XP_002492703.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0475"
                     /db_xref="EnsemblGenomes-Tr:CAY70524"
                     /db_xref="GeneID:8199603"
                     /db_xref="GOA:C4R4N8"
                     /db_xref="InterPro:IPR019540"
                     /db_xref="UniProtKB/TrEMBL:C4R4N8"
                     /translation="MSESKSEILPPEPEEERSLRTLIFISVFSVIVLLGVPLWFLTTS
                     LYRAELPVEEINNLSSTLKSQIHYDIPFYIELPKPMRYLVLETQELLDSKLAQLSSEH
                     PFDVDYHVSLISGPKKSDLDYQIELVNSEDPNGEGLFISPYERRIVIRNSENVVVNKL
                     VPDFISRVILDEVLKYEISVHQGLLTTNSGFEIPFKDKLKLTFNLFKGDGLPIDWDTS
                     SLERYLDGALENFRTYLDLRVETQVIYFASLNINKDNLIIEDGQYLLTERNLSSFINY
                     SDWGLEDSTTTDPTLNFIIYIPSEDTRPLKVQNSEHNSFLIAQYGGVLILNDIVDNQL
                     SETDLMPILDIFTSQLYKLIGVPEHIESLTPKSPQIRVDIMMRLKIIENLQLAVDNLK
                     SLITLSKRLSTINIPDFTIEHVNSAIENINQSIDKLNSREFVDSLKLSNEAIEESDRA
                     FFSENMVQQAYFPDEHKMAVYLPLIGPIVMITCLMFLRVMKK"
     gene            complement(<908374..>910074)
                     /locus_tag="PAS_chr3_0476"
                     /db_xref="GeneID:8199604"
     mRNA            complement(<908374..>910074)
                     /locus_tag="PAS_chr3_0476"
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /transcript_id="XM_002492659.1"
                     /db_xref="GeneID:8199604"
     CDS             complement(908374..910074)
                     /locus_tag="PAS_chr3_0476"
                     /codon_start=1
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /protein_id="XP_002492704.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0476"
                     /db_xref="EnsemblGenomes-Tr:CAY70525"
                     /db_xref="GeneID:8199604"
                     /db_xref="GOA:C4R4N9"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="UniProtKB/TrEMBL:C4R4N9"
                     /translation="MFKKDPDLKPLSNLKNSDRKKLFAKVVEDYKVSNVPIDYLFPSD
                     SKQGNFKSPLKISGTIYTDAESTPTWFKTKDSNVLPSIMTLWRYPSLIPIVLTNDMVI
                     GKLINGADLMLPGCIPPFDSRCVKGSIVGVASYKQPNVVYAVGECLLGLSDVEETVGK
                     SGVAVRVYHHFEDHLCQLAKITLKPPKEEEALETILQFQDVTSEQPVEEDGLHNNAEA
                     LNSEVQDETIEHEASDSNELAEVLTELTVEDVDMFFERALLQTITQDKISLPISASNF
                     MNHILKNMPPIDSSLVTMKKTSWKKTSKYLKAMQKLKLLDLKGKGEDLTIISVASSDN
                     EKVRKFVPYTVKSVNSSKQSQNKPSKDKLTILFYYKPNSCTRSFFNDNDKVTNVLYSQ
                     QELKNILNEYIRSKDLVREKNKIFLNPPLQEIVKLKEGRTIARDKIFSEFLKGFTINH
                     KIIPINTPDEEVESIKIKKGNVPKVEIVTEMRIGRKVVTRISNFEVYHIKAQELANEL
                     RVKCSGSTTIGENIQSKSTEVTVQGPHEKIVQELLAAKGLSPAWFNVTNKLKAKKKRT
                     "
     gene            <910242..>912089
                     /locus_tag="PAS_chr3_0477"
                     /db_xref="GeneID:8199605"
     mRNA            <910242..>912089
                     /locus_tag="PAS_chr3_0477"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492660.1"
                     /db_xref="GeneID:8199605"
     CDS             910242..912089
                     /locus_tag="PAS_chr3_0477"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492705.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0477"
                     /db_xref="EnsemblGenomes-Tr:CAY70526"
                     /db_xref="GeneID:8199605"
                     /db_xref="GOA:C4R4P0"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024789"
                     /db_xref="InterPro:IPR024790"
                     /db_xref="InterPro:IPR024977"
                     /db_xref="UniProtKB/TrEMBL:C4R4P0"
                     /translation="MEEIYQKPLPLSAPEENYQWCPTIYLISGISANRLQLSVFRVNS
                     QKVWSVSLKSEIICQCWRPDGKIIAVSLKDGSIRLYDGNMGTLMYVIESANNTGGPTA
                     SFLSWPNVKQIKSQSSEDSEPTLQEKLEKFFDFNLAKGLPKLTPLNNTDTVFMNKSLQ
                     DEDKYLTQDNTLNYLLTNYNNVISLSLLGFFQIASLVKFDSNDVILHHFESDDLSTLY
                     FLYNRDGSTLLKQISLNFLKQRDIVNLGLSYSKINSLIEYVNQVLKQLHHETKPYLDF
                     NHKLLDLLKEEIISSEGDETGISLLYGLLLTGIMHPCLKTWITDYLGDKNIRRWIKLA
                     VNCYEGNKKSLFSHLLPCLERIIVMLDELKGSTTPLTKQQLQKLLSGCTDLLQKTYLF
                     IWKINHEQRLFKYFIEWLDYVLLEYTTDDTPDMEIKTKEVTEFLTNHLTSSVMHAFLD
                     DLSSLQNTIRIDMNTITASFVEELKVKTDSKDFPLSITLPSSTLYSTNDSETHNNLKT
                     IVLTNTPDALELISINLITADVQHRHFSFPMSVISYMHYSENSTFILASDGQATEFLK
                     LTSIESSPIQLSRFSGDEFIPTSFKMTHKNEAGFLIDSNRKKYLYFKLK"
     gene            complement(<912099..>913067)
                     /locus_tag="PAS_chr3_0478"
                     /db_xref="GeneID:8199606"
     mRNA            complement(<912099..>913067)
                     /locus_tag="PAS_chr3_0478"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492661.1"
                     /db_xref="GeneID:8199606"
     CDS             complement(912099..913067)
                     /locus_tag="PAS_chr3_0478"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492706.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0478"
                     /db_xref="EnsemblGenomes-Tr:CAY70527"
                     /db_xref="GeneID:8199606"
                     /db_xref="UniProtKB/TrEMBL:C4R4P1"
                     /translation="MKEQLEKLASNFQKSCLDARTIEYSCQFFHKKFKKCQNPEKTAR
                     REYLQKALTYYNAQLSQMNETKHIPQELFNDIYSIAYFQNRPIAERCPRWWRQFMYAT
                     DEPLQRLYINSLFKIEHRIYKDFKDIDDKETLREYDAYFDKQHNSPPVSILESFKDLY
                     NSSDQESTNCKNLLDGSLLQAFYKENGIEDLQVAFDEETNQNVRKLSLFTQSPLFKDK
                     LYYKRTNPPSMKIEFPGTVFGLPIALKRQNVKKRKKLQELRRFMLNVEPVAIDDLDYL
                     DKSIDMDIDAKIKRKIQVWVRNKYALDEEGQFIRSRFCNRPADNVI"
     gene            <913094..>913837
                     /locus_tag="PAS_chr3_0479"
                     /db_xref="GeneID:8199607"
     mRNA            <913094..>913837
                     /locus_tag="PAS_chr3_0479"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492662.1"
                     /db_xref="GeneID:8199607"
     CDS             913094..913837
                     /locus_tag="PAS_chr3_0479"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492707.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0479"
                     /db_xref="EnsemblGenomes-Tr:CAY70528"
                     /db_xref="GeneID:8199607"
                     /db_xref="UniProtKB/TrEMBL:C4R4P2"
                     /translation="MYEMRSGKNAHYINTKTRKGKMRLSRVCVPVCKQDGILYSPQSL
                     SMPLTTTVYQDKENKLDNAKQSLTSRQSLGKQVKPDSQARPRTILGSTNVNSKQILDK
                     RNLIHPKQLTVLNENNLESQDEIEIVPTLDEPNLSDREADSETESEGITYSEPTTFRI
                     EKFQDLKPYTDSLYSQDYKHIPKLDSRELKKEEEDFLLQLDEQIEEDHQKNKEKLLPF
                     PLHSQNDSDLNIYGDLNVSNQELERMIFL"
     gene            complement(<913879..>915109)
                     /locus_tag="PAS_chr3_0480"
                     /db_xref="GeneID:8199608"
     mRNA            complement(join(<913879..914740,914802..>915109))
                     /locus_tag="PAS_chr3_0480"
                     /product="Putative chaperone, homolog of E. coli DnaJ,
                     closely related to Ydj1p"
                     /transcript_id="XM_002492663.1"
                     /db_xref="GeneID:8199608"
     CDS             complement(join(913879..914740,914802..915109))
                     /locus_tag="PAS_chr3_0480"
                     /codon_start=1
                     /product="Putative chaperone, homolog of E. coli DnaJ,
                     closely related to Ydj1p"
                     /protein_id="XP_002492708.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0480"
                     /db_xref="EnsemblGenomes-Tr:CAY70529"
                     /db_xref="GeneID:8199608"
                     /db_xref="GOA:C4R4P3"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C4R4P3"
                     /translation="MSSLYEILGVDPSATQEDIKRAYRKLALKHHPDKVEESVRVESE
                     ALFKEISTAYEILSDEVKRSQYDIYGDTDGVPNRNGPGSGGVPGFGFDFDDANPYGAD
                     EKTPDAVMEMEISLHDLYKGKVIKVSSTRSTICSKCSGSRLRKNADSNSMMKCMFCHG
                     SGMKRAMRPVQNGWAIEEYIDCSHCDGSGLRIQSKFKCKKCSGSGCVEESKILEFNIP
