GenomeNet

Database: RefSeq
Entry: NC_012966
LinkDB: NC_012966
Original site: NC_012966 
LOCUS       NC_012966            1778296 bp    DNA     linear   CON 11-OCT-2017
DEFINITION  Komagataella phaffii GS115 chromosome 4, complete sequence.
ACCESSION   NC_012966
VERSION     NC_012966.1
DBLINK      BioProject: PRJNA39439
            BioSample: SAMEA2272385
            Assembly: GCF_000027005.1
KEYWORDS    RefSeq.
SOURCE      Komagataella phaffii GS115
  ORGANISM  Komagataella phaffii GS115
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Komagataella.
REFERENCE   1
  AUTHORS   De Schutter,K., Lin,Y.C., Tiels,P., Van Hecke,A., Glinka,S.,
            Weber-Lehmann,J., Rouze,P., Van de Peer,Y. and Callewaert,N.
  TITLE     Genome sequence of the recombinant protein production host Pichia
            pastoris
  JOURNAL   Nat. Biotechnol. 27 (6), 561-566 (2009)
   PUBMED   19465926
REFERENCE   2  (bases 1 to 1778296)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (11-OCT-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1778296)
  AUTHORS   Callewaert,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2009) Callewaert N., Department for Molecular
            Biomedical Research, Flanders Institute for Biotechnology (VIB) /
            Gent University, Technologiepark 927, Ghent, 9052, BELGIUM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FN392322.
            Contact: Nico Callewaert
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent Technologiepark
            927, B-9052 Gent, Belgium
            Tel: (32)93313630
            Fax: (32)93313609
            Email: nico.callewaert@dmbr.vib-UGent.be
            ----------- sequencing/assembly
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent -----------
            annotation
            Unit for Molecular Glycobiology
            Laboratory for Protein Biochemistry and Biomolecular Engineering
            Department of Biochemistry, Physiology and Microbiology, UGent VIB
            Department for Molecular Biomedical Research, UGent
            
            Laboratory for Bioinformatics and Evolutionary Genomics VIB
            Department of Plant Systems Biology, UGent
            Web site: http://bioinformatics.psb.ugent.be/
            Bioinformatics Online Genome Annotation System (BOGAS):
            http://bioinformatics.psb.ugent.be/webtools/bogas/ -----------
            * NOTE: finishing of chromosomes in process
            * Final curation of the annotation in progress.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1778296
                     /organism="Komagataella phaffii GS115"
                     /mol_type="genomic DNA"
                     /strain="GS115"
                     /db_xref="taxon:644223"
                     /chromosome="4"
     gene            <4931..>6505
                     /locus_tag="PAS_chr4_0003"
                     /db_xref="GeneID:8200531"
     mRNA            <4931..>6505
                     /locus_tag="PAS_chr4_0003"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493367.1"
                     /db_xref="GeneID:8200531"
     CDS             4931..6505
                     /locus_tag="PAS_chr4_0003"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493412.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0003"
                     /db_xref="EnsemblGenomes-Tr:CAY71233"
                     /db_xref="GeneID:8200531"
                     /db_xref="UniProtKB/TrEMBL:C4R6K8"
                     /translation="MRLSLATRETPSTGTSPVFAGDEDHSSANNSSSNTFNYDYYIKE
                     ELSGNLLETAFFESPINDTMLCSMLSYPKIAGTEKIQEPDHELQQHRNPFGCCQELKA
                     ELAEQQELYLLPNKLTKNIFNSGSPVFIYTKIPQTSSVQSFVDVSNSLFATDSALPTS
                     SFRVDSTVDISFEHSIQDSYCYRSNSAEIAPPSTALSSGTHDLVSTVEASTTLLEAAV
                     NSKRRMLELRQQNRIEDLSFSTSIFLDHSRLPLVRGRSFGGNSSRPPKTPLIPGTRYV
                     TARLRLENSTSEDMCLPQWNKAELKDSRRIIRIERRYQSDEIVASFSIVGSAIEYPKT
                     KPAFDPDVKVLEVSCLKCPTNENEPNEERFVSECTSDEARTQHALTEPLTSGFNREPN
                     GHNPKTAGNSIGCRYYITSVEVIKIIELLIGSYSTSDPVQRRKERGRIRSNLVQFWSK
                     HLVFSSKNSMKRRSVPTGNDAYLTELEHRINTYDVRKPRLFDKSVKILEWSKLGPALR
                     RAIQSYYMVRLDESSN"
     gene            <9831..>12215
                     /locus_tag="PAS_chr4_0005"
                     /db_xref="GeneID:8200532"
     mRNA            <9831..>12215
                     /locus_tag="PAS_chr4_0005"
                     /product="Proton-coupled oligopeptide transporter of the
                     plasma membrane"
                     /transcript_id="XM_002493368.1"
                     /db_xref="GeneID:8200532"
     CDS             9831..12215
                     /locus_tag="PAS_chr4_0005"
                     /codon_start=1
                     /product="Proton-coupled oligopeptide transporter of the
                     plasma membrane"
                     /protein_id="XP_002493413.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0005"
                     /db_xref="EnsemblGenomes-Tr:CAY71234"
                     /db_xref="GeneID:8200532"
                     /db_xref="GOA:C4R6K9"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:C4R6K9"
                     /translation="MSRLSQQVANSITSTTSDDLDARQTDEEQLKSTIFVYDSENYSS
                     AEPQFKSGVKTNVAEKTIEVDEDDFSFIEGDISLMNNSPYPEVREVVPNTDDPTIQIN
                     HWRTWTLTTIFVVVFAGVNQFFSLRYPSLTINFLVAQVVAYPAGKFLARVLPDIRFKN
                     SWFNLNPGPYTIKEHGILTICVALTSSTAYAMNILIAQTNFFDRDFGAGYQILLVWTT
                     QCLGYGLAGVSRRFLVDSPAMIWPQTLISVSMFETLHSSKLENAVINGWKISRYYFFL
                     AVFAISFVWYWFPGFLWTGLSYFNFVLWSPETRNNFVVNFIFGVSGGIGAIAITFDYT
                     QISQAMTGSVFATPFWVVANTYASVFIFFIFLLPILYFTNTWDSKYLPVISTSTFDNK
                     QQKYNVTRILQPDFIIDRQKYREYSPLFIPFSYLLSYALNFAAVIGIFIHTYLYHGKE
                     IYGKLKDARHGGEDIHKRLMNQYTEAPDWWYLVLFVITLALSFVTVCNWDTGFPAWGL
                     VIAILISVLNFVPQGLLEGITNQHVGLNIITELVCGYMLPYRPLANVLFKVYGFIVMR
                     QGLELSRDLKLGRYLKIAPRLLFFMQIWSTLIAGLVNVGIQEWMRHNIKDICLTSQPD
                     GFICANGRTIFNASIIWSLPKYLFSPGQRYNAIMYFFLIGAFAPFFTYALHKKWPHRW
                     FGKINAPVFFTGPGNIPPSTPYNYSVYFVASAILTTIKNKWPRWHGKYNFVMGAAVET
                     GVALAVVLIFLCVQFPGGTLEWWGNTVWKDTLDVKGTPFYTLPEGETFGPDKWW"
     gene            complement(<12916..>14010)
                     /locus_tag="PAS_chr4_0006"
                     /db_xref="GeneID:8200533"
     mRNA            complement(<12916..>14010)
                     /locus_tag="PAS_chr4_0006"
                     /product="High affinity nicotinic acid plasma membrane
                     permease"
                     /transcript_id="XM_002493369.1"
                     /db_xref="GeneID:8200533"
     CDS             complement(12916..14010)
                     /locus_tag="PAS_chr4_0006"
                     /codon_start=1
                     /product="High affinity nicotinic acid plasma membrane
                     permease"
                     /protein_id="XP_002493414.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0006"
                     /db_xref="EnsemblGenomes-Tr:CAY71235"
                     /db_xref="GeneID:8200533"
                     /db_xref="GOA:C4R6L0"
                     /db_xref="InterPro:IPR002283"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:C4R6L0"
                     /translation="MPISKRNVVQPWSRPKPTKEVLDYSELVTIDFSKFDKPNGKFEL
                     AKDLAEALQYDGFWVVVNFGIPQDLIDRQFALGKHFFNNYSLEEKSAKACDFENGDYF
                     GYKKVGAKTVFGTAVRENVETFNMPKFTKDETYKELLKQPFYDDFYDEVSSFSRITHD
                     LLVKRLYQLFAIILELDESYFANKHDYDLPSDTHLRYMQYHPRSLEDDERVERIWSRA
                     HTDFGSLTLLFNQEVNGLQLKLSDNSWKYVKPVYGGVICNIGDTLNFWSGGYFKSTIH
                     RVVRPPEDQLDEPRVGLFYFDRPGKTADIEVAPSPLLKRLGLYNKVEPVNGHHYVRQR
                     VKNYHESSDYGKRAGEVFQVGQFKIQDGFD"
     gene            complement(<14407..>16002)
                     /locus_tag="PAS_chr4_0911"
                     /db_xref="GeneID:8200534"
     mRNA            complement(<14407..>16002)
                     /locus_tag="PAS_chr4_0911"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493370.1"
                     /db_xref="GeneID:8200534"
     CDS             complement(14407..16002)
                     /locus_tag="PAS_chr4_0911"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493415.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0911"
                     /db_xref="EnsemblGenomes-Tr:CAY71236"
                     /db_xref="GeneID:8200534"
                     /db_xref="GOA:C4R6L1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R6L1"
                     /translation="MSFEEKRPVHLETQSTSSSDDQNLNYYDIDFQDGDVYETKEYNA
                     ALKKADLRMLIIYSIAYLFTQINKSNVGNAAIMNVEEGDGIRKALGNLTSQQWAWVLS
                     IFFYPYLFFEPVTTMLLKKFSPRVWQSRLMLTWGTISMLQAVAKDYQGILAIRFFLGL
                     AEAGFYTGIIYHFSFWYRPRQLPTRIAIFYGSGQLSSAFSGIVAYGISFMNGKQGLYG
                     WQWLFIFEGIPTVACGIYSAFYLPNYPEDSKFLSEREKLLIISRLPKSAPKRKDGFFV
                     LSEIKELLKDSTFYSYTGIWLFFGIGSWGLSTVIPTVLFELGFSSTAETQLMTMPGSI
                     IGFFLLNLFGWLIQKRLMNGYQVGFGMAVTLTVGYIILAAIDNPYAKYVFLVICTAVT
                     NSIFAILWADRVRVARGTSSTGLAVGWTNAICQLMGIVSPQFYQPKFGPTYRTSFIIS
                     AALCFCGTVSVAATWLLVYRRGILHTEGAYLEDEDIVKRDEFGLTQARIDEVIRARED
                     PPLLTQVLIQLGLKSTGRAGHST"
     gene            complement(<17061..>18581)
                     /locus_tag="PAS_chr4_0008"
                     /db_xref="GeneID:8201314"
     mRNA            complement(<17061..>18581)
                     /locus_tag="PAS_chr4_0008"
                     /product="Low-affinity Fe(II) transporter of the plasma
                     membrane"
                     /transcript_id="XM_002493371.1"
                     /db_xref="GeneID:8201314"
     CDS             complement(17061..18581)
                     /locus_tag="PAS_chr4_0008"
                     /codon_start=1
                     /product="Low-affinity Fe(II) transporter of the plasma
                     membrane"
                     /protein_id="XP_002493416.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0008"
                     /db_xref="EnsemblGenomes-Tr:CAY71237"
                     /db_xref="GeneID:8201314"
                     /db_xref="GOA:C4R6L2"
                     /db_xref="InterPro:IPR007251"
                     /db_xref="UniProtKB/TrEMBL:C4R6L2"
                     /translation="MGVWRNWVGYPGQRNKVSHKVKTIKPLDFNSLDEKNPDLYVEAH
                     DEVGFNGCRKTGFDRVLDYLVWAMGSKAAFFLMWIILIIWIIVGIVFHAPFNWQVIMQ
                     DGQSIQTYIWDTFLMRQQLVHSFHQNLVWAEFESRTATFRRLLRTVDIEKSSSFVEET
                     KSECSSNEISVELPTEDWFDRMSSWLTEFVGSLTAVVIYWSGIIIWIGCGAIPSNAQN
                     DPPFTGVTTGSNPQKKPFSDTWQLYINTAVAVHLLITSVFLQNARERHDQFVRHMLDH
                     ILHLDYAIESKLRSLSDDLEPNEEQVLVPEKRNKVLHAIDWYSDIIGTGIGGVIAIIV
                     IVIWIIIGGPMGWSDNWWLIIGTYTGLVGFIDGFVLRNVYNRIVIRDQSIYEKCREKE
                     RTFFEEVGLPWPESAPEPNKTISYRISAFINVKCSTTSAVGVSILIIVGLIACACGLR
                     WNTTAQLICNSPTMIIEGFFLIILLQAHKWADVKTRTETSALCMRRSTLNTFVQSL"
     gene            complement(<20479..>21354)
                     /locus_tag="PAS_chr4_0009"
                     /db_xref="GeneID:8200535"
     mRNA            complement(<20479..>21354)
                     /locus_tag="PAS_chr4_0009"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493372.1"
                     /db_xref="GeneID:8200535"
     CDS             complement(20479..21354)
                     /locus_tag="PAS_chr4_0009"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493417.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0009"
                     /db_xref="EnsemblGenomes-Tr:CAY71238"
                     /db_xref="GeneID:8200535"
                     /db_xref="UniProtKB/TrEMBL:C4R6L3"
                     /translation="MSVHFVIAAIVFTILYGIFAIVSISILWKKRTIRTFYTGLFLFG
                     LLRAAAQGCLIGFSAQEFIPRQWLIAYIVLKTEAYYLLILISLFLVCASYLEANGGSW
                     SKRASFDSSKSLLGFKRFNLNTVVLLYCLAVVANVLVVVGGTLLASVNTNEYGNNLAR
                     INSSKGLRATGQALFLMSTLAVLTLAACAIVLDNIRSYLLASVFLATPFLLVRGVYGL
                     LSPFIQGANYASMANYASTGMSTSFIVTEYVLATTMEFISGCIFLSTYYVVHFHKRQA
                     NNAITEDENYDKPFI"
     gene            <22493..>22894
                     /locus_tag="PAS_chr4_0010"
                     /db_xref="GeneID:8200536"
     mRNA            <22493..>22894
                     /locus_tag="PAS_chr4_0010"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493373.1"
                     /db_xref="GeneID:8200536"
     CDS             22493..22894
                     /locus_tag="PAS_chr4_0010"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493418.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0010"
                     /db_xref="EnsemblGenomes-Tr:CAY71239"
                     /db_xref="GeneID:8200536"
                     /db_xref="UniProtKB/TrEMBL:C4R6L4"
                     /translation="MIKNALLLNIIQMTFFIKMKLPQISGPKEMPYHKHPKLCSFMRF
                     LSPRLSTKSEASSYKSTLIRILGIASAYRKLSHARSILCGPNAYKGQMTPLSLLSTVG
                     YLLVNFQFFNEGKCFTKIRKTDEKPENIYIS"
     gene            complement(<23397..>25043)
                     /locus_tag="PAS_chr4_0011"
                     /db_xref="GeneID:8200537"
     mRNA            complement(<23397..>25043)
                     /locus_tag="PAS_chr4_0011"
                     /product="Maltose permease, high-affinity maltose
                     transporter (alpha-glucoside transporter)"
                     /transcript_id="XM_002493374.1"
                     /db_xref="GeneID:8200537"
     CDS             complement(23397..25043)
                     /locus_tag="PAS_chr4_0011"
                     /codon_start=1
                     /product="Maltose permease, high-affinity maltose
                     transporter (alpha-glucoside transporter)"
                     /protein_id="XP_002493419.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0011"
                     /db_xref="EnsemblGenomes-Tr:CAY71240"
                     /db_xref="GeneID:8200537"
                     /db_xref="GOA:C4R6L5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R6L5"
                     /translation="MSSITSKQTAEEKELQSVAKTVTAYEFSELEKLARAQQEVEHGL
                     SKWEAIKTYPKAFFWICAGIFIAILVGYESQAGGIVLSIPRFREDFGNAYQGGYVLPA
                     DWQSAITGGATGALVVGSFFGSFTTDKWGRKWVIMFALLLSIPSVILEFVATTIEVFF
                     AGKFINAFCLGILLTVVTAYIAEISPLALRGVAIASINLALCVGPFLCYIITYKTQNK
                     VGRMAYRSMMIPQFIIAGISIVWCLFLPESPYYLLTKDKTEKTLKSLNKIYKGSDLVE
                     AQYALMKVTIQEAQLANGEGSSLQELFYKRNFKRTLAGVCSFLIQPLSGVAFISGYST
                     YYYQLAGFTDDRSFQLSCGAQGLSIFGTITSWFTLDFFGRRSLMIIGTTCMAVLNLLV
                     ACLGLNINNIPAVTASCAFMAMYNFFYNASIGPGAYVVSGEVPTNNLRSKTIATGSFL
                     NNGIQCMWSFVLPYMFNPDQANMGSKVLFIFGGLSALYLLVFFFYLPETAGRSFEEID
                     EMFNDKIPIRKFKGHKCRVQIEAAQVFNEVKGEINHIERV"
     gene            <25358..>27346
                     /locus_tag="PAS_chr4_0012"
                     /db_xref="GeneID:8200538"
     mRNA            <25358..>27346
                     /locus_tag="PAS_chr4_0012"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493375.1"
                     /db_xref="GeneID:8200538"
     CDS             25358..27346
                     /locus_tag="PAS_chr4_0012"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493420.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0012"
                     /db_xref="EnsemblGenomes-Tr:CAY71241"
                     /db_xref="GeneID:8200538"
                     /db_xref="GOA:C4R6L6"
                     /db_xref="InterPro:IPR008902"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:C4R6L6"
                     /translation="MSFAKSVLEATPNEGEWNKNKFSPSSRRVNAQKIHRIEGNTENV
                     ENLLVQDTTKIAVLHGSDTAVTLDFGFNTCGLVQIEFDNDNDNDKHIELSFSESKQFI
                     DKTTSDRSMDFLMEDLTLKVLCKGTYQMPWVSQRGAFRYLTLWTHEESRSISIKSIST
                     YMTCMPSLGEDLSRYSGYFHSSDQFANSLWYAGAYTIQLATIPVDSGRRHSVIMPRTG
                     WFNDALAGLKDASEILTDGARRDRSVWSGDRSVSLLTEAVCFDGVGGQAATDWLLTHQ
                     KESGEFPYACKPIDMYGSDTYHLWSLVNVYDSFKLTGDDTTALHHWQSYKKGLEYSRN
                     KVSELGLIKVTNVLDWGRDVLQNHAASCNMIYYHTLNGAVELATRFGDEKAASEYASQ
                     AKELKLRINEVLWDEQHGMFKDNELSSVLSQDANCFAVWFDVTSEERKESISENLAKR
                     WTKFGAPAVESPGMISPFISSCELFCHSLAGHPERALELFRTMWGYIWNSPYAVQSSL
                     IEGYFQDGSCKYPFTLYDPAYISHAHPWATGPTVLLTNHIVGLSFEHDHSQWNLFPAG
                     IFSENAIEWAQTGFTSKTKGFISAGYKFERHLKSLELAVKSPKETKGKIGIPYDSDYA
                     ISTVTLNGEVLGTEKLEIQEKYYVVSVKESVTVIVSYC"
     gene            <27648..>30167
                     /locus_tag="PAS_chr4_0013"
                     /db_xref="GeneID:8200539"
     mRNA            <27648..>30167
                     /locus_tag="PAS_chr4_0013"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493376.1"
                     /db_xref="GeneID:8200539"
     CDS             27648..30167
                     /locus_tag="PAS_chr4_0013"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493421.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0013"
                     /db_xref="EnsemblGenomes-Tr:CAY71242"
                     /db_xref="GeneID:8200539"
                     /db_xref="GOA:C4R6L7"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR002772"
                     /db_xref="InterPro:IPR011658"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR019800"
                     /db_xref="InterPro:IPR026891"
                     /db_xref="InterPro:IPR026892"
                     /db_xref="UniProtKB/TrEMBL:C4R6L7"
                     /translation="MTQLDVESLIQELTLNEKVQLLSGSDFWHTTPVRRLGIPKMRLS
                     DGPNGVRGTKFFNGVPTACFPCGTGLGATFDKELLKEAGSLMADEAKAKAASVVLGPT
                     ANIARGPNGGRGFESFGEDPVVNGLSSAAMINGLQGKYIAATMKHYVCNDLEMDRNCI
                     DAQVSHRALREVYLLPFQIAVRDANPRAIMTAYNKANGEHVSQSKFLLDEVLRKEWGW
                     DGLLMSDWFGVYDAKSSITNGLDLEMPGPPQCRVHSATDHAINSGEIHINDVDERVRS
                     LLSLINYCHQSGVTEEDPETSDNNTPETIEKLRKISRESIVLLKDDDRNRSILPLKKS
                     DKIAVIGNNAKQAAYCGGGSASVLSYHTTTPFDSIKSRLEDSNTPAYTIGADAYKNLP
                     PLGPQMTDSDGKPGFDAKFFVGSPTSKDRKLIDHFQLTNSQVFLVDYYNEQIPENKEF
                     YVDVEGQFIPEEDGTYNFGLTVFGTGRLFVDDKLVSDSSQNQTPGDSFFGLAAQEVIG
                     SIHLVKGKAYKIKVLYGSSVTRTYEIAASVAFEGGAFTFGAAKQRNEDEEIARAVEIA
                     KANDKVVLCIGLNQDFESEGFDRPDIKIPGATNKMVSAVLKANPNTVIVNQTGTPVEM
                     PWASDAPVILQAWFGGSEAGTAIADVLFGDYNPSGKLTVTFPLRFEDNPAYLNFQSNK
                     QACWYGEDVYVGYRYYETIDRPVLFPFGHGLSFTEFDFTDMFVRLEEENLEVEVVVRN
                     TGKYDGAEVVQLYVAPVSPSLKRPIKELKEYAKIFLASGEAKTVHLSVPIKYATSFFD
                     EYQKKWCSEKGEYTILLGSSSADIKVSQSITLEKTTFWKGL"
     gene            <30313..>32751
                     /locus_tag="PAS_chr4_0014"
                     /db_xref="GeneID:8200540"
     mRNA            <30313..>32751
                     /locus_tag="PAS_chr4_0014"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493377.1"
                     /db_xref="GeneID:8200540"
     CDS             30313..32751
                     /locus_tag="PAS_chr4_0014"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493422.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0014"
                     /db_xref="EnsemblGenomes-Tr:CAY71243"
                     /db_xref="GeneID:8200540"
                     /db_xref="GOA:C4R6L8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R6L8"
                     /translation="MTDQQASIVVPKIYRTKRRVTHNSKGRAIYSCDRCKLKKRACKR
                     VAVEGSSNVIQSDVPCEGCKKASVPCKTTITRKSKFKVPVASLGLHYRCLLLIMDGLF
                     PHIDVKNIDSLIDLGNSLHLRMPSRDGDFSEEDLKSMEDTSLLITSTKWFKPSMKIFD
                     DIGTEHQRSQEKEGSLKHKPDISQEQALAEPLQETSDALSVPVVHNQMKILEPRKVKQ
                     PVSYSMDGPLVYDNVELIDNYGNKHYLGPFSSITLMGTFGNIITSKIGDTSKLKLNKF
                     RENANDMNFAMLRDGKGYTPSLIREGFPTLRPIKGLTRSVMDRWLEVFVGQIHPIYTC
                     FDEEDLLGKYQKLVIDLQLAEKTNKSVLGLPNDEVCKFYSIFLLGDTFMTHNNDSRRY
                     DPVIQSLSHFVEINLSSLLLTPTLAGVQSEFLYGLYLGTQGQKEGSYLLVELAYRQCL
                     TMGYQREALYSYKRLINEGEIKTTFWSIVQQEIYLSTFMGRISGIQLEEINIKPYSGE
                     LSALKRSDRVASFFREEKVDLCKLCYNLLQYRKEITFSSKKLLAASNEEKAIRCNNRL
                     NSWISNFNFNLSSLLVEKENPNTDKTALVYSTFPEEMWIRIHHSYYIISLCEPFLLYL
                     LGQTESLTVNAGDPLMSLIIDAVKASQHIIDMILYFDQVSENLEFFDNFSILSLATQC
                     LLITDIIISMNQYSSVHLDEEYLNSEHGINEPSLQDHIHKSSRILEDNIESPHSSVRS
                     LCESTIASRDDVQALKEALKKNSQIFESQQSLSFLQKDLSFIFPINGEFSFSGNTELN
                     DVLFGDPEYLKFNS"
     gene            <42361..>42693
                     /locus_tag="PAS_chr4_0018"
                     /db_xref="GeneID:8200541"
     mRNA            <42361..>42693
                     /locus_tag="PAS_chr4_0018"
                     /product="Cytochrome c, isoform 1"
                     /transcript_id="XM_002493378.1"
                     /db_xref="GeneID:8200541"
     CDS             42361..42693
                     /locus_tag="PAS_chr4_0018"
                     /codon_start=1
                     /product="Cytochrome c, isoform 1"
                     /protein_id="XP_002493423.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0018"
                     /db_xref="EnsemblGenomes-Tr:CAY71244"
                     /db_xref="GeneID:8200541"
                     /db_xref="GOA:C4R6L9"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:C4R6L9"
                     /translation="MPAPYEKGSEKKGATLFKTRCLQCHTVEAGGPHKVGPNLHGVFG
                     RKSGLAEGYSYTDANKRKGVEWSEQTMSDYLENPKKYIPGTKMAFGGLKKAKDRNDLI
                     TYLAKATK"
     gene            <43060..>45330
                     /locus_tag="PAS_chr4_0019"
                     /db_xref="GeneID:8200542"
     mRNA            <43060..>45330
                     /locus_tag="PAS_chr4_0019"
                     /product="Component of the SPS plasma membrane amino acid
                     sensor system (Ssy1p-Ptr3p-Ssy5p)"
                     /transcript_id="XM_002493379.1"
                     /db_xref="GeneID:8200542"
     CDS             43060..45330
                     /locus_tag="PAS_chr4_0019"
                     /codon_start=1
                     /product="Component of the SPS plasma membrane amino acid
                     sensor system (Ssy1p-Ptr3p-Ssy5p)"
                     /protein_id="XP_002493424.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0019"
                     /db_xref="EnsemblGenomes-Tr:CAY71245"
                     /db_xref="GeneID:8200542"
                     /db_xref="GOA:C4R6M0"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C4R6M0"
                     /translation="MDQDDLFPNRGSSSSSTLPDSTSLRSVDTELVKEVLEATDPVDL
                     NHVDKLHFTNLFGMHLKQDQREFASDFEKFNKETLMEERLRSKVSKVLSSQQKSNHRL
                     RVVGSSDTWDQKSDSNSFKTIPLNETEWNENVPIDLEKNFETIQDDVSSVEKGFIPVS
                     RRNFVSEWYHKPKRYDIQRKLKTRNLLNIALGGTIGVGILLSSGKGFSIAGPLGCLIG
                     FMITGMVVLATMLSFCEMVTLLPLCGGVSGVASRFVDDAFGFALGIGYWFSYTIGLPT
                     EIIAATIMLSYYEHLHVPGPSTSAWVVFFIVVIVSINLCDVRVYGEVEYFSTIIKVLA
                     LLVLIIFMVVLNAGGVAPSHEYIGFRYWDSSKTNRTEFISNGPFRPTFDLADKGLGSF
                     NGIGGNLGRFCSVLVACVLAAYSYVGTEIVLIAGGESQNPRKAIPAATKVIYWRIIFF
                     YMLAIFVIGLNINSGDPRLLRFYTDGGAPADSQEQQDIQSVMDRNNGNNCHFTLLKWG
                     GFSNGNQSPWIIALQSAGLCSFAAVLNAFLIYFALTAGSSQLYASSRTLYYLSIQGKV
                     PKVFGICSKRGVPYISVLFTGSFSTLAFFAVEQNTVVVFSRYLSICASAGLIVWTGMC
                     LSFIRFYYGLQLRPDIITRNDDNYPYRSPFQPYLAYFGFCMGSILVLSSGFVVFLNGH
                     WSTTFFFTSYGSLILLFVCYFGYKILRRTSIQRLDQLDLDSGRREIDRIIWEEEKDYT
                     VTVKGWIRFIIKKFVY"
     gene            complement(<45327..>46088)
                     /locus_tag="PAS_chr4_0020"
                     /db_xref="GeneID:8200543"
     mRNA            complement(<45327..>46088)
                     /locus_tag="PAS_chr4_0020"
                     /product="Component of the spliceosome complex involved in
                     pre-mRNA splicing"
                     /transcript_id="XM_002493380.1"
                     /db_xref="GeneID:8200543"
     CDS             complement(45327..46088)
                     /locus_tag="PAS_chr4_0020"
                     /codon_start=1
                     /product="Component of the spliceosome complex involved in
                     pre-mRNA splicing"
                     /protein_id="XP_002493425.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0020"
                     /db_xref="EnsemblGenomes-Tr:CAY71246"
                     /db_xref="GeneID:8200543"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="UniProtKB/TrEMBL:C4R6M1"
                     /translation="MSRNSEKANSLLNRYHRQKNVLPVTGDARPKRVQSVKDLRVAEK
                     FRLLCVQEISQKISRINDVSLNDYQIRDLNDELNKLTKERFAWEYHIKELGGPNYILN
                     SNKAMSSVNVDSSGYRYFGRAKDLPDVKQMLEARKKHKTEQETQIQVAKDKKLRLRLL
                     EESKEKLPLSYFGVVNTTVEETSHTDAQGQDEELLEYESRLTTERRRKLNVQFSGAST
                     RSDDEVSLLHLKIPESSAIEKYIIQKKKEKLLSSL"
     gene            <46215..>47867
                     /locus_tag="PAS_chr4_0021"
                     /db_xref="GeneID:8201114"
     mRNA            <46215..>47867
                     /locus_tag="PAS_chr4_0021"
                     /product="Guanosine diphosphatase located in the Golgi"
                     /transcript_id="XM_002493381.1"
                     /db_xref="GeneID:8201114"
     CDS             46215..47867
                     /locus_tag="PAS_chr4_0021"
                     /codon_start=1
                     /product="Guanosine diphosphatase located in the Golgi"
                     /protein_id="XP_002493426.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0021"
                     /db_xref="EnsemblGenomes-Tr:CAY71247"
                     /db_xref="GeneID:8201114"
                     /db_xref="GOA:C4R6M2"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:C4R6M2"
                     /translation="MSGLFSTRHSKYVFAGIFVFGLFLFLLANPSSGNPGLPKMKTPS
                     TGSGGRVIHGLEDEGENIYPGKTTPVVTPKTPNVDGEVISKNPGSEDSIGVSGSTSSV
                     QNGSSSDCGTEYVVMIDAGSSGSRVHVYSFDTCFSPPKLLGETFEMLKPGLSSFDTDT
                     VGAAKSLDPLLKVAVDAVPKEKQACTPVSVKATAGLRLLGPEKSDNILKKVRSYLEEQ
                     YPFSVVEGDGVAIMEGSDEGVYAWITTNYLLGNIGSAELIPTVAVFDLGGGSTQIVFE
                     PKEGEKMLPGEHKYEIEFGGRHFTLYQYSHLGYGLMQGREKINALVIETALKNGNTKL
                     EKLDSKGKEPATKQTLVHPCLPPAVTASDVKVKLENGDSYIVDFVSPLRDDQSSELAS
                     TSATQCRYLAETVLNKDLECKTKSCSFNGIYQPSLTHQFETTRDMYIFSFFYDRLQPL
                     GFPSSFTLDEVKDITKLVCSGSSFWNQFLFQPESVHELENEPLWCLDLSFMVALLHTG
                     YEIPLSRELHTAKKIKDNELGWCLGASLPLLDNNANWKCRVA"
     gene            <48112..>49848
                     /locus_tag="PAS_chr4_0912"
                     /db_xref="GeneID:8201115"
     mRNA            <48112..>49848
                     /locus_tag="PAS_chr4_0912"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493382.1"
                     /db_xref="GeneID:8201115"
     CDS             48112..49848
                     /locus_tag="PAS_chr4_0912"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493427.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0912"
                     /db_xref="EnsemblGenomes-Tr:CAY71248"
                     /db_xref="GeneID:8201115"
                     /db_xref="GOA:C4R6M3"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:C4R6M3"
                     /translation="MSSLKPHKGEDPEPSILDNTSTEPKHRYESLPKLPILHNSLYCK
                     DNPRELPSDKEISGLQRKPSKLKSKLSDEIKHLSPSLKSVKSHAQLAKTANGVRSLAR
                     NLNKATIKLNVRSVMIITKARDNSLIYLTKELTEWLLRREPHMDIYVDHHLEKSRRFD
                     PKSIWQEIPTAQKHLKFWNKALIRDCPDMFDLVITLGGDGTVLYASTLFQRVVPPVLS
                     FSLGSLGFLTNFAFEDFASILTDVLENGVRTNLRMRFTCRAHKENGELMCEQQALNEL
                     TVDRGPSPWVSMLELYGDGSLLTVAQADGLIIATPTGSTAYSLSAGGSLVHPSVSAIS
                     VTPICPHTLSFRPILLPDSMTLRIKVPARSRSTAWASFDGRSRVELLKGYYVTVAASP
                     FPFPTVRSSKNEYFDSVSRVLNWNSREEQKSFVHLLSDKNKESYNQYHSGRTAAGNIR
                     SGQSRMNSIGNPQEESEQTNMNVGRHAYNRVTDSLRQVQLERRHSNTFEIDYNDSSSS
                     DDNNNQLPGEASDSTIELEDNAGDNYFVPLPGEGINTPVPQPFLSNDSNVHSMSSSRV
                     SPLHDGLDRASK"
     gene            <50272..>53898
                     /locus_tag="PAS_chr4_0022"
                     /db_xref="GeneID:8201315"
     mRNA            <50272..>53898
                     /locus_tag="PAS_chr4_0022"
                     /product="Ubiquitin-specific protease that may play a role
                     in ubiquitin precursor processing"
                     /transcript_id="XM_002493383.1"
                     /db_xref="GeneID:8201315"
     CDS             50272..53898
                     /locus_tag="PAS_chr4_0022"
                     /codon_start=1
                     /product="Ubiquitin-specific protease that may play a role
                     in ubiquitin precursor processing"
                     /protein_id="XP_002493428.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0022"
                     /db_xref="EnsemblGenomes-Tr:CAY71249"
                     /db_xref="GeneID:8201315"
                     /db_xref="GOA:C4R6M4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR024729"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029346"
                     /db_xref="UniProtKB/TrEMBL:C4R6M4"
                     /translation="MEESIPTPPLEEMEVSGMDSSASQSPNPVDVIQHDSSNFEAVKE
                     HVLPPVPPDYEVEFEGYFTWNIQDWRKLSDSKIVSPRFVLGNYKWNLLIFLKRANNGT
                     NIGIYLEPHPLDDDQEQDPNWYVCAQFAIDLWNPEYPYIHKSNASYHRFNQDVTDWGF
                     STFLELRNLHRASKSYDKPFLFDNKLNITVYVRVIKDHTGVLWHSFVNYDSKKETGLV
                     GLNNQGATCYLNSLLQSYYFTNIFRKKVYAIPTDDEAKNEQISEETISVSLALQRVFY
                     QLQKSNLPVDTTELTRSFGWDTNEAFIQNDVQEMNRLLMEKLENKMKGTSIEGCLNDI
                     FVGKMKSFIRCIHVDYESSRIEDFWDIQLNVKNMGSLQNSFENYIELETLSGENKYDA
                     SGFGLQDAEKGVVFESFPPVLHLQLKRFEYDFVYDQLVKINDRHSFPDEIDLKPYLDS
                     AGDAYDEDWVYSLHGVLVHTGDISTGHYYAMIKPSIENTWYRFDDDKVWKVTRSQVFD
                     ENFGFDELQPDVVRSMTRSQFLDYQQKRHTSAYMLVYIRKSQEKAVLEPVTDADVPSH
                     IPEQIHKELEERDLLEKERREMHLYEHLKIITNQTFSKYEGFDLTPNVSDLNYYASDL
                     FDEESYPLDVKLLKTEPLSKLYDLVSDSLGGVDPRHFRFWHVSTRRNYTARPDGPVPL
                     TYDTSKIPIGEVFKLNSGKKLVQQTFLFVEEVGKELNFVSKKLLELNKQNPKLDSEIN
                     SNNKFEILKQRYSQIPSDTFPPFHSCDQDSILLFLKYFDPKSQNLQGLTHVVVNKDAK
                     VSTLTKSVNYFMGFDLETPLNFYEEIEPKSIEPIILEISFAESELLNGDIICFTRADT
                     ESDGSIKENIDGYGSVITYYNFLESRIHLFVRPALLDSYLNEEDEKNLESKTFHVWVP
                     SQIPYDCLVARFAKEIKTDPDYLRLYGVNHDDTRIAIHRNTRLRDILPRSVKPSQTIT
                     FEYEILDITLAEFESLVPIEVYWFNNSVLHLQKYELLISKQESIFDLLGKLQYKIGFN
                     DEVREGILAWTSVDHKFGTLVADENIVSLVLRESTNHIFVGSFPHLKKILTTTDENQV
                     LELDDVEIIRGDIREVPVFQFRNEIHRKHGAPFIFDVRRNERFKDTKNRFQRLLGLGD
                     KEFTKTELVIVSNSIDQQIRYVTDESLLLYDELAEHEQLAIDTPPRAVRRPTIQERAL
                     FIKD"
     gene            complement(<53972..>54865)
                     /locus_tag="PAS_chr4_0023"
                     /db_xref="GeneID:8201116"
     mRNA            complement(<53972..>54865)
                     /locus_tag="PAS_chr4_0023"
                     /product="Putative pantetheine-phosphate
                     adenylyltransferase (PPAT)"
                     /transcript_id="XM_002493384.1"
                     /db_xref="GeneID:8201116"
     CDS             complement(53972..54865)
                     /locus_tag="PAS_chr4_0023"
                     /codon_start=1
                     /product="Putative pantetheine-phosphate
                     adenylyltransferase (PPAT)"
                     /protein_id="XP_002493429.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0023"