                     RGAASEGEIILEGESDEKPNYKPGNVILKYTTKAHEYLERKGNDLYTTWKLPLCDCLT
                     GFDYKPSIKTLDGRFLMVNSPTGKVITPTTVLKVPNEGMPILDQGRNWLFKQNPKGDL
                     YIKIEIEFPKDNWFIERNEITKLRLLLSHDSSFPKTEISEGDLNNAIYAANIEFQ"
     gene            <915864..>917396
                     /locus_tag="PAS_chr3_0482"
                     /db_xref="GeneID:8199609"
     mRNA            <915864..>917396
                     /locus_tag="PAS_chr3_0482"
                     /product="Putative alanine transaminase (glutamic pyruvic
                     transaminase)"
                     /transcript_id="XM_002492664.1"
                     /db_xref="GeneID:8199609"
     CDS             915864..917396
                     /locus_tag="PAS_chr3_0482"
                     /codon_start=1
                     /product="Putative alanine transaminase (glutamic pyruvic
                     transaminase)"
                     /protein_id="XP_002492709.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0482"
                     /db_xref="EnsemblGenomes-Tr:CAY70530"
                     /db_xref="GeneID:8199609"
                     /db_xref="GOA:C4R4P4"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R4P4"
                     /translation="MRVNKFIRPCRHMSSTTVVSLGLKIKPDFQPAPKLTVTDLNPHT
                     VNAKYAVRGKIPTKAELLRNQLNDVDHKLPFTKIISANIGNPQQLDQKPLTFYRQILA
                     LLQYPPLLDDPRVASIFPKDIIERARSLLKQIGSVGAYSQSQGVPSIRQSIADFISRR
                     DGHPCARKELIYLTTGASTAVTYLLTLLGQNEKTGFLIPIPQYPLYTATLTLNNRTAL
                     PYYLNEEDNWSIECDEIESIILDSKAKGIDPRCLIVINPGNPTGAILSYEAIEDILNV
                     CAKYGLVVIADEVYQENIFDGKFISVRKVLLDLLQGPKADLYKNIQLASLHSTSKGIS
                     GECGQRGGYMELIGFDESVLEQITKLSSISLCPVVTGQALVELMINPPKEGDESYKLY
                     YDETRAIHDSLAERATKLYDAFNSMEGVVCRKPQGAMYCFPKITIPEKAIKTAKELDF
                     EPDEFYCNELLETTGICAVPGSGFGQKPGTYHIRTTFLAPGSEWINDWVVFHKKFMQK
                     YK"
     gene            <917546..>918301
                     /locus_tag="PAS_chr3_1193"
                     /db_xref="GeneID:8199610"
     mRNA            <917546..>918301
                     /locus_tag="PAS_chr3_1193"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492665.1"
                     /db_xref="GeneID:8199610"
     CDS             917546..918301
                     /locus_tag="PAS_chr3_1193"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492710.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1193"
                     /db_xref="EnsemblGenomes-Tr:CAY70531"
                     /db_xref="GeneID:8199610"
                     /db_xref="UniProtKB/TrEMBL:C4R4P5"
                     /translation="MSGLVSKWATEDSLAEKARVDDTLRRTKSKNVKQSGKLSKDQGL
                     QSASDTPKKAKTFTKNEPLVSRWANVKDPALEEKSSKKVAQHESSGDFSKVSHAHNKD
                     SKRQPKREHHRSEAKKEPPSAPPVDLKTNSLAQRLGQVSLEPDNHKKEYVHAPRENNG
                     SKSSEGLKSNELAQRLGLVTAPKKKSPKKKTGGYKPPHKRDNKLEKQSESKAQEQEQD
                     FALDETKRQELLELMEQYTSTQIDWADDFDDEL"
     gene            complement(<918357..>919766)
                     /locus_tag="PAS_chr3_0483"
                     /db_xref="GeneID:8200225"
     mRNA            complement(<918357..>919766)
                     /locus_tag="PAS_chr3_0483"
                     /product="Conserved phosphoesterase domain-containing
                     protein"
                     /transcript_id="XM_002492666.1"
                     /db_xref="GeneID:8200225"
     CDS             complement(918357..919766)
                     /locus_tag="PAS_chr3_0483"
                     /codon_start=1
                     /product="Conserved phosphoesterase domain-containing
                     protein"
                     /protein_id="XP_002492711.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0483"
                     /db_xref="EnsemblGenomes-Tr:CAY70532"
                     /db_xref="GeneID:8200225"
                     /db_xref="GOA:C4R4P6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R4P6"
                     /translation="MLSNRRFIKQLANWVTAITILINIYLYTYPSFNSERCSWSTTEV
                     RTGSLTNWEGLVLQIPYFGDIFQQYFLDESKLEDNSDDIKILALGDPQINGNWPNTPY
                     IKRLDNFGNDYYLGHIYRTMKRRLLPSHVAVMGDLFSSQWISDSEYYNRTRRYMTRLF
                     PQPEQHTLDAMNFVDKHEDVDWRSFYGWMNGNLNDGSFLREEEYAYYDIYDWTEPRIK
                     GEPLFINITGNHDVGYGDTTYQHLARYRKLFGKDNYFIEYDNDTDHPWRIVVLNSLAL
                     DGPLLQPEFQKYTWQFVEMLSKQNYPGQTILMTHIPFYKREGLCIDGPFVEYFTEENA
                     LEDYRIGLLKSENHLQYETSQKVLNAVFQSGKPGIVLTGHDHEGCENFYSKDENNVWV
                     ADKTVKNKNFYIKEATVRAMMGDFDGHAGIMTGHLNKSTGLWEWDYSTCPFSVQHVWW
                     VGQVGIALSILLQSIGFLI"
     gene            complement(<919911..>922289)
                     /locus_tag="PAS_chr3_0484"
                     /db_xref="GeneID:8199611"
     mRNA            complement(<919911..>922289)
                     /locus_tag="PAS_chr3_0484"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492667.1"
                     /db_xref="GeneID:8199611"
     CDS             complement(919911..922289)
                     /locus_tag="PAS_chr3_0484"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492712.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0484"
                     /db_xref="EnsemblGenomes-Tr:CAY70533"
                     /db_xref="GeneID:8199611"
                     /db_xref="GOA:C4R4P7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R4P7"
                     /translation="MSSTHVFNPNEDVNTAKQKKRKRATGHFECTYPNCSKTFTRSDH
                     LSRHRLNHNPTRRYVCSWEGCDKSFARSDVRDKHFQRHQQRNVLPSPTTPVSEKDGSS
                     RTMVKDGSNKDIFRWLLNTDYAVQDFLPGKVIEPLDSFFYFDVDRSPDSDIQDLLIGS
                     KGTDIVRQPVVMEQPDAAGKSQEKGLHSSYVPESGQKVSSDGKNNFNNSNGDPTLIDQ
                     TYFDDVLRDKLIQLVPGLQYHADFEPVVIRYCLNVFWTVFHPQYPFIHRPTFKSAEAH
                     PLLLLSIIMVGLGFVNKNPDHRIDSISITDSYSLGNIIAHPLRWLICSSHEFTTPPEL
                     WIIQSLILLEIYEINFSNRKLHERAYLHHGLKTQLLRRSPLLGGDPLKNKQDDDESNT
                     TNAQKWLKRESMKRAAFMCFHLDTTHGAIFGHEMILNSHQIKFSLPCNENLWNQTLSG
                     SEKIKPAMNFLDVLKLLLKQQDPPSTLVETFDFSSNHLNENLKLSGLISVLFQLEEKD
                     MELKLLEWESMKASWRDTLTLALDWWKDHLLSQKLSTFSNLSGNYCTGTSLLCEFPVY
                     FILQTFMKMKQYDFIIFTGAPTRMNVRVGMSDYTIVEKRIRSWSKSSAGSFSVVFLYL
                     FLIDLLLVSDAEKQDLEFTYDPNTDPILYRPNLVALSLMILWSYNFIQEGPESTVMAN
                     LKEGMDDLPMNDKDIPYQECGRDYLKRIRNELMVDENQLKLSSDLNTIKLYSKIITGM
                     THKNRMVGLLKFFKKGFLNCTSTICREYGRLLENCISRSLGRRRILCNNMNQ"
     gene            <922552..>923895
                     /locus_tag="PAS_chr3_0485"
                     /db_xref="GeneID:8199612"
     mRNA            <922552..>923895
                     /locus_tag="PAS_chr3_0485"
                     /product="Cytoplasmic protein required for cytoplasm to
                     vacuole targeting of proteins"
                     /transcript_id="XM_002492668.1"
                     /db_xref="GeneID:8199612"
     CDS             922552..923895
                     /locus_tag="PAS_chr3_0485"
                     /codon_start=1
                     /product="Cytoplasmic protein required for cytoplasm to
                     vacuole targeting of proteins"
                     /protein_id="XP_002492713.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0485"
                     /db_xref="EnsemblGenomes-Tr:CAY70534"
                     /db_xref="GeneID:8199612"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:C4R4P8"
                     /translation="MRKRSSSKSTSNYQPIRRDPPELTTKLHVVKLVPLNKSFELVKV
                     LVVPDYPKELELGRQAGSRAGTSLTNAYFASRTLSRSHASLFVKEGKLYVRDLKSSNG
                     TFINDVRLEHKKEYLLNVGDELTLGSTLESQPLHKKIQVKVEKFLTMNLQEYEDLVQG
                     LVIDNDERKAELFNDTLDALLFSDALDSEDKILDALVAGDPNLDSLEVEPTVPTPGVS
                     PSPNLKGITRLEDVTRRLIISINNENIQHQKLLAMGHFLDEYLNHEFSNGKSSSKETK
                     QSGVSQEDHDRLFKEMEKLALENELLKSQITSKDEEEDYDISSEEEMDDRRRLEKEIV
                     ESINSITNSKQNGKVATALTNLLEDVKGENVKDDAVVLAANESASERIHDEVEDSRHS
                     QHEPYKDCSIQTDSFNTVTPKDTVKNGNRNYLTIPILIAVIILLLAYNLRNNSSL"
     gene            complement(<923950..>925356)
                     /locus_tag="PAS_chr3_0486"
                     /db_xref="GeneID:8199994"
     mRNA            complement(<923950..>925356)
                     /locus_tag="PAS_chr3_0486"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492669.1"
                     /db_xref="GeneID:8199994"
     CDS             complement(923950..925356)
                     /locus_tag="PAS_chr3_0486"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492714.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0486"
                     /db_xref="EnsemblGenomes-Tr:CAY70535"
                     /db_xref="GeneID:8199994"
                     /db_xref="InterPro:IPR006970"
                     /db_xref="UniProtKB/TrEMBL:C4R4P9"
                     /translation="MFSIKNIAVALSTLAAVQAVALPSYEVALEHAARGLVPRAFAEA
                     LNPALEKRADFMCHAACGLAIYGAWECGPEEGPFDEECLCAADSSFSTQIDACLECGW
                     CIYQSYFGNLAGALDACGLPITPTGSTCIETATGLTPTLGPFTDYTPTHPNNVPTSSE
                     EETSEEPTEEPTTEETSEEPTEEPTTEETTEEPTEEPTEDETTEETTEEPTEEPTEEP
                     TEDSTEEPTEDSTEEPTIAPTGEPTEEPTEDETTEETTEEPTEEPTTEETSEEPTEEP
                     TTEETTEEPTEEPTGDDDTTEEPTIAPTGVPTEDPSSQYYGNTTTVHSTIRETSIIEY
                     TTCVTDVHGQTTTVTVPCHGKCTASPSVHSTDLTKTYTTTKAIVSGKTVTVTVECETT
                     TPKVSTTHSTTPVPGTTTHSTTPVPGTTTHATTPVVSSVSSTHAISSVTIQTHSGAAN
                     KLSIAGAAIVGYAGLMLL"
     gene            <926526..>930008
                     /locus_tag="PAS_chr3_0488"
                     /db_xref="GeneID:8199858"
     mRNA            <926526..>930008
                     /locus_tag="PAS_chr3_0488"
                     /product="Bud-specific protein with a potential role in
                     membrane trafficking"
                     /transcript_id="XM_002492670.1"
                     /db_xref="GeneID:8199858"
     CDS             926526..930008
                     /locus_tag="PAS_chr3_0488"
                     /codon_start=1
                     /product="Bud-specific protein with a potential role in
                     membrane trafficking"
                     /protein_id="XP_002492715.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0488"
                     /db_xref="EnsemblGenomes-Tr:CAY70536"
                     /db_xref="GeneID:8199858"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q0"
                     /translation="MKKRQQKREVHNTSFTGWREVAGWEPKDTLTADDELMDLLTKQT
                     FLENSLPEIAYGDWYHNFAALVLGATLCWIVGRFKLSLALVFFIVLPLALYYRTSIRK
                     FRGFLRRELQREFVVRNMENDYETMNWLNVFLDKYWIFLEPGVSKMVCEQVNPILANS
                     PAPAFIKQLWLGAFTAGTKPPRIDMCKTLAGTNDDVSVMDWGVSFTPNTLADATVKQM
                     RNRINQKVIVKLKLYGLTLPIVVSDISFRVLLRVRLRMMTQFPHVRTVNLSLVNPPEF
                     DFSCRIFGGDSILSFEILSIPGLKFLIDDMIKKYIGRMLFDPLSFQLNVPMLLAGEAF
                     GSPSGIIEINVKKATHIKAVDTSGGNTVDPYVIFSFGGKEIARTSTIEDTREPIWNET
                     IRFLVSDFSEPLHLDMYDFNDFRKDQLVGNILYDLGAFMDEDELSDLELPILRNNKRV
                     GTLHLDMKYMPIIHGSTLPDGSFDPPPELNSGITSLTVVGARGFNESDKVISVTAEVY
                     LNKELINKTGAQKSNDPKWNSLVHHMIDNRADSYIDILLRDGKKNVIGALHRRLIDVV
                     DSSIVGYSWFPLNEGGEVELKASWGPVELPGGEKADSYVEPIGVARIFVDSCTGLPNL
                     ERIGVIDPYVRILVNNFQRCRTLVQNSTVNPVFKEVLYVTVASPNQKITIEAMDVEKN
                     GRDRTLGAVALNLAEFVGKNDEGKYIESRSDETKEARLISSKGVKGTIKYSIDFFPTI
                     PVVSQNELNKKAAREKEKEEQKKKLEEESEGKAEELKKAEKEKAKTLALLEELEKEQE
                     EHKLNLSFDELIKYQQGVFVYDIISGDFGHESGYLQVYFDQNGYSQFTTRKIRKGGKH
                     RLGVNGDYLVKELEYSQTVIRYVKDFSANRLKNSMAEISLPTIQLLQRSYDKPYLLKL
                     PGQSGTISIYLQCSWIPVLMSQLPSQDSIGNSGQLSVTVLKGKDLPSADRNGKSDPFC
                     ELYLNDNQVYKTKKIKRTLNPEWNESFEVEIGNRCGSILNIDCIDWDVASHNDKLGSG
                     HVSLADIDPMSPTELTVPLKDDDGLEAGEVYLRFVFRPKFVILLRPETTAFSLEAGER
                     VLEAGVGAGGKVIGAGVGAGGKVLGAGVGAGGKVLGAGVGAGGKVLGAGVGTGGKVVG
                     RGASLLRGLRGSEK"
     gene            <930166..>931545
                     /locus_tag="PAS_chr3_1194"
                     /db_xref="GeneID:8199859"
     mRNA            <930166..>931545
                     /locus_tag="PAS_chr3_1194"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492671.1"
                     /db_xref="GeneID:8199859"
     CDS             930166..931545
                     /locus_tag="PAS_chr3_1194"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492716.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1194"
                     /db_xref="EnsemblGenomes-Tr:CAY70537"
                     /db_xref="GeneID:8199859"
                     /db_xref="GOA:C4R4Q1"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR010111"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q1"
                     /translation="MSYSAKDIEVLDKRFPSLKDEFHIPTFKSLGITPPESKSENDDS
                     IYLCGNSLGLMPKATESAIFEELAVWKGKGVEGHFQHPKTPWLDIDLPVVPLIAPIVG
                     AKENEVAVMGTLTMNLNSLLCSFYQPKGRKRKILFEKHAFPSDFYAFLNQAYLKDLSE
                     DDLLQLEPRTGEYTLRTEDIIKVIEDQHEEIALMCFPGIQYYTGQYFKMKEITKAAHE
                     KEIIVGWDLAHAVGNVDVRLHDWDVDFACWCSYKYLNSGPGGIAGVFINERWTDQKFH
                     SKSSPLNYFPRLAGWWGNNASARFSMKEVFDPIPSALGFRQSNPSVVDVVALHSSLKI
                     IHKFGGIKAIREKSIEMTKLMEVLLKRSPHYVKPTELLSRGFTIITPHTSLERGSQIS
                     LLFADGWMPIVFEQLHSLGVICDERKPDVIRLAPVALYNSFQDVISAMEKLKASLDVA
                     SNAVMTVIT"
     gene            <931826..>934387
                     /locus_tag="PAS_chr3_0489"
                     /db_xref="GeneID:8200226"
     mRNA            <931826..>934387
                     /locus_tag="PAS_chr3_0489"
                     /product="High affinity sulfate permease"
                     /transcript_id="XM_002492672.1"
                     /db_xref="GeneID:8200226"
     CDS             931826..934387
                     /locus_tag="PAS_chr3_0489"
                     /codon_start=1
                     /product="High affinity sulfate permease"
                     /protein_id="XP_002492717.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0489"
                     /db_xref="EnsemblGenomes-Tr:CAY70538"
                     /db_xref="GeneID:8200226"
                     /db_xref="GOA:C4R4Q2"
                     /db_xref="InterPro:IPR001902"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018045"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q2"
                     /translation="MSDSIYERGGELPLEPQHFKFANDESVKIAGYEDKQVGPLDVLH
                     EIVDSPWTRFKDYLISLFPILRWILHYNLKWFYSDLIAGVTVGCVMVPQSMSYAQLAG
                     LTPEFGLYSSFVGVLIYCFFATSKDVSIGPVAVMSLQVGKVVAHVQEKHGDLYPAHVI
                     ATAVAFICGVVALGIGLLRLGFLLEFISMPAVVGFMTGSALNIVAGQVPGLMGFNKLV
                     NTRDSTYKVIIETLKHLPDSTIDAAFGIIPLFILYLWKYVCDFGPKRYPSKQKWFFYT
                     SVMRNGVVIIFATLVSWGAYYDWTHNKYPGGAKKVPWSILGTVPSGLKHTGVMEMPNG
                     IFSAFASQIPVSVIILLLEHISISKSFGRVNDYKIVPDQEVIAIGVTNLLGTFFSAYP
                     ATGSFSRSALKAKCGVRTPLAGVYTGVVVLLALYALTEAFYFIPKASLSAVIIHAVGD
                     LMAHWRVTWDFYLIAPLDAAIFLICVLVSVFSTIENGIYFAMAASAVTLLWRNLRTHG
                     QFLGRIKVAEVIDPIVVSRSGRSEYSESSSSINEDTGSIEKKKIHIKFFSKDGQNSDI
                     ELQTKEYSKEYPSDQEFDPSNFDLSKLPKRTRFATRWVPIPKSKFPLSSSHTYANYIN
                     EEIEILPPPTGVIVYRPGEAFTYLNCSRHLDTLLDYMKSNTRRGETVVYKVKSDRPWN
                     DPGELTWNFNSVKNIFKRKKNIDSNEDEIEVVEDNRPILKLIHFDFASVTGVDVTSIQ
                     ALVDLRKAVSRYTGRDIEFHFSGIINPWIKKSLINAGFGKPFQPLKGSTIDNAVSSEH
                     RYYDIGTSYDEYDSTFSAETYDDAELQIGRHRYYAVNSTETPFIHLDIPSYDYLE"
     gene            complement(<934468..>937152)
                     /locus_tag="PAS_chr3_0490"
                     /db_xref="GeneID:8199860"
     mRNA            complement(<934468..>937152)
                     /locus_tag="PAS_chr3_0490"
                     /product="Zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type"