                     /db_xref="EnsemblGenomes-Tr:CAY71250"
                     /db_xref="GeneID:8201116"
                     /db_xref="GOA:C4R6M5"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C4R6M5"
                     /translation="MRSHSCLIVVSEKILVQGLYTQFICKVSQLGDFPNIDVVLTVEI
                     ASAHKVNIVLQHLYEATRNSYGLDVDIQVGFAKWVFKDPHKQWSQIYIADGDNIPHQL
                     QLNNISNVEPVHICFNPSDTSTTEYTNESSANDFNAEQFRVVAVGGTFDHLHDGHKIL
                     LGISAFLSRDELIVGVTGEAMLKNKKYKDYLESFIERKEKILRFLDFAYPGLPVAIHE
                     INDVCGPTATVREIEGLVVSEETSSGGEYVNKVRREKNLPALEVFVVNVLGGSDKTSF
                     SDKLSSTELRRRDYEKATAQI"
     gene            <55215..>55499
                     /locus_tag="PAS_chr4_0024"
                     /db_xref="GeneID:8201117"
     mRNA            <55215..>55499
                     /locus_tag="PAS_chr4_0024"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493385.1"
                     /db_xref="GeneID:8201117"
     CDS             55215..55499
                     /locus_tag="PAS_chr4_0024"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493430.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0024"
                     /db_xref="EnsemblGenomes-Tr:CAY71251"
                     /db_xref="GeneID:8201117"
                     /db_xref="GOA:C4R6M6"
                     /db_xref="InterPro:IPR013958"
                     /db_xref="UniProtKB/TrEMBL:C4R6M6"
                     /translation="MSSKPNNKSSSYFEKQRDALVAEISVSMDTLLNNVNTLNRSLEG
                     AIAVGKEFDNVAAIWNNFYDGMDQTDRLFQKNSRLSPEQDFETPPVDSSR"
     gene            complement(<57892..>59430)
                     /locus_tag="PAS_chr4_0026"
                     /db_xref="GeneID:8201118"
     mRNA            complement(<57892..>59430)
                     /locus_tag="PAS_chr4_0026"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493386.1"
                     /db_xref="GeneID:8201118"
     CDS             complement(57892..59430)
                     /locus_tag="PAS_chr4_0026"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493431.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0026"
                     /db_xref="EnsemblGenomes-Tr:CAY71252"
                     /db_xref="GeneID:8201118"
                     /db_xref="GOA:C4R6M7"
                     /db_xref="InterPro:IPR000560"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C4R6M7"
                     /translation="MLNPRAISLIVLSLLGSTYAEDYECVGTFIFGRHNDRPAKPTNQ
                     QTPLGAEAQLKNGALFRERYYGLTYDNEPVDSEYKIEKLNDEGFYQASQYYGQAPYSG
                     TIAKSHMAFLQGLFPATDGPLSNELLIQSTESDLDNGTVMEYPLNGYQYVMMDFQDPN
                     APNNFIIKGDVNCANSDSAIAAAYKTEEFQNLNDTTFDFYQSLRDVLPEEDIATSFLN
                     FGNAMDIFDYMNVNWIHNSTLHDQWNITLLDEVRLLSNQFQWLISYNETDVTGDISIG
                     GQSILGGVWTYLNTTKEAQSPLINYFTGSFNTMFQLNGLLQLDKLSANFTGMPDYGAT
                     YIFDLMQDTSDNYFVQFSFKNGTDSWDQFTVYPIFGSEDTMMSWDDFSENIKQYSILT
                     LSDWCDRCNAGVEQSSKYPSVCVPYSSTYKAAKELQSNGVDLESILSGDYSSLDIQDS
                     HHSKLSNAAAGGIGAGVTIGTMLVLGALFLVFKRVTRSKKNNVPIATSSESASSDSLA
                     EKSV"
     gene            <60172..>61335
                     /locus_tag="PAS_chr4_0027"
                     /db_xref="GeneID:8201119"
     mRNA            <60172..>61335
                     /locus_tag="PAS_chr4_0027"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493387.1"
                     /db_xref="GeneID:8201119"
     CDS             60172..61335
                     /locus_tag="PAS_chr4_0027"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493432.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0027"
                     /db_xref="EnsemblGenomes-Tr:CAY71253"
                     /db_xref="GeneID:8201119"
                     /db_xref="GOA:C4R6M8"
                     /db_xref="InterPro:IPR010286"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R6M8"
                     /translation="MDEKVRLLENINFHQLAAQHPSLDQFFVGSQYNFDTHEGLIELA
                     QVILLEYFQLKVQLDKTRLCPRIPNRLKYLRLVGSLVEQFKLGDSPLILDIGTGHTCI
                     YPLLGSRLTSWRFIGTDIDERSLECAKKVLEENNVSSERIQLKLVRSGDDPFMDIENC
                     DVVMTNPPFYDETGIKQNKPEKPVLVGKPTELATEGGESQFIINMINHSVKYPGRNTV
                     YSSLVGKYNSLEPVVGKLKELNITNYGLSEFSNKTKRWIVFWTFNKNRPSDNIRMIKR
                     STFNPEKHEIFIPLKNKINLVDFLSSIQRTTIERENEVIVFKTKGIVWSRKFRRTNGT
                     NFLKEKGLGSIFRITELETKIKIHWCYGDDRAVFESLLGLITRKTQQSSGEPL"
     gene            complement(<61330..>61902)
                     /locus_tag="PAS_chr4_0028"
                     /db_xref="GeneID:8201120"
     mRNA            complement(<61330..>61902)
                     /locus_tag="PAS_chr4_0028"
                     /product="Subunit of the GINS complex (Sld5p, Psf1p,
                     Psf2p, Psf3p)"
                     /transcript_id="XM_002493388.1"
                     /db_xref="GeneID:8201120"
     CDS             complement(61330..61902)
                     /locus_tag="PAS_chr4_0028"
                     /codon_start=1
                     /product="Subunit of the GINS complex (Sld5p, Psf1p,
                     Psf2p, Psf3p)"
                     /protein_id="XP_002493433.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0028"
                     /db_xref="EnsemblGenomes-Tr:CAY71254"
                     /db_xref="GeneID:8201120"
                     /db_xref="GOA:C4R6M9"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:C4R6M9"
                     /translation="MFGDTANKLILDAKRSRALDGVPMYQEHDVRDIIRETRDLQKES
                     DIIASQDTNAQDRVKQCQLFVTHLSMRRNKRCLLGYQRSRVEKLMEVAWNGQEMDPQQ
                     MENLSHHEQEYFKKYSNLVALYKSPFQDVDVSGSLEPPKEVFIDVRVLKDAGEILTEY
                     GVFNLTKDSQFFVRQADVEKLIQQGYLEKL"
     gene            <62038..>63753
                     /locus_tag="PAS_chr4_0029"
                     /db_xref="GeneID:8201121"
     mRNA            <62038..>63753
                     /locus_tag="PAS_chr4_0029"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493389.1"
                     /db_xref="GeneID:8201121"
     CDS             62038..63753
                     /locus_tag="PAS_chr4_0029"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493434.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0029"
                     /db_xref="EnsemblGenomes-Tr:CAY71255"
                     /db_xref="GeneID:8201121"
                     /db_xref="UniProtKB/TrEMBL:C4R6N0"
                     /translation="MEDRHLKQRRKKSRTPLPAVDVDDYFIESQEKPSCVLAGAAEAE
                     GGKSKKRKTLELDKELDAWALIDELETVQESQGSQRATLFSNDANYIDEPSFITSDDD
                     EPIDLANLNESFNEAFESAQQKSIKGNEQSMHSHVKYQESLKTYSSTRSFLENDENEP
                     NEIHQHTSEAGRKDTIQDINDLRNLGVTNKIKDEYQFMLESFETADESLMQVTLFDLL
                     QKLQSDRKMLSYFHHMGFPKPLLESAHLKNDLVSKLIFVSIIIFMSSQDLSMTSILNS
                     VSNINDFLIFSNAYRWPDKCSRMKKKLVLDFQKILHKLIGDSSLTTITLHLLLSLAKT
                     NSLCLLERESILQLDQIILHSIKEREFELLNLEATILESLITNSVSTITLFTSIESLV
                     ELLFSNKPHHELSKQSKALFSSITAIGVIYTKSMTEDDKLYNTFLCSKAVLSLLSTVR
                     SSHILSNPNSVQSKDVQLYTWGCFSLGWLLNISKFPRCFKCIDQYSVSVINSVLESMN
                     SSVDLNTGYFSMFVGRLYQADVLVYNRDSPILYNLRTFKKLITVNTLNAQADLIIKDL
                     ERRNY"
     gene            complement(<63794..>65884)
                     /locus_tag="PAS_chr4_0030"
                     /db_xref="GeneID:8201122"
     mRNA            complement(<63794..>65884)
                     /locus_tag="PAS_chr4_0030"
                     /product="Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /transcript_id="XM_002493390.1"
                     /db_xref="GeneID:8201122"
     CDS             complement(63794..65884)
                     /locus_tag="PAS_chr4_0030"
                     /codon_start=1
                     /product="Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /protein_id="XP_002493435.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0030"
                     /db_xref="EnsemblGenomes-Tr:CAY71256"
                     /db_xref="GeneID:8201122"
                     /db_xref="GOA:C4R6N1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6N1"
                     /translation="MSDDDGLMVNFVAPDSSRVRKQPRAVKYRGGNFGINKDGSVDGN
                     MTKMGFQKWGKRKSRASEDGTENKEKAPPGTYSSKRTRFAEGTGPGGGKNDTFVSSLF
                     TSNPEVQEHETKEEAVVQDPSNAPLSDATTFDGLGCNDILYKHLTEHIKFQHPTKIQR
                     SVIPRLLTRERDLFVQAQTGSGKTLAFCIPIVQKLMEIEDLKRDSGLFAIILTPTREL
                     ATQIYSVLETLTRCCHRIVPGIVIGGEKKKSEKARLRKGVNILVGTPGRLLDHMENTE
                     TLDLSSVSYLIMDEGDKLMELGFEETLDKILKLLGERSTIANRKYSNLPSTRINVLCS
                     ATMKGGVSKLGEISLKDAELVTTNSVPDQDVIFDEENNIQAPDQLIQQILIVPPKLRL
                     VTLHSLLKKITSKPGGSRTMLFLSCSDSVDFHFSTFTRKGRKINSKKVLKETGVEISD
                     ERADESSTILTVPILGDNVVAFKLHGSLTQQVRTSTLDMFSSTPESRHTILFCTDVAS
                     RGLDLPYISDVIEYDPPFAVEDHLHRVGRTARAGKGGTSVLFLFPGIEETYTGKIEIY
                     HKKAGLDYVSFSDLLKTSFGKTWEVDATTWHLDVERWLLEDPGAHSAAAQAFTSHIRA
                     YATHLSSERDTFNVKTLHLGHLAKSFGLRETPKTLGVGSGPKATKKNKENSKKKLLRM
                     ATLAVQETSNEFNY"
     gene            <66039..>66815
                     /locus_tag="PAS_chr4_0031"
                     /db_xref="GeneID:8201123"
     mRNA            <66039..>66815
                     /locus_tag="PAS_chr4_0031"
                     /product="RNA polymerase III subunit C37"
                     /transcript_id="XM_002493391.1"
                     /db_xref="GeneID:8201123"
     CDS             66039..66815
                     /locus_tag="PAS_chr4_0031"
                     /codon_start=1
                     /product="RNA polymerase III subunit C37"
                     /protein_id="XP_002493436.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0031"
                     /db_xref="EnsemblGenomes-Tr:CAY71257"
                     /db_xref="GeneID:8201123"
                     /db_xref="GOA:C4R6N2"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="UniProtKB/TrEMBL:C4R6N2"
                     /translation="MSLFVPEDDETQLDTMDLDVSKENLDGDSSKADMNSDEEDPVIN
                     EVPIHINSRLREELVILQYTNRFKQREQPNISQVRFKPQAGVLELNVPLEKSKYFSPE
                     KSAEWDNIDKQILRGVLNESSTYYAGVVKNGAIHLNPIQKNAQVRPYFEYMDQRKSEK
                     QNQFHQQLKIANETTDASKKEVRVVQMSMKTTVDSQPRLGGALQSNKSESEEAWVDYA
                     WLGSSKEQLQLANKDDTLLQSNMTRDEYMGELFKETRVDL"
     gene            complement(<66812..>67773)
                     /locus_tag="PAS_chr4_0032"
                     /db_xref="GeneID:8201124"
     mRNA            complement(join(<66812..67713,67764..>67773))
                     /locus_tag="PAS_chr4_0032"
                     /product="Alpha subunit of the translation initiation
                     factor eIF2B"
                     /transcript_id="XM_002493392.1"
                     /db_xref="GeneID:8201124"
     CDS             complement(join(66812..67713,67764..67773))
                     /locus_tag="PAS_chr4_0032"
                     /codon_start=1
                     /product="Alpha subunit of the translation initiation
                     factor eIF2B"
                     /protein_id="XP_002493437.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0032"
                     /db_xref="EnsemblGenomes-Tr:CAY71258"
                     /db_xref="GeneID:8201124"
                     /db_xref="GOA:C4R6N3"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:C4R6N3"
                     /translation="MSSEFDITATYLRFLEDDPDITMPIAAIESLVTLLKIKQPSTSA
                     ELITLLSGAISELKTSVPNAISLSAGCDLFMRFVLRNTHLYSDWESCRTNLVENGQLF
                     IQRAKESRNKIAEIGLPFIKDDDIVLVHSYSRVVCNLLIRAFQKHIRFRVICTEARPT
                     ETAKSDTMAYLLRQAGIPVAMIYDSEVGFFMHKVDKVFVGAEGVAESGGIINHIGSYQ
                     MGVLAKNANKRFYVVAESHKFVRMFPLGPDDLSIKKKLEFSTEDKPIETRHLEFTPHE
                     YITALITDLGVLTPSAVSEELIKMWYD"
     gene            <68060..>70519
                     /locus_tag="PAS_chr4_0033"
                     /db_xref="GeneID:8201125"
     mRNA            <68060..>70519
                     /locus_tag="PAS_chr4_0033"
                     /product="Mitochondrial elongation factor involved in
                     translational elongation"
                     /transcript_id="XM_002493393.1"
                     /db_xref="GeneID:8201125"
     CDS             68060..70519
                     /locus_tag="PAS_chr4_0033"
                     /codon_start=1
                     /product="Mitochondrial elongation factor involved in
                     translational elongation"
                     /protein_id="XP_002493438.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0033"
                     /db_xref="EnsemblGenomes-Tr:CAY71259"
                     /db_xref="GeneID:8201125"
                     /db_xref="GOA:C4R6N4"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6N4"
                     /translation="MNFQIARFGSRLFGTGLDKIRNIGIIAHIDAGKTTTTERMLYYS
                     GSISKLGDVDQGDTVTDYLETERNRGITIQSAAVTIPWNKYKINLIDTPGHSDFTFEV
                     IRSLRVLDGVVTILDAVAGVEAQTEKVWKQAKDMNIPSIVYINKMDRDGANFNMTVRQ
                     IVSKLATRVVLCNIPYFVNDLKTQSHRFVGVVDIFEGTLLKYHENDDGNDVQVIPLNE
                     LSEFKDSEQVNQDVMKLREAAIETLGEFDDRIVDSYLETEDYMKVPTYILHEALAKAT
                     ISQDVVPIFCGSSFKNIGVQPLMDGVSLYLPNPGEAQKPSVYSPVASVPVKIDPKSGC
                     LINNNKNLCVAFAFKVITHPTRGLLTFVRVYSGILKSNSKVINTQTGDKFNIGKLMVM
                     HGDKPHDVDQLGVGNIGVISINVENKRISTGDTLVCHTLKKSADGLHKNEKRLKLLPI
                     EVPPPMFSVSLQPMTAGDRRGLDQSLNTLLMEDPSLHVHVDEDSGQTILSGMGELHLD
                     IATTRLRDDLGARMEIGKVMINYKETILKPTTPVAKSIEDSAFKKGHFEITLSLDSFQ
                     GKPEDTGLIRKDSEGAVLLNDNNLVIFEQDCEPDFILERVKRVSRGDQDWDLPMTMEN
                     IQNTILSSIAASLQVGGPVAGLSMHSMIVRVHKWEIPQDFDKISSLVTLIRQAISTSI
                     GQLSEKQTTLMEPIMDVAVHVGDSDLGTVSQDLSTARAAQVHSIDDELDSTSSEKLYW
                     AKDLAENIPLPQDPADLASGRHSSPISGRKVVKAITPLREMMGYLPKLKSLTRGHGSY
                     DMVYSGMQRVSPERLKVILDE"
     gene            <70728..>71483
                     /locus_tag="PAS_chr4_0034"
                     /db_xref="GeneID:8201126"
     mRNA            <70728..>71483
                     /locus_tag="PAS_chr4_0034"
                     /product="Subunit of heterotrimeric Replication Protein A
                     (RPA)"
                     /transcript_id="XM_002493394.1"
                     /db_xref="GeneID:8201126"
     CDS             70728..71483
                     /locus_tag="PAS_chr4_0034"
                     /codon_start=1
                     /product="Subunit of heterotrimeric Replication Protein A
                     (RPA)"
                     /protein_id="XP_002493439.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0034"
                     /db_xref="EnsemblGenomes-Tr:CAY71260"
                     /db_xref="GeneID:8201126"
                     /db_xref="GOA:C4R6N5"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014646"
                     /db_xref="InterPro:IPR014892"
                     /db_xref="UniProtKB/TrEMBL:C4R6N5"
                     /translation="MSYQPYNNFNDNAEGGGFTTYNNNDGDGQGSQGKTQQRNTIKPV
                     TIKQINDSKTIISDGEFVVNGVELNMVSFVGIIRNVNDNTSSLTITIEDGTGSLDVRK
                     WVDEGSDPSENNYPLGQYVYVTGLLKEFNEKKSLQQATINPIEDYNQVTYHYLSAIKV
                     HVEANQQGSHQQGNSLFVSQNADDHTNSNDPSEKVYRFIHDNTPSMVEGVPIQYIAQS
                     LSLTDNEVINYCNQLSDVGKIYNGNDDSSYLAV"
     gene            complement(<71514..>76160)
                     /locus_tag="PAS_chr4_0035"
                     /db_xref="GeneID:8201127"
     mRNA            complement(<71514..>76160)
                     /locus_tag="PAS_chr4_0035"
                     /product="Putative helicase"
                     /transcript_id="XM_002493395.1"
                     /db_xref="GeneID:8201127"
     CDS             complement(71514..76160)
                     /locus_tag="PAS_chr4_0035"
                     /codon_start=1
                     /product="Putative helicase"
                     /protein_id="XP_002493440.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0035"
                     /db_xref="EnsemblGenomes-Tr:CAY71261"
                     /db_xref="GeneID:8201127"
                     /db_xref="GOA:C4R6N6"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6N6"
                     /translation="MSSILHQNVEVVIFEIENIAQVLAYKSKLKLSKEEPVSRKRGYN
                     QLQDDHEPNPIPISPELAEISKNSVDLAQVDFCGTIDEPEGCSLLRQLGDELTIKDIE
                     LSLSDDILIVKSIRKQRLSSLPLLSIRLGKIKELVISHLPFFKRVRIVHRSDHIIIVR
                     PQIKFLFSENAPLAFHLEYKISVHQGIFINFPQNWSTHILNLITKLSWSNPTLFESTS
                     TEYSVPDVPMFYSLVSNATSNWTPPFPEKLIRVPGLNANLFKFQSKTVNWLLGHEGVE
                     FNHDTKTTTQLPFYSPPESCDTDTFHNYLIECLNKLSFGWNRIRIDEEVYFYNQYSGN
                     IVSPDKIIAYFKTLAPTNAQGLLSEEMGLGKTVEMIATIMLHPRPELELESQIFDPVA
                     GRNVRKCKSSLIVCPESILKQWRDDIYNFNPHLKVIFYKGISNNKQFKDPSIIAEHLA
                     EHDIILTTYNTVAKEVHYAMYNPTDRPLRKAAKDGRMKAQIEEENATSIPNENDAAKS
                     ERIASTLRKQSSDEFVERYDYSSPLVLLQFWRVILDEVQMVTSKISNAAKICKMIPRA
                     HAWGVSGTPIRNNLDDLQAILSFLRFHPFDDNDSQKRVRIKNPNWELVKSAKPPLTFV
                     RLWSKIALRHTKLMVADDIKLPPQQRIQLSISLTPVERDNYDNLFKSFLSDVALNDKG
                     EPLLENWEPNSTVLTTMRVWLEKLRRICCHAQIGSGNIKKQMFELVGLKTMDAVLDDI
                     LLKVDQDVDTSKRLEILSRCKQGMIYEYMKAPTSALEIWESCLTEIEKQIKALNDLLN
                     GINEGSPVKLEPLDEKEEMEETDSSDENGDFSKKGLLKHRLRSWLELLHRCYFFIASA
                     HNQIYNPKLTEEEKESGSRQNLDEVPDELLDRDSLEHRKIERLYYAKAEDIRKELLKE
                     RLKQVDNSDKDLLTKTRAFLKNNGFMKETRKAHHKKDTDFKDRKDIDVKESDTHLKVD
                     RVNLLKLIQVPDVTGGHFFSFQDDLEGLYHRLNSQAEYVNKWIKVVFSLLTKSIVETE
                     ETTGNEMSSYAEEQDKIDKYLSVIQLALTDRGVCLKASRNRGVPTTYRIPSSTKEEES
                     EFQKARVMTGVSITLTQLLDRISLEAGNNDSETLKNAFLEIKALVSSQVDELTKNLNS
                     ASKIVTVFNNSFNSRVNYFKGLQQISENVMPYSPTGLDPAAQLRGAEGEENRYKQQVA
                     QAQLRSNYLRSLGDNAQNNDERLCIICRSDITIGALTKCGHQYCKECLKEWLKKSSTC
                     PLCKAHLDHFSIYFFTFTRDDLKASLLTANEADTEAEKEEFKKEIYSIYKPMNDETLQ
                     EIQDIPIQKMYGSKVDLIVKQALWLKNKISNVQIVVFSQWLELLEVLAIALKQNGLKC
                     IGAKNSLKLEKGSGRNKEKLTDVELFKSDPSITCFLLNARAQAAGLTLVNASHVFLCE
                     PLVNTALELQAISRIHRIGQQHKTTIWMFTIKDTVEESVLRLSTRKRMRLVENKSTED
                     DGKVLDQNITSDIIDQEELSKTTKGMVHKNIIGGEVVSNEDLWGSIFSAKAQSF"
     gene            <78293..>79922
                     /locus_tag="PAS_chr4_0037"
                     /db_xref="GeneID:8201128"
     mRNA            join(<78293..79571,79666..>79922)
                     /locus_tag="PAS_chr4_0037"
                     /product="Protein kinase involved in the response to
                     oxidative and osmotic stress"
                     /transcript_id="XM_002493396.1"
                     /db_xref="GeneID:8201128"
     CDS             join(78293..79571,79666..79922)
                     /locus_tag="PAS_chr4_0037"
                     /codon_start=1
                     /product="Protein kinase involved in the response to
                     oxidative and osmotic stress"
                     /protein_id="XP_002493441.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0037"
                     /db_xref="EnsemblGenomes-Tr:CAY71262"
                     /db_xref="GeneID:8201128"
                     /db_xref="GOA:C4R6N7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C4R6N7"
                     /translation="MLDEEILTSRQNIKQFIRHGKQAHVQPEPTNQPSPRESYSMANH
                     AVEDRFDYNIATDPNAGNDNTNQHHHKSDKYSEIAQGLVEEESKERQKKQQSMNMERY
                     DLLEKMGEGAFSVVHKAQDKTTGQFVAIKIIRKYQLDAQQQASVLKEVTIMRQLRHQN
                     IVEFIDFIESEDYYLIVQELVSGGELFAEIVKYTYFSEDLVRHIIIQVAQAIRYLHEV
                     VGVVHRDIKPENLLFEPIPFMPSKQVKLRKSDDPSSKRDEGEFVYGLGGGGIGVVKLA
                     DFGLSKQIWEFNTKTPCGTVGYTAPEIVRDERYSKEVDMWAIGCVVYTLLCGFPPFYD
                     ERIDVLTEKVARGQFSFLQPWWDEISSGAKNCVSKLLTVNPKQRYTIDEFLQDPWIME
                     HIQKSQQAQLQRLTLNPPILPSSTTKPAAGISKPNAFDISTAVHRIGEEAALGKTYAQ
                     KGQMESLREDDELHSPESLDSPPKPAKQTIPVSDNQLFDLSLAGASILERRKNKRKTV
                     PVI"
     gene            <80071..>81623
                     /locus_tag="PAS_chr4_0913"
                     /db_xref="GeneID:8201129"
     mRNA            join(<80071..80115,80154..>81623)
                     /locus_tag="PAS_chr4_0913"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493397.1"
                     /db_xref="GeneID:8201129"
     CDS             join(80071..80115,80154..81623)
                     /locus_tag="PAS_chr4_0913"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493442.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0913"
                     /db_xref="EnsemblGenomes-Tr:CAY71263"
                     /db_xref="GeneID:8201129"
                     /db_xref="GOA:C4R6N8"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:C4R6N8"
                     /translation="MPNLPSSLNKMTAQACLRLYPLTLDFITFLNNSPTPYHAVDSVK
                     SKLVESGFNELSERVNWAGKVKKNGAYFVTRNNSSIIAFTVGGHWQPGNGVSIVGAHT
                     DSPTLRIKPISHSTKEGFNQVGIETYGGGLWHTWFDRDLGVAGRVFIEEEESGNIVSK
                     LVKIDKPVLRIPTLAIHLTKERAKFEFNKETQFHPISSLENSSEKEKNKDEEHDACAG
                     EDLTTEEFKSIQSVVERHNKQLLDLVAADLDCSISQIVDFELILFDHNKPVLGGLNEE
                     FVFSGRLDNLTSCFCATEALINASKDTNRLDLDTNIQLISLFDHEEIGSVSAQGADSS
                     FLPDILQRITRLTGNEVSTDLEGQPNSFFLESMAKSFLLSSDMAHGVHPNYGEVYEKL
                     NRPRINEGPVIKINANQRYSTNSPGIVLLKKIGELGKVPLQLFVVRNDSPCGSTIGPM
                     LSAKLGLRTLDLGNPQLSMHSIRETGGARDVKKLVDLFESYFENYYTLEPKIKV"
     gene            <82481..>85636
                     /locus_tag="PAS_chr4_0038"
                     /db_xref="GeneID:8201316"
     mRNA            <82481..>85636
                     /locus_tag="PAS_chr4_0038"
                     /product="Translational elongation factor 3, stimulates
                     the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes"
                     /transcript_id="XM_002493398.1"
                     /db_xref="GeneID:8201316"
     CDS             82481..85636
                     /locus_tag="PAS_chr4_0038"
                     /codon_start=1
                     /product="Translational elongation factor 3, stimulates
                     the binding of aminoacyl-tRNA (AA-tRNA) to ribosomes"
                     /protein_id="XP_002493443.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0038"
                     /db_xref="EnsemblGenomes-Tr:CAY71264"
                     /db_xref="GeneID:8201316"
                     /db_xref="GOA:C4R6N9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015688"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6N9"
                     /translation="MSAASESKQSAEVLEQLFEKLSVAVPEERDTAAANVSSFLNGSI
                     IEHDVPFEFFKELKKTIKNKKNTNGQLNALEAIAHIASDTNLSPSVEPYIVDLTEEIS
                     ILAGDKNKEVQEVAAKALLAVSQSITPVAIKVILPILTQRLAETAKWTEKVAILDAIT
                     SFVDTSKDQLALRMPELVPVLSEAMWDTKKEVKAAATATITAATATVVNKDIEPFIPK
                     LIESIAKPTEVPETVHTLGATTFVSEVTTAALSIMVPLLSRGLAERDTSIKRKAAVIV
                     DNMCKLVDDPQVVAPFMEKLLPALKANFQTIADPEARDVTQRALNTLRRVGAVGADDA
                     IPEVSTAGDVQVTLEILNFLTKDNKIAPRFDIAKTYIAAIAGDLVDERLIDPETWMQN
                     LTPFLTIFLHEKQSKELVEEYRKRSVDNIPQPPSFEDEDDEGEDLCNCEFSLAYGAKI
                     LLNKTQFRLKRARRYGLCGPNGAGKSTLMRAIANGQVEGFPSQDECRTVYVEHDIDGS
                     EADTSTVDFIYGDGSLGTKEEIIAKLKEFSFSDSMIAGPIQSLSGGWKMKLALARAVL
                     RNADILLLDEPTNHLDTVNVAWLVNYLNTCGITSIIVSHDSGFLDKVVQYIIHYEGFK
                     LRKYKGNLSEFVKRVPSAKSYYELGASELEFKFPEPGFLEGVKTKQKAIVKVSNMTFQ
                     YPGTEKPQIRDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTIGEVYVHENCRI
                     AYIKQHAFAHIDSHLDKTPSEYIQWRFQTGEDRETMDRASRQINENDEEAMNKIFKID
                     GTPRRIAEIHSRRKFKNSYEYECSFLLGENIGMKSERWVPMMSVDNAWLPRGELVESH
                     SKMVAEVDMKEALASGQFRPLTRKEIEEHCSMLGLDAELVSHSRIRGLSGGQKVKLVL
                     AACTWQRPHLIVLDEPTNYLDRDSLGALSKALKAFEGGIIIITHSAEFTKDLTEEVWA
                     VLDGTMTPSGHNWVQGQGAGPRLEKKENEEDQFDAMGNKIAAVKKKVKLSSAELRKKK
                     KERMKKKKALGDAYVSSDEEF"
     gene            <86304..>88196
                     /locus_tag="PAS_chr4_0039"
                     /db_xref="GeneID:8201130"
     mRNA            <86304..>88196
                     /locus_tag="PAS_chr4_0039"
                     /product="Meiosis-specific protein with similarity to
                     phospholipase B"
                     /transcript_id="XM_002493399.1"
                     /db_xref="GeneID:8201130"
     CDS             86304..88196
                     /locus_tag="PAS_chr4_0039"
                     /codon_start=1
                     /product="Meiosis-specific protein with similarity to
                     phospholipase B"
                     /protein_id="XP_002493444.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0039"
                     /db_xref="EnsemblGenomes-Tr:CAY71265"
                     /db_xref="GeneID:8201130"
                     /db_xref="GOA:C4R6P0"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:C4R6P0"
                     /translation="MLTAAGVLSAFDSRDPGTSELAGLLQATSYIAGVSGGSWLLSSL
                     ITNDFKPVVDMKNQIWNFEMPLLEGLSWLERYADNEGRNNPKQVLGGGNMRKRELELH
                     NLWFKNISMSSSLSAKVQSYLLETQEQYHKTLNPKIPVTESQELKMKISATSKVKDNA
                     FSSFLKRLFNKGQDTDKGLLHTPKNVDDFSVLNYYLNLHLEVRSKKLAGFQLSLTDYW
                     GRALMRRISPDGPRSMNFTFSEIYSLPSFHSSEQPFPILLADIYQGSRNHSSIDSHVL
                     EINPFEIGSWEPYMKAYMKLRYLGSTLIRGEPVFYSKGSTPVCVENYDNLGFLTAASS
                     SLFNCIFWYLSEAVQKQSPDTYAAFTRIFDTFGLSPLKPDSYGNHSDYALINPNPFLG
                     YPSMDDEISSSSSLHLVDGGEDKQNIPFVPLLWEKREVDVIIAVDSSSDIGGYPNGTT
                     LVATNRRFNQSAKIQNPTVYYRHQNDSASETPTQHSIFPVVPSYEEIVQKGLNKRPTF
                     FGCHLDKSFPLTGLNNTSADIKNLRLPPLIVYLANTLSSFASNTSTFKLSYNRDEISK
                     MIQNGHDIGTYSHSMAFEDYPKCLGCALLKREFDKKTRGMESIVKDKATLPKYCKRCF
                     AKYCYS"
     gene            complement(<88210..>88887)
                     /locus_tag="PAS_chr4_0040"
                     /db_xref="GeneID:8201131"
     mRNA            complement(<88210..>88887)
                     /locus_tag="PAS_chr4_0040"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002493400.1"
                     /db_xref="GeneID:8201131"
     CDS             complement(88210..88887)
                     /locus_tag="PAS_chr4_0040"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002493445.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0040"
                     /db_xref="EnsemblGenomes-Tr:CAY71266"
                     /db_xref="GeneID:8201131"
                     /db_xref="GOA:C4R6P1"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:C4R6P1"
                     /translation="MWSLFISGLLIFYPLVLGDDPKEVDTELNDASPPKGMSWQSWHM
                     KSEHDIDGHDTDAVFKLHDYRHVNSLNHDDILRMYGLLREEVVGKGDGTGGHDESEGI
                     SQKVKDKVISTVFGLIDSNSDGEISFDEWQKFSAKGGELPDMGVGVGHELDFEAEYER
                     HHWLKYHAENDPDVTIQHPEDIAHELLHHEHEVEHDETIANKRVIDGFKETVVLIENI
                     PDLFRSK"
     gene            complement(<89346..>89711)
                     /locus_tag="PAS_chr4_0914"
                     /db_xref="GeneID:8201132"
     mRNA            complement(<89346..>89711)
                     /locus_tag="PAS_chr4_0914"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493401.1"
                     /db_xref="GeneID:8201132"
     CDS             complement(89346..89711)
                     /locus_tag="PAS_chr4_0914"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493446.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0914"
                     /db_xref="EnsemblGenomes-Tr:CAY71267"
                     /db_xref="GeneID:8201132"
                     /db_xref="UniProtKB/TrEMBL:C4R6P2"
                     /translation="MAAALVEFDAAEVSWREEVTLAAVASDSATVDKSDTREVKDSTT
                     ELAATLVFPTREILEDSDILMKKYYNTHEGYLIFINTLISIPRSQSVLCILDHGDMVI
                     VSRWNNCPIGINVSFALLF"
     gene            complement(<90070..>90459)
                     /locus_tag="PAS_chr4_0041"
                     /db_xref="GeneID:8201317"
     mRNA            complement(<90070..>90459)
                     /locus_tag="PAS_chr4_0041"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_002493402.1"
                     /db_xref="GeneID:8201317"
     CDS             complement(90070..90459)
                     /locus_tag="PAS_chr4_0041"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_002493447.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0041"
                     /db_xref="EnsemblGenomes-Tr:CAY71268"
                     /db_xref="GeneID:8201317"
                     /db_xref="GOA:C4R6P3"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:C4R6P3"
                     /translation="MPFSIELFLTPYQTKKINYETKTFTVDASAPTEQGVFDPASYAK
                     YLIDHIKVGGHIGNLGSDITVTQEGNKIIVVSNTKFSGKYLKYLSKRYLKKNQIRDWI
                     RFISIRKNEYRLQFYATEEDDEEEDEE"
     gene            complement(<90886..>91266)
                     /locus_tag="PAS_chr4_0915"
                     /db_xref="GeneID:8201133"
     mRNA            complement(<90886..>91266)
                     /locus_tag="PAS_chr4_0915"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493403.1"
                     /db_xref="GeneID:8201133"
     CDS             complement(90886..91266)
                     /locus_tag="PAS_chr4_0915"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493448.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0915"
                     /db_xref="EnsemblGenomes-Tr:CAY71269"
                     /db_xref="GeneID:8201133"
                     /db_xref="UniProtKB/TrEMBL:C4R6P4"
                     /translation="MSDTLLVDTSVSFTSTPQYSQSTLSTSGYFKSLQSGTSYTQQRD
                     HAIETSTIEVGPVNSVSTSTDDAGVSIVSLGGSTTAISNSSNPSRPDVNTTTETPENT
                     ATTSSKSSWLITLTVLTSLLVTTL"
     gene            complement(<92062..>92544)
                     /locus_tag="PAS_chr4_0042"
                     /db_xref="GeneID:8201318"
     mRNA            complement(<92062..>92544)
                     /locus_tag="PAS_chr4_0042"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493404.1"
                     /db_xref="GeneID:8201318"
     CDS             complement(92062..92544)
                     /locus_tag="PAS_chr4_0042"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493449.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0042"
                     /db_xref="EnsemblGenomes-Tr:CAY71270"
                     /db_xref="GeneID:8201318"
                     /db_xref="UniProtKB/TrEMBL:C4R6P5"
                     /translation="MKLAEALIIRKDIYKNLKQLENRIRRNITIQEGTSAPENSNALL
                     VEYNEQHKEYVGLVVKINLTNAKIFLKFYHPIEEKEVEATMTEALALRDYLKERSSAL
                     REFAAEASSSRAVLTRTEVRFKTTMKASDIQKEQDRTGKLLRQLDLKIQEKNWNAELE
                     "
     gene            complement(<93081..>94586)
                     /locus_tag="PAS_chr4_0043"
                     /db_xref="GeneID:8201134"
     mRNA            complement(<93081..>94586)
                     /locus_tag="PAS_chr4_0043"
                     /product="Mitochondrial aldehyde dehydrogenase"
                     /transcript_id="XM_002493405.1"
                     /db_xref="GeneID:8201134"
     CDS             complement(93081..94586)
                     /locus_tag="PAS_chr4_0043"
                     /codon_start=1
                     /product="Mitochondrial aldehyde dehydrogenase"
                     /protein_id="XP_002493450.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0043"
                     /db_xref="EnsemblGenomes-Tr:CAY71271"
                     /db_xref="GeneID:8201134"
                     /db_xref="GOA:C4R6P6"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR015657"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C4R6P6"