                     /transcript_id="XM_002492673.1"
                     /db_xref="GeneID:8199860"
     CDS             complement(934468..937152)
                     /locus_tag="PAS_chr3_0490"
                     /codon_start=1
                     /product="Zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type"
                     /protein_id="XP_002492718.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0490"
                     /db_xref="EnsemblGenomes-Tr:CAY70539"
                     /db_xref="GeneID:8199860"
                     /db_xref="GOA:C4R4Q3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q3"
                     /translation="MQVLATLHKTLLFSIVINESIDMVPTKKKRSFYGCWTCRSRKVK
                     CDNGRPSCQRCQKSNLNCLGYNIKLSWSTPYTVGKHGTLVPLSNYVLDKEDDSIQRRN
                     ISLVRFTSDSTYKNDKDLDLVLDELEQLPVYGNSPNKRGPFMVFQASTDHKVKTETNT
                     SIPNDSSKDLFSIRSLSSTNLVPYMTMDVVDVINQNRDFVLEAFDSNFVHQDAFTHAL
                     NTTLEDELELHHSAPASTFPERDRIVIHEQLKPSALVTFKGIKGDINSNPRDEQEVLD
                     CLFPNYYNSEANHSILEMSLSRNQELNNLDKTYKLFENLSHSHISSIREYSFPWLLST
                     QMFQKLITNFQSEKHFMMLLTFRGNVMDSVILPVLYRAIGQMSILTADIEHEFGRIIS
                     SEMFHKRMMRIMVLSALNISAFLLYRKSLFEQNFYGSDYLEIAIVLRRFIILELSNLI
                     KCLLVPSGVPFKDAKRKLQIKNGKLVNYLITNDLIKELIVVLVFFIKIDELFGIIDNF
                     TTLFDILDQLVDYLNNYKPSFYENADMLEKNINLKLIIMYYKFMQIFFFSTTNIDLFN
                     YEVKDKNFEDMLDENYNKISAATLNDSFNPDAFFNIDFLQEEVSVSEKQNKSFLSKSF
                     PARFNFAKGYSDSEEESNHNQTGSENRYYTKDNENSRVANSPTIKESLIHIPYPYNES
                     VYKYRDESIVSTLELTYGMPETLFQLFKKTVTLTNHHSFFKRRNLKHPRNFSKVASDL
                     ETELKSWTLPWILYESSDTISISFLSTFHRILFHMSMSYYNSILIYFYIFVQDFKASD
                     LSSLVQESLTHLEALVSLSVSSNVVKDFTVHVPFWPFFVCACGATLEADQARAVALMK
                     NFKTNERWIGKQLIHAVWEKHRQKFTDTNWVTMTKVGT"
     gene            <938969..>939356
                     /locus_tag="PAS_chr3_0492"
                     /db_xref="GeneID:8199861"
     mRNA            join(<938969..939053,939097..>939356)
                     /locus_tag="PAS_chr3_0492"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492674.1"
                     /db_xref="GeneID:8199861"
     CDS             join(938969..939053,939097..939356)
                     /locus_tag="PAS_chr3_0492"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492719.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0492"
                     /db_xref="EnsemblGenomes-Tr:CAY70540"
                     /db_xref="GeneID:8199861"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q4"
                     /translation="MLLRSTQKTLVSFLTSHDAVNDTKAGMQRCLRKFKPRSFDAKLT
                     TGVCLALKQITQSRKKRPACGMLRLLSVHTSGLVLEGYPRVECAPPQLAKRAVRHTKE
                     ENSGQVTCLKKV"
     gene            <940342..>942600
                     /locus_tag="PAS_chr3_0493"
                     /db_xref="GeneID:8199862"
     mRNA            <940342..>942600
                     /locus_tag="PAS_chr3_0493"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492675.1"
                     /db_xref="GeneID:8199862"
     CDS             940342..942600
                     /locus_tag="PAS_chr3_0493"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492720.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0493"
                     /db_xref="EnsemblGenomes-Tr:CAY70541"
                     /db_xref="GeneID:8199862"
                     /db_xref="GOA:C4R4Q5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q5"
                     /translation="MAHEKAGKEEKHSSTQKNTDLNLYEQSQQPSQPQQPFIRHQSIP
                     NFSQLQYPQQWQYQTYQPSPAFNPGHGQPTHMYESSSSHQSSQLENLPGGAIGGRPQI
                     TPLPPHSLPLQQQHPQPIVPGQAFGVPMYQQFPQNYVTQDTLQPKSSLSLMVNPPAAT
                     KSKQDPRAKVACIRCKKRKTKCTGGNPCKLCSISKVKCVYQTPGKRISILESHFRSLQ
                     DRIKFLENELHIAKDQRSDPSRFKAIDRALDSFTNERLYSMIGSLHFMFKEFVLSTDI
                     STLFEAVDNNVNAFQPNEGTEEKKDNELFFKSVLLCIVAISLIRDAKLSQHVSNSTII
                     NLSHEVVYENPEKLPGFVYIRDALSIVPLMCISSEQSQVVELLTLISYYFLCSGHNEI
                     AYKYSALGDKICTVAKLYINKDANQYRRKVFWNCYSFTRLLTITHLYELKPNLTQSFR
                     FSEIDIPQPMLSNSNSLEVSSSTISTMFRHRADLANISEQLINLFSRNPPQLSTSSKE
                     WMLNGYVREFIFEALLEQVPFLLDWTQDFQITSFPAFATTGQHYCVMILVHFFGPLLI
                     FGVGSLIKKSVWPNIESILILSLRLYPVLQDDSSSMLRCHDFFKFMIVIIVRTLQLHQ
                     YGYINLQKQLHLENYLLINLNQLREYDASSFAKTLDQLNLFSSRQKLSFVDRLPKPKN
                     KKYPLRMDYMDPSSMENSIESLFVGDKDQCLYKLRQSKPEFLSCYTNEWFDTDRIWAH
                     LVTEEQLTPHQS"
     gene            complement(<942872..>943639)
                     /locus_tag="PAS_chr3_0494"
                     /db_xref="GeneID:8199863"
     mRNA            complement(<942872..>943639)
                     /locus_tag="PAS_chr3_0494"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492676.1"
                     /db_xref="GeneID:8199863"
     CDS             complement(942872..943639)
                     /locus_tag="PAS_chr3_0494"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492721.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0494"
                     /db_xref="EnsemblGenomes-Tr:CAY70542"
                     /db_xref="GeneID:8199863"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q6"
                     /translation="MALTKKPVIKPIFISNLDQIEKVEKVEKTREQALNDIREKLKSN
                     KLKQEEKAREEKEKQATVMSWSPSPIVAKKSSSWGSQSSGSSGSGTESPAIRDFRRKQ
                     SRELFGDFKLNIPLKQSKSAQSIMVLNSDNSSNSSKRPSFNKGRSESVLQFTASNNKL
                     DSIWLHKMTTISRQHSVVSSLDGQDPNEEDDIMEDVEQFHVVSGTTTPLDIPSSCHHS
                     PGDSEYLDDADFVAVSPKSQPPSMSDLADYYNQNQFL"
     gene            <944090..>946534
                     /locus_tag="PAS_chr3_0495"
                     /db_xref="GeneID:8199864"
     mRNA            <944090..>946534
                     /locus_tag="PAS_chr3_0495"
                     /product="Low-affinity phosphate transporter of the
                     vacuolar membrane"
                     /transcript_id="XM_002492677.1"
                     /db_xref="GeneID:8199864"
     CDS             944090..946534
                     /locus_tag="PAS_chr3_0495"
                     /codon_start=1
                     /product="Low-affinity phosphate transporter of the
                     vacuolar membrane"
                     /protein_id="XP_002492722.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0495"
                     /db_xref="EnsemblGenomes-Tr:CAY70543"
                     /db_xref="GeneID:8199864"
                     /db_xref="GOA:C4R4Q7"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q7"
                     /translation="MKFSHSLQFNAVPEWSTKYISYSTLKKLIYSLQRDYVNSGALSK
                     TTTPYDSEQEPLRSRFKDSDPVDVFFKALDKELRKIDTFYKQKEKHIYKDFDEIIREI
                     EEFESSYKNSTMQDEPVRKRLRDLIGTIKSNDFATDETGAVSSSRFSINSANDSNCHS
                     YDNLKSLVQRRTSRPELFDDDDFNLDFSTQVTITTKKSLTGIYVALSELKSFIELNQI
                     GFSKALKKFDKSLETEVKAEYLAKLPEVSYIFKPSTLDTLNKKIASVISIYSLLVTDS
                     DFNLAKSELRSHLREHIVWERNTVWRDMLGMERKTQAANLEEVKGTPDGIPIASSINV
                     SLGAGRYLRIPIILVSQTVLKGSAIAFLSILLLFLSPFEDTQQKNCFAILVCASLLWA
                     TETIPLYITALLIPLSIVVLGVLKDPYDDHVLTGEEASKYIFSQMWSSVIMLLLGGFT
                     LAAALSKYHVDKSISTWILSKAGNSPPIVLLTIMGVSLFASMWVSNVAAPVLMLSIIQ
                     PLLRTLPTGSVFAKQLILGIALASNIGGTASPIASPQNIVALESMDPQPSWGEWFIIA
                     LPVAVVALVLVWILLLLTFQNQKHLNLVSIKPIDAPFSFAQWYIVFVTMITIILWCLQ
                     SKLSYIFGEMGIIAIIPIIAFYSAGLLVTEDINNYPWNIVLLAMGGIALGKAVSSSGL
                     LAHIAKAIQAQVMDLDIFSISLVFGLLVLVVATFVSHTVAALIIVPLAAEIGNALPEP
                     HPRILIMITALMCSMAMGLPTSGFPNVAAVCQLDEIGVPYLTVGTFITRGVPASVICY
                     GIVILIGFFIMKIINF"
     gene            <946671..>949340
                     /locus_tag="PAS_chr3_0496"
                     /db_xref="GeneID:8199865"
     mRNA            <946671..>949340
                     /locus_tag="PAS_chr3_0496"
                     /product="RNA-dependent ATPase in the DEAH-box family"
                     /transcript_id="XM_002492678.1"
                     /db_xref="GeneID:8199865"
     CDS             946671..949340
                     /locus_tag="PAS_chr3_0496"
                     /codon_start=1
                     /product="RNA-dependent ATPase in the DEAH-box family"
                     /protein_id="XP_002492723.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0496"
                     /db_xref="EnsemblGenomes-Tr:CAY70544"
                     /db_xref="GeneID:8199865"
                     /db_xref="GOA:C4R4Q8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q8"
                     /translation="MSEGTGGVSIRRQHINWSDDSDDEQKKDTKLESVDDLDDDEKQR
                     DEFSKRLKDQDKTANKAPKPRADDTTDMKELRRLAREQYLTKREKDKFLLLKREVNEL
                     EEDVAKYGWENLTEKERSEISFKKEILEIFEKRSELLKDGENYQLPDDSTADRKRKAD
                     VLYSKEKYEATKQTRDQAWESQQIRMATTGKELNLEEFSLPDSKNYDFVFDEKFHVNF
                     TGNSEEPAIKQAEQMEIQDLKNQEIRNIQQTRESLPVCRYREQLLEAIKDHQVLIIVG
                     ETGSGKTTQLPQFLHEAGYTKNGKKVGCTQPRRVAAMSVASRVSKEVGCPVGTTVGYS
                     IRFDDRSTDQTVIKYMTDGMLLREFLNDPELSSYSAMMIDEAHERTLHTDILLGLMKD
                     ICKYRKDLRLLISSATMNAEKFSKFFDDAPIFNVPGRRFPVDIHYTIQPEANYLQAAI
                     TTIFQIHTNQKETPGDILVFLTGQDEIEYMQENITDICRKLGSKIQEMIICPIYANLP
                     PEMQQKIFEKTPPNARKVVLATNIAETSITIDGIKYVIDPGFVKENVYNPATGMESLV
                     VTPCSQASADQRAGRAGRVGPGKCFRLYTKWSYDNELPKNPTPEILRTNLTSVVLLLL
                     TLGINDLLHFDFMDAPSPEALMKSLELLYSLGGLNEKGRLTKTGRQMAEFPTDPMLAR
                     TLLASDQYNCVQEVLTIVSMLGESSALFFRPKKNKAMADKAKQAFVVENGGDHMVLLT
                     IFNQWVDTGYSYQWCKDNFLQFKSLSRARNVRDQLERVCDRVEILNHKEKSEHGISNP
                     GQDSKNSKLLPIQRAFIAGFFPNTAKLSKSGTYKSLKENQLVYIHPSSTLFKAVPPPR
                     YVIYHELVLTSQQFMRNCIPVEERLLTPYLNRM"
     gene            <949500..>951038
                     /locus_tag="PAS_chr3_0497"
                     /db_xref="GeneID:8199866"
     mRNA            <949500..>951038
                     /locus_tag="PAS_chr3_0497"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492679.1"
                     /db_xref="GeneID:8199866"
     CDS             949500..951038
                     /locus_tag="PAS_chr3_0497"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492724.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0497"
                     /db_xref="EnsemblGenomes-Tr:CAY70545"
                     /db_xref="GeneID:8199866"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="UniProtKB/TrEMBL:C4R4Q9"
                     /translation="MKDDCDKLSSEMAHTRETEAERNEKRRKVDRQFNIGTANTYFNE
                     VDDYMISSFTESSDRIVSQRNSMPSSPPRIDELDSLSSSSPIDVVAPESQPIPMQLTF
                     SQLARKNLSSEDTLELDIDNYGRVSGVRNCELYSTSPTKDHDMGHREFLYKDSAEAQR
                     EAVKVLRMVFDEDNENKIDLERFGLTSIPDEFEDFKDSIMVNDSGHLSSPQLHVFLGH
                     NHLSSLSHSLFQVPFIDVLSLRFNHLTRIPGNIKKLTQLRYLALGNNNIVHLPHSILK
                     LDKLQVFSLRPNPLKEPSEGDIELNLKPGPRYASRIRWSNKRKSSKIMPRLNKAYSSF
                     GGDLSLLEKSTSSPKSVLEQERGPYLSPNRTPNLLNEQTTISEAFADERDFDSQEQEL
                     IKNSTSYVPRLTELALRCISNYRISISEAKQWKKSTSKYILKMASKALIQGTNGESCG
                     SCENIIIEPVAAVYEWWDIADAKNVPIRRHFCSKMCAIKWESAIQEMTEGTHKKGSSQ
                     INST"
     gene            complement(<951020..>952141)
                     /locus_tag="PAS_chr3_0498"
                     /db_xref="GeneID:8199867"
     mRNA            complement(<951020..>952141)
                     /locus_tag="PAS_chr3_0498"
                     /product="Actin-associated protein"
                     /transcript_id="XM_002492680.1"
                     /db_xref="GeneID:8199867"
     CDS             complement(951020..952141)
                     /locus_tag="PAS_chr3_0498"
                     /codon_start=1
                     /product="Actin-associated protein"
                     /protein_id="XP_002492725.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0498"
                     /db_xref="EnsemblGenomes-Tr:CAY70546"
                     /db_xref="GeneID:8199867"
                     /db_xref="GOA:C4R4R0"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:C4R4R0"
                     /translation="MKVDWNDVKENVIRAPQIFLQRTNLASTNPSLIDDEIIGLQTNF
                     KNLVTNCKHLQVSLKRYEESAKFMVECGLQTGQSLKSLVADTSKTRSEIDSLFLNKIN
                     QYNMVFQDCKPIVIEVLTSLNDRVGSRLKQLESHNKEVASLLRQREYALLDLNKEMLC
                     LERLKAKGNLMTCKEQQKIFTTERKLTVCERNFTKLNRVIKQELPVYLVISKSIIENI
                     LQVIYFGTLTVFYELQNKLKSLERDINLHDADQSHYSTTTKNMELVSVFKAKHAPVAL
                     QVDSLKICHFYEKNLRNVASNIPSASTIVTNYSGLKIVQEDKDLVCVAGYNFEKINDQ
                     DLSFKRGDHIKVLKQEGSWWKGELNGKVGNFPSNYVELI"
     gene            complement(<952246..>954486)
                     /locus_tag="PAS_chr3_0499"
                     /db_xref="GeneID:8199868"
     mRNA            complement(<952246..>954486)
                     /locus_tag="PAS_chr3_0499"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492681.1"
                     /db_xref="GeneID:8199868"
     CDS             complement(952246..954486)
                     /locus_tag="PAS_chr3_0499"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492726.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0499"
                     /db_xref="EnsemblGenomes-Tr:CAY70547"
                     /db_xref="GeneID:8199868"
                     /db_xref="GOA:C4R4R1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R4R1"
                     /translation="MSDKDIPSSLTISPWSIKPAAKKKKISQDKTNSSTAPNTHLYGK
                     VIRHDKEKRNKACNSCRKSKIKCESSLEQDNAPCKRCLNHGLQCVYEYKIPSYKVIGG
                     SSVNEVLDNSKNNFRPTEKADISKILNPQSSQVLTTSTNQASETPIQNSNNQGWKSSV
                     ENRLQNFDSTLTDILSLLRDRQNGKSQEPSISATIDSILTLEDAHILFDYFDTNITPQ
                     LFGFDLSSYSVNELRATSPILFITICCISSIHHIDFKHIHESLKGLLEKLSQDVLQNP
                     PNNEVEAFNTIIALCISGFWFQKNQIFTGLALQLAKNMNLNVPVRKNKRKRRNSNSRS
                     ISDKDRLKLWYLLFILDGHQSLAFNRQPLLSSNDPALTHSRQLLSSESVRDKYCEALR
                     ENPSTELILNGSPPGSSSDTDSPSKVTNGSSTSDQSHELKYSDLRLVSQVEYNQAISE
                     VFRGNAWDLLTPASFGIPFKSNVELDKWMVQWTVLLSPMHSNNIWSSKSTLIYYNFAK
                     MHINSLSVRKLHTDGSSFPEWKDDEDEDDESLSNTEYENKRAQVSICKENSHSSDSDD
                     SDSDDEFITHSPVVSQRESLKVSSQIAVSAAETVLNLVLSDNDIISALRFVPVHVHVM
                     LYYAAMLVINSPTLLRTHFTGSKNHKGKKEDPNLTAVKIVKKLRNLIYHHKPIDRKFA
                     EIVILGLDKLLADKHSTLKNESSVDPSTLQKVFNVLHEDEINFREESKLAEKIFAWPG
                     TNHGHP"
     gene            <955489..>955899
                     /locus_tag="PAS_chr3_0500"
                     /db_xref="GeneID:8199869"
     mRNA            <955489..>955899
                     /locus_tag="PAS_chr3_0500"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492682.1"
                     /db_xref="GeneID:8199869"
     CDS             955489..955899
                     /locus_tag="PAS_chr3_0500"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492727.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0500"
                     /db_xref="EnsemblGenomes-Tr:CAY70548"
                     /db_xref="GeneID:8199869"
                     /db_xref="GOA:C4R4R2"
                     /db_xref="InterPro:IPR003781"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R4R2"
                     /translation="MAFFGNRTYLVVGASKNPEKYGYKVLKWYLDRNLNVVPINPTTP
                     EVLGAKTKSSILEALANGHEYSLSVITPPDVSYNSLKEVLESVKGDLVKSIWFQPNSY
                     DEKLISYLNKKGFYKNKGNLIYNDCILVSGDSKI"
     gene            complement(<955906..>956580)
                     /locus_tag="PAS_chr3_0501"
                     /db_xref="GeneID:8199870"
     mRNA            complement(<955906..>956580)
                     /locus_tag="PAS_chr3_0501"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492683.1"
                     /db_xref="GeneID:8199870"
     CDS             complement(955906..956580)
                     /locus_tag="PAS_chr3_0501"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492728.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0501"