                     /translation="MTFAPPLEFEIDLPNGLKYTQPLGLFINNEFVEGVEGKLLPVIN
                     PCDETKITQVWEASAADVDRAVDAAEDAFNNSVWATQDPLERGKLMNKLADLIDRDFN
                     ILAGIESIDNGKAYTSAQGDVTLAVNYIRSCAGWADKILGNVVDSGNTHLNLVKREPL
                     GVVGQIIPWNFPLLMLAWKLGPALATGNTVVLKTAESTPLSGLYVAKLIKEAGFPPGV
                     VNILSGFGNPAGAAIAAHPRIKKIAFTGSTATGRKIMEAAAKSNLKKVTLELGGKSPN
                     IVFEDADIQKTIHNIILGIFFNSGEVCCAGSRVYIQDTVYEEVLEAFKKETDNVKVGG
                     PFEEGVFQGPQTSELQLNRILSYIKHGKDEGARVITGGSRYRNRGYYIKPTIFADVTE
                     DMKIVKEEIFGPVVTITKFSTVDEVVGYANNTNYGLAAGIHTNNLNKAIDVASRIKAG
                     VVWINTYNDFHHMVPFGGYGESGIGRELGAEALDNYTQAKAIRIAYTPEHK"
     gene            complement(<95236..>97077)
                     /locus_tag="PAS_chr4_0044"
                     /db_xref="GeneID:8201135"
     mRNA            complement(<95236..>97077)
                     /locus_tag="PAS_chr4_0044"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493406.1"
                     /db_xref="GeneID:8201135"
     CDS             complement(95236..97077)
                     /locus_tag="PAS_chr4_0044"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493451.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0044"
                     /db_xref="EnsemblGenomes-Tr:CAY71272"
                     /db_xref="GeneID:8201135"
                     /db_xref="GOA:C4R6P7"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR013784"
                     /db_xref="InterPro:IPR014766"
                     /db_xref="InterPro:IPR029411"
                     /db_xref="InterPro:IPR029413"
                     /db_xref="UniProtKB/TrEMBL:C4R6P7"
                     /translation="MLLPLNLLLLLAPTISAAALKPRDTVPRSLVDESSPFVVDLLSE
                     KSDNSTQIVKFGNDKFSLEMGPQYGTKLLWNPYGLNSGFDNETVDLVGSAVGLYASYE
                     GALHDLNYTSVTISDETENMIDLSFNAYEGEHHMVLFQGLDGFYSYFVNKNLPTLGEF
                     RTLFRLNPDVYQSGHTTLKDGLLPTFPDDFKGTKTFDETWLAPDNSSYITKYDWSSRT
                     HEEEAFGVYGTYNETGKDYGFWLVSPGRDFYVGDQTKQELMVHRESSTGDVVLLNMLH
                     GTHFEADFVEDFPKDKMWGPYLWYFNNGDKADLLRRATKERHNWPYRWLEDKKFQSRG
                     TVKGRLVLSNGQPASNVNLFLGNENYTMVQGAGYQYYSFTDDAGYFEIPHVRTETSYR
                     LQAFGSFWSRYTAADKQLETFLYEKKINVHKGKTNDLGTIKWSASDEKFEELWSIGAF
                     DRTTLGFLDGGLKYENMLIESCPSDLTYVIGEDNESDWCFGKGKKGVWTVQFEVDADD
                     VKRDAQLYLSFAGYTGNATFVGGNSTSLAVHVNDVVLGRDRFNTNITNDKSTYRSSSY
                     GGNWYLTSLDVPSGALTSGTNNVSFVTTNSEVNKGFLWDSLKFVWKL"
     gene            <97836..>98864
                     /locus_tag="PAS_chr4_0045"
                     /db_xref="GeneID:8201136"
     mRNA            <97836..>98864
                     /locus_tag="PAS_chr4_0045"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493407.1"
                     /db_xref="GeneID:8201136"
     CDS             97836..98864
                     /locus_tag="PAS_chr4_0045"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493452.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0045"
                     /db_xref="EnsemblGenomes-Tr:CAY71273"
                     /db_xref="GeneID:8201136"
                     /db_xref="GOA:C4R6P8"
                     /db_xref="InterPro:IPR018465"
                     /db_xref="UniProtKB/TrEMBL:C4R6P8"
                     /translation="MSSNRTYAELLEKQGERLQKRWRSIIDKYSKVDLDEQGDLIDLH
                     TGEIVEDNGHLESVSSRKHNIWKAEKEDILDEDFESTEDIEAVDQNSEQDIGEESSLE
                     RSSDETSGASSNESSNESPENSEDNSEIKSSQGDVSKESLSEDSKASNDQEEPEDQIN
                     KRNKLKKTSKLTLQESLPVFKKSSLDPSSNDLRYDKRDNRLIADENSLSLRDNLILIN
                     KNTSTPFSSPLRRSPQIPLVSPTTPTRRTPKPISYFSTPRRTKPDIKNELLPVSPKTA
                     SPTKRRRSSRTRELSSSTNAVYLDLTKETNLGSPWTDKSPTKSPIINTRTDTERDTAI
                     DDEVLIDN"
     gene            complement(<99138..>100178)
                     /locus_tag="PAS_chr4_0046"
                     /db_xref="GeneID:8201137"
     mRNA            complement(<99138..>100178)
                     /locus_tag="PAS_chr4_0046"
                     /product="Mitochondrial outer membrane and cell wall
                     localized SUN family member"
                     /transcript_id="XM_002493408.1"
                     /db_xref="GeneID:8201137"
     CDS             complement(99138..100178)
                     /locus_tag="PAS_chr4_0046"
                     /codon_start=1
                     /product="Mitochondrial outer membrane and cell wall
                     localized SUN family member"
                     /protein_id="XP_002493453.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0046"
                     /db_xref="EnsemblGenomes-Tr:CAY71274"
                     /db_xref="GeneID:8201137"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:C4R6P9"
                     /translation="MKSQLIFMALASLVASAPLEHQQQHHKHEKRAVVTQTVTVAAGQ
                     TAAAGSAQAVVTSSAAPASVASSAAASASSSSSSYTSGASGDLSSFKDGTIKCSEFPS
                     GDGVVSVSWLGFGGWSSIMNLQGGTSESCENGYYCSYACEAGYSKTQWPSNQPSDGRS
                     VGGLLCKDGLLYRSNTAFDTLCVPGKGTASVENNVSKGISICRTDYPGSENMCVPTWV
                     DAGNSNTLTVVDEDNYYEWQGLKTSAQYYVNNAGVSVEDGCIWGDESSGVGNWAPLVL
                     GAGSTGGLTYLSLIPNPNNKKAPNFNVKIVATDGSSINGDCKYENGIFVGSSTDGCTV
                     TVTSGSAKLVFY"
     gene            complement(<100931..>101815)
                     /locus_tag="PAS_chr4_0047"
                     /db_xref="GeneID:8201138"
     mRNA            complement(<100931..>101815)
                     /locus_tag="PAS_chr4_0047"
                     /product="Peripheral membrane protein located at Vid
                     (vacuole import and degradation) vesicles"
                     /transcript_id="XM_002493409.1"
                     /db_xref="GeneID:8201138"
     CDS             complement(100931..101815)
                     /locus_tag="PAS_chr4_0047"
                     /codon_start=1
                     /product="Peripheral membrane protein located at Vid
                     (vacuole import and degradation) vesicles"
                     /protein_id="XP_002493454.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0047"
                     /db_xref="EnsemblGenomes-Tr:CAY71275"
                     /db_xref="GeneID:8201138"
                     /db_xref="InterPro:IPR018618"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q0"
                     /translation="MPSNSCVTDNSSFLKEEDPIKTAKDKVNNERHLKDALTGDDAHA
                     NIDEQEVKGWQPEGSKLNNKTESYDLHTGSANNVSEDKYISMEFTPSLASTKSWHKGV
                     QPLTSSFLKPNASFIGSQQSGRSTYEVKVDLKQVDLKKSTLTGFLTIKGLTESHPEII
                     TLFQGEIVGPKFSFFTNKDSWGSDSRTDIQHWSRFPSFRSLNFNSGNDVLNSHIYDNY
                     LNNEFIYMRWKEMFLIPDAKVRDIKGASFAGFYYVCFSQLTGSISGLYFHKYSEKFQQ
                     LELCHAPDGGCSSYFKLA"
     gene            <102215..>104515
                     /locus_tag="PAS_chr4_0048"
                     /db_xref="GeneID:8201139"
     mRNA            <102215..>104515
                     /locus_tag="PAS_chr4_0048"
                     /product="Intracellular beta-1,3-endoglucanase, expression
                     is induced during sporulation"
                     /transcript_id="XM_002493410.1"
                     /db_xref="GeneID:8201139"
     CDS             102215..104515
                     /locus_tag="PAS_chr4_0048"
                     /codon_start=1
                     /product="Intracellular beta-1,3-endoglucanase, expression
                     is induced during sporulation"
                     /protein_id="XP_002493455.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0048"
                     /db_xref="EnsemblGenomes-Tr:CAY71276"
                     /db_xref="GeneID:8201139"
                     /db_xref="GOA:C4R6Q1"
                     /db_xref="InterPro:IPR005200"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q1"
                     /translation="MGLLDKLKEKSRAKSGGASNYENSEHQSQTHLRYSRPPAPLPKS
                     SNSSANLFSKNFLLNQDVTTLFPVADRYPVPLPAGYSRASSPLPTNSFYETLLLEDHS
                     CPVWTHPYSLWIPPKDMNRPGLALNHVDEHMKVFGPDNTLEHPQFFFSPVAILSLCLS
                     AMEFGSSPVQVSVTNTKKLYCHLSLSNGYGSNITVPIIQGMAFVSAIYENCQPRLYSN
                     VGFRELTAVGTLNNGMRKYRATLNDNTIWSLYVSTHCDLQFNSPEEITSCSQGPFQGQ
                     TLVQVAKLDSPHYDEICGNVVTGMHLYGDSSLVQNETTQTGTYGFNFDLLQSNGPSDL
                     AMWTLPHQYTVLSCGKVTDLSLNSTVKGPMRLVRTSGKSVLMTEQLPPHELQFAPWTS
                     LHQSNTSHAISKKAHQEICRVARSEFAADRIVEWSCTDSMYTSGKILDKAAYQLYVLA
                     YEVRDRELTLEALRRLEAALSRFVNNKQPQPLYYDPFWKGIVSGAGLDGNIFVDYGNT
                     HYNDHHFHYEYHIHAAALLVKVDKDFDSGQRERWIRPWVEALLSDVATPIEDHSQFPQ
                     FRSFDWFHGHSWATGLFARGDGKDEESSSEDYNMSYALYCWGLAVDNKHLVAMGKLML
                     GVQRHAVNSYMLYSDDNQIMPRQFVGNKVSGILFENKIDHTTYFGQRPEYIHGIHMLP
                     LTPISSFIRNPKFCKEEWNQRLGKEFVSAIPEGGWKGLLTLSTVLFEPEFAYDFFVRK
                     DFDPLNLDNGMSQSWSLLLAAHAAQK"
     gene            <104680..>105546
                     /locus_tag="PAS_chr4_0049"
                     /db_xref="GeneID:8201140"
     mRNA            <104680..>105546
                     /locus_tag="PAS_chr4_0049"
                     /product="Mitochondrial protein, putative inner membrane
                     transporter"
                     /transcript_id="XM_002493411.1"
                     /db_xref="GeneID:8201140"
     CDS             104680..105546
                     /locus_tag="PAS_chr4_0049"
                     /codon_start=1
                     /product="Mitochondrial protein, putative inner membrane
                     transporter"
                     /protein_id="XP_002493456.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0049"
                     /db_xref="EnsemblGenomes-Tr:CAY71277"
                     /db_xref="GeneID:8201140"
                     /db_xref="GOA:C4R6Q2"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q2"
                     /translation="MIPEDPDTNRTAKDLTAGSIGGIAQVLTGQPFDIVKVRLQSAPP
                     GRFSGALDVVRQIFYKEGPLAFYKGTLTPLLGVGACVSVQFSVNEAMKRFYASQGVAL
                     GNAQYYTCGLFAGVANGFLASPIEHVRIRLQTQTNKAYKGPLDVATKLLKTGGITSLM
                     RGLGPTLIREGQGMGVYFMTFESLVERTMKHDGIARKDIPGWKLCVFGGLAGYSMWFA
                     VYPVDVIKSRLQTDNISNPEFRNGFSVAKHIYKVDGVKGFFRGFAPTILRAAPANAAT
                     FLAFESAMRLLD"
     gene            complement(<105601..>106449)
                     /locus_tag="PAS_chr4_0050"
                     /db_xref="GeneID:8201141"
     mRNA            complement(<105601..>106449)
                     /locus_tag="PAS_chr4_0050"
                     /product="Chorismate mutase, catalyzes the conversion of
                     chorismate to prephenate"
                     /transcript_id="XM_002493412.1"
                     /db_xref="GeneID:8201141"
     CDS             complement(105601..106449)
                     /locus_tag="PAS_chr4_0050"
                     /codon_start=1
                     /product="Chorismate mutase, catalyzes the conversion of
                     chorismate to prephenate"
                     /protein_id="XP_002493457.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0050"
                     /db_xref="EnsemblGenomes-Tr:CAY71278"
                     /db_xref="GeneID:8201141"
                     /db_xref="GOA:C4R6Q3"
                     /db_xref="InterPro:IPR008238"
                     /db_xref="InterPro:IPR020822"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q3"
                     /translation="MEFKKPATVLNLANIRQALVRMEDTVVFSFIERSQFYESPSVYA
                     PNKYKIPNFSGSFLDWLLLQNEKTHSLVRRYESPDETPFFPDQLEESFLPSLNYPPIL
                     ADYADEVNVNDEIRTVYIEKIVPQIAAKKGDQDENIGSTACADVDCLQALSRRVHFGK
                     FVAEAKFQNEMARYTNLIRNKDIKGIEEAITDSAVEAKILERLIAKGHAYGTDPTLRY
                     SQNPQSKVQPEAIAKIYKEVVIPLTKKVEVEYLLRRLGDDDEAEAQDPQRKTQLMNRL
                     LSNSLW"
     gene            complement(<106739..>107680)
                     /locus_tag="PAS_chr4_0051"
                     /db_xref="GeneID:8201142"
     mRNA            complement(<106739..>107680)
                     /locus_tag="PAS_chr4_0051"
                     /product="Probable Hsp40p co-chaperone, has a DnaJ-like
                     domain"
                     /transcript_id="XM_002493413.1"
                     /db_xref="GeneID:8201142"
     CDS             complement(106739..107680)
                     /locus_tag="PAS_chr4_0051"
                     /codon_start=1
                     /product="Probable Hsp40p co-chaperone, has a DnaJ-like
                     domain"
                     /protein_id="XP_002493458.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0051"
                     /db_xref="EnsemblGenomes-Tr:CAY71279"
                     /db_xref="GeneID:8201142"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q4"
                     /translation="MSKANPLSFLSYLPSYTPPMISFVRRYSNLSDRIITNESHIKAL
                     LTWNPDTPYSSLQLPNGAIAKDVKQRYHQLAKIYHPDLHTNTTQVTFTDTHGHRVCIS
                     RKELEERFRRISAAYQMLRDTKARREYDISGRGWVTPHGPGRSRHSTQASTNRFGGAG
                     VSDHEFFYAGTWEDFARMRAQQDPGVARREREELNRIFLTGALSMAAAVSILWLAWSV
                     GGLDEIEAQTTEVHEKCLSDLERCYTNYGFEQNKVTRINRFLWLRKLNELIMGNINPM
                     HIQPVALSTDRLMDYNTDFVAATSQSGASTSAEDSRR"
     gene            complement(<107820..>109082)
                     /locus_tag="PAS_chr4_0052"
                     /db_xref="GeneID:8201143"
     mRNA            complement(<107820..>109082)
                     /locus_tag="PAS_chr4_0052"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493414.1"
                     /db_xref="GeneID:8201143"
     CDS             complement(107820..109082)
                     /locus_tag="PAS_chr4_0052"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493459.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0052"
                     /db_xref="EnsemblGenomes-Tr:CAY71280"
                     /db_xref="GeneID:8201143"
                     /db_xref="GOA:C4R6Q5"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q5"
                     /translation="MSAVTVTGNNGDASRSNTTTTTKRTGNVSSFSQSKGLTAIDTWG
                     NVFKVPDFTIKQILDAIPKHCYERRLTTSFYYVFRDIFLIGCTMFMGSFIPMIENVFL
                     RGAAYAALVFLLSVEYTGLWVLAHECGHQAFSDYGWVNDTVGWILHSYLLVPYFSWKY
                     SHGKHHKATGHLTRDMVFVPATKEKFLEKRNASKLGELGEDAPIFTLYQLVAQQLGGW
                     ILYLFTNVTGQPYPNTPKWMQNHFVPSSPIFEKKDYWFIILSDLGILAQLMVLYVWRQ
                     QMGNWNLFIYWFLPYVLTNHWLVFITFLQHSDPTMPHYEAEQWTFARGAAATIDREFG
                     FIGPFFFHDIIETHVLHHYVSRIPFYNAREASEGIKKVMGEHYRYSGENMWVSLWKSG
                     RSCQFVDGENGVKMYRNINNWGIGTGEK"
     gene            <111582..>114773
                     /locus_tag="PAS_chr4_0054"
                     /db_xref="GeneID:8201144"
     mRNA            <111582..>114773
                     /locus_tag="PAS_chr4_0054"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493415.1"
                     /db_xref="GeneID:8201144"
     CDS             111582..114773
                     /locus_tag="PAS_chr4_0054"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493460.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0054"
                     /db_xref="EnsemblGenomes-Tr:CAY71281"
                     /db_xref="GeneID:8201144"
                     /db_xref="InterPro:IPR021717"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q6"
                     /translation="MAQSIGSLANIYIRPNDNLPVYSIDIPLEHYTLSDEVKSSFDPE
                     DKFKRQVTVVGGFLEIDNVVHKLNYRIHQSLDSFELVPITLNQTITNYDFQALRFQLP
                     QDITIQEKCFSIQYGGGEILVDFLSSKNTIISLNISLQNFIKDKSELTSLNFHTWGFI
                     SAPYSFEVRNPFLLRPLTENELILSLKDGGLLQLSRSKELKTFHVTIFNDTSYLDSLK
                     LKLFRRGKFWNENLSPKAIISILPLTETYLATLSIDKILRIWNLNTRGVVLERSLSNE
                     LPDSLAKDYLDSSVANLLQKKFFGNTVYLSVSLPLSENIIILYSVTLSDDTVSLSNLE
                     NHEILPIKPDTGNLWLLQDYAFLITGATSAKFWFLWRSNSFSVIHQYDFSLDNGELSI
                     KSALDLTTPKSSIKEDFNGKVDQIDAHYVTRIFNLYDLAIISTVYEIFERLYYVDNFV
                     FEKELAKSSTYSLKDRIVNLLHSHLTSKDNNLYDLGSQWVKFETTCKELWDTNNESLS
                     INLDLENNLLYVLNGLNYSIVRDATIFELILSANPITSSQNITKTSIEDLNQLSALLS
                     DYSSSFPQSVLSEVAEKLLTISDNERNKTTLVMNELFQKYLQSYISKQQITELLSGLS
                     SIEHVIESVEFLISYPESSYDFEEYSESSVSRRTEWGEEILFREFQSRALVHKVVFLN
                     LILVMITVDNSNEIIVTLFEKLLKSFKHNQLVLEAMKRTSEKPPIFASIFKFLFPKPH
                     NINGNSIASLFSRLLKEVADGSFIKATVSHLLNQNDYTLLGPELMVHLQKATPVDVFL
                     RAMVAIDVKPEDAKEIFQRNDTLISKHTLTQHESWLLNPIERLTVLFNVSLTEYYNHL
                     TEFFSTRQLHSIALSMALRAIESSAPGEDDHIQQWNCFTLALSVENYELAYSATQNLK
                     PEFRKNALKQFILALMKNGLLLKFINYDFTGSLELINEVLQEFIDTTPNLEATLKFHK
                     LAYSWRLKVGDYRGACESLYQFIDKQRSRETRMTENESIVLVEFYLIIINLLFTFSNA
                     DDRWILAKQKAGNKILTLPSLQEEYQDLISSIS"
     gene            complement(<114813..>116495)
                     /locus_tag="PAS_chr4_0055"
                     /db_xref="GeneID:8201145"
     mRNA            complement(<114813..>116495)
                     /locus_tag="PAS_chr4_0055"
                     /product="Protoporphyrinogen oxidase"
                     /transcript_id="XM_002493416.1"
                     /db_xref="GeneID:8201145"
     CDS             complement(114813..116495)
                     /locus_tag="PAS_chr4_0055"
                     /codon_start=1
                     /product="Protoporphyrinogen oxidase"
                     /protein_id="XP_002493461.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0055"
                     /db_xref="EnsemblGenomes-Tr:CAY71282"
                     /db_xref="GeneID:8201145"
                     /db_xref="GOA:C4R6Q7"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="InterPro:IPR004572"
                     /db_xref="InterPro:IPR027418"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q7"
                     /translation="MLKSLAPNSSIAVLGSGISGLTFSFFLNRLRPDVKIHIFEKSKQ
                     VGGWIRSEEHETFHFEKGPRTLRGTNTGTLMLLDLLTKIGANDKVLGLHKDSLANKKY
                     LLSPFSDVHGNNAKLLQVPQDFSSFVKFMFDPLSKDLILGLLKEPWQPKLKYSDESVD
                     HFFNRRFATKLSENIVSAIVHGIYAGDVKKLSVKAIFPRLPEMEQESGSIIRYMIAQY
                     RTKKNVKQKVDPFLADYEKLIGTSLSFKNISLFLKNFPMLSFQGGLQKLPISLKNHLS
                     QIENIKFHFDSKIKNIALESGKVALTDHDQVYLVDHVRSTINTNELAKIISPVVPSST
                     KKKSVFKSKANGPGLVKCLSWLHYTNILMCNIYIPKHVSKSITGFGYLVPRSMSSQAS
                     KLLGVIFDSDIETAMTPNFTEANITAINSNSASPKQLQKFSDQFVNNDLPKYTKLTLM
                     LGGHYLKSEADMPGSAESKHAVKAILSNHLNIDLDEFASLPDFKMEITKIPNCIPQYE
                     VGYLDLKRKVQNAASKEFNDQISFGGMAFGDGVGIPDCVQNAFKDSATLSGI"
     gene            complement(<117872..>119011)
                     /locus_tag="PAS_chr4_0058"
                     /db_xref="GeneID:8201146"
     mRNA            complement(<117872..>119011)
                     /locus_tag="PAS_chr4_0058"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493417.1"
                     /db_xref="GeneID:8201146"
     CDS             complement(117872..119011)
                     /locus_tag="PAS_chr4_0058"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493462.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0058"
                     /db_xref="EnsemblGenomes-Tr:CAY71283"
                     /db_xref="GeneID:8201146"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q8"
                     /translation="MSNEYEDETSPSLLKELSSINDQVSSLPKWRQLLAVFKNLILHR
                     VFLSDFERQLVTRIANDSDFISKYSKPIKIIYDEGHELTLSYFHYAPSKIRKTILFVH
                     GLAGQTTQFEYILKDLIGKDIELISIDLPGFGNSKRKFNASYKNYFKESHSNETMIQV
                     ESSVSAFLQKIRPTPDTLSRIIELVLQKLSINEVSIVSHSYGTHIANKLLKKVKINEW
                     ILLSPPSFTGIDHRSRWLTVFIWFPILFHLFRSIDRLDGLNSTSLNRYIWTGNSPDLG
                     TLFKQLKQFRWNLDTDSTAYLRYIQSLKLNQLNDLDNIDVKSIDIFVGSNDKVTPPSA
                     SRRTAEYLRGKNHQVGLTELKECSHSIMLDRKVELTSSVVQKLVH"
     gene            <119176..>120147
                     /locus_tag="PAS_chr4_0059"
                     /db_xref="GeneID:8201147"
     mRNA            <119176..>120147
                     /locus_tag="PAS_chr4_0059"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493418.1"
                     /db_xref="GeneID:8201147"
     CDS             119176..120147
                     /locus_tag="PAS_chr4_0059"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493463.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0059"
                     /db_xref="EnsemblGenomes-Tr:CAY71284"
                     /db_xref="GeneID:8201147"
                     /db_xref="UniProtKB/TrEMBL:C4R6Q9"
                     /translation="MSDLNFSDIVNSSPRSESRKRVKSNPANENSQIIELGDEKDQLM
                     AKRKELKRKILLNKEQLKELQGVKENLASSKYGIENDNETEDIIIPHSGLLQLFMKYN
                     TYPSHDMESRLKYLRRVFPNLKLEVSSELTKQVLVDVQIQRLNAFPRLVSNFKIRMTI
                     DKKEEKLDDWSLVEHDFDIEDPRFVQKLNGKDPSKFLFGLHEYFEFYNERFDTFHRII
                     RNFKDELQLIGFDTFNSGQQELKLLLHLIDEKSITITDSTLNLQINWRILFDDLEETF
                     YDSISCNVTKKNEIFTDSGLDETLQTLLHYKSSYESLSIIVKSLFQL"
     gene            complement(<120152..>120622)
                     /locus_tag="PAS_chr4_0060"
                     /db_xref="GeneID:8201148"
     mRNA            complement(<120152..>120622)
                     /locus_tag="PAS_chr4_0060"
                     /product="Evolutionarily conserved glucosamine-6-phosphate
                     acetyltransferase"
                     /transcript_id="XM_002493419.1"
                     /db_xref="GeneID:8201148"
     CDS             complement(120152..120622)
                     /locus_tag="PAS_chr4_0060"
                     /codon_start=1
                     /product="Evolutionarily conserved glucosamine-6-phosphate
                     acetyltransferase"
                     /protein_id="XP_002493464.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0060"
                     /db_xref="EnsemblGenomes-Tr:CAY71285"
                     /db_xref="GeneID:8201148"
                     /db_xref="GOA:C4R6R0"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C4R6R0"
                     /translation="MQPVSVPALPQGYNLRRVGKEDFQDKNLFKTLSILTTVGDIPEP
                     KFHALIEYWNDRKEIYNPMVITNAENVIIATGMLFVEHKLIHGGGKVGHIEDISVNPS
                     EQGKKLGLIMIRNLIQIAQTEGCYKVILDCDEKNVRFYEKCGMKIEGVEMGYRF"
     gene            complement(<120724..>122877)
                     /locus_tag="PAS_chr4_0916"
                     /db_xref="GeneID:8201149"
     mRNA            complement(<120724..>122877)
                     /locus_tag="PAS_chr4_0916"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493420.1"
                     /db_xref="GeneID:8201149"
     CDS             complement(120724..122877)
                     /locus_tag="PAS_chr4_0916"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493465.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0916"
                     /db_xref="EnsemblGenomes-Tr:CAY71286"
                     /db_xref="GeneID:8201149"
                     /db_xref="GOA:C4R6R1"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="UniProtKB/TrEMBL:C4R6R1"
                     /translation="MTRQRSATIGARRHRKNSLVIVDPPTVEYHHLKHETDRNDLKKN
                     VSTTHLHTLEEQSRKKDLLLWPLTNEENREYTEYVKSELLYPHINEVLDFESYQTLDT
                     ETADVLDETLDYFTHVHDVNGSLLQETQDIIDQLNDLQLINESIINQTKEFHETSNKL
                     ITETNEDRQLYNGVMEILDVFNQLDPIIHKLNTTSSSGMVNDASFAEILTKLDFCMQF
                     LETDERREFKEYAKYKTRFRQCLIRALTLIRNYVIETFKEYEPIIVAKLAEESDLSFL
                     QKKLVTNEVFTEDLGEKNIIQLISYLNERYSADDEEISNLLKDIYAQYFRLRWKLVHF
                     LVEPLLLEIKENSLDVALKHFDSWYGLISDEKNLLESFFTGRNDLQTQQLSQWLAQVI
                     SPLHEILKGEIAKVHDVEELKKLLTELQQYRNTSMSGDEEEELNLNKFFEPVINDFDN
                     QYLAQIRQRVTDSIINYEPSPKELKLSAATLPVYPPILEVSAILEESQLLISKASFDH
                     LANTLVHISILSILKNYGGELNHKVDKQVIARKLFVIKSLLHLKNELQTKYAFIDFGT
                     ASKNTSITSVIRHLFHKSNPVFEHYVEFDSTKTNKSRKDLRLWFLPTVLTQDTDSFTE
                     LSLVLHKIINEFIVDYATKIIQDIDPQNMLDTLTYQISHLTTSISTNIEDEKITESLI
                     ERIQGRIVDEYEARKLPDTDRFLVFFNQAIADDDT"
     gene            complement(<123273..>123556)
                     /locus_tag="PAS_chr4_0061"
                     /db_xref="GeneID:8201319"
     mRNA            complement(join(<123273..123453,123522..>123556))
                     /locus_tag="PAS_chr4_0061"
                     /product="Component of the RNA polymerase II general
                     transcription and DNA repair factor TFIIH"
                     /transcript_id="XM_002493421.1"
                     /db_xref="GeneID:8201319"
     CDS             complement(join(123273..123453,123522..123556))
                     /locus_tag="PAS_chr4_0061"
                     /codon_start=1
                     /product="Component of the RNA polymerase II general
                     transcription and DNA repair factor TFIIH"
                     /protein_id="XP_002493466.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0061"
                     /db_xref="EnsemblGenomes-Tr:CAY71287"
                     /db_xref="GeneID:8201319"
                     /db_xref="GOA:C4R6R2"
                     /db_xref="InterPro:IPR009400"
                     /db_xref="UniProtKB/TrEMBL:C4R6R2"
                     /translation="MPRAIKGALVKCDPSIRALILKIDAESHDIVIEELDDTHLVVDQ
                     NRIPFVKAELARILAQNSYNPLDEDEA"
     gene            <123739..>126957
                     /locus_tag="PAS_chr4_0062"
                     /db_xref="GeneID:8201150"
     mRNA            <123739..>126957
                     /locus_tag="PAS_chr4_0062"
                     /product="Vacuolar membrane protein"
                     /transcript_id="XM_002493422.1"
                     /db_xref="GeneID:8201150"
     CDS             123739..126957
                     /locus_tag="PAS_chr4_0062"
                     /codon_start=1
                     /product="Vacuolar membrane protein"
                     /protein_id="XP_002493467.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0062"
                     /db_xref="EnsemblGenomes-Tr:CAY71288"
                     /db_xref="GeneID:8201150"
                     /db_xref="GOA:C4R6R3"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R6R3"
                     /translation="MVENTENSEKSSIDLSTSDRASQKPELPEAVLVDGNNELAKVDD
                     SGEEERGKKEQEQQEDKEGEEEGHNQQTEEANGSIKTSKAKEENGAAVSVHEASSKDD
                     ETLDEQKEGQNGVDKTTEASNKVAQQQLDASDNLDSLDSSTSDLSDELQSQSDVNDNP
                     DAELPQFTFHRISQLPPSFMKHDPISASYIHEKFFLFATHNGFIHISDNNFQEIRTFR
                     AHRASILSLHTDGEYFASASMDGTVVVGSILNDKDIVAYDFKRPVHAVIIDRQYKVTK
                     SFISGGMSGEVILSTRNWLGQRADTVLETEHGPITSIKCVDDLIIWTNDKGITFYQTS
                     TRTMLLNTPLPKGFNRPDIYWPKYSFPETDRLIVGWNDHVWFYKLTIPQTVQTLQAAN
                     FLSTAASSFRIGAVEKSVELESHVHLPDTIIGGISSINDNLIVLNYLAPVEDKSNNSR
                     RPKMKSAPPELQVIDPWTKEELSVDIIEPKDYATLGVNDYHLEKSIGEMVRWFLISPN
                     DAILIKEFSLHDQLEWYIEHKMYQKAWSISEYILPPLERITLGVQQVHEYINSEKWSE
                     AGELLTKVLAHSDDTSKEHQEYIKGEWANFLDLFFEKGHQDQIVDCIPKVYFPNSAVN
                     IDPKIYGKYLEHYLTDWKNIPKFLQLYHDWDHRLLDLRYFQFLLDNTLNSNQNESNNK
                     MPMVDKIRFLFIELCLEIDDPQPAVKHLIIMRDPGTLQFLISNHILGKFVDRLPEILT
                     LELNDEELQYATVDFIREKLTTNIELLASKHREIMPSKIIELNERAGLSVINYLYLEK
                     LSQLDKLLTKDFEDEMVMLYAKFNVSLLYNFLSKHNNYNIDSAIEICEEMHCYKELVY
                     LWGKIGKNKKAVTLIIDKLEDPDLAIQFVATNNDSELWDYLLEYSMDKPKFIKALITA
                     ANSSQYFNNMDDPFVLKIDPISIVKRIPERIEIEGLKRALMNITYDNYLELTINKIIL
                     QIIQEETLEIGNFYRKERLKGATLEPRQNSKFLKETVIMYSDPAKPLVTETEVVGEGN
                     EWKQVVNEDDNATIDISTKISHLNYIRQKLVLLRLRSENGRT"
     gene            <127078..>128520
                     /locus_tag="PAS_chr4_0063"
                     /db_xref="GeneID:8201151"
     mRNA            <127078..>128520
                     /locus_tag="PAS_chr4_0063"
                     /product="C-24(28) sterol reductase, catalyzes the final
                     step in ergosterol biosynthesis"
                     /transcript_id="XM_002493423.1"
                     /db_xref="GeneID:8201151"
     CDS             127078..128520
                     /locus_tag="PAS_chr4_0063"
                     /codon_start=1
                     /product="C-24(28) sterol reductase, catalyzes the final
                     step in ergosterol biosynthesis"
                     /protein_id="XP_002493468.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0063"
                     /db_xref="EnsemblGenomes-Tr:CAY71289"
                     /db_xref="GeneID:8201151"
                     /db_xref="GOA:C4R6R4"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:C4R6R4"
                     /translation="MSKTKTDGTKVGKQAEPIENNIDKSSHLVDSSGTSRFLADKEIE
                     YDFGGPIGVTAMMLGFPLLMYYMWISAEFYHGALAWPEPDQSWPQFLAHLYQLFLDHG
                     KPSPRAWRIFLTFFFTQMLFYVTLPGIWTKGQPLNHLNRKQLPYYCNALASFYTSIAI
                     AVVLHLTGLFKIYTIVDMFGEIMTCAITLGFTISIALYVYTLTVSGDYHRMTGNHVYD
                     MFMGAPLNPRVGIIDLKMFFEVRLPWYTLFFLTLGLCAKQYEEYGYVSTQAWFMLLAH
                     WLYANACSKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYSQCTLFLFYHDPQEYNW
                     STGYNVLLFTVLLAAYYFFDTGNAQKNAFRKQMGGDVHIRKSFPFLPYQILKNPKYLK
                     CSNGSVLLIDGWYKYARKIHYTADYIQCLTWALACGGASVFPWFFPVFFLITLLHRAD
                     RDNAKCKKKYGADWDKYLKECPYQFLPWIY"
     gene            complement(<128559..>129335)
                     /locus_tag="PAS_chr4_0064"
                     /db_xref="GeneID:8201152"
     mRNA            complement(<128559..>129335)
                     /locus_tag="PAS_chr4_0064"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493424.1"
                     /db_xref="GeneID:8201152"
     CDS             complement(128559..129335)
                     /locus_tag="PAS_chr4_0064"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493469.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0064"
                     /db_xref="EnsemblGenomes-Tr:CAY71290"
                     /db_xref="GeneID:8201152"
                     /db_xref="UniProtKB/TrEMBL:C4R6R5"
                     /translation="MSGINLQINDEFKAYHLPFLWSYHTGLFDANGIKINFSKEAPVE
                     NSKTIGFEFNNLLSSQITLLEGVNLELLYLDNLNLSEKLTIGAPIVGGLDTNQFTALL
                     ADKFNNFELLILDTQTLVEGMYSKQLDAIVGFDLLHKIQLEDHGMRLKSSNIVRTRLL
                     DSKVDLVCGLRNITDDEAEKIKLCLTCAIEQILSDPLDTLGDISTLVPELDFDFQLRI
                     LERSFPYFVKSKMKHSAVIDYQQFKSFQDEAGGFHRICIE"
     gene            <129794..>130816
                     /locus_tag="PAS_chr4_0065"
                     /db_xref="GeneID:8201153"
     mRNA            <129794..>130816
                     /locus_tag="PAS_chr4_0065"
                     /product="Protein involved in synthesis of the thiamine
                     precursor hydroxymethylpyrimidine (HMP)"
                     /transcript_id="XM_002493425.1"
                     /db_xref="GeneID:8201153"
     CDS             129794..130816
                     /locus_tag="PAS_chr4_0065"
                     /codon_start=1
                     /product="Protein involved in synthesis of the thiamine
                     precursor hydroxymethylpyrimidine (HMP)"
                     /protein_id="XP_002493470.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0065"
                     /db_xref="EnsemblGenomes-Tr:CAY71291"
                     /db_xref="GeneID:8201153"
                     /db_xref="GOA:C4R6R6"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="InterPro:IPR027939"
                     /db_xref="UniProtKB/TrEMBL:C4R6R6"
                     /translation="MSTNKITFCLNWQAAPYHAPIYLAQKLGYFKDEGLDIAILEPGN
                     PSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVGSLLDEPFTGILYLESSGITDF
                     QSLKGKRIGYVGEFGKIQLDELTKHYGMTPDDYTAVRSGMNVAREIINGNIDAGIGIE
                     CVQQVELEEYLRSQGKDVDGAKMLRIDKLAELGCCCFCTVLYIVNDKFLAANPDKVRK
                     FMSAVKRATDYVIQKPAEAYADFIEIKPLMGTPLNYKIFQRSYAYFSESLYNVHRDWN
                     KVNAYGKRLMVLPEDFKANYTNEYLSWPEPKEVSDPLEAQRRMNIHQEQCKCNPSFKR
                     LALTGL"
     gene            complement(<131003..>131812)
                     /locus_tag="PAS_chr4_0066"
                     /db_xref="GeneID:8201154"
     mRNA            complement(join(<131003..131748,131806..>131812))
                     /locus_tag="PAS_chr4_0066"
                     /product="Alpha 1 subunit of the 20S core complex of the
                     26S proteasome"
                     /transcript_id="XM_002493426.1"
                     /db_xref="GeneID:8201154"
     CDS             complement(join(131003..131748,131806..131812))
                     /locus_tag="PAS_chr4_0066"
                     /codon_start=1
                     /product="Alpha 1 subunit of the 20S core complex of the
                     26S proteasome"
                     /protein_id="XP_002493471.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0066"
                     /db_xref="EnsemblGenomes-Tr:CAY71292"
                     /db_xref="GeneID:8201154"
                     /db_xref="GOA:C4R6R7"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C4R6R7"
                     /translation="MSVLGSAGFDRHITIFSPEGRLYQVEYAFKAINVENINAMGICG
                     EDSVVLISQKKIPDKLLDPSTISYMFKISNSVGMLATGSIPDARAQALRARAEATEFK
                     YKYGYEMPADALAKRIANIAQIYTQRAYMRPLGVSLMFAAVDDEHGPSLFKTDPAGYY
                     TSYKATATGPKQQEILTKLEKSYKKKRNASVLVEGSWERVVEFAIIQLSNTLGMEFRK
                     DDLEVAVATKDGFRSLSSDEIDERLVFIAEQD"
     gene            complement(<131996..>134065)
                     /locus_tag="PAS_chr4_0067"
                     /db_xref="GeneID:8201155"
     mRNA            complement(<131996..>134065)
                     /locus_tag="PAS_chr4_0067"
                     /product="Mitochondrial ribosomal protein of the small
                     subunit"
                     /transcript_id="XM_002493427.1"
                     /db_xref="GeneID:8201155"
     CDS             complement(131996..134065)
                     /locus_tag="PAS_chr4_0067"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the small
                     subunit"
                     /protein_id="XP_002493472.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0067"
                     /db_xref="EnsemblGenomes-Tr:CAY71293"
                     /db_xref="GeneID:8201155"
                     /db_xref="GOA:C4R6R8"
                     /db_xref="InterPro:IPR015324"
                     /db_xref="InterPro:IPR016522"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R6R8"
                     /translation="MILSKSSRLLYKIPRQRSGLRFYSASLERFQKPQDEPVIVSPIS
                     YARRRRSEIFGQLVDNDEPSKKVNVIDADQLENEIAEIRNSESEEGLERISSQDSRLH
                     PLTIQGRVNRTEIKLNEEVSETINNHILLLNNPRHLRIKAAQTFVDLGTNGTHKPVQS
                     ELEADAHIAGLFVQNYASIYQVLSELKKRVGESFNPQRVLDVGFGPATGMVALNELMG
                     SDFNPTVKDAVVVGSYEMKQKAKIILSRQLAEYTAVAQDEFELDNESGPSEPVEAELK
                     RKVARIDTKRITIKTNLLSSLPIGNSKKYDLIILNHQLLLNKASYPAQVEESMDAYLQ
                     KLAPGGHLVIVERGTPLGFETIAKARQVAIRPENHSSNLKIPRPYQKGNFKTDRQLQD
                     DAELEPELKEHFEIIDHANSTVRDYYLKVVAPCAHHGVCPLQTLNPDVFSLPKYGKKL
                     NFCHFQTQVLRPKFSMELKKGLLLATKWTDKTSGIGIKGQAPAGNGRRNGRNNELASF
                     SYLILERSPSDAPTLSKLARLQESTKNRTNILGYEGDSIDNWPRVMKNPLKRKGLILA
                     EMCGPSGLIEKWYLSKGSGGKQIYHDARKLQAGDLWAIGGAKSAIPANTSYDHFREKI
                     EKKQSDMKVANRQQSRQELKLRKQTARNALQEAPKSLEESLYQLSVAHSMELEKKPKE
                     RRQFKKY"
     gene            <134213..>134977
                     /locus_tag="PAS_chr4_0068"
                     /db_xref="GeneID:8201156"
     mRNA            <134213..>134977
                     /locus_tag="PAS_chr4_0068"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493428.1"
                     /db_xref="GeneID:8201156"
     CDS             134213..134977
                     /locus_tag="PAS_chr4_0068"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493473.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0068"
                     /db_xref="EnsemblGenomes-Tr:CAY71294"
                     /db_xref="GeneID:8201156"
                     /db_xref="UniProtKB/TrEMBL:C4R6R9"
                     /translation="MDSELRFQRLVFTKRKPTRLTSKELLTAKNESKKTGITTTVGSR
                     TRSKAGHNLFKKHKHEHVANTASKVGNNSTFEERLEKQNVYDAEESRAKPFTHTPANN
                     TVNLGEKYKEWGPSINGYRFLDKEEKVNDYNVPNVEGQDSYGLSYPEDAEPLTKHLQT
                     YDEYIQNWRENTRLYWPNEENLWTCVSYDSIKQFLRGSQNLAAFKKRLKVERIRWHPD
                     KMKQNIDCNEKDLILVTETFQLINKLWEDFFKVKHS"
     gene            complement(<135055..>136053)
                     /locus_tag="PAS_chr4_0069"
                     /db_xref="GeneID:8201157"
     mRNA            complement(<135055..>136053)
                     /locus_tag="PAS_chr4_0069"
                     /product="Nucleosome assembly factor, involved in
                     chromatin assembly and disassembly"
                     /transcript_id="XM_002493429.1"
                     /db_xref="GeneID:8201157"
     CDS             complement(135055..136053)
                     /locus_tag="PAS_chr4_0069"
                     /codon_start=1
                     /product="Nucleosome assembly factor, involved in
                     chromatin assembly and disassembly"
                     /protein_id="XP_002493474.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0069"
                     /db_xref="EnsemblGenomes-Tr:CAY71295"
                     /db_xref="GeneID:8201157"
                     /db_xref="GOA:C4R6S0"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="UniProtKB/TrEMBL:C4R6S0"
                     /translation="MSLVSLLGVNVLNNPAKFTDAYEFEITFECLEPLKEDLEWKLTY
                     VGSSKSLDHDQELDSILVGPVPVGVNKFLFTADPPSPELIPSSELVSVTVILLSCSYK
                     EKEFVRVGYYVNNEYDSEELRENPPAKVQVDHIVRNILAEKPRVTRFNIVWDNENENP
                     DEFPPEQPDVDLEEDDEEDYAADELEEEVEGSVSRVTEDIADGEGEGEINGNEDNGND
                     AEADLIPTEDEAADGDSPSKKRKIENQEEEEEEEEAEELEAEEEDIEEDLEAEEDDED
                     IEEEEDANADTDEEGVEDGAEEGVDGEGAEDESAGEDEAAEDGESQPTVQESKVDD"
     gene            <136388..>137503
                     /locus_tag="PAS_chr4_0070"
                     /db_xref="GeneID:8201158"
     mRNA            <136388..>137503
                     /locus_tag="PAS_chr4_0070"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493430.1"
                     /db_xref="GeneID:8201158"
     CDS             136388..137503
                     /locus_tag="PAS_chr4_0070"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493475.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0070"
                     /db_xref="EnsemblGenomes-Tr:CAY71296"
                     /db_xref="GeneID:8201158"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:C4R6S1"
                     /translation="MQSPSKANINLSGTDPLDGILKTTTDPSNWRFTESSLIQALILK
                     KEQERTKQEYYRVESLNRTLEILRLACHARIPPHLIPTLISGNPGAATQSTMAAAGAS
                     ASEKVSPKGDEVARSQYKFGNSSQIPMPRGPNLGAVPLKDVPNHQRKLSPARVGRDAV
                     ASLGINDPGRVNGIHPRQDISHQKSSSLPPKVSIPELSTVDFHNQENLRNKLINSNGK
                     EQGMVSTHQLIQFHHWTPDKDTEAEITPNKRRRSSLVFESPDSTIADRDEYSFLGETP
                     SKGATSIQRTSSLNPKKFNRQHHTRTRSDTSIIRQIKQEEKNENILNANGVSPDGTST
                     RSSSISTTASSINFPPTTKGANNRPTPRFPNNILSGT"
     gene            <139138..>140412
                     /locus_tag="PAS_chr4_0072"
                     /db_xref="GeneID:8201159"
     mRNA            <139138..>140412
                     /locus_tag="PAS_chr4_0072"
                     /product="Protein required, along with Dph2p, Kti11p,
                     Jjj3p, and Dph5p, for synthesis of diphthamide"
                     /transcript_id="XM_002493431.1"
                     /db_xref="GeneID:8201159"
     CDS             139138..140412
                     /locus_tag="PAS_chr4_0072"
                     /codon_start=1
                     /product="Protein required, along with Dph2p, Kti11p,
                     Jjj3p, and Dph5p, for synthesis of diphthamide"
                     /protein_id="XP_002493476.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0072"
                     /db_xref="EnsemblGenomes-Tr:CAY71297"
                     /db_xref="GeneID:8201159"
                     /db_xref="GOA:C4R6S2"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="UniProtKB/TrEMBL:C4R6S2"
                     /translation="MPDIKPRRRFGGKKSLEGASVKPEEPTSGLVKKRKPKTVGRIMN
                     QIPEDILNNEDLNNSIKLLPSNYNFEIHKTVWNIKKQNAKRVALQMPEGLLIYSLIIA
                     DILEQFCDCEILVMGDVSYGACCIDDYTARSLDCDFIVHYAHSCLVPIDITAIKVLYV
                     FVTITIDEKHLESTIRRNFEHGTRLAVFGTIQFNPAIHALKGKLLEQKYDTGNECDSK
                     IIYAIPPQTMPLSKGEVLGCTSARLNKEQYDGMIYVGDGRFHLESAMIHNPEIPAYRY
                     DPYSRKFTREYYDQQEMNRVREDAINVAARAKTIGLILGALGRQGSPQTLATLEEKLK
                     AKGLTVVKIILSEIFPLKLAMFDGIDAFVQVACPRLSIDWGYAFSRPLLTPYECMVML
                     EQDKMWKSNYYPMDYYHKDGYGRGKVPDHSDL"
     gene            complement(<140438..>142852)
                     /locus_tag="PAS_chr4_0073"
                     /db_xref="GeneID:8201160"
     mRNA            complement(<140438..>142852)
                     /locus_tag="PAS_chr4_0073"
                     /product="Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p)"
                     /transcript_id="XM_002493432.1"
                     /db_xref="GeneID:8201160"
     CDS             complement(140438..142852)
                     /locus_tag="PAS_chr4_0073"
                     /codon_start=1
                     /product="Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p)"
                     /protein_id="XP_002493477.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0073"
                     /db_xref="EnsemblGenomes-Tr:CAY71298"
                     /db_xref="GeneID:8201160"
                     /db_xref="GOA:C4R6S3"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:C4R6S3"
                     /translation="MDFVYEYSDATPSGTFDDPLPAEPEPPFNLSNLNSYKDDLTKKF
                     SKMSILKSLKNDTNSVDDVDDSQSISNDGQRAYKYANQSLDLVNQHTTNKSIRTTSDE
                     QPSVSTVLSNRLSRVLNNTNYDPSTKELLSIVEKKIKEDTAHEYDKVTDPSFVGNLAR
                     RKLRNDIEHDVVDANFNFLKQLQPLRKTLGQIESDLNEMNELNNQITEKLSSRVEDTT
                     RLDNSIHELHATSKIISIKKKLLQNFQNRYTLSHFEAHQLEFGEIDDSFLEILKKAES
                     IHDDCSILLTMENATVGINIMNDMKKLSNNAIDRLSTFVTKHFSRLSSSNNTSASIED
                     KAFLKRSILFISERYPEQLSGITNQIVESRSKSLLDEFQIQLNGYADSASRNERDVNK
                     PLFLSAYDSERFLGDLLAYIHGTIVNERETVESLFSLQDEEKDNIVLTTLVESIVSKN
                     IESLATPLNLKIEQIIRNESKLTAIQAFYDLLSLYSMMLEKTLGSKNALLSTINSLKV
                     SALGKIQSSINIKLKNIERTANESMSYYNEDEQLDGTNHNFVSETHYIEEITPELAVP
                     DWLINFYGDVLPIFDNEKVTNAKELYEDLLKYCFEQIIQLIEKQIAQNKLNDAREILI
                     FKSNCYDFVYSKIVTLNIFKEKLDRLEVMIKECESKLTEIQYTYLLKQSGLYDIHNLV
                     NMISSTREDFFDVSVYEPITENSLFNGDKFKEISDRLQDFLPIALIDYQEERLLYLLP
                     PTLVNSIIQNSSVDFVNFYFKLSLIVKEYLKASEGCLRWDDMEVATLLSCESAYIKQK
                     PDIEES"
     gene            <144128..>145489
                     /locus_tag="PAS_chr4_0917"
                     /db_xref="GeneID:8201161"
     mRNA            <144128..>145489
                     /locus_tag="PAS_chr4_0917"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493433.1"
                     /db_xref="GeneID:8201161"
     CDS             144128..145489
                     /locus_tag="PAS_chr4_0917"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493478.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0917"
                     /db_xref="EnsemblGenomes-Tr:CAY71299"
                     /db_xref="GeneID:8201161"
                     /db_xref="GOA:C4R6S4"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:C4R6S4"
                     /translation="MASLSVSEITFLTFQAVVQVVLICSSGYWASKVGLLGENGQKVL
                     SRLNVDLFTPCLIFTKLASSLSVKKLIQIIVIPIFYAVTTLVSFVCSKVACRVFRFNG
                     PESGFVTAMSVFGNSNSLPVSLTVALAYTLPNLSWDDIEDDTPDKIASRGILYLLIFQ
                     QLGQMLRWSWGYNKLLRKRSPEELEHSDFDKAGDEEQRSLMDVVTSTISNGMYAATDN
                     YVIDDDDNDNDTKTNYLHTVVSESPCSSSSVSNKTQVETISILNKSFTLKEKLVYYTG
                     VFTGFMNPPLYAMLLAVFVASTPPIRDELYENNGFVQNTLGSAVRQLGSISIPLILVV
                     LGSNLNPSSNVAPPSRNYGKMIFASLLCRMILPSLILLPLIAICVKYLGVSVLGDPVF
                     LIVSFILTVSPPAIQLSQICQLNELYEMEMAGVLFWGYVILTLPSTILIVVGSLKVLE
                     WSQ"
     gene            <145663..>146556
                     /locus_tag="PAS_chr4_0074"
                     /db_xref="GeneID:8201320"
     mRNA            <145663..>146556
                     /locus_tag="PAS_chr4_0074"
                     /product="Vacuolar protein sorting protein"
                     /transcript_id="XM_002493434.1"
                     /db_xref="GeneID:8201320"
     CDS             145663..146556
                     /locus_tag="PAS_chr4_0074"
                     /codon_start=1
                     /product="Vacuolar protein sorting protein"
                     /protein_id="XP_002493479.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0074"
                     /db_xref="EnsemblGenomes-Tr:CAY71300"
                     /db_xref="GeneID:8201320"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:C4R6S5"
                     /translation="MSLFFKVPLDIEVRLDGEDSRETVEVKSAKGRKEKLPVYKDGET
                     VKGQVSVRLKDNKRVEHLGIKVQLLGSIETKVDGIKNDEFLSMAHELASPGDLRHPET
                     YHFEFRNVEKQYESYRGKNVRLRYYIKVTLGRKSADVIRERELWVFQKNQLPLGATKP
                     DASIKMDVGIEDCLHIEFEYSRNRFSLKDVIVGRIYFLLVRLKIKHMELSLIRRESCG
                     APPNQVNDSETLVRFEIMDGAPVRGETIPIRLFLGGFDLTPTYRDVNKKFSTRTFLSL
                     VLIDEDARRYFKQSEIFLYRE"
     gene            <146702..>147469
                     /locus_tag="PAS_chr4_0075"
                     /db_xref="GeneID:8201162"
     mRNA            <146702..>147469
                     /locus_tag="PAS_chr4_0075"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493435.1"
                     /db_xref="GeneID:8201162"
     CDS             146702..147469
                     /locus_tag="PAS_chr4_0075"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493480.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0075"
                     /db_xref="EnsemblGenomes-Tr:CAY71301"
                     /db_xref="GeneID:8201162"
                     /db_xref="UniProtKB/TrEMBL:C4R6S6"
                     /translation="MASFTYLPGSSIGTRHQNQMRFDRLTRWERQCDLRIERPGNGAS
                     VIKVLTGVEGLDLTSTQIQLLNGMEELNNRCKLSGLSSTHAIQFAKKNLDASLRAKET
                     HYNLPIFCQGRSHKAKSKYLRSDHRYYTDYYNLVGTDLVPLLDCFEQLHQSVLQIHYH
                     RDRESQKQLAVEALKEYLPEFFAISKKFTEKLERLELRTLSRNRCLLEYMGDIADSSD
                     APIHVLKKTKKITPLHKTVIFNKLSHGRYSDDVCKKI"
     gene            <148211..>151861
                     /locus_tag="PAS_chr4_0076"
                     /db_xref="GeneID:8201163"
     mRNA            <148211..>151861
                     /locus_tag="PAS_chr4_0076"
                     /product="One of two (see also PSK1) PAS domain containing
                     S/T protein kinases"
                     /transcript_id="XM_002493436.1"
                     /db_xref="GeneID:8201163"
     CDS             148211..151861
                     /locus_tag="PAS_chr4_0076"
                     /codon_start=1
                     /product="One of two (see also PSK1) PAS domain containing
                     S/T protein kinases"
                     /protein_id="XP_002493481.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0076"
                     /db_xref="EnsemblGenomes-Tr:CAY71302"
                     /db_xref="GeneID:8201163"
                     /db_xref="GOA:C4R6S7"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4R6S7"
                     /translation="MPYTPPQRSAAKHSANPRSSPISSIILGSQPSSSTSSRNSNQSS
                     ESLLDAHLGATLSGPQPMPHPMVQSTSSFFIFDSDSDADEDEASSIGDVSNTNENENR
                     TQIPKTNSRHTPSPPRKAANGMSLLQKSRSANSSTLLLRRAINSRSNLSGMSVPNRQK
                     VLDQRTSTLKVSSVPPTEFERKQSAANAPLLEDVLKFPKVSTQAYSYARLSANSLALR
                     LNVLKRSLEILSDRPDLVISRSSTSYNEPQSVETKPYSRDGSEERINLRGNASYAALS
                     ALFMSNQRSRDTSPNSQNREHYFESRDKDVGSTMDLKQELKPIIALLEKADTDMIHDH
                     EKDVALKLHDLSLSGVTTEKYFKKNLLYALATPFLESSNHTLPIQTAPSSLALSTLPT
                     SIGSSKPRNSHAQRPYHGILSTKNVSPQAVFTCQLDSPWSLKAANDLACLMFGVTRNS
                     IRALALLDLIAPRSRDFVLQKLYKRTSEIVFSGEIIAVVKPNNTMAWTSLWSKRKDDM
                     MILIFDQIPCDSFDLTISKPLAHDTDSEYYIHAFKEHTGSLLEFATFEQGDPLSFFIP
                     SLAMELASLVDRHNESELPINLQDSAHINDIRYYTLRFHDNHIPCAITSIPLDNENES
                     DKESVIRMNIHCLPYIAGTFVVSSSSYKILAHNDAISKNLFGTSNILNLDFDQLIPDF
                     RKLVETAKIRERSLKNSEPNLVLPEHYFRKLKADLAGHSSSEREELFLNGKGLDAIHR
                     DGTRTRVDIQLRVPNAECYILWITYSRTVQFNDLRKDRRHSVVEPLDLHHTLSHSSNE
                     DRSMALPSQLQLLRDHETDLVSCSGDSSDELSRSNSLLRDNPIGRSESFNNIGNRANN
                     YGMKPFSARELEKVNSEPLVTVIPNKIKTESMDGLLPTESSALKYEKDVIAKESHELK
                     VFSEDKLLSIENEEMANIQAKSALWPKQVGLKRREKKITEFIRLKNMGEGAYGKVSLC
                     VNKEDPGYKVIIKSIIKERILVDTWVRDRKLGTIPSEIQIMAFMNHDPHPNIMRIVDF
                     FEDSNYYYLETPAHGDPTGIDLFDLIEIKTNMSEEECKYIYRQCCSAVAHLHKHGVVH
                     RDIKDENIIVDSNSVVKLIDFGSAAYVKNGPFDVFVGTIDYSAPEVLHGAPYEGKPQD
                     VWAMGILLYTLVYKENPFYNVDDIIEGELRLPPVFSNECTDLIKKILVRDVEKRPTMG
                     EIMEHSWLKSKA"
     gene            <153020..>154090
                     /locus_tag="PAS_chr4_0077"
                     /db_xref="GeneID:8201164"
     mRNA            <153020..>154090
                     /locus_tag="PAS_chr4_0077"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493437.1"
                     /db_xref="GeneID:8201164"
     CDS             153020..154090
                     /locus_tag="PAS_chr4_0077"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493482.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0077"
                     /db_xref="EnsemblGenomes-Tr:CAY71303"
                     /db_xref="GeneID:8201164"
                     /db_xref="GOA:C4R6S8"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C4R6S8"
                     /translation="MSNNNIPPPPMFKSSNFITMNRASISNGTLTTSSHETDYKARGT
                     DTGSRSSSVSGTSAKRRRRSTLTESKEEIAKKKKELKAAHSIIEKKRRIKMNREFEAL
                     KYMIPACRSSVYSLMSNSVGTYPAQDSANMHKLTILQSTVEYIKYLHQCIRLMRSEIQ
                     SVCPNSEWLTANNIDFCDYELDLEKYRNIESEFDFQTEVFNKLLENNGNPISFPHLEE
                     TNSSKENINESEDDEDDDTSTNNDSGRDPEDFNDSNSISDKDPISPLIAAENYGSSSS
                     LRSSSSYQSPLFSPETPFNNSTNIRAKAAPCELPPLKKISSFQLPSPAMTGLSNAELE
                     EEDASKALLLMKQKTSIHSLLN"
     gene            <154235..>156415
                     /locus_tag="PAS_chr4_0078"
                     /db_xref="GeneID:8201165"
     mRNA            <154235..>156415
                     /locus_tag="PAS_chr4_0078"
                     /product="Essential protein with dual roles in spliceosome
                     assembly and exocytosis"
                     /transcript_id="XM_002493438.1"
                     /db_xref="GeneID:8201165"
     CDS             154235..156415
                     /locus_tag="PAS_chr4_0078"
                     /codon_start=1
                     /product="Essential protein with dual roles in spliceosome
                     assembly and exocytosis"
                     /protein_id="XP_002493483.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0078"
                     /db_xref="EnsemblGenomes-Tr:CAY71304"
                     /db_xref="GeneID:8201165"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="UniProtKB/TrEMBL:C4R6S9"
                     /translation="MGGDYSLRKSRAPKGDWKQYEPDASLPYHKGQDQGATNELRKIS
                     TNASTRVQRRLSVKLNSTPMTTFTPHNAPSLPGNMHDLWTNDVAAVTNDNLLTVPHTT
                     KPRRRGFSNLSARSFDFDADPEAAQTLPNLLAQSDFDCVEYVRKELANADAQKIDEFA
                     NNLLHLQKKAEADFKISVAKSEHEIVQIKDDILETKHQLKDLGSSINELYLISGQLQS
                     IALKKLHEEEANNQQSTQHNTSPTKNFSRTGSVLNRKRDRSSILMVEKLWQVQMNELF
                     KQIEGIQKFLSFNPGRHIIAESSRWFELNSATMKPLQPAHLFILNDHVLIATRKKLKT
                     KINETGNQVGNKSLKQLIATQCWPIRDLSVKKLELKKFTDAKTFTIALEYKKMSFIYQ
                     TDRQEPLDLIVGSFRRTKDDLSDFIEQQRQNTESLRNSMSRLSISEDSIRRHSSKLHD
                     LSHKVHSRNRSMEHGSQDKIKLSSSMGNMGQDELDFRTEGLLPSPSHSKAIIEKLTGL
                     EDTLDEVDIHLVHQQFPDAVDSLKQLSSQLNSILPTINLNDKLSEGTVLFDLLKVKLT
                     MRQESIIKSLNFELNRPSISDEKVYQIVQLLSSLDLEKIARDSLFESKANLIEKLNRS
                     VVFEGDIPSYVSQLTIIRFQTLKATCQLYRRCFPNKEMNCYLIEFVTNQINQHADILK
                     RQLKGVDEKSSSYIDCLEITKSQSNELKEIGVNVDFLMEDTYAF"
     gene            <156566..>157177
                     /locus_tag="PAS_chr4_0079"
                     /db_xref="GeneID:8201166"
     mRNA            <156566..>157177
                     /locus_tag="PAS_chr4_0079"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493439.1"
                     /db_xref="GeneID:8201166"
     CDS             156566..157177
                     /locus_tag="PAS_chr4_0079"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493484.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0079"
                     /db_xref="EnsemblGenomes-Tr:CAY71305"
                     /db_xref="GeneID:8201166"
                     /db_xref="InterPro:IPR013923"
                     /db_xref="UniProtKB/TrEMBL:C4R6T0"
                     /translation="MSLTWKHEVLEALKERDRKESRSKEIYESCEYLPYPIPCTLINT
                     NNSIVQFSVDKFQELKRQFESIEKKDSQIQLEKTISQLKVQTESLDSTQRRLRQAQDK
                     KNELEKANSELTKALNAAEDRLKQSVNKLMVLKEESQTKNASLELVNDELLSLHIQNN
                     LMNDKIESLTSENDKLVQRWMEKVTKDAELLNEANKYASRGRN"
     gene            complement(<157220..>158398)
                     /locus_tag="PAS_chr4_0080"
                     /db_xref="GeneID:8201167"
     mRNA            complement(<157220..>158398)
                     /locus_tag="PAS_chr4_0080"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493440.1"
                     /db_xref="GeneID:8201167"
     CDS             complement(157220..158398)
                     /locus_tag="PAS_chr4_0080"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493485.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0080"
                     /db_xref="EnsemblGenomes-Tr:CAY71306"
                     /db_xref="GeneID:8201167"
                     /db_xref="UniProtKB/TrEMBL:C4R6T1"
                     /translation="MISFQPSYYVSTPALLSPSRHEYGYQSSAVTPCFFENNLDTVLS
                     ALQRHNYTSPPPPKIKPTEDQRSYYVKMSKKSGDFSDYGVKVYQDQKFTHVWVYSTSD
                     NVKRHFKYPNSAVQYEGIRAKVARNGRFLLIQIPKISRPDVVLNIVQKRLQSIANQER
                     KEREELERRELQRKAAMERNRRLRALEEQQLAAQREYFEKSLQSAFSPFFTYRLESKQ
                     KDEQESNAESATNQVTAKPNVIRIPVNHVDESNEVIPTKAPKASKTDVEEQPNVNDVE
                     KEADMQDVEENPNTQDAEYETEQFSDFEGFSDDGDIEEAIEPMDEDEEDSDNSQFMEE
                     PEILKRRPSPYSISFPATLSAESSSTKAPKIKKPNKIPIEEVEDEEFKRFSSSSDNDS
                     "
     gene            <158969..>159725
                     /locus_tag="PAS_chr4_0081"
                     /db_xref="GeneID:8201168"
     mRNA            join(<158969..158999,159049..>159725)
                     /locus_tag="PAS_chr4_0081"
                     /product="Riboflavin synthase"
                     /transcript_id="XM_002493441.1"
                     /db_xref="GeneID:8201168"
     CDS             join(158969..158999,159049..159725)
                     /locus_tag="PAS_chr4_0081"
                     /codon_start=1
                     /product="Riboflavin synthase"
                     /protein_id="XP_002493486.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0081"
                     /db_xref="EnsemblGenomes-Tr:CAY71307"
                     /db_xref="GeneID:8201168"
                     /db_xref="GOA:C4R6T2"
                     /db_xref="InterPro:IPR001783"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR023366"
                     /db_xref="InterPro:IPR026017"
                     /db_xref="UniProtKB/TrEMBL:C4R6T2"
                     /translation="MFTGIVEIIGTVLEYQELDVSASGGNGVSLTITDASKILSDVHI
                     GDSIAINGTCLTVTEFTNNDFKVGIAPETLKKTNLGSLKKGSKVNLERAMTGETRFGG
                     HMVQGHVDTVAEIVSSVPEGNAIVYTFKLRDPEFIKYVVHKGFICVDGTSLTVTNVND
                     DAAEFSIMMIKHTQENVVLPLKKLGDFVNIEVDLAGKLIEKQVQVALDNEINSDNSPL
                     INLITRIVQKVVKEQLA"
     gene            complement(<159759..>161039)
                     /locus_tag="PAS_chr4_0082"
                     /db_xref="GeneID:8201169"
     mRNA            complement(<159759..>161039)
                     /locus_tag="PAS_chr4_0082"
                     /product="Essential protein involved in a late step of 60S
                     ribosomal subunit assembly or modification"
                     /transcript_id="XM_002493442.1"
                     /db_xref="GeneID:8201169"
     CDS             complement(159759..161039)
                     /locus_tag="PAS_chr4_0082"
                     /codon_start=1
                     /product="Essential protein involved in a late step of 60S
                     ribosomal subunit assembly or modification"
                     /protein_id="XP_002493487.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0082"
                     /db_xref="EnsemblGenomes-Tr:CAY71308"
                     /db_xref="GeneID:8201169"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C4R6T3"
                     /translation="MSEPIRDPEIEQPAAEEEGEYVTINEVDEIVPEDENDAEPIEDD
                     DEDESHDLSVNQEGNIELDLSNNSRTFFDTHKDSIFTVFTHPTLPLVVTGGGDDTAYL
                     WTTHTQVPKVVTELEGHKESVISGGFAGNGSYLITGDMAGKVQIFKSTKRGQKWDLLT
                     SLEEVEEVVWVRAHPTQDLFAFGARDGSVWSYAITDQGVDILMTGFSHSLECTTGEFY
                     DLQNQDSASLLTTSEDGTIVGWNCFTGQQNFKIEAEQLKGIITAWVTISIDPVSNIAA
                     VGSRNGQIAIINPGNGSVLNILQAIEIGENDDEFDASIEALAWNRSQSILAAGLVSGD
                     VILFDINTWKPRRSIKLSDAVTKLIFVENTPFLFGSSMNGKVYKWDARTGAELHVCVG
                     HYMGVLDFALQTKDPLTVITAGDDGVSLVFDIPS"
     gene            <161176..>162534
                     /locus_tag="PAS_chr4_0083"
                     /db_xref="GeneID:8201170"
     mRNA            <161176..>162534
                     /locus_tag="PAS_chr4_0083"
                     /product="Splicing factor that is found in the Cef1p
                     subcomplex of the spliceosome"
                     /transcript_id="XM_002493443.1"
                     /db_xref="GeneID:8201170"
     CDS             161176..162534
                     /locus_tag="PAS_chr4_0083"
                     /codon_start=1
                     /product="Splicing factor that is found in the Cef1p
                     subcomplex of the spliceosome"
                     /protein_id="XP_002493488.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0083"
                     /db_xref="EnsemblGenomes-Tr:CAY71309"
                     /db_xref="GeneID:8201170"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4R6T4"
                     /translation="MFSESVTSGVDLLEKRTKKLFGVDTDPSQIFVDDDASSLYSQTI
                     IEKQYRNTQSLPEYLEAEIDREKYGESSIITSLKEKALPDINRSSQQAQLVLRKNTQD
                     IQAQQLIKAQAQTAGLYSHMEKPEWHAPWKLMRVIVGHTGWVRSVAVEPENKWFATGS
                     ADRTIKVWDLVSGKLKLTLTGHIMAVRGLVISDRHPYLFSGSEDKTVKCWDLEKNQII
                     RDYHGHLSSVYSVDLHPTIDIIATAGRDSVVRVWDIRSRTPIHTLTGHTSTITNVKCL
                     PTDPQIISTSMDGTVRLYDLVAGKCMKTLTHHRKAVRGMCVHPQEYAFATASSDSIRQ
                     WKLPEAQLLNNCAPVESNKIINTLSVNQKGVLFSGADDGTLGFFDWRTGHQFQAAKNE
                     PTPGSLDSESAVLASTFDNSGLRLITCTADKTIKIWKEDEMSTPETDPGLPWDPTTRI
                     ID"
     gene            <162650..>164044
                     /locus_tag="PAS_chr4_0084"
                     /db_xref="GeneID:8201171"
     mRNA            <162650..>164044
                     /locus_tag="PAS_chr4_0084"
                     /product="Histone acetyltransferase catalytic subunit of
                     the native multisubunit complex (NuA4)"
                     /transcript_id="XM_002493444.1"
                     /db_xref="GeneID:8201171"
     CDS             162650..164044
                     /locus_tag="PAS_chr4_0084"
                     /codon_start=1
                     /product="Histone acetyltransferase catalytic subunit of
                     the native multisubunit complex (NuA4)"
                     /protein_id="XP_002493489.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0084"
                     /db_xref="EnsemblGenomes-Tr:CAY71310"
                     /db_xref="GeneID:8201171"
                     /db_xref="GOA:C4R6T5"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="UniProtKB/TrEMBL:C4R6T5"
                     /translation="MTASPEPIEIQEAKLVVPEQYSEEQFAPGELKVGCTVSAFKDGE
                     VRLAEVLSIQQKKNRLVFYVHYQDFNKRLDEWIEKDRIDYKRPVFWPKPKSEKKDKTK
                     SNKGKNNKQIKSNKGDSTVKQEDTSVDLSGKDSAGQDVMDLDNLNVQGLVKEGEELTR
                     EDEIKKLRTGGSMIQSHNEVSKVRNFSKVIIGKHIVEPWYFSPYPVELTEEDEIYICD
                     FTLSFFGSRKQFERFRIKNTLRHPPGNEIYRDDVVSFFEIDGRRQRTWCRNLCLLSKL
                     FLDHKTLYYDVDPFLFYCMTIRDDLGHHLVGYFSKEKESADNYNVACILTLPQYQRHG
                     YGKLLIQFSYELSKTEGKVGSPEKPLSDLGLLSYRAYWADTIVKLLMENGTETTIDEI
                     SAQTSMTTTDILHTLQTLNMLKYYKGQHIICLTDQVVKQYDRLIKRKRHVLDPAKLSW
                     KPPVFTASQLRFGW"
     gene            complement(<164052..>165104)
                     /locus_tag="PAS_chr4_0085"
                     /db_xref="GeneID:8201172"
     mRNA            complement(<164052..>165104)
                     /locus_tag="PAS_chr4_0085"
                     /product="Activator of the phosphotyrosyl phosphatase
                     activity of PP2A,peptidyl-prolyl cis/trans-isomerase"
                     /transcript_id="XM_002493445.1"
                     /db_xref="GeneID:8201172"
     CDS             complement(164052..165104)
                     /locus_tag="PAS_chr4_0085"
                     /codon_start=1
                     /product="Activator of the phosphotyrosyl phosphatase
                     activity of PP2A,peptidyl-prolyl cis/trans-isomerase"
                     /protein_id="XP_002493490.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0085"
                     /db_xref="EnsemblGenomes-Tr:CAY71311"
                     /db_xref="GeneID:8201172"
                     /db_xref="GOA:C4R6T6"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="UniProtKB/TrEMBL:C4R6T6"
                     /translation="MPYFKPIKRIFTESDLEQWKHCETYSYIVDTIETLASSVEGKEL
                     GSPTSITPSAQTLLDILETVSEIVDKYPVVQDKGSSRFGKVEFRDFYDDIEANSEKLL
                     APLATNNEQSLIELTTYFNNSWGDRIRIDYGSGHELNFLAFLLCLLKLKVLTLNDSQT
                     IVLKIFSKYLQVMRKIQKLYWLEPAGSHGVWGLDDYHFLPFLFGAAQLSPMTRSRPSS
                     IHNKDIVDMYKDKYFYYQCIDFINQVKTGPGSGSLRWHSPMLDDISGVRKWSKVSEGM
                     QKMYKAEVLCKLPIIQHFYFGSILKAPENLSDPSESADNEHGHQHTWGDCCGIAIPSP
                     FAAKEMQQHTKTIPFD"
     gene            complement(<165365..>165982)
                     /locus_tag="PAS_chr4_0918"
                     /db_xref="GeneID:8201173"
     mRNA            complement(<165365..>165982)
                     /locus_tag="PAS_chr4_0918"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493446.1"
                     /db_xref="GeneID:8201173"
     CDS             complement(165365..165982)
                     /locus_tag="PAS_chr4_0918"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493491.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0918"
                     /db_xref="EnsemblGenomes-Tr:CAY71312"
                     /db_xref="GeneID:8201173"
                     /db_xref="UniProtKB/TrEMBL:C4R6T7"
                     /translation="MFAKTPWMIARHGTRLQSSTPKKELLKKIKPVIPTASKNKTKKA
                     TIGTNQTLKLNDDGKSTQKPRKGFSTLPKMAPITLNPRALMLEAFFSGYKPITMPLKP