                     /db_xref="EnsemblGenomes-Tr:CAY70549"
                     /db_xref="GeneID:8199870"
                     /db_xref="InterPro:IPR012445"
                     /db_xref="UniProtKB/TrEMBL:C4R4R3"
                     /translation="MDFNLNIHTSLDIVSDHIEALLWTILFQRLFGTISPSQSTFLGI
                     TYPKVELPILQTLIDSKISQFKRDIMESKTLSQNDHDDDNDNQSLEDETELGSFRLSF
                     FEKFSKRDSKNTLLKFWTNETKESSEDITGIVNDDIQRGSFQDCWETWNLTLYISSGK
                     DYANSFLESMFQILDITDINKSHIPTIRSVAIAPFPFKIAYLVKKDSSIGSSMEYITE
                     KDAQEE"
     gene            complement(<959753..>962482)
                     /locus_tag="PAS_chr3_0503"
                     /db_xref="GeneID:8199871"
     mRNA            complement(<959753..>962482)
                     /locus_tag="PAS_chr3_0503"
                     /product="Zinc finger transcriptional activator of the
                     Zn2Cys6 family"
                     /transcript_id="XM_002492684.1"
                     /db_xref="GeneID:8199871"
     CDS             complement(959753..962482)
                     /locus_tag="PAS_chr3_0503"
                     /codon_start=1
                     /product="Zinc finger transcriptional activator of the
                     Zn2Cys6 family"
                     /protein_id="XP_002492729.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0503"
                     /db_xref="EnsemblGenomes-Tr:CAY70550"
                     /db_xref="GeneID:8199871"
                     /db_xref="GOA:C4R4R4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R4R4"
                     /translation="MPGTYKFRRSYKACLNCKIRKVKCDLGPLDNQNEPPCAKCRREK
                     KECVFPESRNRKRRSVVENQDQEYNQELYPHEKSRRTSQEASESHKYTSSNLGHPGPV
                     FPPPSNINNLLNNSERNHYENHPPPMSQRLTVPSVTHNRKLKDDSNSSSTSELNNLDF
                     KTSQGTMVFLASAAGEIARADERDHIDALKRHQQLETSFSQTQNLQQDMHGTRGESTS
                     NQSADERHTMPPLESSSSVRPKPSSTLADIDYIGPTKVLTETQARRLISLFFNTMHPF
                     FPHIPSEMHSADCLAGYPILLCAILTISARYHKLDENDDASSSNNIQVHEQLWVYCQR
                     LISQTVWAEASTRSIGTVFAFLLFTEWNPRAIHWRWSDYANSDTGELAPLKEVVLAAE
                     EGGSVTGLDAMRRSDRMAWMLIGSSVRLAQDMGFVEHDSGVFLATHIAEINTAMNINR
                     RSMLTSSLHEIDILDHDSQDPSFENEPLDLVVIKEKQKRNMVNPDDDRPNSQPVTNHL
                     KFTKMQMAKLELLQITSICYESLYGKDPKFSGLDKHQNLALLDILSPLLESWYRRYHR
                     LLVPSSPSYLAHNNPRKQFLNQSPEFYAELAILLDRESLIFDYYYAKLYIFSLALSPE
                     ISKSSISSRKQKQMKLDDIAKSSKYVEMAFNAAKEMLSVTHRTHKLRILRFMPVRWLT
                     RIVRAVAFVVKCYLTLTSPVPIAPREFNPSNILHDAVNSFNGSKTDDTSSNYQSAMFS
                     VIPLDEIIAVIQRAAISLREASPDELHLCTRYSTILMYLCTQMKARNKNNGKVIDYEA
                     EIQNAYKDAEKVRQSGLDSPANGLSPYASERSSKQKDHHYNLTEPINSPSQENTYDDN
                     FSQMMNPSETVFNWFSNNDFGVGLEFVDAWTQELEQDYLQKISENPGNSAGNS"
     gene            complement(<962741..>964078)
                     /locus_tag="PAS_chr3_1195"
                     /db_xref="GeneID:8199872"
     mRNA            complement(<962741..>964078)
                     /locus_tag="PAS_chr3_1195"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492685.1"
                     /db_xref="GeneID:8199872"
     CDS             complement(962741..964078)
                     /locus_tag="PAS_chr3_1195"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492730.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1195"
                     /db_xref="EnsemblGenomes-Tr:CAY70551"
                     /db_xref="GeneID:8199872"
                     /db_xref="UniProtKB/TrEMBL:C4R4R5"
                     /translation="MIRSSITHSKIGPISKMFLRRFSTNGSVWNAYSPIFKEDENLKD
                     LRTSKFEYKSLYQPLKIDSFTSEIENSSEKVDYYSHCLREEMKHYGNSEFQDEDRLNN
                     TSSLPELRMIKTKNQAFETYLIENPNVDPKSTVTKMKQYVKFAVMFMKFFKLGVMNVW
                     KNYRLNRKEFYGSYYMVDPKNENAKLKVKNLNSVIDELHTVINCERNVRNASEQRRVL
                     NKGGTQDLFPKIELSRSTLQRVLRTRADFIKLPLFAVLFLLLEELTIGLCYIFPEIVP
                     STCELPQLNHRFFYQQSKSQKELLELRQNAPKSELFKKTPYNISCKELFVLSSVLKTK
                     SSLIPTVLYPESYLRQALLRKLKSLNVDNYLIVRDGGVWKMTNLEILRSCIDRGLVDF
                     SKELNPNNDPQSEEQKSHYELIDFSTLRFRLHSFICEMNRSNNHASVGLLGMY"
     gene            <964689..>966506
                     /locus_tag="PAS_chr3_0504"
                     /db_xref="GeneID:8200227"
     mRNA            <964689..>966506
                     /locus_tag="PAS_chr3_0504"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492686.1"
                     /db_xref="GeneID:8200227"
     CDS             964689..966506
                     /locus_tag="PAS_chr3_0504"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492731.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0504"
                     /db_xref="EnsemblGenomes-Tr:CAY70552"
                     /db_xref="GeneID:8200227"
                     /db_xref="UniProtKB/TrEMBL:C4R4R6"
                     /translation="MYNQYGNIEYLEPMHGNSNGVLGHQSSFQHGAGLYQDLPLDQNL
                     VRMSPYGTVPQDPLLSVSHDPVATIEGPPIGTFQNNTGKSSMQQSPLGNQSGLASDQP
                     HQSLSQQDPNARQKTAFNESPENFKASQIQNPVGTRELTEHPHIEQSSQVQPMQQVSY
                     MQSMQPLQGYQHVQPTQLADQSQHVQIHSQLQNVQPSYPYSVFPSPQTNLIGVTEFPP
                     NAMHSPNSAVPYTSSISQQHSYTDTLNLMDMNDNATPLVPFPEDLEDIFADGPLVDVP
                     TSNEEGSSRSLLDQSFIFDFDTSNLHDEPLSNNGLGITTSREKQSSLQPLAYNKKRVV
                     GPMTLKPNVSNRSMKIKQRILSDSSVLEQHGIQKFDKPPMPYSMDVSSAESSPREKSS
                     TSPILELGGGIRKNSIKPLRKSASQGTLTQSKRSKMKPIGERLSFSEYSSTLELSGMN
                     PNLSNQASRRQFSFVIEQPNRTKEKRKINHSRNSSAGNKSLPNWSDAGSATTSPKFDP
                     STIKHRTTSTESSPVTPLSATVSKFQSLKTHDEVELESLPEDLPYHSDRKKSLSEQES
                     MGISHQPVISSFKRMDSHPKTYNTIQEGMNQFQVIINKR"
     gene            complement(<966731..>967804)
                     /locus_tag="PAS_chr3_0505"
                     /db_xref="GeneID:8199873"
     mRNA            complement(<966731..>967804)
                     /locus_tag="PAS_chr3_0505"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002492687.1"
                     /db_xref="GeneID:8199873"
     CDS             complement(966731..967804)
                     /locus_tag="PAS_chr3_0505"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002492732.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0505"
                     /db_xref="EnsemblGenomes-Tr:CAY70553"
                     /db_xref="GeneID:8199873"
                     /db_xref="GOA:C4R4R7"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C4R4R7"
                     /translation="MDSILTNRCLTPVSNHETFNLVGGSKSLTSAETRKNSDERSSIS
                     IPSPPLSPYQRSLDVERDHKIFDVVGRSNDQIVGDFEEPATKTQTEQLEEGKPDDAPK
                     ISSSVLLSNQTFPIKDLTNAKLTVNAWASINSGDSSFKENQLVFLDSYYNIIDTRKKR
                     APRRKYPTAQPRRRVFFSASESETPNERVRTRRVIRDNVKYSDYESEVEISRPSTPKR
                     STKRVSKPSTPQPQFYSDYESIPDYSPPLSTLPPNNTKALKAEWKGQPMNLSDDPLVG
                     KLHPAEVTLASVLRLPCNVYLDSKRRLFSEKVSRFRLGLPFRRTDAQKACKIDVNKAS
                     RLFAAFEKVGWLDDYHFRKFLDM"
     gene            complement(<968316..>972953)
                     /locus_tag="PAS_chr3_0506"
                     /db_xref="GeneID:8199874"
     mRNA            complement(<968316..>972953)
                     /locus_tag="PAS_chr3_0506"
                     /product="Pentafunctional arom protein"
                     /transcript_id="XM_002492688.1"
                     /db_xref="GeneID:8199874"
     CDS             complement(968316..972953)
                     /locus_tag="PAS_chr3_0506"
                     /codon_start=1
                     /product="Pentafunctional arom protein"
                     /protein_id="XP_002492733.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0506"
                     /db_xref="EnsemblGenomes-Tr:CAY70554"
                     /db_xref="GeneID:8199874"
                     /db_xref="GOA:C4R4R8"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR001381"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="InterPro:IPR008289"