                     PSKKKQPNAVFYVELEDDNMELFDDNDPEELSRRLDYQNSRRYTFSNSSTTHYRTSDV
                     APHKKDVLSNLDDKFKTRDVKRGRKRVMLANYHDKRYGTEQGEED"
     gene            <166143..>167483
                     /locus_tag="PAS_chr4_0086"
                     /db_xref="GeneID:8201321"
     mRNA            <166143..>167483
                     /locus_tag="PAS_chr4_0086"
                     /product="Putative acyltransferase with similarity to
                     Eeb1p and Eht1p"
                     /transcript_id="XM_002493447.1"
                     /db_xref="GeneID:8201321"
     CDS             166143..167483
                     /locus_tag="PAS_chr4_0086"
                     /codon_start=1
                     /product="Putative acyltransferase with similarity to
                     Eeb1p and Eht1p"
                     /protein_id="XP_002493492.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0086"
                     /db_xref="EnsemblGenomes-Tr:CAY71313"
                     /db_xref="GeneID:8201321"
                     /db_xref="GOA:C4R6T8"
                     /db_xref="InterPro:IPR012020"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R6T8"
                     /translation="MVGIINQVKLHKPDVAVKLPKKDGNGFSTLEDIINTYIPEFQDG
                     KQSWFYPPLFNGHLQTMWAAAGSFEQVDQIYYGRRVLNYPDGGSGTADFVISKKQFEE
                     EEAGIPPKSQCVQADNGELVEPVLPPRTRFMNEGELKNQASDDTRPMLVVLHGLSGGS
                     HEAYVRCLLKEVTEEHDFDAVVLNARGCAQSQLSTPQLFNGFWTEDLRFLVNHLATWF
                     PERTLFAVGASLGASILSNYIGQEGDECRFAAAAVLGNPWDLAASSYLLHRSWIGRYI
                     YSPAMTQSLMNLVDRHDDILRGSDLYSQNRERYHEGIKLLYDFDNRYTAPLFKFNTAY
                     EYYRVGSSVNRLPAVRTPLLIINALDDPIVGSEALPFQECKSNPFTLMLTTSLGGHLA
                     WFQSPTKRWYVRPLASFFQKFYDTIDTKSQPEIDPKALPHKHQATDGRLRGPFQ"
     gene            complement(<167525..>168061)
                     /locus_tag="PAS_chr4_0087"
                     /db_xref="GeneID:8201174"
     mRNA            complement(<167525..>168061)
                     /locus_tag="PAS_chr4_0087"
                     /product="Protein involved in the repair of double-strand
                     breaks in DNA during vegetative growth"
                     /transcript_id="XM_002493448.1"
                     /db_xref="GeneID:8201174"
     CDS             complement(167525..168061)
                     /locus_tag="PAS_chr4_0087"
                     /codon_start=1
                     /product="Protein involved in the repair of double-strand
                     breaks in DNA during vegetative growth"
                     /protein_id="XP_002493493.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0087"
                     /db_xref="EnsemblGenomes-Tr:CAY71314"
                     /db_xref="GeneID:8201174"
                     /db_xref="GOA:C4R6T9"
                     /db_xref="InterPro:IPR007232"
                     /db_xref="UniProtKB/TrEMBL:C4R6T9"
                     /translation="MDSSDSESLDACQSELFPKELKFDLFDDFSIIKPSEWAITRIGW
                     LQTKIDRLHRSRNSVQRRYLKRELENQKLISTANQVFGFNGWSSVLDGSFEMSECAEE
                     DGRFKMKVLTTVKLILKDGTTCSATGTGRTQNASGRAQALSKCKKEAINDAIRRCIES
                     LPNLLLESQDRKQTFKDY"
     gene            <168228..>172442
                     /locus_tag="PAS_chr4_0088"
                     /db_xref="GeneID:8201175"
     mRNA            <168228..>172442
                     /locus_tag="PAS_chr4_0088"
                     /product="Essential protein involved in intracellular
                     protein transport"
                     /transcript_id="XM_002493449.1"
                     /db_xref="GeneID:8201175"
     CDS             168228..172442
                     /locus_tag="PAS_chr4_0088"
                     /codon_start=1
                     /product="Essential protein involved in intracellular
                     protein transport"
                     /protein_id="XP_002493494.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0088"
                     /db_xref="EnsemblGenomes-Tr:CAY71315"
                     /db_xref="GeneID:8201175"
                     /db_xref="GOA:C4R6U0"
                     /db_xref="InterPro:IPR006953"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024095"
                     /db_xref="UniProtKB/TrEMBL:C4R6U0"
                     /translation="MFSGLRSKKTEVDPEGVIETICDRLSNATLLTDRRAAVLSLKNF
                     SRDYRESVIGNGLKGLVSTLHKDIQDIDVVKAVLETLLILFIRGESDEDQTRSLISEQ
                     SRAQNGKYPSPSLLAGEVRMDQFSLLVADELTQAPENFDLLLKILDSEIGHDFYIKIY
                     TIQILEALVSCRPSRSKECIVSSPLGTPLLVSLLDDPNEPIRNEIILLLMGLVNQNNN
                     IQKLVVFQNCFDKLFEIIELEGGIRGSIVVQDCLTLICNLLEYNASNQKTFLETNCIP
                     KLQSVLSFPLVEEIVWNPQRLSNHVTTLEIIRIFLQGGGDELREFQSKLAAADILLIG
                     LKLVFIKDIPNKIRGVALLTISDLIRGNSEIQYQFSQIDVPYIDPSFPSQLQKFDQVI
                     PVTIALLNWCLHSNSVHIFDIRVAAYQCLEAYFQDNEEAIVAFTEDQVESFKHQRFYY
                     SDTVPMSEDDSRDNDATLIENGNANTLIRRKDSPKATPTPQGNIFQTLLTYDATVNLN
                     PYRIWFASYILMALINGSEQTMSTLLDLTVGDASEGDEVVFAIQTMLELLVTNLPHAD
                     SRIIVAYLMLLIYIFYENFEAVDGFLEETSNTTSLLDYLSRPSNEDLLVQGLIHMLLG
                     VIYEFSRKESPICRKDLLTLLSKHVSVNAYCLKITELNLQIFSKYSPDIIFDPPTGDN
                     GLPEVYLNPFFVDLVKENLPRIRNALSHDPNSNPVLRLDYESYETLENDFQELSSAFE
                     IYKNEYEDISEKYKVLTESNSLLEEEYESLKSKFSNVDTKFAEVWNSNESLEKEHSEL
                     LVSFNECKKTLQELEQTSKQLAEAKTKLEEEKSEDYEQIKKMAKNLFTIGKENEEYKK
                     IKKEQEKLDKKHEAELDTLHKDIEVRDSVIKEFQTQLSGLRSQVKEKDSAYANLMQKL
                     RESASLIKRLQSENSSLKDGMAALRQEVSSSRNNSSDYRKESDETIRKLQEKVQDMEQ
                     GMRNSGTLNVQSQDKDESLETNIATQSPSPKIERSELNKEMEDSQGLQDPSQEHKNVL
                     VLSASSTVPPDQQIEEEISNGKEPDSQAVVRELEEKLAQTTKHLLELKLKVDGAGADE
                     APIKIEQLTTALETTKDQLMTVTMEYNEKLDEMKGEKNALQSSIFTLNGRREEMEQEL
                     KESKEHTIELEELINAQKESNKELESKLQESTDSLKRQSEILVELDKEKQLLEERINN
                     LESQLAEISSDHETLVPEDEEHGRLLHLKDKEIEELKTKVDGLEDEKSKLSTELNLIQ
                     EDIYEVKRSLQDQIRELAEEKFNLQNSLNSIESEKKKPETDLLEQIKLLKGQLDEKDR
                     LIQTLEQGQDEEELQKKPESGNEESLKLKSIVHDLETELQENQSQLDDLMLVMLDLEA
                     KKAHYKKLAMEHGETISEDESEENES"
     gene            complement(<172466..>174838)
                     /locus_tag="PAS_chr4_0089"
                     /db_xref="GeneID:8201176"
     mRNA            complement(<172466..>174838)
                     /locus_tag="PAS_chr4_0089"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493450.1"
                     /db_xref="GeneID:8201176"
     CDS             complement(172466..174838)
                     /locus_tag="PAS_chr4_0089"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493495.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0089"
                     /db_xref="EnsemblGenomes-Tr:CAY71316"
                     /db_xref="GeneID:8201176"
                     /db_xref="UniProtKB/TrEMBL:C4R6U1"
                     /translation="MAERASPSPRNLSYDGAKMEFKFPQMNIPSPERQTSLGGVSRET
                     ETETETELQNYIKRDPVFRENPVGFQHLSAVRVESRCGSTDTTLGSAKKNENGNTDIE
                     EDVAEDDNLSIISSAYQVPLGSQEDSAPPSRIQSFNNNGVSIFKETQLRLARESLAEE
                     AQTEIMSSSQALESEVSSISKHILDTVVQNVVLPEANLDKPLPVVKQTVPNLAQAPVY
                     QRLTSSSSFNSTPTLRRSRTILKTNPELASLIQQSVSRDPSSRQSYRNSSSSLQRSKA
                     MKKKAGWISAFLLSGVKLRKKLRRWRIIVTRKAFGRFTRKHKRSSNVTIINASCDSLR
                     RNRSIRSNKGRKNKFNMEALMKLQNPVNLSRLKTVSRSLNNVPSHGGVLVRKQRETSY
                     NRDVIKQKELTNLKFEEILGNNANGTSTEKLQKLNLYLEEQQEKYKMSLEEEDKFDRG
                     ERCFSASLGLYRSNFKLETCDSADYDQSSQSEFEEMVLPFNGAPTSPRQEFRVSSPVR
                     KGTQRRSPLSHDVEQEETDDEVIQLYKLWRNYLGTVVKRRIEMKLEIEEVTKTEVKSV
                     TNSINSQTQSQHIQTTSLASHKETQQQDPTIKHKPRNSVLSAIIQEFEKRDYVLSDSD
                     SRSINTDVTSINSAKTFQVSHMDAIQVPDIEVLSTNEQSSEDEFVEEVASLRIKDVSE
                     DQLWLDRMGSISRQSSLCRLPSSVRRKKETEKTETDPHKQVAADENKNYKSYALINSG
                     LGRSFSFNSEASNDRAIPTGTSSNDRQRLNKQLKRYKESRMAVMNEGVAN"
     gene            <175190..>175936
                     /locus_tag="PAS_chr4_0090"
                     /db_xref="GeneID:8201177"
     mRNA            <175190..>175936
                     /locus_tag="PAS_chr4_0090"
                     /product="Trimethyl guanosine synthase, conserved
                     nucleolar methyl transferase"
                     /transcript_id="XM_002493451.1"
                     /db_xref="GeneID:8201177"
     CDS             175190..175936
                     /locus_tag="PAS_chr4_0090"
                     /codon_start=1
                     /product="Trimethyl guanosine synthase, conserved
                     nucleolar methyl transferase"
                     /protein_id="XP_002493496.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0090"
                     /db_xref="EnsemblGenomes-Tr:CAY71317"
                     /db_xref="GeneID:8201177"
                     /db_xref="GOA:C4R6U2"
                     /db_xref="InterPro:IPR019012"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R6U2"
                     /translation="MGKRRRTDTNNPLPSHISKFWNQRYTLFSKFDDGIQLNEELWYS
                     VTPEEMAMYLAKFFRHIFPDARTILDICSGGGGNTIQFARYFPNSKIFGIDNTQANID
                     CAVVNSAVYNVESRITYLLRDWENYHLFINELKELIGPVDVAFCSPPWGGPSYLSQEV
                     YDSENIKPLGLERLLESMFQLTENVVLFLPRNTDKTQLSDVTRKLKGPSAKCRVVEAY
                     VNKRPKGILCFWGEKFTNYQPNKDLTDEED"
     gene            <176150..>178186
                     /locus_tag="PAS_chr4_0091"
                     /db_xref="GeneID:8201178"
     mRNA            <176150..>178186
                     /locus_tag="PAS_chr4_0091"
                     /product="Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /transcript_id="XM_002493452.1"
                     /db_xref="GeneID:8201178"
     CDS             176150..178186
                     /locus_tag="PAS_chr4_0091"
                     /codon_start=1
                     /product="Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /protein_id="XP_002493497.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0091"
                     /db_xref="EnsemblGenomes-Tr:CAY71318"
                     /db_xref="GeneID:8201178"
                     /db_xref="GOA:C4R6U3"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C4R6U3"
                     /translation="MARLADWSRDTPSRMNGRVARPQGHLRPPSSASSSSSQMSTSSY
                     DSTKPRAQSALSGRTPTRRPMTPLSNKLQPGLATPMRPASSLRKRPSTPTLNSYKGKI
                     NVSVRPRPLLSVSHGNTNNPWFIENDNNTIAHDEAGEFQYDNVFDPLVNNRQVYDQVV
                     KPVVEKAMDGFNGTIFAYGMTGSGKTYSMQGSEFEDGLIQLAVNQIFDTVRSDPSSQY
                     TISCSFLEIYNERIFDLLNPESANALRNFNFGSIGTSSKDELKIRDDPIFGTKVIGLH
                     EEIVTTPDDLIHLIHRGDQIRKTGGTDYNSRSSRSHAIVSIKIKKLTNSQEFFATLSL
                     CDLAGSEKATTQIERRKEGSFINKSLLALGTVISKLSQNQGSLHIPYRDSKLTRFLQP
                     SLSGESVVSILCTIHLSQITVGETLNTLRFASRAKNIAIAAARNGSNVQDNFRLESLA
                     KELVETKRQLMELQLSSTKISDTDDEQLQRLRAENRILSEQVEHFRRMSDLGRADRVN
                     LSNDIVSLLGELRESDSNRDTVIQKIESFNKHQQLDLEEMKSYISHLEHMMKTGEKFQ
                     VNPQINASSKKQKTYEELFVGSEGLSLKSLVKDQEEEIMELKEMLKEKDSIIKALRTA
                     KRARDSVLNIGSNNTSDLENEYEDYTSAKDNLQYGKAIKTVTERVQLRSIENEI"
     gene            complement(<178200..>179402)
                     /locus_tag="PAS_chr4_0092"
                     /db_xref="GeneID:8201179"
     mRNA            complement(<178200..>179402)
                     /locus_tag="PAS_chr4_0092"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493453.1"
                     /db_xref="GeneID:8201179"
     CDS             complement(178200..179402)
                     /locus_tag="PAS_chr4_0092"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493498.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0092"
                     /db_xref="EnsemblGenomes-Tr:CAY71319"
                     /db_xref="GeneID:8201179"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C4R6U4"
                     /translation="MSDNSRDTGISGYGFGPTLALATLNTLETSMESTFLTNMLGRIS
                     VVAGYLSIISWLFAQLPQVIKIYNTKSLEGVSLAFLLVWFVGDFLNFTSCLLNDAMAF
                     QILLSGYYCMIDLILAGQFYYYTHMYRLHHHHHHNQHHQHPLKKTNRLTTIKSTPDEL
                     AATTSIQLPPEHISIPVTKPGSSSLSIKNSWSSFFTASFVTSFNKVQAMPIPDELMFT
                     ASSSLNWGPILAWACTSCYLSSRIPQLITNYKLKTTSGISIKLFISALLGNLFYSISL
                     LANFYQLKLLVKENSPDSIPSNILDIYSEFWERELSYFLGAIGTVSFDILVLFQFFKW
                     DRGHSTHLNKKKSFKVIKVPKSFEAHPNSPPLDNTAVPTGSTSLIHNDYDMNVHLEED
                     SSPKYGSF"
     gene            <179790..>181280
                     /locus_tag="PAS_chr4_0093"
                     /db_xref="GeneID:8201180"
     mRNA            <179790..>181280
                     /locus_tag="PAS_chr4_0093"
                     /product="Putative transcription factor involved in
                     regulating the response to osmotic stress"
                     /transcript_id="XM_002493454.1"
                     /db_xref="GeneID:8201180"
     CDS             179790..181280
                     /locus_tag="PAS_chr4_0093"
                     /codon_start=1
                     /product="Putative transcription factor involved in
                     regulating the response to osmotic stress"
                     /protein_id="XP_002493499.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0093"
                     /db_xref="EnsemblGenomes-Tr:CAY71320"
                     /db_xref="GeneID:8201180"
                     /db_xref="GOA:C4R6U5"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:C4R6U5"
                     /translation="MGRRKIEINPILDNRNRSVTFMKRKAGLFKKAYELSILCQVDLT
                     VIIKGSNDKFYEFSSMDTNDLIAQYQSAGAVKDEEKEPSSYGRHEKKQRVFGDRSGNS
                     GITHHARSSAEDHSFDDEEDEDDEEEDSTINNENELPSRKRLRSSNASSVPTRTTRSQ
                     SSQYSPVSNGTQMAGTASHPINNSMGSSQRLPFVHPMTSPVMQGNMTTNSGPQNNDYS
                     NTPSLRPVLRVTIPQEADDQKETKVDQDNGSRESVPRDQGPGQSNSNGNGNNLPPSRL
                     PMLKYSQPSLSALYKSNTPSSLSRMFPHHHPGSTVPPETSSKTPTEESDNSARSTPVS
                     GGTSFFMIPQQGGSPTNNISGGLLPYNSNLRSNSLTNAKNMETQTPGSGLPSKYVNDL
                     FPSPSTYFSNDYNITFGTGNTPLAPSTAQSFQPSATSGNNVTNPNPNRSPSEAKRLHI
                     QTNIPTSTSSRSGSLNNGVLLPSPSQLLDRNSMHDSRFPSSVTKKS"
     gene            <181624..>182424
                     /locus_tag="PAS_chr4_0094"
                     /db_xref="GeneID:8201181"
     mRNA            join(<181624..181629,181720..>182424)
                     /locus_tag="PAS_chr4_0094"
                     /product="40S ribosomal protein S6"
                     /transcript_id="XM_002493455.1"
                     /db_xref="GeneID:8201181"
     CDS             join(181624..181629,181720..182424)
                     /locus_tag="PAS_chr4_0094"
                     /codon_start=1
                     /product="40S ribosomal protein S6"
                     /protein_id="XP_002493500.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0094"
                     /db_xref="EnsemblGenomes-Tr:CAY71321"
                     /db_xref="GeneID:8201181"
                     /db_xref="GOA:C4R6U6"
                     /db_xref="InterPro:IPR001377"
                     /db_xref="InterPro:IPR014401"
                     /db_xref="InterPro:IPR018282"
                     /db_xref="UniProtKB/TrEMBL:C4R6U6"
                     /translation="MKLNIAFPANGTQKCIEIDDEHKLQAFYEKRMGQEVEGDSVSDE
                     FKGYVFRITGGNDKQGFPMKQGVMHPTRVRLLLSKGHSCYRPRRAGERKRKSVRGCIV
                     AADLSVLSLVVIKQGEQEIEGLTDAQVPKKLGPKRANNIRKFFGLTKEDDVRQFVIRR
                     EIVKGDKTYTKAPKIQRLITPERIARKQRLRELKYENARKQKDAAAEYAKLLAEKIHQ
                     RNAEKAEIKKRRASSLKA"
     gene            complement(<182486..>183859)
                     /locus_tag="PAS_chr4_0095"
                     /db_xref="GeneID:8201182"
     mRNA            complement(<182486..>183859)
                     /locus_tag="PAS_chr4_0095"
                     /product="Subunit of the SF3a splicing factor complex,
                     required for spliceosome assembly"
                     /transcript_id="XM_002493456.1"
                     /db_xref="GeneID:8201182"
     CDS             complement(182486..183859)
                     /locus_tag="PAS_chr4_0095"
                     /codon_start=1
                     /product="Subunit of the SF3a splicing factor complex,
                     required for spliceosome assembly"
                     /protein_id="XP_002493501.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0095"
                     /db_xref="EnsemblGenomes-Tr:CAY71322"
                     /db_xref="GeneID:8201182"
                     /db_xref="GOA:C4R6U7"
                     /db_xref="InterPro:IPR000061"
                     /db_xref="InterPro:IPR022030"
                     /db_xref="UniProtKB/TrEMBL:C4R6U7"
                     /translation="MVQDDIPEDIPEGVILPPPAVQEIINKTAGYVHRNGASFETRIK
                     EKELHNNKFQFLIDEDPYNAFYKWKLEQLKNNQTIDTASNEQFQDRESKVQEISRPKD
                     LEFLIDFKPMSSLDHDIIKLTALYVAVDKTTGDGVFRKKFEQSFGGKNAQFGFLDPTH
                     SLNSIFNQYVNQYTLLLRLMKDKEKSDIFAKIELGCNSVHSFLDKSFSRAEYLQQEKM
                     KEEHKKAKDEAMMLEFASIDWQDFTLVQVIEFTEEDFHSELSQPLNLSELQYRSLEEK
                     SSGLLIEEAPPDFQETEEPKIENVPRRKVPKGMKIRAAGETRLGRMNEPKEKLIKCPL
                     TGELVPESKFQDHINVLLRDPKYKEERARYEAKVSKSNLTTDEVLNNVSILANARKIR
                     EAKQSQSQLNTEDSNRKRPLQWDGYSASTQTIKKQAKQMYSAEEIEEQKRRRKESLNR
                     IGSHKPQ"
     gene            <184690..>185937
                     /locus_tag="PAS_chr4_0096"
                     /db_xref="GeneID:8201183"
     mRNA            <184690..>185937
                     /locus_tag="PAS_chr4_0096"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493457.1"
                     /db_xref="GeneID:8201183"
     CDS             184690..185937
                     /locus_tag="PAS_chr4_0096"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493502.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0096"
                     /db_xref="EnsemblGenomes-Tr:CAY71323"
                     /db_xref="GeneID:8201183"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R6U8"
                     /translation="MSSTEYIQNMLHVKIKGRPCILLARKGGIIELRGSESPNELLYS
                     WNESTVDDSDFVVGMAYVNEVLYSCSNRGLLLLRDLSNINRGKHCPETANSDRKSDLL
                     EHYQGNAVSWTINEPISFFKVHPIHSEICLVGGYNNEVEILDITSNLNLLTGSVLIEG
                     LDRNSKFKLKIAKYAASIQPIWKAKVHTHPKRGDSVYIKEEFSWPQDAVFLDPERKKC
                     SGFKICCGSRFGKLMVYDTSLSRYAISQLTVSNHSITNVKLLVNDSLVMFVDSCQTVG
                     IVNLVIEEIVNYYRIPMGSISSCECLVLEDPKAALVNKSLTFTNPILFIVGGIDKKLR
                     VYRLDNNNQCTLIGCAKTSSIMPSICLALDNPVDKEAVHKLLLKDFHIDRSHDDTYDD
                     YYFKSKFHNHRKNVTAAYKLRKV"
     gene            <194369..>196039
                     /locus_tag="PAS_chr4_0098"
                     /db_xref="GeneID:8201184"
     mRNA            <194369..>196039
                     /locus_tag="PAS_chr4_0098"
                     /product="Subunit of Elongator complex, which is required
                     for modification of wobble nucleosides in tRNA"
                     /transcript_id="XM_002493458.1"
                     /db_xref="GeneID:8201184"
     CDS             194369..196039
                     /locus_tag="PAS_chr4_0098"
                     /codon_start=1
                     /product="Subunit of Elongator complex, which is required
                     for modification of wobble nucleosides in tRNA"
                     /protein_id="XP_002493503.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0098"
                     /db_xref="EnsemblGenomes-Tr:CAY71324"
                     /db_xref="GeneID:8201184"
                     /db_xref="GOA:C4R6U9"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR005910"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR023404"
                     /db_xref="UniProtKB/TrEMBL:C4R6U9"
                     /translation="MAVGMQVTKSKQKMAPEKERFLQCCGDISMELVASLKNSKDIHL
                     NGLITRYSKKYKLKQQPRLTDIISSIPDQYKKYLIPKLKAKPVRTASGIAVVAVMCKP
                     HRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRIEQ
                     LRQLGHSIDKVEYIIMGGTFMSLPVDYREGFITQLHNALTGYNGKDIDEAIKFSQQSL
                     TKCVGITIETRPDYCTETHLSDMLKYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCET
                     FGYSKDAGYKVVSHMMPDLPNVGMERDLEQFKEYFESPAFRTDGLKLYPTLVIRGTGL
                     YELWKTGRYRSYNANALIDLVARIMALVPPWTRIYRVQRDIPMPLVTSGVENGNLREL
                     ALARMKDFGTSCRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETFLSYEDPKQ
                     DILIGLLRLRKCSKKYTFRKEFTSQPTSVVRELHVYGSVVPLHSRDPRKFQHQGFGTL
                     LMEEAARIAKEEHGSEKLSVISGVGVRNYYARLGYTLDGPYMSKSLID"
     gene            complement(<196053..>197267)
                     /locus_tag="PAS_chr4_0099"
                     /db_xref="GeneID:8201185"
     mRNA            complement(<196053..>197267)
                     /locus_tag="PAS_chr4_0099"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493459.1"
                     /db_xref="GeneID:8201185"
     CDS             complement(196053..197267)
                     /locus_tag="PAS_chr4_0099"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493504.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0099"
                     /db_xref="EnsemblGenomes-Tr:CAY71325"
                     /db_xref="GeneID:8201185"
                     /db_xref="UniProtKB/TrEMBL:C4R6V0"
                     /translation="MTAVNDTDSKKHDEPVQETERGSKETTAKSENADANPDRRNNSN
                     KQQIESIAIQILSPGLPLLKPVFEEALARSKTIEEQQKDLIAKREQGVSERADQESFP
                     PLDSVGEDLADKPQQPRSATRLPNKSLKRRNAPPPLNIANGNHISNPSIRSAPIRTNL
                     HYTQQGQGAGPERFRKRRLPFSGQPPLTSVPQGGFRSYPFPQAQPTAGFAPMPFPVYG
                     PEPHYIVPHSALMAQGCIVPNNVAPGVVKQSRQPPMGNQQPQQVYTSARQAPMRHIKM
                     QVQQESPHVTDVFSNDTKKVAPLTSQPLSAQQETFAFFGENENLVEKDNSDSNEKEDK
                     EEEGDGDVESRAIEDEYKPSTKARNIEGELRIDSEQFAFTFQTGGDPETDKTNFINTI
                     CAAWDEYRKNLG"
     gene            complement(<197500..>199758)
                     /locus_tag="PAS_chr4_0100"
                     /db_xref="GeneID:8201186"
     mRNA            complement(<197500..>199758)
                     /locus_tag="PAS_chr4_0100"
                     /product="Component of NuA4, which is an essential histone
                     H4/H2A acetyltransferase complex"
                     /transcript_id="XM_002493460.1"
                     /db_xref="GeneID:8201186"
     CDS             complement(197500..199758)
                     /locus_tag="PAS_chr4_0100"
                     /codon_start=1
                     /product="Component of NuA4, which is an essential histone
                     H4/H2A acetyltransferase complex"
                     /protein_id="XP_002493505.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0100"
                     /db_xref="EnsemblGenomes-Tr:CAY71326"
                     /db_xref="GeneID:8201186"
                     /db_xref="GOA:C4R6V1"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR024943"
                     /db_xref="UniProtKB/TrEMBL:C4R6V1"
                     /translation="MVLPSAAGARFRQRKISVKQTLQVFKQSDIADLETEDQQRELQK
                     IETGVEKGEEEEEHLQRVINAAQAAVISGGKVEKAYIPTPDASQVWKDYDKYYRDKFQ
                     PPGTYIRFSATVEETTGCIYNLDEEDESFLKEVLNKNLANGIKPCTETELEIVLQRFE
                     VVIDKKQPFLAMDPSQILTFEELHSAALVVDPNSIEEIELSLEKQLGLHPFRTLLDGQ
                     RSQLSHRKLAELLRIFGQKIYDHWKQRRIARHGRPITAQLRFEDSSEKDDSDPYVCFR
                     RREFRQARKTRRTDTQGSERLRKLHRELKQTRDLLLAVAQREVKRKEAIEVGHEVFQL
                     RCSVKTLKRDLGVKGEEEDLVAHKRKKVVPTTDEDRKYRKGYNSGNYPNRNQAQAQQQ
                     QQQLQQQQISKSGLNPVSIQPYVKLPMSRIPDMDLITVSTVLNEKDEAINRAVAEKLR
                     QRKESDRGWVNLTDDPFNPFLQFTNPDSILEKGHFPYSSIAAALFEVDQSNYFDPEIT
                     QLIKDKKPLPRTLCFKDNALTTPLPPSIYEVASNNKLDVTAPICKVRKRMGRRGLWID
                     RKMTVDEPLDEFLDFSTFEKSLDADITDRNSAKSQQGMNVYDSVDDANSRLRSRFSFD
                     RDVPLFNPVDPSELNQISSQTQSIRFGCMLLTKAYEQVHQAKQKLFLEQQQHQQKQQQ
                     KLLQQRQKVQQKLQQQQQQQQQAQQQNPKSNTNKVVNQINNTKSPVKQSKIPSKVSKN
                     ISGVTTSAGKGA"
     gene            complement(<200502..>202499)
                     /locus_tag="PAS_chr4_0101"
                     /db_xref="GeneID:8201187"
     mRNA            complement(<200502..>202499)
                     /locus_tag="PAS_chr4_0101"
                     /product="Mitochondrial aspartyl-tRNA synthetase, required
                     for acylation of aspartyl-tRNA"
                     /transcript_id="XM_002493461.1"
                     /db_xref="GeneID:8201187"
     CDS             complement(200502..202499)
                     /locus_tag="PAS_chr4_0101"
                     /codon_start=1
                     /product="Mitochondrial aspartyl-tRNA synthetase, required
                     for acylation of aspartyl-tRNA"
                     /protein_id="XP_002493506.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0101"
                     /db_xref="EnsemblGenomes-Tr:CAY71327"
                     /db_xref="GeneID:8201187"
                     /db_xref="GOA:C4R6V2"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004115"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004524"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C4R6V2"
                     /translation="MLRQTKYISRRCSVCIWRRGLSSRVQLPDRETTVAKFVFPSTTH
                     TIGSVALSLEKYLGKEITLHGWMNSKPRKVSKRLAFGELRDYNGDITQIVIADEEMIS
                     LQLQLEDAIAVTGTISRRRPKKDQSEESVGKLWDLNVIKLQILNRSNLVPSQLKSLDV
                     ASPDYPPEYRYLQLRSKFFQDALKLRAKALQRVRSTLDSLSFTEIETPLLFKSTPEGA
                     NEFLVPTRRKSYFYALPQSPQQYKQLLMASGVKSYYQVARCFRDEDLRADRQPEFTQI
                     DIEMSFADGKQVRHAVEQVVNNVWLDVKKSPLYVPFGTDQLVRSNEFPLMSYKSVLEL
                     YGIDKPDLRSSLRFHDISEFTTRVANPDFPVFEVCVLKQAFEGSHYTIPDLLIQPDNY
                     KSRRPAMFAIKSTTDLNNWHQHFSEYADIDSSKLEELTAKLNLQPGDIITGADRAILP
                     YENPTPLGRFRQLAIEQFPTKWRRTVANSEEDTLKDLSVATWVVDFPLFNPVEEDQLS
                     GKQSYPLYKKNQYESTHHPFTMCSPADYDLLSTDPLAVHGEHYDLVVNGVEVGGGSRR
                     IHDSNLQQYIFKEILGIQDPHRLFGHLLGAFESGCPPHAGFAIGFDRLCAMLLGSTSI
                     RDVIAFPKNQKGRDPVTESPSMVPSKTLEKYHIREIEACHQ"
     gene            <202831..>204344
                     /locus_tag="PAS_chr4_0102"
                     /db_xref="GeneID:8201188"
     mRNA            join(<202831..203032,203317..>204344)
                     /locus_tag="PAS_chr4_0102"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="XM_002493462.1"
                     /db_xref="GeneID:8201188"
     CDS             join(202831..203032,203317..204344)
                     /locus_tag="PAS_chr4_0102"
                     /codon_start=1
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="XP_002493507.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0102"
                     /db_xref="EnsemblGenomes-Tr:CAY71328"
                     /db_xref="GeneID:8201188"
                     /db_xref="GOA:C4R6V3"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C4R6V3"
                     /translation="MSQGTLFITEQTRGVVPKGLVQYFKLDVKISNKEDEQFKKYFPL
                     NYIPAFVGPKGLKLTEVSAVIEHLLNLAGEKKLKGTTELEQVQVNKWISFFNTEVIST
                     SARIFLPLLGKAPYNKKDIDAATERLDTIIQIIEARLSEFTYLVGERITVADLFAATV
                     IGRSLETIFDKAWISKHQDIFRWFSTVSAHPVLSWRYVDFKPRDKPVEYVPPKKEKKE
                     KKKEEKPKQEKKPAPAAAEQSDEPPVEKKAKHPLEALGKPKLAIDEWKRFYSNEETRE
                     SAIPWFWEHFDADEWSLWKVTYKYNDELTLTFMSNNLIGGFFARLTGSIKYMFGCAVV
                     YGENNNNGIIGGFMVRGQDYKPAFEVAPDWESYSYEKLDPNSEEDREFFNNMLAWDKP
                     IVVNGEEKEIADGKVLK"
     gene            <204607..>205722
                     /locus_tag="PAS_chr4_0103"
                     /db_xref="GeneID:8201189"
     mRNA            <204607..>205722
                     /locus_tag="PAS_chr4_0103"
                     /product="Subunit of Golgi mannosyltransferase complex
                     also containing Anp1p, Mnn10p, Mnn11p, and Hoc1p"
                     /transcript_id="XM_002493463.1"
                     /db_xref="GeneID:8201189"
     CDS             204607..205722
                     /locus_tag="PAS_chr4_0103"
                     /codon_start=1
                     /product="Subunit of Golgi mannosyltransferase complex
                     also containing Anp1p, Mnn10p, Mnn11p, and Hoc1p"
                     /protein_id="XP_002493508.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0103"
                     /db_xref="EnsemblGenomes-Tr:CAY71329"
                     /db_xref="GeneID:8201189"
                     /db_xref="GOA:C4R6V4"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R6V4"
                     /translation="MLVPNKNHLFHQIRRKPSQIVAPILFLVLVVYLLFGIGQSSSKK
                     PKYSYKDKTQGWLLSSKIPPGPDEMAKNHIMHYNMNLLETTVMPAFNKEQVLVLTPMS
                     KFYPEYWDNLLALSYPRELMELGFIVPRGKAGDEVVKKLETAVKAVQRSSTESARFAR
                     VTILRQDSESVESQLEKDRHALKAQKERRSKMALARNSLLFSTLGPFTSWVLWLDADV
                     VETPKTLIQDLATHNKAVIAANCYQRYYNEETKKNDIRPYDYNNWVESEEGLRLASTL
                     GPDEIIVEGYAELPTFRALMAHFYDPHGDLSTEMQLDGVGGTAVLVKAEVHRDGAMFP
                     SFPFYHLIETEGFAKMAKRLGYQVFGLPNYLVYHYNE"
     gene            <205921..>207027
                     /locus_tag="PAS_chr4_0104"
                     /db_xref="GeneID:8201191"
     mRNA            <205921..>207027
                     /locus_tag="PAS_chr4_0104"
                     /product="Zinc-finger protein of unknown function"
                     /transcript_id="XM_002493464.1"
                     /db_xref="GeneID:8201191"
     CDS             205921..207027
                     /locus_tag="PAS_chr4_0104"
                     /codon_start=1
                     /product="Zinc-finger protein of unknown function"
                     /protein_id="XP_002493509.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0104"
                     /db_xref="EnsemblGenomes-Tr:CAY71330"
                     /db_xref="GeneID:8201191"
                     /db_xref="GOA:C4R6V5"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C4R6V5"
                     /translation="MAKSPETRMRPPLEASFHSSSTRRFSGPKNSLAESTSGLASPLA
                     TKELKISTSKQNQTPVTISNDMLNINPNLKSIVEGGTSPIAESNVGVAAFAATATAAS
                     LQLSGSNSSKSPTSRNLSHVPCKFYRQGACQAGSSCPFSHTLTQTSQAATCKYFQKGT
                     CKFGSKCALVHISPEGKKVNLKALNQAYQVPKHERSLSSSQGLSQQIHKDPETSDDQA
                     SSMSSPTRTVTSQMASSPFSNTNSIWSGTGSKERRLSGPSFSTGSFSRGSFSRGSFSN
                     HTVSKAELNQLISGCAISDDEVDGAENMNALGAEDFLPSSLSDLLTPQELKRKNSKSG
                     SRANLRHLFDAPLHGRQNEAGTRIDEDTQFWIDY"
     gene            complement(<207127..>209034)
                     /locus_tag="PAS_chr4_0105"
                     /db_xref="GeneID:8201192"
     mRNA            complement(<207127..>209034)
                     /locus_tag="PAS_chr4_0105"
                     /product="Putative GTPase that associates with free 60S
                     ribosomal subunits in the nucleolus"
                     /transcript_id="XM_002493465.1"
                     /db_xref="GeneID:8201192"
     CDS             complement(207127..209034)
                     /locus_tag="PAS_chr4_0105"
                     /codon_start=1
                     /product="Putative GTPase that associates with free 60S
                     ribosomal subunits in the nucleolus"
                     /protein_id="XP_002493510.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0105"
                     /db_xref="EnsemblGenomes-Tr:CAY71331"
                     /db_xref="GeneID:8201192"
                     /db_xref="GOA:C4R6V6"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR010674"
                     /db_xref="InterPro:IPR012973"
                     /db_xref="InterPro:IPR024926"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6V6"
                     /translation="MQLTWKDIPTVPTSNDMLDIVLNRTQRKTPTVIRPGFAITRIRA
                     FYMRKVRYTAEGFAEKFTDLLQGFPNIDDVHPFHRDLMDTLYEKNHYKVSLSAISRAK
                     AMIEQVARDYVRLLKFGQSLFQCKQLKRAALGRMATIVKKLKDPMVYLEQVRQHLGRL
                     PSIDPNTRTLLICGYPNVGKSSFLRCITKADVEVQPYAFTTKSLYVGHFDYKYLRFQA
                     IDTPGILDRPTEEMNNIEMQSIYAIAHLRSCVLYFMDLSEQCGFSVEAQVRLFHSIKP
                     LFANKTVLVVVNKTDIISIEDLDPERRELLSSIEKVSGVEIMQTSCYEEDNVMKVRNS
                     ACEKLLTSRIEQKLKGSSRISNVLNKIHVAKPQARDDVDRAAYIPDAVKTLKKYDPED
                     PNRRKLARDIEAENGGAGVFNINLKDKYMLEDDEWKNDIMPEILDGRNVYDFLDPDIA
                     AKLQALEEEEEQLSKEGFYDSDSEIEDEEVEDIKEKARWIRNKQKMMINDAKMKKNNS
                     RSVMPRTKVTHSVANLKDHMYKLGHETSGLNASVKRASAQQSRGSEIVRKEASADTKR
                     PHTMLLQRDRRSDGVSDGSLRSKVDRVAKMHLRERNRHTRKGEGDRADTASLPKHLIA
                     GKRGNGKTDRR"
     gene            <209322..>209875
                     /locus_tag="PAS_chr4_0106"
                     /db_xref="GeneID:8201193"
     mRNA            join(<209322..209450,209503..209613,209666..>209875)
                     /locus_tag="PAS_chr4_0106"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493466.1"
                     /db_xref="GeneID:8201193"
     CDS             join(209322..209450,209503..209613,209666..209875)
                     /locus_tag="PAS_chr4_0106"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493511.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0106"
                     /db_xref="EnsemblGenomes-Tr:CAY71332"
                     /db_xref="GeneID:8201193"
                     /db_xref="UniProtKB/TrEMBL:C4R6V7"
                     /translation="MTVEAMNKTDLKSNSVISTVIEQDEDDSSLAPLAIDEIAEGIET
                     IEEEASSPESSKAEEDQKQNPLKRGNSRFKHFYFKREHQKENQPVEKEKVLREPSSRL
                     SLLRNHKNVCVKVTMVPTFLLTTPEAKGNLRRCPTKDFDYKTTTLSG"
     gene            complement(<210135..>210899)
                     /locus_tag="PAS_chr4_0107"
                     /db_xref="GeneID:8201194"
     mRNA            complement(<210135..>210899)
                     /locus_tag="PAS_chr4_0107"
                     /product="60S ribosomal protein L2"
                     /transcript_id="XM_002493467.1"
                     /db_xref="GeneID:8201194"
     CDS             complement(210135..210899)
                     /locus_tag="PAS_chr4_0107"
                     /codon_start=1
                     /product="60S ribosomal protein L2"
                     /protein_id="XP_002493512.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0107"
                     /db_xref="EnsemblGenomes-Tr:CAY71333"
                     /db_xref="GeneID:8201194"
                     /db_xref="GOA:C4QWG6"
                     /db_xref="InterPro:IPR002171"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR014726"
                     /db_xref="InterPro:IPR022666"
                     /db_xref="InterPro:IPR022669"
                     /db_xref="InterPro:IPR022671"
                     /db_xref="UniProtKB/TrEMBL:C4QWG6"
                     /translation="MGRVIRAQRKGAGSIFTAHTRLRKGAAKLRALDSSEREGQIRGY
                     VKQIIHDPGRGAPLAKVIFRDPTKKGLREETFIANEGLYTGQFIYAGKDASLNVGNIL
                     PLGALPEGTIISNVEAKPGDKGTIGRTSGNYVIVIGHNVEENKTRVKLPSGAKKIISS
                     NSRGVIGVVAGGGRIDKPLLKAGRAFHKYRVKRNSWPRTRGVAMNPVDHPHGGGNHQH
                     IGKASTISRNAVAGQKVGLIAARRTGLLRGTQKTQD"
     gene            complement(<211367..>213139)
                     /locus_tag="PAS_chr4_0108"
                     /db_xref="GeneID:8201195"
     mRNA            complement(<211367..>213139)
                     /locus_tag="PAS_chr4_0108"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493468.1"
                     /db_xref="GeneID:8201195"
     CDS             complement(211367..213139)
                     /locus_tag="PAS_chr4_0108"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493513.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0108"
                     /db_xref="EnsemblGenomes-Tr:CAY71334"
                     /db_xref="GeneID:8201195"
                     /db_xref="GOA:C4R6V9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R6V9"
                     /translation="MSEESPIAARNAARSSRKIDNYTSLNFVAFLSACFVNISFAVFL
                     TSTQTYFITDVLGIGQNVGAYVGSLGFFDELLAIIVVPFIGALCDRIGSRPIEFGGLL
                     IVGASFMGYAVFVNETVYPGMLFWRLVFSVGSASIMSIITVMLIELNNSDFKVSEFFS
                     QNFFGKSIQLDAETQSTLDDTLSQAAESLEATGETRAYTGTNSDIIDEGELNDVQQVN
                     EVNKSKGGEGKRVSLVGIASGLGAIFSVSVFLRMPVWFGTRNPAGVALKKSYLVVGII
                     AILVAVLLFFSLYKDDKKKIFKDDIDELFDDLNIHDADSDLDDDVEEAELFLGTSHSS
                     HKSYLESIKYGFQLSVQNPMILLAFLGGFMARCLTITVTVFIPFYINHYFYKSGKCST
                     ESTDKVHCPDSYILASILTGISNMAALIFAPIFGVLIDKFNNHAHLLLIVNTLSLLSA
                     VGVTFIKTPDSSALIFLFATMLGVSQIGFIIISMTMLSNISSNQEYYKNKGSLVGVYS
                     LFGCVGVLIVNKFGGWFGDWFMHGPFILLALFNVLFFIALFALKGVKKNESRDFQSVL
                     QSFTGTRVGRMFSNNRHVPNSDEF"
     gene            <213500..>217005
                     /locus_tag="PAS_chr4_0109"
                     /db_xref="GeneID:8201196"
     mRNA            join(<213500..215393,215498..>217005)
                     /locus_tag="PAS_chr4_0109"
                     /product="Component of the condensin complex, essential
                     SMC chromosomal ATPase family member"
                     /transcript_id="XM_002493469.1"
                     /db_xref="GeneID:8201196"
     CDS             join(213500..215393,215498..217005)
                     /locus_tag="PAS_chr4_0109"
                     /codon_start=1
                     /product="Component of the condensin complex, essential
                     SMC chromosomal ATPase family member"
                     /protein_id="XP_002493514.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0109"
                     /db_xref="EnsemblGenomes-Tr:CAY71335"
                     /db_xref="GeneID:8201196"
                     /db_xref="GOA:C4R6W0"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR027120"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6W0"
                     /translation="MKVEELIIDGFKSYATRTVISGWDSQFNAITGLNGSGKSNILDA
                     ICFVLGISSMTTVRASNLQDLIYKRGQAGVTKASVTIVFDNSDTDKSPIGFEKLPSIS
                     VTRQIVLGGTSKYLINGHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE
                     ILSLIEEAAGTKMYEDRREKAEKTMSKKDVKLREIRSLLEEEITPKLDKLANERRVFL
                     EFQQIQTDLEKLTRVVAAHDYKDSSKKYDHQRRLLDKQKGLLGELESSIEQLEKESKS
                     IHEEINRIKEKRKTELSNNASVKELEKQETIISNELARLVTSHQIKLDTIKSTNSLKQ
                     KHKSQIKQMETTIEKLKEKTTLLEKEYQNSKDSLTKLKQNHSKREDLLSSLSTGISSQ
                     GISTTGYASQLRDAKKKHSDALLSQEQLNMQSLHLQKEIETEKTAVLEAEKENKVLTD
                     ELERKGQEYCTITQKLNELGFHPSNITNLQQQKSKIEQQIYKATNELENSKRRVANLD
                     FHFANPSPQFDRRSVKGTVAQLFTVDEKNMKSVSALEVCAGGKLYNVVVDTQETASQL
                     LKGGQLKKRVTFIPLNKISAYCIDPRKVQQAKELCPGKVELALNLITYDKDVEAAMKF
                     TFGGRLVCGSRNNVGVMLTTVQKCKNIEREIANMKKELLEMNEKQKQQQGIVKQTESL
                     QQKANKLKHEISLGKKNQESHHSTITIRKNAQNISQLEEINEKLNNQNTIVLKLTEEI
                     AQIEKDIQEFGSDKSSKLKQLADEVKSLASQIPKAEETMNLKYSDYQQSLLDLEKMKG
                     DLDDLNSGVQEKDVSQLNAECDEIKQQMTNQEQELDKVRGKLEDERQKLLNLNDELDD
                     LNNELSTKHKLINENKLETQKLSHEIEKVKSVCKAYKQTVENLIKENEWVSDSNIVEK
                     LIEENPSINVHECYERIDQLKGVFQGMKRKVNSNIMSIIENVEKKEGSLKQMIRTIEK
                     DKAKIEETINKLNEYKKITLIETWKKVSEDFGNIFRDLLPNSFAKLVPPENKDVTDGL
                     EVKVMLGKVWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQN
                     IGHLIKTRFKGSQFIVVSLKEGMFTNANRVFRTRFQDGTSVVSAT"
     gene            complement(<216985..>218613)
                     /locus_tag="PAS_chr4_0111"
                     /db_xref="GeneID:8201197"
     mRNA            complement(<216985..>218613)
                     /locus_tag="PAS_chr4_0111"
                     /product="Low affinity methionine permease, similar to
                     Mup1p"
                     /transcript_id="XM_002493470.1"
                     /db_xref="GeneID:8201197"
     CDS             complement(216985..218613)
                     /locus_tag="PAS_chr4_0111"
                     /codon_start=1
                     /product="Low affinity methionine permease, similar to
                     Mup1p"
                     /protein_id="XP_002493515.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0111"
                     /db_xref="EnsemblGenomes-Tr:CAY71336"
                     /db_xref="GeneID:8201197"
                     /db_xref="GOA:C4R6W1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C4R6W1"
                     /translation="MAHSDSSGKHIFSTIHDPDLPPYRSSLIKQDDSIPGIRTLRLQS
                     VIVLFLSRMVGSGIFATPGGILADCQGSVLLFMVTWVIGGVIALSGTCVYLELGSYLP
                     VNGATKIFLEFMYPYPLYYTSFIFGAFTILFNFSSTNALVFAEYIRYALGYSYQESAI
                     KYLAITAITAVVCAHGYSRNVGLAVQNFIGLIKIIQISMLFLTCIYVFLFPESLTGIE
                     NHLHLKDFTSLPSTFSSVSYATATLKAIHSFGGWTSAFAVQNEIKKPIQTLRLAAMIS
                     LVSIIALYITMNLAYLKVVPHKDIQFGGQLVGALFFTKLFGPYYGHVLFSLFIALASL
                     GNLLVVVFVDSRLVVEVAREGLVPFSSILRSNRPFHTPLAALITHGILSSLVIIIPRN
                     RVYSYIISLQFYPNQVFHAIVCLGLLFRIRRKFPNVIAPTRAPTFVVFICLLGSLSVV
                     LSPFISSSKNSFKDASFAFIGVGALLLLSFCWFILYYWWPLRGNFSVEREWKEDSFDG
                     MTYYECYKSLRNDELDDYGSINIENRRSLGGANY"
     gene            <219604..>220722
                     /locus_tag="PAS_chr4_0112"
                     /db_xref="GeneID:8201198"
     mRNA            <219604..>220722
                     /locus_tag="PAS_chr4_0112"
                     /product="Threonine aldolase"
                     /transcript_id="XM_002493471.1"
                     /db_xref="GeneID:8201198"
     CDS             219604..220722
                     /locus_tag="PAS_chr4_0112"
                     /codon_start=1
                     /product="Threonine aldolase"
                     /protein_id="XP_002493516.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0112"
                     /db_xref="EnsemblGenomes-Tr:CAY71337"
                     /db_xref="GeneID:8201198"
                     /db_xref="GOA:C4R6W2"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:C4R6W2"
                     /translation="MTKEDFPCANEFRSDTFTVPTASMIQSVALASVGDSVYAEDLDT
                     LNLEEKVAQMADKEAGLFCVSGTLSNQIGLRSHLMQPPHRILCDSRAHVYMHEAGGLA
                     TLSQAMVTPVTPRNGLYLTLEDVVDNYIPDDGDIHMAPTKVVSLENTIHGIITPLEEI
                     ARISEWCRENDVRLHCDGARLWNASVETNTPLSEYGKLFDSISLCLSKSLGSPMGSVL
                     VGDRKFIDKANHFKKQNGGGIRQSGFIARMASIAIDENLGKLRQSHEYAKDVARFLQD
                     NGVPLECPTHTNFVFVDQKKARIDPDHLVAMGEKYNVNIMGTRFAFHFQNSKEAVERL
                     KQAIMETFKYSQEHPYVSTGAKRLYTSKSRSNSPVLKN"
     gene            <221077..>223980
                     /locus_tag="PAS_chr4_0113"
                     /db_xref="GeneID:8201199"
     mRNA            <221077..>223980
                     /locus_tag="PAS_chr4_0113"
                     /product="Protein that associates with ribosomes"
                     /transcript_id="XM_002493472.1"
                     /db_xref="GeneID:8201199"
     CDS             221077..223980
                     /locus_tag="PAS_chr4_0113"
                     /codon_start=1
                     /product="Protein that associates with ribosomes"
                     /protein_id="XP_002493517.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0113"
                     /db_xref="EnsemblGenomes-Tr:CAY71338"
                     /db_xref="GeneID:8201199"
                     /db_xref="GOA:C4R6W3"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:C4R6W3"
                     /translation="MTQSESAQSESTQAVKAQELPLTLSNEFLPEHYDLNLDILPKKP
                     NFTGTNGIRMVKNRRYVPPAAIEEGEQKLEVVLHSLELFVTDAFFIVKDGDSFLKEKV
                     AVKHNKAVHTVTFTLTGDKVELYRNAPFFQCSVFYMGVITNCRSTEDKTRGVFRSNYA
                     WSDEEGKQFPGQIFATHCQPTFARQIFPCIDDVTHKVTIQLSIQTDADLTCISNTAVE
                     AGELLPDEKNEDDGVTRKMVLFEKSPPTLVSLFAFVVGDLEFTEKVVKVAGQELPLRV
                     YVQKGDAKLTEYALDVASKSFPLMATKFGLSPCPFKKLDFAALPYLTDGGMENSGLIT
                     IAAPHLLVEPDTTTDPEYASHLTKVRQVIVHEMVHQWMGNFVSFDDWSHMWFNEAFAT
                     WLALVVLEEINEYPDDKDIWLSQANLEMYQMMRRDATKFVVPIYREERKKVQSIQDAF
                     NEHAYQKGVFVLRMLTNLFNSSNDDSNNDFFAIVSQFLADYKYLSIKPSDFFKYVTDS
                     ELNKKKIDAAAIMYSWVRTPGFPIVSATVNSQGKVHLEQHRFLFRTRIEETDLEDVPY
                     HVPVSIRLKDGTIARQMLTDRSIDLDLKVEDVVVLNANYTNPMIYQYSLEYYDNIATA
                     IKENKLSAIELTSLYTDLSSILMEKYQGDDDIIGLLKTVEAFGEDSAKLQFLPLNTAL
                     NLLEAVQNALETYTVKNSKEARRRIESFVSRISAKLFDKLEWESVDYSTLPPTELYTR
                     NTILSMAGKSEHEPAVKTVKQFYKKLTHGPKKSVPKQFLAAVLIVTARRCDQKEYKEI
                     ASLAKNAEINVQNLVSGSQVDIQTSAMSALGHVKNVQLIKKTLNHVASNITSKLIEIC
                     LLGFKSNVDARGELFQWFSLNYENWLVKAGTDTTEAGKQMRITLHNLTKIVFEVMMFD
                     ESGLEQIDSFTKRIEARFPKFEPLKQAFKQAESIVEDKKVLNQSNEEVIAYLN"
     gene            complement(<224038..>224607)
                     /locus_tag="PAS_chr4_0114"
                     /db_xref="GeneID:8201200"
     mRNA            complement(<224038..>224607)
                     /locus_tag="PAS_chr4_0114"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493473.1"
                     /db_xref="GeneID:8201200"
     CDS             complement(224038..224607)
                     /locus_tag="PAS_chr4_0114"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493518.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0114"
                     /db_xref="EnsemblGenomes-Tr:CAY71339"
                     /db_xref="GeneID:8201200"
                     /db_xref="UniProtKB/TrEMBL:C4R6W4"
                     /translation="MMMYSPGVPKASNFIDPALITPPPSPEPAFTPRRRLLKQVPHSH
                     FWIQNEDSFEVFQARLFRLHATSTLQLLSYIDQNPEVTFHFSTFFQDVILPDRMYQFP
                     GENLKEFVVLSGREAVDQYSKLRILLTIYLRRIAAGRICLGLLNQLSNSDEGKIDQIL
                     LHNLIARVRPIYGDKVLTDLGIKLKHSNL"
     gene            complement(<224612..>225289)
                     /locus_tag="PAS_chr4_0919"
                     /db_xref="GeneID:8201201"
     mRNA            complement(<224612..>225289)
                     /locus_tag="PAS_chr4_0919"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493474.1"
                     /db_xref="GeneID:8201201"
     CDS             complement(224612..225289)
                     /locus_tag="PAS_chr4_0919"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493519.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0919"
                     /db_xref="EnsemblGenomes-Tr:CAY71340"
                     /db_xref="GeneID:8201201"
                     /db_xref="UniProtKB/TrEMBL:C4R6W5"
                     /translation="MYPVSIPSLNSSHEVGKEQLVDPLSLANVIQYQSTFLHGTQSHV
                     IEHRSLSSKDQTSMSFDNNDFQRHNSDTNLRRRKSKKAASELNRNFSTGSKASGYSYK
                     VSRRKPLHNYEPSWRKHSKKPTTHPNFSTKEQLYRVIERLNLKDRQLAIFSPHGPSTA
                     PACILQYETEAYKSIVQPNPKLKKKVKQLSFDKNQVAVLSVDSHEANLEKYQKILNYP
                     LPPNQWK"
     gene            <225640..>226181
                     /locus_tag="PAS_chr4_0115"
                     /db_xref="GeneID:8201322"
     mRNA            join(<225640..225657,225714..>226181)
                     /locus_tag="PAS_chr4_0115"
                     /product="Minor isoform of tropomyosin, binds to and
                     stabilizes actin cables and filaments"
                     /transcript_id="XM_002493475.1"
                     /db_xref="GeneID:8201322"
     CDS             join(225640..225657,225714..226181)
                     /locus_tag="PAS_chr4_0115"
                     /codon_start=1
                     /product="Minor isoform of tropomyosin, binds to and
                     stabilizes actin cables and filaments"
                     /protein_id="XP_002493520.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0115"
                     /db_xref="EnsemblGenomes-Tr:CAY71341"
                     /db_xref="GeneID:8201322"
                     /db_xref="InterPro:IPR000533"
                     /db_xref="UniProtKB/TrEMBL:C4R6W6"
                     /translation="MDKLKEKINKLKLDAETWQEKHDDVNSKIKVLEQEALEKDHQIQ
                     ALTRKNDVLEEQVEKLEEQLSTSKETVNESHSLKTNNENITKKNQLLEEELEAADKNL
                     KETTEKLRDTDIKAEALEKKVTSLENEREEWERKFEELQEKYNATREELDAISEQLEN
                     L"
     gene            <226458..>227300
                     /locus_tag="PAS_chr4_0116"
                     /db_xref="GeneID:8201202"
     mRNA            <226458..>227300
                     /locus_tag="PAS_chr4_0116"
                     /product="Protein involved in N-glycosylation"
                     /transcript_id="XM_002493476.1"
                     /db_xref="GeneID:8201202"
     CDS             226458..227300
                     /locus_tag="PAS_chr4_0116"
                     /codon_start=1
                     /product="Protein involved in N-glycosylation"
                     /protein_id="XP_002493521.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0116"
                     /db_xref="EnsemblGenomes-Tr:CAY71342"
                     /db_xref="GeneID:8201202"
                     /db_xref="GOA:C4R6W7"
                     /db_xref="InterPro:IPR021100"
                     /db_xref="UniProtKB/TrEMBL:C4R6W7"
                     /translation="MSFTPTEEPIPSYERSQLLHRTASSRRMARNSSHSLSNLNISKI
                     VSEDIKKQQESLRIMGLAILSSRQHLALSFCKDIPLIIIAIDLYGCLKNCWTPRTHQH
                     SITSAKSSEYVLGGIWCLVSGYLTYSILDGLMVRWIVTYSSWGAIVRMLSMSLLIVIV
                     IQLLSIVCNPDGLYYLPAWVLISCLLTVIYIIQSYVTSNLRIKSHLEEPYAEGVISLP
                     IIPRPDDKVKRTVDIYNIAVFAVVPIGIASFVTMVGLIRILLIMRFDVGSVTNTVSNI
                     AIPQ"
     gene            <227442..>228101
                     /locus_tag="PAS_chr4_0117"
                     /db_xref="GeneID:8201203"
     mRNA            <227442..>228101
                     /locus_tag="PAS_chr4_0117"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493477.1"
                     /db_xref="GeneID:8201203"
     CDS             227442..228101
                     /locus_tag="PAS_chr4_0117"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493522.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0117"
                     /db_xref="EnsemblGenomes-Tr:CAY71343"
                     /db_xref="GeneID:8201203"
                     /db_xref="GOA:C4R6W8"
                     /translation="MNKFSSDSSRTTAQSTINKLLVNLIPGSQLNDAKVAKKAKKSSS
                     AKIISDQIGSRMEFKRNEEKRRKFLKQNNLKKRKMKRKSKDLEAQLERIARLSNIKEL
                     QQMSEDSNDPLLDQVIDKKITALLSWTTDNSELGTEIEKLKKDILNTDNEEVRRRKSY
                     RDEEREEAEFRSEVEKGSIAYPGLTPGLAPVGLSDDEDDEEEDESDGFDKEEEEDQFS
                     E"
     gene            complement(<228154..>231180)
                     /locus_tag="PAS_chr4_0118"
                     /db_xref="GeneID:8201204"
     mRNA            complement(<228154..>231180)
                     /locus_tag="PAS_chr4_0118"
                     /product="DNA repair and TFIIH regulator"
                     /transcript_id="XM_002493478.1"
                     /db_xref="GeneID:8201204"
     CDS             complement(228154..231180)
                     /locus_tag="PAS_chr4_0118"
                     /codon_start=1
                     /product="DNA repair and TFIIH regulator"
                     /protein_id="XP_002493523.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0118"
                     /db_xref="EnsemblGenomes-Tr:CAY71344"
                     /db_xref="GeneID:8201204"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:C4R6W9"
                     /translation="MDLQLSQWVSQFMASENDPPCEEIAKAVIEKRISLLQLIKTLGS
                     HLTDETPHIRSTAVGCLSNTLAKIERLNRADIEVIAKFYIGKLDDNDVMSNTLVGLRA
                     LTSLKNFNPALLESVLTSVQEKYEPASFLAATRYQSFLLLETIYQKHLDFILANLNDL
                     FVKVFIHISTNEKDPRNLLISFSLNKQISSTLQVENFAEDLFDNAFCYFPVSFKPPPN
                     SPYSIASHDLKTGLRQVFAATPLFAKDLFPNILEKLTSTSPAVKLDVLQTLNLCLDTY
                     DNDTIQEYWLTLYNALKFEVLYNDLANIVELADIEKLSTEDDLVFKEVIALFKNLPKK
                     FTDEQIIKNLQIMLEELKEYLHISHKYFKQTVLLLSVMATSKLSVYNHIVGEVLPVLL
                     TDEPSTVVDEKNLATALNFFINPDYPESKLSQYKDDILVVLSKGLMSSSNVETTLKCI
                     CIRSLVNLSFILDTQEVASVISNLSELLLSTMKNEKDPIFQETLNAFTNISATMPNVV
                     LETTLPLLLSKLPNESSSEIDLELVRNVLNVVVNISHSKLLLDSIIVRLLSVYERLLN
                     GRVVTMDYYYFLLNSIYLLLSNYPELLSKDYADRVIPQITSLTIVNYRLSKESPVYLN
                     ERILDQCGKIIRLIICKLELIHHQKILDDAVDTFLLGSDSPLFSTSLGLEISLVSKPP
                     TLVSLFNKFLSAVSKDCPLKIEPLDVLSSLVEITRDSKHFESLFERMGFLELICLLAN
                     KYISDSDLEKILNELSETIDLQSSDSLGTLEVMAWITKSLVLSNSPLAMKYQEYFFSL
                     LEIPSVASVSPKLLEVLIAEVSELEVNKRDKKIINLNVRLLYKQKFYNIMLPKIIEGY
                     RNCEQASKETYLLLLSLILNHVHQREIILSHLENILPLILQIIQSDNAKSRNSGLEIL
                     NLTIESNCMLIKPHLHSIISRLLAITKDNSDLNGQINALLCLKEIGISKIPLSQLQPF
                     RTTIINQTVAVLSHKKRKVRKLAADVRQIYYELEQS"
     gene            <231393..>239202
                     /locus_tag="PAS_chr4_0119"
                     /db_xref="GeneID:8201205"
     mRNA            join(<231393..238718,238765..>239202)
                     /locus_tag="PAS_chr4_0119"
                     /product="Protein involved in cell morphogenesis and
                     proliferation, associated with protein kinase Cbk1p"
                     /transcript_id="XM_002493479.1"
                     /db_xref="GeneID:8201205"
     CDS             join(231393..238718,238765..239202)
                     /locus_tag="PAS_chr4_0119"
                     /codon_start=1
                     /product="Protein involved in cell morphogenesis and
                     proliferation, associated with protein kinase Cbk1p"
                     /protein_id="XP_002493524.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0119"
                     /db_xref="EnsemblGenomes-Tr:CAY71345"
                     /db_xref="GeneID:8201205"
                     /db_xref="GOA:C4R6X0"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:C4R6X0"
                     /translation="MNDPGMNSYSFPPQNNDDNSEVLPDSPGETNNVYQNQSIDLSLE
                     DQREQSGFSDNHGDVLPILSNINDSYENFSSNVLNKEIRQSAQLPTLPPDILASKESV
                     NISKLPQLSPNGVETGSHGLGLNQVTLDDPSTKHTANISLEHQQQTKDNYIYESQNTL
                     DLRRNLATEFKTPADYALHILFTQFVRYAERKLHLCLDQFALDDELGVVNFLSEADPT
                     FDKIIDSLGNIAKKNPKPIIDSVMFWRKSKAEVALIASQEVDRNIELFKKERSHLNKL
                     KEENQDTTVASVRLSDLEILVNDSKETALQADRKSLVSTFLVCRVLIDVVKKTPTKSF
                     TGDLEEKLEDTCYSQLKSADPLLLRTSIIRTSNWNLFAELISCLSAKRFISVSDRFIA
                     DLEKYPTGYVASSEKNLSEVQLSFIIHGSRYLKLKTIPLESFEDSADFMKSFGKFFSM
                     CQNPNLLIVYCQVLSHLLYSVSDVITAEVNHPTWVEAINLIFQKAQTLNSAASSIPWI
                     HVIQLTTAALCSSTEAIFKDHWVSLIDDLAANLNSKTPIRNKVVIMRCICRLCWVYLY
                     RNTESFNLTVKKIRYVHLLLQPNGQTTANSSKKNVHWLVSDDELVASVIYFFRLSSFK
                     LLDSEMENNLLPVMHSNFFGNSIGSPMLLTTTIRCYVHVLKDSGSTERPPFPTDEVIN
                     TFESELDQTPAGRIPFKENTSAYINHEEFSHIIGELILHLDQVYGASSQKAASSDKLS
                     HKSSASFSSLSSASSFKNAFTFMKSNTDSQKKDKEQYSLLFASVIEVIPWCFFNKVIS
                     FRKLVELLVRNASHPDVLIASEAISGLKVFMVSGKQSILLNTFTNYAFKLEDKNNHNS
                     LNHQYLNSNEYLHYLNIYHELLESWLDSLKKRNEKKSARVEPLQSGDALHLPTEIMPL
                     DMADTSVSKEQEVIEQLELKSIAAIIDEFEGNAMFFLCSHSIDVRTLGVKLLKLVVEF
                     DNFFNEAPQAGSNDNEGNGHIRATSKFAAEFGTRVIQVLETIDFFELMTGNLKRNELS
                     YPEKSRLSKLQLKSRKDTLIKLAESNYGVDSALWFRVFPSILSIFVERCPIPIAICRT
                     YSCVRMVQLYDQLLDTINNDKDMGQSYSIIKEYKIYLMIACASLTSTSEQRMHIPRLL
                     GSNTSENHLAMTKSHSRKKSQQMFTLQHRTITSVKSIFKMVIPLLGTNSVALKDTVVS
                     GLSCLNVNIFTSFLESIKPYFQTFADDTVTSSITTGPENLIRIELSQILYKLTGSYLK
                     PEFINYVYADQTILSQLLTYIKELKSFLSENTIQQSLEFQPLRSYFTGILENVYQGIL
                     QSDEDIDKWLPFEARVGCFSFLEEWSSYGRCVPISTRRYEVMQKKAAASKDAVSECAN
                     LEMEKTKLQRLVNSCMVSLCTSPITESVNEDGLSVVMSFDINSLMTWIESLCRSKDKQ
                     AHAQGKEALLNVLVMNDNLQSIIDMIIRNCYCYHESSASSEIYFTVLVQAFIQKPNFP
                     IKLFECISLGLFGSGSENFNIRSHATKFLVESEKRFFHSSVSERFTESIRSRTRVIYK
                     RAMFNLATYFASRYQEEHMKVISELTMIFHLVGPEQRRDVLVSLIPWVQIVKLELDPE
                     NPNYAYSNMVIQNFFEITIKFSDKIQNEVEALWIALANGSHPQNAHEIAKFIMDNSIE
                     RKNPIFVGISRQVFVYLSASSAGPDLVNQLITNLEPKCMVPQQPKTLSNPPIALDLPY
                     VANIWKGLQFNYKVDAVFSLGQLSMIFLVDLLAISPSILRTKLALLLHASFVLLDHYL
                     RVVQDQACVLLIHLLHELAIDNDKAKEIFTFLRQPDYSKKLWVYDNLRTNRNGTRTPR
                     NMDKLIREVLQIFTPIFPGLQEEWSRTALKWATSCAVRHIACRSFQIFRSLLYFLDQR
                     MLKEMLHRLSNTISDGTPDIQGFSMQILMTLNAVTAELSSETLIDFPQLFWSSVACLS
                     TIHEQEFIEVLSSLSKFISKIDLDSEDTVNCLISTFPPKWEGKFEGLQPIIMVGLRSS
                     NAYEPSLRLLNRLNLLKDSKILGTGDLRLLYALLANLPSFLHASTENNFPEDVINAGK
                     VISQMADANDKPALSAIIDSLLKDKFRRKNDFLSQFCSVLRQYFLPLYEAQILVFLLG
                     LLPNKIGWIKIEVMDLLKFIFPIVNLESSQFTGVGADLIAPLLRLLLTDYADQALSVL
                     ETNVLISGSQLDQDVLRMSLGNEHIKKEYEKTATLFGVPEPSGWAIPMPAITAATTRN
                     NIHAVFSTCVVASNTEAELAHNNEEIQFHSEEYPPYQPIAQPTEDAYSVVNNNTGEWG
                     LNNMLETLNNLDSFFTNDEPRTFFDGGDHKYNNSIDTKASGMETITQMESAPQVYDKK
                     ASMILNRSLARSPSNASFKSPLMDAFNQQSGHTFRKHDELNAEGTNNEENKSSVYPAS
                     EIPLNMEKSSYLLFRGSRGSPVKPRGVSRKNKPERREQFDKTPPLGPTSSGSQISSEL
                     LQNEPTSGRVNLEETHFRFEGLLRTKRKQNRFSVNSGNVTSSNDNLHTPVLTRNSFPA
                     RSPSSGSSGGLSPVFNPATAPSNGPSGPRGRDVRSSVFGRNHRKSSPKS"
     gene            <239379..>240560
                     /locus_tag="PAS_chr4_0920"
                     /db_xref="GeneID:8201032"
     mRNA            <239379..>240560
                     /locus_tag="PAS_chr4_0920"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493480.1"
                     /db_xref="GeneID:8201032"
     CDS             239379..240560
                     /locus_tag="PAS_chr4_0920"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493525.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0920"
                     /db_xref="EnsemblGenomes-Tr:CAY71346"
                     /db_xref="GeneID:8201032"
                     /db_xref="GOA:C4R6X1"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025604"
                     /db_xref="UniProtKB/TrEMBL:C4R6X1"
                     /translation="MPEKLEEWEIKKYWEIFSGLKPVDNKLSGDRVSVVFKNSQLNTD
                     QLALIWDLSDIDQDGELDFEEFCIAMRLIFDLVNGTIAELPSTLPNWLVPGSKAHLVQ
                     ANSAVSQGSNYSANTQVDDDDEDAKLSSDFEWYISPADKSSYESIYTASSDQYGRIKF
                     NDLQELYETLVKVPQTDISSAWNLVNPKQAETIDKDQCLVFLHILNQRSNGKRVPRGV
                     PASLRATFSKETPTYDLKSSQAQVTKPSSAPGHESRKHSFADSYLSKIGASQNSSAEV
                     GTDFSATKDTDWEEVRLTRQLQDLEELISKVEKDRSQRLDPDPAVNASSMTKYELEQL
                     LKYKEDKLTSLKSSNGASSGSLSSIKADVDLIESQVQTLQEYLQSKKEELKQLQSTLK
                     T"
     gene            complement(<240623..>241492)
                     /locus_tag="PAS_chr4_0120"
                     /db_xref="GeneID:8200953"
     mRNA            complement(<240623..>241492)
                     /locus_tag="PAS_chr4_0120"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493481.1"
                     /db_xref="GeneID:8200953"
     CDS             complement(240623..241492)
                     /locus_tag="PAS_chr4_0120"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493526.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0120"
                     /db_xref="EnsemblGenomes-Tr:CAY71347"
                     /db_xref="GeneID:8200953"
                     /db_xref="GOA:C4R6X2"
                     /db_xref="InterPro:IPR001268"
                     /db_xref="InterPro:IPR010218"
                     /db_xref="InterPro:IPR020396"
                     /db_xref="UniProtKB/TrEMBL:C4R6X2"
                     /translation="MIAARSIQRAIGTKPLAVRAVVLTTNSFRGFSKSSMSRKADEEP
                     LPVLRDLPRPEYGELHAPVYNPAEKYKEQIEELHKFGRYIMGCLPKFVQQFSVWKDEL
                     VIYVAPSALTQVATFLKDHTSAQFKACMDVTAADYPTRTNRFDVVYNLLSVRHNSRIR
                     IKTYASEVSPVPSVVPLFQGANWFERETYDLFGIFFEGHPDLRRIMTDYGFQGHPLRK
                     DFPTTGYTEVRYDAEKRRVVYEPLELTQAWRNFTVGSSVWEQVGDGKDFTPESFKLPT
                     PAPDPEPEADKKK"
     gene            complement(<241651..>243228)
                     /locus_tag="PAS_chr4_0121"
                     /db_xref="GeneID:8201033"
     mRNA            complement(<241651..>243228)
                     /locus_tag="PAS_chr4_0121"
                     /product="Subunit beta of the cytosolic chaperonin Cct
                     ring complex, related to Tcp1p"
                     /transcript_id="XM_002493482.1"
                     /db_xref="GeneID:8201033"
     CDS             complement(241651..243228)
                     /locus_tag="PAS_chr4_0121"
                     /codon_start=1
                     /product="Subunit beta of the cytosolic chaperonin Cct
                     ring complex, related to Tcp1p"
                     /protein_id="XP_002493527.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0121"
                     /db_xref="EnsemblGenomes-Tr:CAY71348"
                     /db_xref="GeneID:8201033"
                     /db_xref="GOA:C4R6X3"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012716"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C4R6X3"
                     /translation="MSVNILGDQVSEERAENARLSAFVGAIAVGDLVKTTLGPKGMDK
                     LLTSASSGQSIVTNDGATILKSIPLDNPAAKVLVNLSKVQDDEVGDGTTSVTVLASEL
                     LREAEKLVDRKIHPQTIIEGFRIASKAALEALDKVAVDNSHDDAAFRKDLINIAKTTL
                     SSKILAQDRDKFAEIAVSAILRLRGSTSLERIQLIKIIGGQLSDSYLDDGFILNKKFG
                     LDQPKKIKDASILIANTSMDTDKVKIFGAKFKVDSTSKLAQLEKAEKDKMKAKVEKIK
                     NFNINCFVNRQLIYDWPEQLLADSNINTIEHADFDGVERLALVTGGEVVSTFDYPGKV
                     KLGKCDLIEEVIIGEEVMTRFSGVSEGAACTIILRGATEQVLDEAERSLHDALSVLSQ
                     TTKETRTVLGGGCSEMIMSNAVDTQAQNQEGKKQLAVEAFARALRQLPTILADNAGYD
                     SSELVARLRSAIYSGLTTSGLNLSNGTVGDMRQLGVMESYKLKRAVVNSASEAAEVLL
                     RVDNIIRAKPRTADRNR"
     gene            <243693..>245247
                     /locus_tag="PAS_chr4_0122"
                     /db_xref="GeneID:8201034"
     mRNA            join(<243693..244307,244405..>245247)
                     /locus_tag="PAS_chr4_0122"
                     /product="Probable transporter, member of the Ca2+-binding
                     subfamily of the mitochondrial carrier family"
                     /transcript_id="XM_002493483.1"
                     /db_xref="GeneID:8201034"
     CDS             join(243693..244307,244405..245247)
                     /locus_tag="PAS_chr4_0122"
                     /codon_start=1
                     /product="Probable transporter, member of the Ca2+-binding
                     subfamily of the mitochondrial carrier family"
                     /protein_id="XP_002493528.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0122"
                     /db_xref="EnsemblGenomes-Tr:CAY71349"
                     /db_xref="GeneID:8201034"
                     /db_xref="GOA:C4R6X4"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R6X4"
                     /translation="MISVDNQARVPDAQMESSEARDRRYKQLFERLDIQHSGAISLSG
                     FRKSVKDLDHPIKDSKDAVEEIFQSLDNHNLNAVDFDSFKEYLIRAETQIIKGFHNLD
                     KDQDGIINQNDVKNYLEGLGVEANDKQVEQFFNRLDTKHDGVITYDEFRDTLLLMPRL
                     SGSRVKTAYKFISSDLENVSSDGDFTVGEDILNSIGYFLAGGLSGKITSSVGELKHQK
                     IPIDKIKSPILKAATSIYRQGGLRGFYVGNGLNVLKVFPESAMKFGSFEAAKRFMCTV
                     EGVSDPTQLSKVSTFAAGGFGGVCAQMTVYPIDTLKYRLQCAKLDSDIRGNRLLWTTA
                     KQMYKEGGLRIFYRGLYVGIIGMFPYAAIDLGTFSTLKKWYFQKEAVLQNCAPEDVKL
                     PNYIVLSMGALSGTIGASMVYPVNLIRTRLQAQGTYAHPHRYNGFFDAARKTMVKEGV
                     PGLFKGLLPNLAKVAPAVSISYLMYENLKDLFQLE"