                     /db_xref="InterPro:IPR010110"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016037"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018508"
                     /db_xref="InterPro:IPR023193"
                     /db_xref="InterPro:IPR027417"
                     /translation="MSGLIEKVSILRNDSIHVGYNMSSHIVDEILTKKASSTYVLITD
                     SNIVKMGHLQTFVDEFNRLIPSKRPGSRILTYVVPPGEANKNRATKAAIEDYLLEKGC
                     TRDTFILAIGGGVIGDMIGYVAATFMRGVRFVQIPTSLLAMVDSSIGGKTAIDTPLGK
                     NFIGAFWQPDYVFVDVAFLETLPEREFINGMAEVVKTAAIWNEQEFSRLETYSKRFLK
                     VIRDRRVDDSVDLTSLKEHIIKLVLESIKVKAEVVTLDEREGGLRNLLNFGHSIGHAI
                     EAILTPQALHGECVSIGAVLEAELSRYLGILSPVAVSRLYKCFAAYGLPVSIADKLVQ
                     KRTNGKKCPVDVLLQKMAIDKKNDGSKKKVVLLSKIGKCYEPKASYVNDEDLRFVLTD
                     EVLVKDFNSAPSTAVVVPPGSKSISNRALILAALGKGECKIKNLLHSDDTEHMLNAVA
                     ALKGADISFDDNGETVVVTGNGGNFTATDAEIYLGNAGTASRFLTSVASIVKPDSNTT
                     HVILTGNARMQERPIGPLVDALRTNGSDIEYLNREGSLPLKIKSGNGLKGGRIELAAT
                     ISSQYVSSVLMCAPYASEPVTLSLVGGKPISLLYVDMTIAMMKSFGIEVTKSTTEPYT
                     YHVPQGHYVNPAEYVIESDASSATYPLAFAAMNGTQVTIPNIGSSSLQGDARFAVDVL
                     KPMGCKVEQTATSTTVQGPTKGTLKPLPLVDMEPMTDAFLTASVVAAIANDTNQSTSI
                     VGISNQRVKECNRIEAMITQLAKFGVRAKELEDGIEVFGIDYHHLKTPSDGVYTYDDH
                     RVAMSLSLLAGLAESPVLIQERHCTGKTWPGWWDILHTTFNVELDGHEAVVETTTAKA
                     NEDKSIIVIGMRAAGKSTLSHVIAQTLKGFKVVDLDDVFVEKYGDIREFIKENSWELF
                     REKEAMIAKEAFKNYSKNTVISTGGGIVETEASRKLLKQQMKDGHIVLHLHRDIEETV
                     VFLSQDKTRPAYVDEINQVWERRKNLYKECSNYFFFSPHCQTEREFFTLKKTFSKFIN
                     RITGGAVPSIPNGRSAFVCLTYEDLAPVSSKLTRVTNGCDAVELRVDLLKQHDSHFIS
                     NQIGILRNQTSVPILFTIRTKSQGGRFPDDSYEDIERLLNLAIKLGVEYVDLELSLPE
                     SLLDSVASKRQFTKIIGSHHDFSGTVKWNNVEWENKYLLALKLNVDIIKFVGTATSLN
                     DNWELEHFRSLHTDKPFIGINMGPLGKVSRVFNTILTPVTHKDLPSSAAPGQLTLKEI
                     NEYFGQFGGSSRKKFYIVGKPISHSKSPELHKTFYDEFGLSHTFDKFETDDAAKVFND
                     LVKGNDELGGCAVTIPLKIDMLKYVNELTDSAKSIGALNTIIPIGDGRFIGDNTDWIG
                     IRDSLHQAGCEIAPESSVGLVVGGGGTSRAAVYALHQMGCSKIYMLNRTPSKLSEIKN
                     HFPSNYNIHIVDSLDAIDEDDKLDAAVSTVPGDKPLDDQLISLLKKLLEKKRGHAVLL
                     EAAYKPRETPIMALAFSRGWKVVPGSKMLVNQGIEQFYKWTGYQFSSHIDL"
     gene            <973556..>975142
                     /locus_tag="PAS_chr3_0507"
                     /db_xref="GeneID:8199875"
     mRNA            <973556..>975142
                     /locus_tag="PAS_chr3_0507"
                     /product="C-22 sterol desaturase"
                     /transcript_id="XM_002492689.1"
                     /db_xref="GeneID:8199875"
     CDS             973556..975142
                     /locus_tag="PAS_chr3_0507"
                     /codon_start=1
                     /product="C-22 sterol desaturase"
                     /protein_id="XP_002492734.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0507"
                     /db_xref="EnsemblGenomes-Tr:CAY70555"
                     /db_xref="GeneID:8199875"
                     /db_xref="GOA:C4R4R9"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:C4R4R9"
                     /translation="MSQVISSYSGSNSSTIAGTISHYAQSVINDFTWWQAALAIIVGV
                     LSYDQIMYQIRKGNIAGPKFKIWPVIGPFLESLDPKFEEYKAKWDSGPLSCVSIFHKF
                     VVIASTRDLARKILQSPAYVKPCVVDVAVKILRPSNWVFLDGKEHVDYRKGLNGLFTK
                     KALEVYIPAQEKIMDDYLNRFAEMSKEKPMIFFHEFREIMCALSLKTFCGDYITDEQI
                     KLIADNYYKVTAALELVNFPIIIPFTKTWYGKVTADDTMKIFESCAAMAKKHINEENG
                     KPTCVMDAWIDSMKQARESKSKDPDAKLLIREFSNREISEAIFTFLFASQDASSSACC
                     WMFQLIADRPDVMAKIREEQIRLRDGDINKPLTGELIDSMKYTFMVVKETLRYRPPVL
                     MVPYVVKKSYPVSDNYTVPKGAMVIPTLYPALHDPEVYENPDDFIPERWVEGSPANQA
                     KKNWLVFGNGPHVCLGQNYVMMAFTALIGKAAMLYDIDHTVTPLSEEIKVFATIFPKD
                     DLILQFKHRDEQEILNDISA"
     gene            <975322..>976050
                     /locus_tag="PAS_chr3_1196"
                     /db_xref="GeneID:8199876"
     mRNA            <975322..>976050
                     /locus_tag="PAS_chr3_1196"
                     /product="hypothetical protein"
                     /transcript_id="XM_002492690.1"
                     /db_xref="GeneID:8199876"
     CDS             975322..976050
                     /locus_tag="PAS_chr3_1196"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002492735.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_1196"
                     /db_xref="EnsemblGenomes-Tr:CAY70556"
                     /db_xref="GeneID:8199876"
                     /db_xref="UniProtKB/TrEMBL:C4R4S0"
                     /translation="MEKSGKMMPIPELNIRKDNYSQLYSLVDVLLAKLDTNRQLKRSL
                     FRKLEALSNFQKVATQQAESSEPTIDLAKSKRQPETIPQALKTSLDSLHIDEKPKNTA
                     GDEESELAALRQENLRLREKITQTQIHNSRMVQLLDDYEDNILMIVDRLRDYIIQSRQ
                     SSVDKLREQNGKLYEKTQEVNHLIGELLSYQESAAEQLPPMLDPLKQASGSDSSESEL
                     RDSFEAFYLDKYAREALAVLYSGK"
     gene            <976303..>977859
                     /locus_tag="PAS_chr3_0508"
                     /db_xref="GeneID:8199856"
     mRNA            <976303..>977859
                     /locus_tag="PAS_chr3_0508"
                     /product="Specificity factor required for Rsp5p-dependent
                     ubiquitination and sorting of cargo proteins"
                     /transcript_id="XM_002492691.1"
                     /db_xref="GeneID:8199856"
     CDS             976303..977859
                     /locus_tag="PAS_chr3_0508"
                     /codon_start=1
                     /product="Specificity factor required for Rsp5p-dependent
                     ubiquitination and sorting of cargo proteins"
                     /protein_id="XP_002492736.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0508"
                     /db_xref="EnsemblGenomes-Tr:CAY70557"
                     /db_xref="GeneID:8199856"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C4R4S1"
                     /translation="MYSFDDVNVGNPELDLNIPFVIGLSAILSLLLLLLIIIAVYYTF
                     FCGSSTFGYDLGDNFSIRLPQNFQVDDDKIKLWEKTYFPLLTDEEKDQYLLGKHFFHF
                     NKPNVVPQGTGFGIDAQLSLRDRGINIFYFESYTNHTDLVLDQINHPEKYKRSINEDS
                     ASFDEEEIIEQSQKSSLVAKSFPDYGAVTDEGTSTSRNIPVPFYIEDRTDIIFTTDKP
                     HSTTLNFPLPTKNRRKDTVYFEAKLYEFNPANTLISVGLCCKPYPDFRLPGYNPYSIG
                     IESSGHMRLNRPFINDSDTPVLLPQLIQGDVIGIGYKYYPGSVYVTHNGKKIMEVLHD
                     IKLDLYPCIGSTGGRSQVSVNLGQLGFVFIEANVKKLGFCEGDNEGSLGAPPLYLSTK
                     EDVEDTILQTGEALPPEYPENETTFFGPKAYLQGRVAISKPSSLPLMSPRQVRSILSD
                     DYLTHTDDEISSRPPSYISNSSDQDSTEHNAPNTTILANDQSDLTISTTNKASRKKGK
                     RRRKNKSRRR"
     gene            complement(<977912..>978367)
                     /locus_tag="PAS_chr3_0509"
                     /db_xref="GeneID:8199877"
     mRNA            complement(<977912..>978367)
                     /locus_tag="PAS_chr3_0509"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492692.1"
                     /db_xref="GeneID:8199877"
     CDS             complement(977912..978367)
                     /locus_tag="PAS_chr3_0509"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492737.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0509"
                     /db_xref="EnsemblGenomes-Tr:CAY70558"
                     /db_xref="GeneID:8199877"
                     /db_xref="UniProtKB/TrEMBL:C4R4S2"
                     /translation="MPPVKSLDIFFNRTEKLLEANPTTTKVSIKLGVNFNDHENPQSK
                     HNVITVRVSDPVSGSNFKFKVTNKTDMLKIFSFLGPHGIELPISGQQSQIKSNDQTQS
                     DNTEVPTTFHRGATSILANKAFEKKPLIIKDSSTAKKGGKGGKKKGKKF"
     gene            complement(<978520..>980196)
                     /locus_tag="PAS_chr3_0510"
                     /db_xref="GeneID:8199878"
     mRNA            complement(<978520..>980196)
                     /locus_tag="PAS_chr3_0510"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492693.1"