     gene            complement(<245393..>246457)
                     /locus_tag="PAS_chr4_0123"
                     /db_xref="GeneID:8201035"
     mRNA            complement(<245393..>246457)
                     /locus_tag="PAS_chr4_0123"
                     /product="Receptor for alpha-factor pheromone"
                     /transcript_id="XM_002493484.1"
                     /db_xref="GeneID:8201035"
     CDS             complement(245393..246457)
                     /locus_tag="PAS_chr4_0123"
                     /codon_start=1
                     /product="Receptor for alpha-factor pheromone"
                     /protein_id="XP_002493529.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0123"
                     /db_xref="EnsemblGenomes-Tr:CAY71350"
                     /db_xref="GeneID:8201035"
                     /db_xref="GOA:C4R6X5"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="UniProtKB/TrEMBL:C4R6X5"
                     /translation="MEEYSDSFDPSQQLLNFTSLYGETDATFAELDDYHFYVVKYAIV
                     YGARIGVGMFCTLMLFVVSKSWKTPIFVLNQSSLILLIIHSGFYIHYLTNQFSSLTYM
                     FTRIPNETHAGVDLRINVVTNTLYALLILSIEISLIYQVFVIFKGVYENSLRWIVTIF
                     TALFAAAVVAINFYVTTLQSVSMYNSNVDFPRWASNVPLILFASSVNWACLLLSLKLF
                     FAIKVRRSLGLRQFDTFHILAIMFSQTLIIPSILIVLGYTGTRDRDSLASLGFLLIVV
                     SLPFSSMWAATANNSNIPTSTGSFAWKNRYSPSTYSDDTTAVSKSFTIMTAKDECFTT
                     DTEGSPRFIKGDRTSEDLHF"
     gene            complement(<247340..>250051)
                     /locus_tag="PAS_chr4_0124"
                     /db_xref="GeneID:8201036"
     mRNA            complement(<247340..>250051)
                     /locus_tag="PAS_chr4_0124"
                     /product="ATP-binding protein required for mismatch repair
                     in mitosis and meiosis"
                     /transcript_id="XM_002493485.1"
                     /db_xref="GeneID:8201036"
     CDS             complement(247340..250051)
                     /locus_tag="PAS_chr4_0124"
                     /codon_start=1
                     /product="ATP-binding protein required for mismatch repair
                     in mitosis and meiosis"
                     /protein_id="XP_002493530.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0124"
                     /db_xref="EnsemblGenomes-Tr:CAY71351"
                     /db_xref="GeneID:8201036"
                     /db_xref="GOA:C4R6X6"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028831"
                     /db_xref="UniProtKB/TrEMBL:C4R6X6"
                     /translation="MITQISEKDAHKLSSGQLIIDLTAAVKELVENAIDANSSQIQIT
                     IKDYGLDSIQVSDDGVGISVEDHPFVCSPYYTSKLSSFEDLQAVSTLGFRGEAMSSLC
                     NISNVTIVTCPDPDVAASKLEYDHSGKLIKSSSISAKKGTEVTISNIFENLPVRRKEL
                     VKHAKRDFYKLMTVLQSYAVINTQRRIMVNHITAKGKKNQMLATQGASLKGNLVNVFG
                     AGALNGLIPINIQLSISAKYSEEFELSVEGYISNCSFGQGRASSDRQLFFINGRPVDL
                     AQLSKKINEAYKTFNHLQYPMVVLNLKLDPNYLDINVTPDKRTIMIHHEDQVLESLID
                     ALINEFNSQSHIIPKQETSTLVDSSMLQRPTGDTSFRQRKRSDIYSTINERTKRLKDA
                     SLHVEDTNNTTTELSLFVREDSEEHTGATEPDQDIGNDVGVVLTTLSPPRTVKTVRNY
                     RLDERDNSSNQRKEEESSKSDYSEEDEVDDQGTSTPNDDSNNLSITRVYSVEDNDHQG
                     PDDVVIIDEKHIGEGRGGFGRSKATEKSIDEENIVENGIKNQEPSNDSELVNAEIIDE
                     EDGSDHADIIEYNSPTTRQIPKNRPQLVTEIFQEPSKQNNATSEIDLLASYSSTVPIL
                     NFSRAKRLNSQRYVGTVAIESQKIAQQFASNTSRLINAVDSEKTSLEVAKDDITDKEV
                     AEEALTMRVSKTDFLKMKVVGQFNLGFIIVTKKSTEGKQDLFIVDQHASDEKYNFENF
                     QKNTQFLSQPLVVPQFIELNLLDEVLVQDNIEIFSKNGFSIKFQEENEAGKRIQLLSI
                     PMSKGTVFDIADFHELVHLLKENQGISKENLLAHVRPSKIRSMFAMRACRASIMIGKS
                     LSMKTMTRVVHHLSGLDKPWNCPHGRPTMRHLIELSDLKPFQDDYIV"
     gene            <250208..>250918
                     /locus_tag="PAS_chr4_0125"
                     /db_xref="GeneID:8201037"
     mRNA            <250208..>250918
                     /locus_tag="PAS_chr4_0125"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493486.1"
                     /db_xref="GeneID:8201037"
     CDS             250208..250918
                     /locus_tag="PAS_chr4_0125"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493531.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0125"
                     /db_xref="EnsemblGenomes-Tr:CAY71352"
                     /db_xref="GeneID:8201037"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:C4R6X7"
                     /translation="MNLQTGTDSKTANASNAPPEDELVRLPQIYQMTIDYILIWIELI
                     WYYRGLYPAESFKAKQAFYTKVYQNRHPDLQAYLDDLRGDLMDLLQNGQLCKIHLRIF
                     EHNKVIESYTINVINSPILYESFALEEDVIISNEDYPLAMIYAEFQASLNSLISELSG
                     ISNQYPVSQTQEDDNYKFKIYISPNAGTNDLYSKLVVNANWTLTSRRPQNAPVHLNRA
                     RAVDLGFLNIQTTFNIRS"
     gene            <251046..>252845
                     /locus_tag="PAS_chr4_0126"
                     /db_xref="GeneID:8201038"
     mRNA            <251046..>252845
                     /locus_tag="PAS_chr4_0126"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493487.1"
                     /db_xref="GeneID:8201038"
     CDS             251046..252845
                     /locus_tag="PAS_chr4_0126"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493532.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0126"
                     /db_xref="EnsemblGenomes-Tr:CAY71353"
                     /db_xref="GeneID:8201038"
                     /db_xref="InterPro:IPR005011"
                     /db_xref="UniProtKB/TrEMBL:C4R6X8"
                     /translation="MGGESLSIEETNKLRKQLGLALLPVEPSVSNVSAKDSISVEKTN
                     KLRTSIGLKPIPESTPDSETKNYEEYKREQEKQLKEKEIEQRLERLRNKASNDKLRKQ
                     GTLLDSEDSANWLENLGKAETDTAVESSKAHSADYTEHDLKGTKVAHDLKDIVDVGQD
                     IVLTLKDGSVLDDEDELEANVLVKMKQLEENIRNKLGEEKYDELDHGPGLTGGSFRLG
                     DAVPTEGERQKHQVRPNMKLVQFSDDEFEGEVKIGSDYKKPVKMKKLKKKTQNKRKKL
                     DDDEEINTFKVIKLDISDEYNEEDEYSKQLSAAKANRKPIRDTAEFLAEKVEQNKVET
                     IPLTVSTMFVDETDEFLTSLKDAVERDIEEKKDEENKIEEVKVEKPVFRKRKGISSQR
                     KETQETDEPVPENQPVDTVEKDETKEKIIHEIEDKKVADQLSTAEPENGQETTKETNP
                     IAATPTQLNSSESLGAGLGATLKYLKVKPSIDAQRAELQNKQLLKERERQLAVIERQI
                     NERLREQALYGGSGTQLEYTNLSKKEKERLSQLEKEREQLLKDTFQEEKLKNYNPKVN
                     LVYTDEKGNKLSTKDAFKYMSHKFHGTFKKNNK"
     gene            complement(<252850..>254424)
                     /locus_tag="PAS_chr4_0127"
                     /db_xref="GeneID:8201039"
     mRNA            complement(<252850..>254424)
                     /locus_tag="PAS_chr4_0127"
                     /product="RNAase III"
                     /transcript_id="XM_002493488.1"
                     /db_xref="GeneID:8201039"
     CDS             complement(252850..254424)
                     /locus_tag="PAS_chr4_0127"
                     /codon_start=1
                     /product="RNAase III"
                     /protein_id="XP_002493533.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0127"
                     /db_xref="EnsemblGenomes-Tr:CAY71354"
                     /db_xref="GeneID:8201039"
                     /db_xref="GOA:C4R6X9"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:C4R6X9"
                     /translation="MSDEEGKRKRQKTDKASGEEKKSKKKTKISLVQCLETEYAVNKL
                     TSSLKEVLEVSPSYREVAKALDNLGDYEAAVVLALTRGPKLVHASKLKTLYKHGKLDF
                     LNLILNFNDPKVFAEFEDLESKYNKKKSDNKSGKKDINKPSNEDEEGKEVRPKGVEQY
                     PPPLLPLTDPVLRSKVFTHKSAVTQAEEDSIEAANSSYERLEYLGDAVLELAVTSIVM
                     KEFPASSEGHLSVCRQQIVSNSNLENYSKLYGFPEKLSSLMSKEETDKNNGKIYADIF
                     EAYIGALYVQNNNDLTMIQEWLGKLARPVIEAMKMKRDKSYLNKSAKEKLYALIGSAK
                     SAPKYVTLDNGPARDEWLVQVEMEGEIIGKGIGGSVKDARTRAAMAALENHNAIRKYN
                     TMRSTTLREESLVKAPEDSELQKEVDDLIEKIKMSKNVKNVSFPLRVPENSGVIPEHK
                     GLIMFLFSKWNLQTELKCVKLNDQFETTFVVEGKSILTSYSQHKKRSNLLCYTYFYKN
                     LHILKLLMKEYVKEQS"
     gene            complement(<254541..>257581)
                     /locus_tag="PAS_chr4_0128"
                     /db_xref="GeneID:8201040"
     mRNA            complement(join(<254541..257186,257276..>257581))
                     /locus_tag="PAS_chr4_0128"
                     /product="Member of the imitation-switch (ISWI) class of
                     ATP-dependent chromatin remodeling complexes"
                     /transcript_id="XM_002493489.1"
                     /db_xref="GeneID:8201040"
     CDS             complement(join(254541..257186,257276..257581))
                     /locus_tag="PAS_chr4_0128"
                     /codon_start=1
                     /product="Member of the imitation-switch (ISWI) class of
                     ATP-dependent chromatin remodeling complexes"
                     /protein_id="XP_002493534.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0128"
                     /db_xref="EnsemblGenomes-Tr:CAY71355"
                     /db_xref="GeneID:8201040"
                     /db_xref="GOA:C4R6Y0"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR015194"
                     /db_xref="InterPro:IPR015195"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y0"
                     /translation="MTQKLATPNSETQDERRRRFLLQGTPKEEMRKDFASVSKRFKYL
                     LNLSDLFRHFIDLGASKDKQLLKLVRTIDTKKHNKSSSRSAVGNGRHRKKVRKRRRCR
                     IQGLNWLISLHENCLSGILADEMGLGKTLQTIAFLGHLRYNKGIDGPHIVIVPKSTLD
                     NWRREFAKWTPDVNTLVLQGTKEERALLLKDKLMEADFDVCITSFEMVIREKAKLGKI
                     RWQYIVIDEAHRIKNEESALSQIIRLFYSRNRLLITGTPLQNNLHELWALLNFILPDV
                     FGESDVFDEWFESQSQDQDEVVQKLHKVLSPFLLRRVKSDVEKSLLPKKEVNLYVGMT
                     EMQIKLYRNLLEKDIDAVNCGFGKREGKTRLLNIVMQLRKCCNHPYLFEGVEPGPPFT
                     TDEHLVYNSAKMIVLDKLLKKMKEQGSRVLIFSQMSRLLDILEDYCFFREYEYCRIDG
                     STAHEDRINAIDEYNKPDSKKFIFLLTTRAGGLGINLTSADIVVLYDSDWNPQADLQA
                     MDRAHRIGQKKQVQVFRFVTENAIEEKVLERAAQKLRLDQLVIQQGRASSNKNQTIGN
                     SKDELLDMIQHGAQQMFETKGSTVGDDDIDSILRKGEEKTASLNAKFSNLGLDDLQNF
                     TSEASSAYEWNGKNFAQKNNRVGRSYISLAKRERKELQYDIDKYYDDMLLPGGKQSRG
                     PRPPKHIIIHDFQFFPPGLAELLEREQLAFKRKIGHQVTLKELGGSDDEDLVMSEGEE
                     HAREIRKVKEQNKIDNAVELTEEEQALKDKYLGEGFSKWSRRDFTNFIHACANHGREN
                     LTMIAKQMKNKTFEEVEAYSKAFWANYKQVQGYEKYIQEIELGEQKAHKLRLQHELLA
                     EKIRQCKSPLRELVIQYPPNNSKKVYTDLEDRYLLTMLNKHGLNRDNLYDIIKREICQ
                     CELFKFDWYFRSRTPQELARRCNTLLLAIIREIDGPLATKRKRNNLSKETSLEPSVEP
                     ESVTNKKQKSL"
     gene            <257962..>258660
                     /locus_tag="PAS_chr4_0129"
                     /db_xref="GeneID:8201041"
     mRNA            <257962..>258660
                     /locus_tag="PAS_chr4_0129"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493490.1"
                     /db_xref="GeneID:8201041"
     CDS             257962..258660
                     /locus_tag="PAS_chr4_0129"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493535.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0129"
                     /db_xref="EnsemblGenomes-Tr:CAY71356"
                     /db_xref="GeneID:8201041"
                     /db_xref="GOA:C4R6Y1"
                     /db_xref="InterPro:IPR013962"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y1"
                     /translation="MSEPLKRSSRPGTPHRLSSRSSLLSSSSPRGGNHYDIDPNKTPL
                     DEVLCSNTGQGETSSSLLSELNDSLTTLDANMTKVNSVHESLTNFNESFSAFLYGLSM
                     NAWCVEYSEAPTKENFENRSKLNNLKAKIKETEQILEQYSRKRKDTAKITKPAKYAKQ
                     SNPKPSTTLSIPQPTPAKQQVSSTDSSFEIEEETERSSRIGAIGKSRIPYKSDSKRSM
                     MRLKSLPPRRPPFR"
     gene            complement(<259018..>260328)
                     /locus_tag="PAS_chr4_0130"
                     /db_xref="GeneID:8201042"
     mRNA            complement(<259018..>260328)
                     /locus_tag="PAS_chr4_0130"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493491.1"
                     /db_xref="GeneID:8201042"
     CDS             complement(259018..260328)
                     /locus_tag="PAS_chr4_0130"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493536.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0130"
                     /db_xref="EnsemblGenomes-Tr:CAY71357"
                     /db_xref="GeneID:8201042"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y2"
                     /translation="MENYEDQLLICFDKEGLNNADKPIQSVNEFDPSIPKLLPHERMY
                     SIQVGDRLFAISGASLSSDGPSYFTNFFQKNENEGKVLFIDRSPVVFEIIQKHLQGYH
                     ISIDDPSEYIHLFEDASYFNLSRLTKVVREMNYYVVIGSRPFVLERGLLNVEGNSPNY
                     FTLAYDTLLQNPAKVIHQRNLIRPPPQAPLTVSNRSPHLFAMIVRYLQGESVDSIDDS
                     LRHDLINECKYYRFQALEQKLIKHNIRTNVIRCCEEIVIDCKYISPKGLVSQTVESTV
                     GYLMYQRPYVDKYPRELVMQISTAEASLVATLDNQSYELILAPSLAVRLDKLFGKFTS
                     APLIYGQLQNYEDLAKDSGKLTMLTRIDNDVPARINNFERDRHWMSEALHTQNLQNDE
                     EMSTINLTRSLWKVGVHNQQLWMEAIKIEGITSAYGWNSSTSFL"
     gene            complement(<260659..>261162)
                     /locus_tag="PAS_chr4_0131"
                     /db_xref="GeneID:8201043"
     mRNA            complement(<260659..>261162)
                     /locus_tag="PAS_chr4_0131"
                     /product="60S ribosomal protein L6"
                     /transcript_id="XM_002493492.1"
                     /db_xref="GeneID:8201043"
     CDS             complement(260659..261162)
                     /locus_tag="PAS_chr4_0131"
                     /codon_start=1
                     /product="60S ribosomal protein L6"
                     /protein_id="XP_002493537.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0131"
                     /db_xref="EnsemblGenomes-Tr:CAY71358"
                     /db_xref="GeneID:8201043"
                     /db_xref="GOA:C4R6Y3"
                     /db_xref="InterPro:IPR000915"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y3"
                     /translation="MAIETPHDPALQAPTQGKLRKSLVPGTVLILLAGRFRGKRVIYL
                     KNLEDNTLLVSGPFKVNGVPLRRVHDSYVIATSTRISVEGLDLAKFDLAYFNSEKSGN
                     EEDKSEADFFGDKAEKKTVSPEQIEDQKVVDKALLAEVSKVAHLEEYLAAPFSLRRGD
                     RPHLMKF"
     gene            complement(<261350..>263251)
                     /locus_tag="PAS_chr4_0132"
                     /db_xref="GeneID:8201044"
     mRNA            complement(<261350..>263251)
                     /locus_tag="PAS_chr4_0132"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493493.1"
                     /db_xref="GeneID:8201044"
     CDS             complement(261350..263251)
                     /locus_tag="PAS_chr4_0132"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493538.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0132"
                     /db_xref="EnsemblGenomes-Tr:CAY71359"
                     /db_xref="GeneID:8201044"
                     /db_xref="InterPro:IPR002761"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y4"
                     /translation="MKFVALVSGGKDSCFNIWHCLSQGHELIALANLYPPPEGSEELD
                     SFMYQTVGYQALEHYEECIGVPMHRRVIAGTSKNQQLEYEKTEDDEIEDLYQLLSDVK
                     ESHPELEAVSVGAILSSYQRTRVEDVCARLNLVALSYLWQMNQLGLMGEMCQSGMDAR
                     IIKVAAIGLDENDLGKSLIEMYPKLIKLNDMYDVHICGEGGEFETLVFDAPFFLKKLS
                     ITHQEVIKPSNDEVYHLSLGFTTQEKSKEDGDATKFLSAPPLLNEEMESIYDQLSSTK
                     FKIPLVEKEAQSALVEFEVTSKQVGNLLYISNLSSREDEIESQITSIFTQLTDILNTH
                     GLSYEHIQSVQLFLRDMDDFAKVNAIYQQYFTKPLPSSRVCVQTLLPEKNQALLSAIV
                     IPNLKDKSGVHVRGISYWAPHNIGPYSQSILHKQQRTTVALISGQIPLIPQSMVLADP
                     NDRLLNVALSLQHFDSVKKLISLDQNAFAICYFKDLEYLPIAIEAWKLYEPSSKVPVV
                     FAQVTQLPKSAPIEWSGSVYQETPNYDDYYGDSSENEDESTQIANNLSSLELQGQSVT
                     FQDGYVSLTFAPGLSATAHNTVILNKGQASKLETIPQEYSVDIIPVNRLFDFTGKDQD
                     LAVLHRLNI"
     gene            <263367..>264146
                     /locus_tag="PAS_chr4_0133"
                     /db_xref="GeneID:8201045"
     mRNA            <263367..>264146
                     /locus_tag="PAS_chr4_0133"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493494.1"
                     /db_xref="GeneID:8201045"
     CDS             263367..264146
                     /locus_tag="PAS_chr4_0133"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493539.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0133"
                     /db_xref="EnsemblGenomes-Tr:CAY71360"
                     /db_xref="GeneID:8201045"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y5"
                     /translation="MSSTGTPAETPTHEDSGLLIDVEKETRKLVRLRNKALVKAATSS
                     DPDTIRRYERLRNDRILRSERYKQDQIAQWKEKGRVDLIPKDDNFGRMANRLAQAKTG
                     NSDITRQHNARSRYVLQLKKIRGSGGFKDSVTPYGFQKLSNEGQNLEIEPISPVIQKP
                     ENSESTVQHLPTPGHHSLAPPPPPPTSQHFSSINPTIQSNSGPNQTFVPPFQLSFAFP
                     LSAPPPPPPPPLPPPPQPVAVGVIQPKNNRRKARKRPKIEY"
     gene            complement(<264165..>266225)
                     /locus_tag="PAS_chr4_0134"
                     /db_xref="GeneID:8201046"
     mRNA            complement(<264165..>266225)
                     /locus_tag="PAS_chr4_0134"
                     /product="Sm-like protein involved in docking and fusion
                     of exocytic vesicles"
                     /transcript_id="XM_002493495.1"
                     /db_xref="GeneID:8201046"
     CDS             complement(264165..266225)
                     /locus_tag="PAS_chr4_0134"
                     /codon_start=1
                     /product="Sm-like protein involved in docking and fusion
                     of exocytic vesicles"
                     /protein_id="XP_002493540.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0134"
                     /db_xref="EnsemblGenomes-Tr:CAY71361"
                     /db_xref="GeneID:8201046"
                     /db_xref="GOA:C4R6Y6"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y6"
                     /translation="MASDLINLQRDYLLKLIGSVETSNGLKCLVLDANSERLVNSLID
                     SNTLLRYVTTVERIDKKRKIRLSMEGVYLIGPTKFSVNCLLADFQINPTRYKKAHLLF
                     LSPLARELTNLIMGNKQLEANTITRRTVDFTLLPLESHVFLSDAPDSLPTLYNENCLD
                     LIRYQASRAVQTLMNLCIITGEYPLVRYYSPQNPINKSSVLPRMIAQEFQSTLDDYCR
                     IKQDFPGDNPRPRSIFIITDRTMDLLAPLMHDFTYEAMCFDLLEFAENVDGDYPNTYR
                     YSVENENGELLDREASLKPPIDDYWEELRNMHILDASNQLDVKLNKLITNNPMMVDRD
                     KASGTRDFLFIVAHLHGFDEERRKIMLHKKLTEELLVINNERHLAECADFEQNCAAFG
                     VSYDGEKIKDMASFLLSWISLDYFTTSDKIRLILIYAIYRGGLIRADVSKLVKFAGLA
                     SAEEHVMTLFENFSLLGFQLLKAHPKDKSFKKQFWHKIDSNAVLNTSRYKPAIQAIVE
                     LASKGILDEASFPYIKDKPLEVSETNPDSATSLKNPRYRAAWSRKGSSYSPPKQRIVV
                     YSAGGITYSEMKAGYDAGCLLNKDVFIGSDEVITPRMFVNNVIDLTSDRASLSLFYDR
                     RRAAGESAPKVLFEQESHHRPSIGGPVDSSASLASTTSQSHEPPTNDKEKHRKRDKLK
                     KFWK"
     gene            <268879..>270042
                     /locus_tag="PAS_chr4_0136"
                     /db_xref="GeneID:8201047"
     mRNA            <268879..>270042
                     /locus_tag="PAS_chr4_0136"
                     /product="Subunit of the histone deacetylase Rpd3L
                     complex"
                     /transcript_id="XM_002493496.1"
                     /db_xref="GeneID:8201047"
     CDS             268879..270042
                     /locus_tag="PAS_chr4_0136"
                     /codon_start=1
                     /product="Subunit of the histone deacetylase Rpd3L
                     complex"
                     /protein_id="XP_002493541.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0136"
                     /db_xref="EnsemblGenomes-Tr:CAY71362"
                     /db_xref="GeneID:8201047"
                     /db_xref="InterPro:IPR013904"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y7"
                     /translation="MDGELLGCIVRLKNALEREKSGNTFNSDYDYEDTEDYPINDPQF
                     SGSFGKRTNRGNKLFDSYSKVDRTRLGSEFEFFRSGVTKSLGVHGSKIVFTNNLKRKH
                     YKDESDEISQKRRTQAKQISNGNKKSKGEEAENESEDSEDDTDDNPFNLINVGEILEP
                     IQDPTDIATRPTIRRTYDPKTSKNLQNLSLQTIQLIEKEQETVVQLFKLMDFFLGDDY
                     NNFHPDHMKLPEYDHHLSFDDLDRQLESANIRCKTTVDNSTSTTSQASSIEANKEPPV
                     YAEAKDKRITRSQANEGVTVTDPFFQTPEFVKDPNFGISDPKDAESTRQLLQITLQRN
                     EEFIRCLTTIRNGMVRTERMKNSIFKWCREMNGETDINIEGKPMTKDDIRKEK"
     gene            complement(<270109..>272389)
                     /locus_tag="PAS_chr4_0137"
                     /db_xref="GeneID:8201048"
     mRNA            complement(join(<270109..271346,271420..>272389))
                     /locus_tag="PAS_chr4_0137"
                     /product="Putative tubulin tyrosine ligase associated with
                     P-bodies"
                     /transcript_id="XM_002493497.1"
                     /db_xref="GeneID:8201048"
     CDS             complement(join(270109..271346,271420..272389))
                     /locus_tag="PAS_chr4_0137"
                     /codon_start=1
                     /product="Putative tubulin tyrosine ligase associated with
                     P-bodies"
                     /protein_id="XP_002493542.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0137"
                     /db_xref="EnsemblGenomes-Tr:CAY71363"
                     /db_xref="GeneID:8201048"
                     /db_xref="GOA:C4R6Y8"
                     /db_xref="InterPro:IPR002828"
                     /db_xref="InterPro:IPR004344"
                     /db_xref="InterPro:IPR027746"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y8"
                     /translation="MHVLLINDDGPPNLMSSPYAKFLVDAIRNHTDWELSIVVPSQQR
                     SWIGKAHFAGKELTAQYLYSALNCPMDDSSHGPFASPVSRYREDKNLQEWVLIDGTPA
                     SCTDIGVHHLYKDKPPVDLVLSGPNYGRNSTALYIMASGTLGGALEGALTGKRAIGLS
                     YSFYTRDHDAKVLKIASELSLKLIKYLYNNWHPEAELYSINVPLKDSLGPDTKAIFAP
                     ILENRWGSVFTKVIESKKDLPEVSDIVDETVAHKTTFKWTPDFDSVHTSVKESVGLND
                     GKVVEQGNIRYVTILPFFRVLSTNNLVSLHLKQFTRVLTPLRVKLISNKSVLLVTYDK
                     NSYIFDPLINAMERKLPKVPVVSTFPEKYHKLVHYGDYEGLNFDKIVSEPSYKVCSYI
                     YRKALIRKHYLANTVKVYKTKHPESILATHVPLSYQLELDYAEFLDDALDEYLDLREE
                     LEENESSGCHKTYILKPSMSDKAQGIRIFRTIDELQAIFDSFEDEASDAEEEAEETND
                     AASDNRIIISQLRHFIVQEYVDKPLLLPQYNNRKLHIRTYIVANGDLEVYVFEKMLLL
                     FANDPYVSPEKTEKDEDGVFILNGHLTNTCAQKTVITDEITDANTNVVELWSSKLTEN
                     QKQKLFGQVKEIVKELFKAALSVDRINFQPLSNAFEVFGIDFLVDENFECSLLEVNSY
                     PDFKQTGDDLKQIIYQLFEGIVDQCISPFYFPDSKKKNPLMHKVLDTNTGSLS"
     gene            complement(<272556..>273818)
                     /locus_tag="PAS_chr4_0138"
                     /db_xref="GeneID:8201049"
     mRNA            complement(<272556..>273818)
                     /locus_tag="PAS_chr4_0138"
                     /product="Small subunit of carbamoyl phosphate synthetase"
                     /transcript_id="XM_002493498.1"
                     /db_xref="GeneID:8201049"
     CDS             complement(272556..273818)
                     /locus_tag="PAS_chr4_0138"
                     /codon_start=1
                     /product="Small subunit of carbamoyl phosphate synthetase"
                     /protein_id="XP_002493543.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0138"
                     /db_xref="EnsemblGenomes-Tr:CAY71364"
                     /db_xref="GeneID:8201049"
                     /db_xref="GOA:C4R6Y9"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C4R6Y9"
                     /translation="MNILRNNRHFLKSLVFQQTRLSSSARLDRATLTIRNGPVFDGYS
                     FGANKNISGEAVFTTSLVGYPESMTDPSYKGQMICFTQPLIGNYGVPSGKTRDEFNLL
                     KYFESPRIQCIGIIVSDVALQYSHWTAVESLSQWCKREGVAAITGVDTRALVTYLREQ
                     GSSLARLTVGEEYDADEDAAFEDPGSVNLVHKVTTKAPFHVPSPNAKYHVAVIDCGVK
                     ENILRSLVSRGASITVLPYDYPIQKVASKFDGVFISNGPGDPTHCASTVQNLRELMQQ
                     NLDLPVFGICLGHQLLALASGAKTIKLKYGNRAHNIPALDLTTGKCHITSQNHGYAVD
                     ASTLPSDFKEYFINLNDQSNEGLIHDSRPIFSTQFHPEAKGGPLDSSYLFDKYFDLLA
                     EYRQKSNDPSHLKVDDLLVDILPKVRVV"
     gene            <274513..>275679
                     /locus_tag="PAS_chr4_0139"
                     /db_xref="GeneID:8201050"
     mRNA            <274513..>275679
                     /locus_tag="PAS_chr4_0139"
                     /product="60S ribosomal protein L3"
                     /transcript_id="XM_002493499.1"
                     /db_xref="GeneID:8201050"
     CDS             274513..275679
                     /locus_tag="PAS_chr4_0139"
                     /codon_start=1
                     /product="60S ribosomal protein L3"
                     /protein_id="XP_002493544.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0139"
                     /db_xref="EnsemblGenomes-Tr:CAY71365"
                     /db_xref="GeneID:8201050"
                     /db_xref="GOA:C4R6Z0"
                     /db_xref="InterPro:IPR000597"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR019926"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z0"
                     /translation="MSHRKFEAPRHGSLGFLPKKRASSPRARCKAFPKDDKSKPVALT
                     AFMGYKAGMSTIVRDLDRPGSKMHKREVVEAVSIVDTPPLVVVGVVGYVETTSGLKSL
                     TTVWAEHLSDDVRRRFYKNWYKSKKVAFSKYSAKYANDPASIETELARIKKYASVVRV
                     LVHTQIRKTPLNQKRAHLAEIQINGGSISEKVDWARDHFEQTIAVDTVFEQNENIDVI
                     AVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVACIGAWHPAHVMWTVARAGQNGFHHRT
                     SINHKIYRVGKGDDESNGSTEYDRTKKTVTPLGGFVRYGEIRNDFVMIKGSIPGPVKR
                     VVTLRKSLYTQTSRKATEQVTLKWIDTASKFGKGRFQTPAEKAAFLGTLKKDLQ"
     gene            complement(<276239..>278059)
                     /locus_tag="PAS_chr4_0140"
                     /db_xref="GeneID:8201051"
     mRNA            complement(<276239..>278059)
                     /locus_tag="PAS_chr4_0140"
                     /product="ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
                     helicase"
                     /transcript_id="XM_002493500.1"
                     /db_xref="GeneID:8201051"
     CDS             complement(276239..278059)
                     /locus_tag="PAS_chr4_0140"
                     /codon_start=1
                     /product="ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
                     helicase"
                     /protein_id="XP_002493545.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0140"
                     /db_xref="EnsemblGenomes-Tr:CAY71366"
                     /db_xref="GeneID:8201051"
                     /db_xref="GOA:C4R6Z1"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z1"
                     /translation="MSELEDSMNNLNVNEGGRQSKSNYVPPHRRNGQGSSAFANNGSR
                     GGGFGGRGRDNFSAGRGGGRNGMNFRGGRGRGPTRGQGRWVQGKHVPAPKDEELELKM
                     FGTPEDPSFQSSGLNFDNYDDIPVEATGEDVPEPITQFTSPPLDELLLENIKLSRFTK
                     PTPVQKYSVPIVSNHRDLMACAQTGSGKTGGFLFPVLSECFQTGPAPIEVESETVFRK
                     HRAYPTILVMAPTRELVSQIYDEAKKFAYRSWMRPCVVYGGANIRDQMEDLILGCDLL
                     VATPGRLSDLLERGKISLAKIKYLILDEADRMLDMGFEPQIRHIVQGCDMPSVNERHT
                     LMFSATFPRDIQLLAKDFLKDYIFLSVGRVGSTSENITQRVLSVEDDEKKSVLLDILS
                     SSDDIKEGLTLIFVETKRMADTLSHFLVTRNFPATSIHGDRTQQEREHALHLFKSGAA
                     PILVATAVAARGLDIPNVTHVVNYDLPADIDDYVHRIGRTGRAGNVGIATAFVNRGNK
                     NLIKGLIELLTEANQEVPQFLSALSREATMGRGGARGGRGGRNAYGKDFRRSSNYPPQ
                     PSSQTYGRANGGSGYFGGSNFYGSAPSSNTTQQSSGSDWW"
     gene            <278573..>279709
                     /locus_tag="PAS_chr4_0141"
                     /db_xref="GeneID:8201052"
     mRNA            <278573..>279709
                     /locus_tag="PAS_chr4_0141"
                     /product="RNA binding protein, component of the U1 snRNP
                     protein"
                     /transcript_id="XM_002493501.1"
                     /db_xref="GeneID:8201052"
     CDS             278573..279709
                     /locus_tag="PAS_chr4_0141"
                     /codon_start=1
                     /product="RNA binding protein, component of the U1 snRNP
                     protein"
                     /protein_id="XP_002493546.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0141"
                     /db_xref="EnsemblGenomes-Tr:CAY71367"
                     /db_xref="GeneID:8201052"
                     /db_xref="GOA:C4R6Z2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z2"
                     /translation="MSQQYSGYGQQQQQQRQNLFQVWMGDLLPSWEEDTIRQIWLSVD
                     PSLSEKIHSIRVIKDKTPNLAKLNNNPGYCFLRFTDYDTANELITNYQGKPIPNHKDK
                     FFKLNWASSHTQNQQQQQGYQNTQDSSNRTQENSIFVGDLAQGVTDTMLLDAFKKNYP
                     SAFSARIMIDSQTGKTRGFGFVKFRDIQELNKALIEMQGFVLNGRPIRVSTAGRSTSN
                     TNGGQLKQSVQQSSTAPSSSGSQSYGFGNRLVIPPLPLAPPLNPASDPNNTALSVTNI
                     DELTEQKELWEYFQPFGKIVLFKQTSKESAIVVYADRLGAELAVREMNGCQVGFSRIV
                     VKWGESPVKPPENNSDYPLTKDNVQNEFQLNENFLKNRNYDLIL"
     gene            complement(<279768..>280238)
                     /locus_tag="PAS_chr4_0142"
                     /db_xref="GeneID:8201053"
     mRNA            complement(<279768..>280238)
                     /locus_tag="PAS_chr4_0142"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493502.1"
                     /db_xref="GeneID:8201053"
     CDS             complement(279768..280238)
                     /locus_tag="PAS_chr4_0142"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493547.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0142"
                     /db_xref="EnsemblGenomes-Tr:CAY71368"
                     /db_xref="GeneID:8201053"
                     /db_xref="GOA:C4R6Z3"
                     /db_xref="InterPro:IPR008699"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z3"
                     /translation="MLRQAYRLAGKTNSITSSSVFIRNKSFLPHFIPKNYSYGDYPRL
                     KPENLQKRDPYLKYDDQANKRNFNEPLHPQQDDLDMWAPDHFDFVQDSIALKWFGTFF
                     GVLAVFSSVIYIGGLYPEKPANPRNYPFSGLAKDLGASSEEDTLLYAAKIDKSI"
     gene            <280513..>285264
                     /locus_tag="PAS_chr4_0143"
                     /db_xref="GeneID:8201054"
     mRNA            <280513..>285264
                     /locus_tag="PAS_chr4_0143"
                     /product="Swi2/Snf2-related ATPase that is the structural
                     component of the SWR1 complex"
                     /transcript_id="XM_002493503.1"
                     /db_xref="GeneID:8201054"
     CDS             280513..285264
                     /locus_tag="PAS_chr4_0143"
                     /codon_start=1
                     /product="Swi2/Snf2-related ATPase that is the structural
                     component of the SWR1 complex"
                     /protein_id="XP_002493548.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0143"
                     /db_xref="EnsemblGenomes-Tr:CAY71369"
                     /db_xref="GeneID:8201054"
                     /db_xref="GOA:C4R6Z4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z4"
                     /translation="MPRSLARLRSTDNLPTRSSSPDTDSPGANGGKIRAISEVQSDNE
                     SAATKRRRTRLRSRDSPVNYSLKSYKRVSARPNDAHPSYLKESDKPLESVLKHIDQNL
                     PKEQADKLHKENLCDILQAQEKTLDELFVLQNFTFLTDFDQINRSSEIYRALIDENNL
                     WNTLAPENVNGRGTKRVHSRRRATSNLSGQESKLIEEVQDMLLERRRRLKTSAGKTNG
                     ISQTHPKKTNKHQVFETSISKKAVVSRPTSVSEHRGKKARKHMEEKVHAQQQESDEQS
                     GSDDTMQHGEDSETVSSLSDSPVEQSSLGHLPKKVHLNFTIPKQIVTHPDHLTKPEYG
                     GNLGNLLASFYSLDDDMEPSQFQDYISLQRDLVERIRKGVNDKFLKIDYSENVNKPHV
                     QGTTREPTMIKLNSVHHRYKDPFRTQLFPHLHYDHLLAHGVFYSKLLHDRRVSRIQKA
                     KKVANMIDSHFKKLSQSKEREEKENQIRVIKLARRVAKLVKNRWLQAEKVFRILEDRE