                     /db_xref="GeneID:8199878"
     CDS             complement(978520..980196)
                     /locus_tag="PAS_chr3_0510"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492738.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0510"
                     /db_xref="EnsemblGenomes-Tr:CAY70559"
                     /db_xref="GeneID:8199878"
                     /db_xref="UniProtKB/TrEMBL:C4R4S3"
                     /translation="MFDSLPLDQYRANYQAIKEHKPIPYGDAKGLILMSDDIDLDLVL
                     RKHIPTKILEEYFHKPREGDASTDGKTRYASDTEELLRFSNVFKDDSIEIGRSRSMYG
                     SPKYSSFEKENILRPSTKANQKGTKYDIDIAGDLLASSHKFISNLPTTNKYEKLLSSS
                     IEKTIREFKRLKEENEQLRSKSSSPRNTGARQSEELVYLKDVNKTLMERLQKEKDSKE
                     QLTKMETELKVKDDSLRDLESQLVERNQLIDSLRVQLADREKLLEKSKSELAEKDHII
                     ETRNVQLTEKDQLVEKIKSELDTRKIINEKENTSKTRNSFGTHDSEVHEKQSTPTQGD
                     SSVKQSEAEAAVSSIARELHQIKESITYLGKDPKKTKLFEEINEIRDQIKYLDLKRFE
                     KEEEIANLNEKELYIQQLSGRSGYYFQGPNLAKEQWDSMRNQPTASPKHDANMQDSPT
                     FRRAQRVKQPCPTCFQSNISPTQSTRDSRANQYAHNNDIYVNDLENIDPNDFLSKLTG
                     PEENRKKEEALNYLDSTRCARKHAQGHTQGSNHLGDMEEIHEEIANSEYY"
     gene            <981002..>982627
                     /locus_tag="PAS_chr3_0511"
                     /db_xref="GeneID:8199879"
     mRNA            <981002..>982627
                     /locus_tag="PAS_chr3_0511"
                     /product="Choline/ethanolamine transporter"
                     /transcript_id="XM_002492694.1"
                     /db_xref="GeneID:8199879"
     CDS             981002..982627
                     /locus_tag="PAS_chr3_0511"
                     /codon_start=1
                     /product="Choline/ethanolamine transporter"
                     /protein_id="XP_002492739.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0511"
                     /db_xref="EnsemblGenomes-Tr:CAY70560"
                     /db_xref="GeneID:8199879"
                     /db_xref="GOA:C4R4S4"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C4R4S4"
                     /translation="MSSSVEKSDVNDVSLTRRFTKDSTLDKDDLILAQLGYEPELNRN
                     FSVWSVLGVGFGLTNSWFGISASLVTGISSGGPMMIVYGIMIIAAVSTCIGITLSELA
                     SAYPSSGGQYVWAKVLAPKYPVLAFLCGSFSYAGSIFSSTSTTVATVQIAVAFYELTH
                     ADYEFHRWHVFVAFQILNFFIFFFNCYAKFLPSIAKSSLYISLGSFIVITITVLACSS
                     GHFQNAKFVFSDFDNQTGWESAGIAFIIGLINPNWSFSCLDCATHMAEEVAQPERVIP
                     IAIMGTVAIGFFTSFVYCISMFFSIRDLDALLNTATGAPIISIYYQALQNQGGAIFLG
                     FLLFLTACGCLISGHTWQMRLCWSFARDNGLPFSPFLSKVDKRMGIPFNAHLFSVCLC
                     SLVSCLYLASDLAYNSLVTGCITFLLLSYAIPVSCLIYNGRDSITHGPFWIGKFGYFT
                     SSMTVAWALFALVFYSFPFVKPVTKSNMNYAAAAIVGWLVVSLVYWFSYGKKIFIMRN
                     EDDEDAVLKKIFAKTESHREKDATIPVEVTKEL"
     gene            complement(<982679..>985006)
                     /locus_tag="PAS_chr3_0512"
                     /db_xref="GeneID:8199880"
     mRNA            complement(<982679..>985006)
                     /locus_tag="PAS_chr3_0512"
                     /product="Mg<sup>2+</sup>-dependent phosphatidate (PA)
                     phosphatase"
                     /transcript_id="XM_002492695.1"
                     /db_xref="GeneID:8199880"
     CDS             complement(982679..985006)
                     /locus_tag="PAS_chr3_0512"
                     /codon_start=1
                     /product="Mg<sup>2+</sup>-dependent phosphatidate (PA)
                     phosphatase"
                     /protein_id="XP_002492740.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0512"
                     /db_xref="EnsemblGenomes-Tr:CAY70561"
                     /db_xref="GeneID:8199880"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4R4S5"
                     /translation="MQYVGRAIGSVSKTWSSINPATLSGAIDIIVVEQENGDLACSPF
                     HVRFGKFQLLRPSQKKVDFIVNGEKTDLPMKLGDGGEAFFVFETDAAIPSELQTSPVI
                     SPVSSPEPASPLSTPSRPNSEPDYLELGDGESTTSELENFKLNRYPYLSTEVSHSDPG
                     VGSVSSSPENTKIIQKISRKLNTKNIPSKVDNNGNLVLDIQGYKSDDLDDNSKSLKQL
                     LLAELGEDVDLDKVIEKDHEGNIMINGAISLLSGEDDLESFPQTDDQAESLKLDLESD
                     KSDIESDTNHELSRYFKTLRLTSDQLKCLTLKKGINELKFSVNKGKSVVTANLYFWDY
                     YDPIVISDIDGTITKSDALGHVFTMIGRDWTHKGVAKLFSDIKSNGYNIMYLTARSVG
                     QADSTRYYLNNIEQEGLRLPQGPVILSPDRTMAALRREVILKKPEVFKMACLNDIKKL
                     YLTNTKDLNPNTDSADFTDINTNTLRSSSLTEDVQTPFYAGFGNRITDALSYRSVGIP
                     SSRIFTINPDGDVHMELLELAGYRSSYVHISELVDHFFPPVNTELFKSMPSDTYRNTA
                     KFSDVNYWKEPLYNFEELSDEDSSEDELRRRKEEERLQSAPRSPILAAGASFFKGSSS
                     LLGSPERMTLSDPKPTEVAPSTIKPPKSVGSVSSDEEKLKDHDDFIDVDHEDETLDDD
                     DDPFDYDYEYEDEEEENDDVDEVDDGEEYSDDYYDEEDDYDEELDHTLEPDQKKELDQ
                     TAEANQLPPSGPDEMESKSFKKASDLISKMRIDDS"
     gene            complement(<985144..>986013)
                     /locus_tag="PAS_chr3_0513"
                     /db_xref="GeneID:8199881"
     mRNA            complement(<985144..>986013)
                     /locus_tag="PAS_chr3_0513"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492696.1"
                     /db_xref="GeneID:8199881"
     CDS             complement(985144..986013)
                     /locus_tag="PAS_chr3_0513"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492741.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0513"
                     /db_xref="EnsemblGenomes-Tr:CAY70562"
                     /db_xref="GeneID:8199881"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:C4R4S6"
                     /translation="MSVIVHPLALLTIIDEFQRRGRNNDSIIFGGLLGKHDESTNQIS
                     VVNSFVIPLIDNQFLNKEYLQDMLLKFSIINSNFRFVGYYHVQSLNGTETQQYDLNAI
                     NLVCQDDNRPSSFVHWIVTDPKEFKSFSMYYLDDSMVQLVNSNIQHYISKPLPYEFKN
                     LLSEKIAIDTILKQSRLEKDLSTKNSLKKLNNSYIDIHSSLNVLYKSVNRLIRYLKKC
                     SKSEVSIDYDTVQEMNTVILKIERLKLIPQVKEEFDLVTLSLLVDNLDQMDHLLYLRK
                     QVEQYKISESMYS"
     gene            <986189..>987733
                     /locus_tag="PAS_chr3_0514"
                     /db_xref="GeneID:8199882"
     mRNA            <986189..>987733
                     /locus_tag="PAS_chr3_0514"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002492697.1"
                     /db_xref="GeneID:8199882"
     CDS             986189..987733
                     /locus_tag="PAS_chr3_0514"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002492742.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr3_0514"
                     /db_xref="EnsemblGenomes-Tr:CAY70563"
                     /db_xref="GeneID:8199882"
                     /db_xref="UniProtKB/TrEMBL:C4R4S7"
                     /translation="MGRKVANNDPNVDSFLRKVQELDAKKKKEDNERVLKLEEEVESK
                     RSKVGDLDELRRSKSKSNGPPQRPQKPDSLRSGSEEEYNDIQLIHPIARDEEKQKMDS
                     EEEAAPQLPKRPKNSILEFPEKNSFVDSLPNFNNSKAPKVIRSEDVLRKPKRDFVINK
                     GNRIGREEVTHDDGKDENPPALPLRRSNVTINEGTKEKPNAALKLGTQKDIKTKENAE
                     TERKPLIPSKPTSLKVLKPETTVSLKISTPPPPAPKPRNQKKEPVIEENNDDSVVESL
                     KKLSPKPKTPAKPSSLQVPSKPITTKPAPLKPTKPKDLAKGLDSNPPEAVVKAKEIKS
                     KPLILPKKASKSNFNQPQEDILQSQLQKLRESKSSGKNHNFNAAQETIFNAQLNGLRS
                     RKPDQNQSKGLLPKRSETFSSKPVPIPFMVDPSSSKVLEKSLTKSRTIDGSDVGLSQE
                     HHQSLSHPNMTRAKGPKRRLPKTLSNPEAIKQPQPTSSTTSLGKKVPPPKPSKKRIVS
                     NSELFL"
     gene            <987936..>989324
                     /locus_tag="PAS_chr3_0515"
                     /db_xref="GeneID:8199883"
     mRNA            <987936..>989324
                     /locus_tag="PAS_chr3_0515"
                     /product="Subunit of the alpha-1,6 mannosyltransferase
                     complex"
                     /transcript_id="XM_002492698.1"
                     /db_xref="GeneID:8199883"
     CDS             987936..989324
                     /locus_tag="PAS_chr3_0515"
                     /codon_start=1