                     KEKERIKESKQHLSKILEHSTQLLEAQMNRATSASASELPSASGSDIGSSTNTDDENM
                     STSNDEEEEDANDEKHMKVDSSQDDSNLTVEELREKYKHLSHVNNEEEIVEDQNIELT
                     AEEKRLLDEETKKVNPLFDSDDESESEISEDSEDMSMESITDEDDQNGGTDLNGSSGL
                     ASLFGQVKEEEDSDDESVKSDIEESDQEEKIKVEKHNILSSNSDSVVTKKSKSEASDE
                     FTNEQVNSVIDVPVPHLLRGTLRVYQKQGLNWLASLYNNNTNGILADEMGLGKTIQTI
                     ALLSYLACEKHVWGPHLIIVPTSVMLNWEMEFKRFAPGFKVMTYYGNPQQRKEKRRGW
                     NKPDSFHMCITSYQLVIQDHFVFRRKKWKYMILDEAHNIKNFRSQRWQALLNFNTEHR
                     LLLTGTPLQNNIMELWSLLYFLMPSSKADNKQSMPAGFANLDDFQRWFGKPVDKMIEA
                     GDALADQETKATVSKLHQVLRPYLLRRLKADVEKQMPAKYEHIVYCRLSKRQRFLYDD
                     FMSRAQTKETLASGNFLSIINCLMQLRKVCNHPDLFEVRPVVTSWVLEKAVATDFEPK
                     DLLIRRKLRDRDAVDLQVLNLLPSHNDLNLSTHTVASTAHLNANAHLSNHIREIEKVV
                     KTPVPENYYDFQSYYRYLKYKEQQDALDHSTHALYLNRLRCERRPIYGKNTLDLLKVV
                     NHTDKPLKMTDDRVLSEAFDDMFTTIEERSIKMKDIFEKYAFVTPPVVCLNMNDVAIN
                     SGLNGYLRTVDNGISNPFHQLQTKLSIAFPDKSLLQYDCGKLQKLASLLLELKSNGHR
                     ALIFTQMTKVLDILEQFLNIQGYRYMRLDGATKIEDRQVLTERFNKDDRITCFILSTR
                     SGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSEYTIESNIL
                     KKANQKRQLDNVIIQEGDFTTDYFGKLSYKDLLGEEVSNEDDSPLLISGVDENSKSFT
                     KVLTQAEDADDAAAANEAMKEVELDNEDFVEADPSRQESVSKSNTPQLEEDAVSIEPA
                     SSTLTMEEDEYEEGHIDEYMIRYIASGMYWD"
     gene            <288180..>288653
                     /locus_tag="PAS_chr4_0145"
                     /db_xref="GeneID:8201055"
     mRNA            <288180..>288653
                     /locus_tag="PAS_chr4_0145"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493504.1"
                     /db_xref="GeneID:8201055"
     CDS             288180..288653
                     /locus_tag="PAS_chr4_0145"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493549.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0145"
                     /db_xref="EnsemblGenomes-Tr:CAY71370"
                     /db_xref="GeneID:8201055"
                     /db_xref="InterPro:IPR024316"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z5"
                     /translation="MSFESASYNDQFQYVLLQILTRLSIYLRHVSYWGYKASVEHPQI
                     VSVIITLLGLFITFFLIKKLVQLIINTTVFVLKLWIAIALVFLVYKLFDRGTLFFTED
                     LNYFYHNLEISQNWSGSIRSIDTLITKVINQARFLLKLLLSTYLKDNEFLTFFRD"
     gene            complement(<288643..>289896)
                     /locus_tag="PAS_chr4_0146"
                     /db_xref="GeneID:8201056"
     mRNA            complement(<288643..>289896)
                     /locus_tag="PAS_chr4_0146"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493505.1"
                     /db_xref="GeneID:8201056"
     CDS             complement(288643..289896)
                     /locus_tag="PAS_chr4_0146"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493550.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0146"
                     /db_xref="EnsemblGenomes-Tr:CAY71371"
                     /db_xref="GeneID:8201056"
                     /db_xref="GOA:C4R6Z6"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z6"
                     /translation="MFGHKFKEEQFSFGKNVVQVNNGSFGSVPTTVLQKYKEAIDLDH
                     EFSDRYLLYKLPGTLKEATAQVAEFVNSDVNNIVFTMNATTSVNTVLRSYPFVKGDKI
                     AMFDITYGACANTVKFLSKRQGIEVVTVELKLPLEDDEIVEKFEATLKEEKPKLALFD
                     VIVSMPGIRLPFERLIEVCRKHNVLSLVDGAHAIGILPLDLKKWKPDFFLSNLHKWLY
                     VPKGCSFLYVDPKHHRNIHTFPVSHSYLDDEEVLSEELEKTRLVDRFAFYGTFSYAGI
                     DCIPAALEFRRTVCGGEEKINDYCFKLAKDAANHIAKQWNTSILENAKGTLSTTMSNV
                     EVPVNDQLLQFLKKDKKNIVKLRKTVDPLMLKEHNTLLPSIFHNGKLWVRFSAQIYNE
                     LSDYEYASGLFLKLLEENEAHILSL"
     gene            complement(<290121..>291509)
                     /locus_tag="PAS_chr4_0147"
                     /db_xref="GeneID:8201057"
     mRNA            complement(<290121..>291509)
                     /locus_tag="PAS_chr4_0147"
                     /product="Aromatic aminotransferase II"
                     /transcript_id="XM_002493506.1"
                     /db_xref="GeneID:8201057"
     CDS             complement(290121..291509)
                     /locus_tag="PAS_chr4_0147"
                     /codon_start=1
                     /product="Aromatic aminotransferase II"
                     /protein_id="XP_002493551.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0147"
                     /db_xref="EnsemblGenomes-Tr:CAY71372"
                     /db_xref="GeneID:8201057"
                     /db_xref="GOA:C4R6Z7"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z7"
                     /translation="MTFPDSNVTNFISKRARARAIDPAFNSVGFGKAHDKGVAPINLG
                     YGMPDQSFFPIKSLQVNLQDSSFEVPRETANRQEIDLKTGLQYASPYGHPSLLKYTRE
                     IIERIHSPANDRWDTVITAGGANGIDKCFDLLLDEGDTVLIEEYTFVPILGSVKNIGA
                     TVVPLKFDFQSQSGLDIEYLAYVLENWESLYPGKRFPKVLYTIPNGQNPTGFVTDLKS
                     KQKIYDICVQNDIFIIEDDPYGYLELATDKPFDDVEEYLKSLPTSYLSVDKHSRVLRI
                     ESFSKVFAPGSRLGFIVAHKDFIEPITNYSVLATGFPSGPSQILINNTITALGGLDGW
                     FKWAIKVRNEYWSRKQAAMKQLLQSSCAKKDQLIVFEPKAGMFISVSLNFPPGSNCLE
                     LMSKLSEKTAQHGVTVVPYQTLSPIPDFTKDNCHYVRLTIASAIDHGQLKEAFRRFTS
                     AVEDLFQDLESS"
     gene            complement(<291782..>293203)
                     /locus_tag="PAS_chr4_0148"
                     /db_xref="GeneID:8201058"
     mRNA            complement(join(<291782..293118,293173..>293203))
                     /locus_tag="PAS_chr4_0148"
                     /product="Gamma-tubulin"
                     /transcript_id="XM_002493507.1"
                     /db_xref="GeneID:8201058"
     CDS             complement(join(291782..293118,293173..293203))
                     /locus_tag="PAS_chr4_0148"
                     /codon_start=1
                     /product="Gamma-tubulin"
                     /protein_id="XP_002493552.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0148"
                     /db_xref="EnsemblGenomes-Tr:CAY71373"
                     /db_xref="GeneID:8201058"
                     /db_xref="GOA:C4R6Z8"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z8"
                     /translation="MPGEILTISAGQCGNQVGEQYWNQLCKEHGISSNGTLETDESTN
                     GIPQVFFRKSGNSRFTPRALLIDMEPSVVNGVRSRNDNLFNPRNCYISPEGRGAGNIW
                     TQGFEHATRHVDEFLDMIDKELDFCDSLESFQLIHSVSGGTGSGLGSFLLETLSDRYS
                     KKLLQTHSIFPDTKTSDVVVQPYNVVLTLKRLIQEADATMVFDNPALMSIANSNLDID
                     DVSIKETNQLISTVISTLSSTIRFPSYSYNSTTSILSTLIPTPDLHFLIPSYTPFTQD
                     FISHPKQFRKTTGYDIILELLDPKLQMIRSRNTTNNMNLSVLDFIRGDVKATDVQKAL
                     VKAQQRIQFVPWTGSTIHLALAARPPKFQNTNVTGMMVKNSTEITGLFESLLSNYNRL
                     RAKNAFIANYEESALELNMDIKEELDESYQLVLNLIDEYSASKTMSYVEDSDVDNPDD
                     DLNIE"
     gene            <293884..>294717
                     /locus_tag="PAS_chr4_0149"
                     /db_xref="GeneID:8201059"
     mRNA            <293884..>294717
                     /locus_tag="PAS_chr4_0149"
                     /product="Microsomal cytochrome b reductase"
                     /transcript_id="XM_002493508.1"
                     /db_xref="GeneID:8201059"
     CDS             293884..294717
                     /locus_tag="PAS_chr4_0149"
                     /codon_start=1
                     /product="Microsomal cytochrome b reductase"
                     /protein_id="XP_002493553.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0149"
                     /db_xref="EnsemblGenomes-Tr:CAY71374"
                     /db_xref="GeneID:8201059"
                     /db_xref="GOA:C4R6Z9"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C4R6Z9"
                     /translation="MDNNVVVFTAILVVVSIAAYILLFSNSDRKVLKKDEFQPFPLIQ
                     RTQLTHNTAIFRFGLPRPTDVLGLPIGQHISIAASIGGKEVLRSYTPTSTDDAKGYFD
                     LLIKVYEQGNITKYVDNLKLGESIRVRGPKGNFTYTPNMVKELNMIAGGTGITPMYQI
                     ITAIARNPEDKTRVNLIYGNQKEEDILLREELESISVLNPNIKIFQTLDAPPANWEGG
                     VGFVTEEMMRTVLSEANDSNKLLICGPPPMVSSCKKNAVLLGYPKAKPVTKLADQVFV
                     F"
     gene            complement(<294770..>296329)
                     /locus_tag="PAS_chr4_0150"
                     /db_xref="GeneID:8201060"
     mRNA            complement(<294770..>296329)
                     /locus_tag="PAS_chr4_0150"
                     /product="Aspartate kinase (L-aspartate 4-P-transferase)"
                     /transcript_id="XM_002493509.1"
                     /db_xref="GeneID:8201060"
     CDS             complement(294770..296329)
                     /locus_tag="PAS_chr4_0150"
                     /codon_start=1
                     /product="Aspartate kinase (L-aspartate 4-P-transferase)"
                     /protein_id="XP_002493554.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0150"
                     /db_xref="EnsemblGenomes-Tr:CAY71375"
                     /db_xref="GeneID:8201060"
                     /db_xref="GOA:C4R700"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR018042"
                     /db_xref="UniProtKB/TrEMBL:C4R700"
                     /translation="MSSPALTPRRGWVIQKFGGTSVGKFPDKIADDVVKVWNESNRVA
                     VVCSARSSHTKTEGTTSRLLASADVVLDADDDNQYLHFLEKITIDHVENAMEMIQSKK
                     IQAKLIEDTHHEIEEARKLLYASQIIGEVSPKTLDCIMSCGEKLSCLFMAALLNDRGI
                     PAEYVDLSNVVTKDFGTVLDATFYRSLASRLHEIISAIDSSKVPVVTGYFGTIPGGLL
                     NGVGRGYTDLCAALVAVGVDADELQIWKEVDGIFTADPRKVTDARLLQSVTPEEASEL
                     TYYGSEVIHPFTMEQVIKARIPIRIKNVENPAGEGTIIYPQNVGRKGEATPPHPPTAV
                     ERLPSSIYNKIKTATAVTAKSDIVVVNIHSNKKTLSHGFLAHIFSTLDKYRLVVDLIS
                     TSEVYVSMALYVTKTDRKLLRSTVEELKRFGEVEVTHDMAIVSLVGIHMKQLIGIAGA
                     MFKTLADERINIEMISQGANEINISCVINKNDTVKALNAIHSKIITDPFKSNLAIELT
                     SKVSELRLDQY"
     gene            <297655..>298884
                     /locus_tag="PAS_chr4_0151"
                     /db_xref="GeneID:8201061"
     mRNA            <297655..>298884
                     /locus_tag="PAS_chr4_0151"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493510.1"
                     /db_xref="GeneID:8201061"
     CDS             297655..298884
                     /locus_tag="PAS_chr4_0151"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493555.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0151"
                     /db_xref="EnsemblGenomes-Tr:CAY71376"
                     /db_xref="GeneID:8201061"
                     /db_xref="InterPro:IPR006970"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:C4R701"
                     /translation="MLTKVISLAILTASAFADSGEFTLWNLSPGDPYDSTFWGVSEGL
                     IVPVEPGVTFVITDDLQLKTTDDQFVTVGEDSALGLGAEGSVEFSIINEDGITSLYYN
                     GELVTAYICEGAEPQIYLTGSEEDPECVSYTVAVIGVDGEAPPTFPEEDDETTTTDDP
                     TDEPTDEPTDEPTDEPTDEPTDEPTDEPTDEPTDEPTDEPTDEPTDEPTDEPTDEPTD
                     EPTDEPTEEPTEEPTEEPTDEPTPPPPHWGNETVTATKTEYETTKVTITSCEETKCYE
                     TTSDAWVSTCTTEIGGKVTKIVTWCPIPSTPGPKPPKPTKPTETKPTTVPAPTTKKPE
                     TPTTKKPETPAPEKPEKTTTVIPPPTTEKPSTLSTSSVTGSVTIPTITATGGAGSNFN
                     LGGLTVGVAGIAMALFV"
     gene            <301802..>303793
                     /locus_tag="PAS_chr4_0152"
                     /db_xref="GeneID:8201062"
     mRNA            <301802..>303793
                     /locus_tag="PAS_chr4_0152"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493511.1"
                     /db_xref="GeneID:8201062"
     CDS             301802..303793
                     /locus_tag="PAS_chr4_0152"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493556.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0152"
                     /db_xref="EnsemblGenomes-Tr:CAY71377"
                     /db_xref="GeneID:8201062"
                     /db_xref="GOA:C4R702"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="InterPro:IPR012132"
                     /translation="MAIPEEFDILVLGGGSSGSCIAGRLANLDHSLKVGLIEAGENNL
                     NNPWVYLPGIYPRNMKLDSKTASFYTSNPSPHLNGRRAIVPCANILGGGSSINFMMYT
                     RGSASDYDDFEAEGWKTKDLLPLMKKTETYQRACNNPEIHGFEGPIKVSFGNYTYPVC
                     QDFLRATESQGIPYVDDLEDLVTAHGAEHWLKWINRDTGRRSDSAHAFVHSTMRNHDN
                     LYLICNTKVDKIIVEDGRAAAVRTVPSKPLNAKKPTHKVYRARKQIVLSCGTISSPLV
                     LQRSGFGDPIKLRAAGVKPLVNLPGVGRNFQDHYCFFSPYRIKPQYESFDDFVRGDAN
                     IQKKVFDQWYANGTGPLATNGIEAGVKIRPTPEELSQMDESFQEGYREYFEDKPDKPV
                     MHYSIIAGFFGDHTKIPPGKYMTMFHFLEYPFSRGSIHITSPDPYATPDFDPGFMNDE
                     RDMAPMVWSYKKSRETARKMDHFAGEVTSHHPLFPYSSEARAYEMDLETSNAYGGPLN
                     LTAGLAHGSWTQPLKKPAGRNEGHVTSNQVELHPDIEYDEEDDKAIENYIREHTETTW
                     HCLGTCSIGPREGSKIVKWGGVLDHRSNVYGVKGLKVGDLSVCPDNVGCNTYTTALLI
                     GEKTATLVGEDLGYTGEALDMTVPQFKLGTYEKTGLARF"
     gene            complement(<303928..>305829)
                     /locus_tag="PAS_chr4_0153"
                     /db_xref="GeneID:8201063"
     mRNA            complement(<303928..>305829)
                     /locus_tag="PAS_chr4_0153"
                     /product="Phospholipase B (lysophospholipase) involved in
                     phospholipid metabolism"
                     /transcript_id="XM_002493512.1"
                     /db_xref="GeneID:8201063"
     CDS             complement(303928..305829)
                     /locus_tag="PAS_chr4_0153"
                     /codon_start=1
                     /product="Phospholipase B (lysophospholipase) involved in
                     phospholipid metabolism"
                     /protein_id="XP_002493557.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0153"
                     /db_xref="EnsemblGenomes-Tr:CAY71378"
                     /db_xref="GeneID:8201063"
                     /db_xref="GOA:C4R703"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:C4R703"
                     /translation="MALPIVATLLIALGLEIVSAWSPTGGYAPGEVECPDVSSLIRDG
                     SSLSEREQDWVEARHKITDENLKDFLNHANLSDFDVEQFLSSSDHSITIGVAFSGGGY
                     RAMLSGAGQLSALDNRTTGAWEYGLGGLIESTTYITGLSGGNWMLGTVVFNNWTSIED
                     ILSGGDIWDLENPLYNPGGWNVLETSIFWDDVSDQLDEKEDAGFENSLTDPWGRALSR
                     QFFPSYPSFGAGLTFSTLQSFPEFTNQEIPFPIHVAVGRTPGSQIISLNSTVFEFNAF
                     EMGSWDPSVYGFTDLTYLGTNVTNGVPNNADDERGCIAGFDNTGFVLGTSSSLFNQFI
                     LQLNTSDLSGAIYQIIEHFLTGLSEDEDDIAIYSPNPFYKSTYAGVGAIAENDTLYLV
                     DGGEDNQNVPLQPLLQKERDVDIIFAFDNSADTDLSWPNGSSLVNTYMRQFSSQANGT
                     TFPYVPDTTTFLNLNLSSKPTFFGCDARNLTDIVEGTDHIPPLVVYLANRPFSYWSNT
                     STFKLDYSESEKRGMIQNGFEVSSRLNMTIDEEWRTCVGCAIIRRQQERSNATQTEQC
                     RRCFENYCWNGDIDTSTEDIPVNFTTTGATNEENDNSTSISSANSVAPSKLWYQAPLL
                     LVGLVAFFI"
     gene            <306052..>307500
                     /locus_tag="PAS_chr4_0154"
                     /db_xref="GeneID:8201064"
     mRNA            <306052..>307500
                     /locus_tag="PAS_chr4_0154"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493513.1"
                     /db_xref="GeneID:8201064"
     CDS             306052..307500
                     /locus_tag="PAS_chr4_0154"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493558.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0154"
                     /db_xref="EnsemblGenomes-Tr:CAY71379"
                     /db_xref="GeneID:8201064"
                     /db_xref="InterPro:IPR007224"
                     /db_xref="UniProtKB/TrEMBL:C4R704"
                     /translation="MFEEATFRNESPGDMGLRLKLVARQHALKRLIKHQKSTDTLMTC
                     KIPPSERIDSYDAFEVWIKPRPKGSHSKSKVRSSTPPFKVCTDDEVEAANTKIREYIR
                     KVDNTIKKPISTSLNRHLKVLSSGYEILPKKSLILKSDSLSYEPYMKYHVGRLSNLLH
                     LLVLRQDWKRAYKCFSLLIRQRNIDLRSIWGIGVEILTRLNELKFTDHLQEFGEDFHL
                     DEYDIRLLSVLRNKDLIPDQNLRGSLLDFTPDSRLDKFLTWMHVYYGVKYFYSYNDQS
                     WELKHYLYGAELEENESAPEDTENEPNNKHPKKNSDKLSMAWRLPPAFRTGSKTHTPL
                     YVTTMVWHLIISLDLDRAEEVLSELLLEPPFNSDGMYFYLTGLVKFLKIQVALDSNGP
                     VDPIKGWAQECRGLWDKAQSNKLEFPLAELLKHLETFESRAANLDIHSSPDDSDKFSE
                     EVQSSPISLTALESPQLNAIDSTDEDNLGISF"
     gene            complement(<307555..>308204)
                     /locus_tag="PAS_chr4_0155"
                     /db_xref="GeneID:8201065"
     mRNA            complement(join(<307555..308088,308145..>308204))
                     /locus_tag="PAS_chr4_0155"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493514.1"
                     /db_xref="GeneID:8201065"
     CDS             complement(join(307555..308088,308145..308204))
                     /locus_tag="PAS_chr4_0155"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493559.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0155"
                     /db_xref="EnsemblGenomes-Tr:CAY71380"
                     /db_xref="GeneID:8201065"
                     /db_xref="InterPro:IPR010754"
                     /db_xref="UniProtKB/TrEMBL:C4R705"
                     /translation="MSITLKLTSLFIRTVSKPMASAIKLQAKEHPKFKKTCILVAQSL
                     HQWDSKLRMRIMGHDVTIRPLNDAKAVENGANFLSEFVLFSVAGSLILFESQRQRKKE
                     AARRENVADDISTLQHEIEYLKRKMEEYNMKLDDYKPPQELKPSILKLEPNVDESHSL
                     PTREDAISRLNPPVKQQDKEKRFPVKDDNIREESKSS"
     gene            <308462..>310048
                     /locus_tag="PAS_chr4_0156"
                     /db_xref="GeneID:8201066"
     mRNA            <308462..>310048
                     /locus_tag="PAS_chr4_0156"
                     /product="Ubiquitin-protein ligase"
                     /transcript_id="XM_002493515.1"
                     /db_xref="GeneID:8201066"
     CDS             308462..310048
                     /locus_tag="PAS_chr4_0156"
                     /codon_start=1
                     /product="Ubiquitin-protein ligase"
                     /protein_id="XP_002493560.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0156"
                     /db_xref="EnsemblGenomes-Tr:CAY71381"
                     /db_xref="GeneID:8201066"
                     /db_xref="GOA:C4R706"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4R706"
                     /translation="MISIFWLRILYYSFSTAGLAVLLSLIQTYPNWYSFAVAIGTNSY
                     MFLVLANFVIAWHFILTEISIKIFFGRLRTLEANHVFERSWASLVGLIMILLSFQADN
                     SLIMLLLVVNSFNLKCFGWMLVDRIEYKIQRSDTVKQLLASKEFVALNGCLGLAGLMT
                     SVCDRSSLDSDNGEVYLLFAMEYTSTFLNLLKSYASLVLNSVEMTRIRLGIDQEEWES
                     KTFYMKVTKLILSVLKFVLLLAVVWGIMSFYHVPISLVRDLYVSAVSLLHQVRELRAH
                     LRTFSELNVKLSDATVQDLAEHDVCIVCHEEMDESKIGTGDRNTPKKLNCSHIIHLSC
                     LKKWIDISQTCPMCRAPVFSDNSRSQNVNTDVAGPLPDNNPPPAIAVAQGTRDDPTPT
                     IPSNSNNMADIYRSSPILNQIPRDAFRTERREIPGRSILENDDNSWFQFPLQSNSDNS
                     FKVILNSQDYLRFGTDLGTTQARPSPHIVSSEDQGISSSSERNTDVNTETYQIIQNQA
                     QTIANLQQRIHLLEQRLNSQ"
     gene            complement(<310128..>310526)
                     /locus_tag="PAS_chr4_0157"
                     /db_xref="GeneID:8201067"
     mRNA            complement(<310128..>310526)
                     /locus_tag="PAS_chr4_0157"
                     /product="Histone variant H2AZ, exchanged for histone H2A
                     in nucleosomes by the SWR1 complex"
                     /transcript_id="XM_002493516.1"
                     /db_xref="GeneID:8201067"
     CDS             complement(310128..310526)
                     /locus_tag="PAS_chr4_0157"
                     /codon_start=1
                     /product="Histone variant H2AZ, exchanged for histone H2A
                     in nucleosomes by the SWR1 complex"
                     /protein_id="XP_002493561.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0157"
                     /db_xref="EnsemblGenomes-Tr:CAY71382"
                     /db_xref="GeneID:8201067"
                     /db_xref="GOA:C4R707"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4R707"
                     /translation="MSGKVHGGKGKSGAKDGGIRSQSHSARAGLQFPVGRIKRFLKRN
                     AQNKIRVGAKAAIYLAAVLEYLTAEVLELAGNAAKDLKLKRITPRHLQLAIRGDEELD
                     TLIKATIAYGGVLPHINKVLLLKVENKKKH"
     gene            complement(<310770..>312485)
                     /locus_tag="PAS_chr4_0158"
                     /db_xref="GeneID:8201068"
     mRNA            complement(<310770..>312485)
                     /locus_tag="PAS_chr4_0158"
                     /product="Tetradecameric mitochondrial chaperonin"
                     /transcript_id="XM_002493517.1"
                     /db_xref="GeneID:8201068"
     CDS             complement(310770..312485)
                     /locus_tag="PAS_chr4_0158"
                     /codon_start=1
                     /product="Tetradecameric mitochondrial chaperonin"
                     /protein_id="XP_002493562.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0158"
                     /db_xref="EnsemblGenomes-Tr:CAY71383"
                     /db_xref="GeneID:8201068"
                     /db_xref="GOA:C4R708"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR018370"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C4R708"
                     /translation="MYRLACRPQLKKSAISLARTIAHKEIKFGVEGRAALLKGVETLA
                     DAVSVTLGPKGRNVLIEQPFGGPKITKDGVTVAKAITLEDKFENLGAKLLQDVASKTN
                     ESAGDGTTSATVLGRTIFTESVKNVAAGCNPMDLRRGSQAAVEAVVDFLQKNKKEITT
                     SEEIAQVATISANGDSHIGELLASAMEKVGKEGVITVKEGKTLEDELEVTEGMRFDRG
                     YISPYFITDAKSGKVEFENPLILLSEKKISSLQDVLPSLELSSKSRRPLLIVAEDIDG
                     EALAACILNKLRGQVQVCAVKAPGFGDNRKNILGDVAILTGGSVFTEELDLKPENASI
                     ELLGTAGSITITKEDTVVLNGEGSTDAIQQRCEQIRGAVEDPSTGEYEREKLLERLAK
                     LSGGVAVIRVGGASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALLKASRILDSV
                     KGSNFDQQLGVEIIKKAIRGPAKRIVENAGEEGAVVVGKILDDFGEDFNKGYDSSKGE
                     YVNMLDAGIIDPFKVVRNGLVDASSVASLLATTECAIVDAPEPKGPPAGGPPAGGMGG
                     MPGMF"
     gene            <313109..>314848
                     /locus_tag="PAS_chr4_0159"
                     /db_xref="GeneID:8201069"
     mRNA            <313109..>314848
                     /locus_tag="PAS_chr4_0159"
                     /product="Protein with a possible role in regulating
                     expression of nitrogen permeases"
                     /transcript_id="XM_002493518.1"
                     /db_xref="GeneID:8201069"
     CDS             313109..314848
                     /locus_tag="PAS_chr4_0159"
                     /codon_start=1
                     /product="Protein with a possible role in regulating
                     expression of nitrogen permeases"
                     /protein_id="XP_002493563.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0159"
                     /db_xref="EnsemblGenomes-Tr:CAY71384"
                     /db_xref="GeneID:8201069"
                     /db_xref="InterPro:IPR009348"
                     /db_xref="UniProtKB/TrEMBL:C4R709"
                     /translation="MSTLFPGFVPITAMFYAVFHPTEGTKVVHQVPSGSMVPTDAQDS
                     SSADEPLFHFDSIKNFIIPKPQLCDRLISFKVDQFRVVGFPVNIYGSHYARNSFSFNF
                     CFVFPYDRDITPYKGNIKRLGKMFRALEEQSRILSKKSGENSGEIFFKDKESSDYLQQ
                     QHSNPLFQVNQGITEDTKYLRTVNPNVELQDIRVGGHKLSLNSIESLIQQIYQDLNNY
                     SECLIPIDASNSVDIKLFPVLPSPADILPSDVPVPTMKLDSMVDLNWDPTMIKILPFI
                     NGINPVCRISQLADADYYLTKTCIQHLLYYQCLNMVSIFQFSNTYAPTPNVRLFLTHP
                     TMAAECQEYVLSEDVSFSELPMHTPSPLRNEEEDYFHRPSSHSQSASAASEKQVRIVV
                     PSQSSLFTLYSSLHQGHTIKEWYIHHQRHLRNIDLRRFLLFGVLKGIIYHVRAIPVLH
                     TSHLALGSSAIDEDPAQENLVAEEPTSSSQPAFKGLRSYQLNEDISESVLTVNSGKVR
                     FRGSAGQADLFQEKPNFKKISQKSRQKQQLFRHMQKSRDFDYICTELASSRSEVESLL
                     DEYFGSEWGLLLC"
     gene            <314964..>317705
                     /locus_tag="PAS_chr4_0160"
                     /db_xref="GeneID:8201070"
     mRNA            <314964..>317705
                     /locus_tag="PAS_chr4_0160"
                     /product="Kinesin-related motor protein required for
                     mitotic spindle assembly and chromosome segregation"
                     /transcript_id="XM_002493519.1"
                     /db_xref="GeneID:8201070"
     CDS             314964..317705
                     /locus_tag="PAS_chr4_0160"
                     /codon_start=1
                     /product="Kinesin-related motor protein required for
                     mitotic spindle assembly and chromosome segregation"
                     /protein_id="XP_002493564.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0160"
                     /db_xref="EnsemblGenomes-Tr:CAY71385"
                     /db_xref="GeneID:8201070"
                     /db_xref="GOA:C4R710"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C4R710"
                     /translation="MESQDESITVVVRCRGRSSKEVQLKQPIIVDVPSEFDSDSVTRT
                     VSVNTSHDSSLSSQITSTKSYTVDQSFGPAVDQEMVFQSVAEPLFEEFIRGYNCTIFA
                     YGQTGTGKTHTMCGDGREIEGSLSPDAGIIPRLLFKLFDALNQKNIDFVVKCSFVELY
                     NEELKDLLGNINSSKSRLRIYEQRDGSKPLIKIDGLEERHIQDAHQGMKLLQKGIRQR
                     KTASTKLNEMSSRSHTIFTVTLWQKLPNDVDDKYSVAKMNLVDLAGSENIHRSGAVNA
                     RAREAGVINQSLLTLGRVINSLVDKASYIPYRESKLTRLLQDSLGGKTKTVLIANISP
                     TRADHHETISTLEYAAKAKNICNAVQVGGFVSKNLLLKDLASEITRLKLDLIATRSKE
                     GVFLDDSNYNQLISEQENLKTEVRELQISNRALRLKLENTSNTLKKEKEYHSKIEQEL
                     TAYKNSNITIQNSLKERNNQLIDISLITNNIAQTAEKDLKQVKSFQELVARQLKHRTL
                     QELQASLNHLMRKNNAKDITIDEDTGMLRVLLKDFESMLQNTLLGMTKDVIEPSVNTK
                     ATVSELRSHLQDLGQLLRSQVDDNLSMISSLEQQTRSISRYIEKGMFKNKDQIVENCL
                     SQLKADIERETLKFQEVMFSKVRDSVSSATKTLASSETNEITKIYQSWIGSTSDAVMN
                     RKSREDEFRKSFEISEATTEQKLSEIDERTTNGAESLREHQENLLQKSYLLSSNGPVC
                     RAVDQIDIKFNTVGNCRTHLHDKLHSVYEQLSHYTHQVNQVVNQNRDDESSRLEVERF
                     LRSFKAVLKSSGLEEDFKMRQRETEATVGEIQQLSVRELNLDQDPDSSGSANPTTRVQ
                     VLTPRKNSLHTPGVGSSTPQGLKRPRSNEDKENTLLASPKHPRIFGDGASLLGNQEK"
     gene            <317908..>318405
                     /locus_tag="PAS_chr4_0161"
                     /db_xref="GeneID:8201071"
     mRNA            <317908..>318405
                     /locus_tag="PAS_chr4_0161"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493520.1"
                     /db_xref="GeneID:8201071"
     CDS             317908..318405
                     /locus_tag="PAS_chr4_0161"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493565.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0161"
                     /db_xref="EnsemblGenomes-Tr:CAY71386"
                     /db_xref="GeneID:8201071"
                     /db_xref="UniProtKB/TrEMBL:C4R711"
                     /translation="MVVDDAFHQQLEEIDRIILCNRYAQINRQYRKGQNVYYQKILNQ
                     QKLYQGRSSPQVVSFKPLSPELPSARASNSNGPTFAGSSQQRHVATSPLTPINSQQFP
                     VVTNGSTPAETGMIGSGNLEGSSSTSSTLLGLNYKHPKGGYGDMNMDYGVSKNIWGSD
                     TSVWG"
     gene            <318854..>319762
                     /locus_tag="PAS_chr4_0162"
                     /db_xref="GeneID:8201072"
     mRNA            <318854..>319762
                     /locus_tag="PAS_chr4_0162"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493521.1"
                     /db_xref="GeneID:8201072"
     CDS             318854..319762
                     /locus_tag="PAS_chr4_0162"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493566.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0162"
                     /db_xref="EnsemblGenomes-Tr:CAY71387"
                     /db_xref="GeneID:8201072"
                     /db_xref="UniProtKB/TrEMBL:C4R712"
                     /translation="MESRFVIQFRNSSAETLVDGGNSVVYSRNSSNGSNCPIITHQTT
                     STPTSKSSRSTTILNDSAYKSELPPPPLVYANEKAILLHFARLFALRHGYQLVINKND
                     KRRVIMLCSKHGNYRHSSKKTSCEGQSVIRGVNGLKRQAKCDCLFRAELQFKSRKNLW
                     LLKPIYMKHNHSSKLTLPIIRGKSDNASQPSRLDDFCSDKNHLNCFFDASRDSGLDLA
                     SSDPFKFPYSRELDGIRVLSSDLPTPPVNTEEPILDDLTVSVSAHLKRALDAMNYTPK
                     EHFLDQRSNNSFDEPPTKKPDLKSEF"
     gene            complement(<319821..>322067)
                     /locus_tag="PAS_chr4_0921"
                     /db_xref="GeneID:8201073"
     mRNA            complement(<319821..>322067)
                     /locus_tag="PAS_chr4_0921"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493522.1"
                     /db_xref="GeneID:8201073"
     CDS             complement(319821..322067)
                     /locus_tag="PAS_chr4_0921"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493567.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0921"
                     /db_xref="EnsemblGenomes-Tr:CAY71388"
                     /db_xref="GeneID:8201073"
                     /db_xref="GOA:C4R713"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:C4R713"
                     /translation="MRLNDTDLDIRTQKIPVLTYNDSLDNSIEDSTIESTTTSKTSRS
                     TRKRYRNKTFIDWIYEYELAKHVKETVTKNGSPLLQMYIPKSKWVVLGISSVTMGVLV
                     VLIDFLSLWLHDKKYGYCSGHLVTIRSNCEEGQWKGWSQTIFTFMNSDTVFHGIGNLV
                     ICLVLSGIFATMAVLITTKYSFSAHSGIAELKIILNGLIINGFLNIEVVLSKIFGIIM
                     VVAAGIWAGKDGPLVHISAGICNFFLTKIPNLHSQNQALKRELIAATTAAGIALAFNS
                     PIGGILFVFEQFSGSIGIHSLMWPGFVSSTIAVTVMKALHPFDDIITGNLFVVTEDKN
                     WLNVELIPFIFLGCLGGFLGVLFNQLNIRLQRFRVVKFMGSRQAQLLDVLAVCLITVL
                     LSYGNSFSGLTLTEMTSALFTDCSKSKYGVLCGASTLQSDNLEFPWKLCLVLLSTFCQ
                     GMLLSAYTVGGNIPGGILLPSLTIGALVGRLFGTILKYYQLRYPSLDIFMNCNSEGQC
                     ISPGSYAVIGAASFLTGVTRMTITVIAIMMEVTGALTYVLPVMIGVLFSILTNSILSG
                     KSSYELWLKLNDYPYLRPGIEEFVNPDLTRIPCHRLFKPTNQLFVICKDKFVTVNDIC
                     DILESANVSGFPVLEKEGGKFIGYISSYELQLELDKLLDIEGVDRSTAVTLNPSSSDY
                     SLEGILETNLLILPPEMDLLTCYDFFQKMSTSIAIFCDSKNQLVGIFSRVDIIELVEK
                     SGVELERL"
     gene            complement(<322193..>326464)
                     /locus_tag="PAS_chr4_0163"
                     /db_xref="GeneID:8200954"
     mRNA            complement(<322193..>326464)
                     /locus_tag="PAS_chr4_0163"
                     /product="Abundant subunit of the nuclear pore complex
                     (NPC)"
                     /transcript_id="XM_002493523.1"
                     /db_xref="GeneID:8200954"
     CDS             complement(322193..326464)
                     /locus_tag="PAS_chr4_0163"
                     /codon_start=1
                     /product="Abundant subunit of the nuclear pore complex
                     (NPC)"
                     /protein_id="XP_002493568.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0163"
                     /db_xref="EnsemblGenomes-Tr:CAY71389"
                     /db_xref="GeneID:8200954"
                     /db_xref="GOA:C4R714"
                     /db_xref="InterPro:IPR004870"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="UniProtKB/TrEMBL:C4R714"
                     /translation="MPDHFGQVLWSKKTTTANDDVKLERSELQKKAAVRRIVQNGIRK
                     PTPLRMLKMPSYPQMNGTDSKIDTSKENNDIKLTTSTPLKIGTNAIHSAISKDNNTVV
                     LSDAISKYAIDNYNFQPPLGLGPFSRFEKSSILNFPDRLFEEYNSTECITNMGIFQQI
                     GKAWLTVDNKLIIFNFKSATQDYFTIDEIRHSILTVKLIEPKPNVFVDSVNYLLLVST
                     PIDIYIFAVEYNAIKDKLEIFNTGMSVSTQGLIVDHFETFEKTHDIFFCGKGDSVNVW
                     KLSYSNNEEWFHKKCNKECLTRNSLSTVVPTFNKVPGLNIFGTSDSETSTSNERESIS
                     QMQIDQSRSILYTLSTRSVVRAYRIKVLSSGTVSLSHPTTKGPMDLLKDLSTTYGLSN
                     LTPQTKNFKLLKIFPVTNLESSSLFLIAITNTGSRIFINGSANLGDGLALIASHLKLP
                     PPDHKFFQKVSDEKAKQGKDSSLAINSNESSKLSENIYGNTASFLNVTALQLGQAQSV
                     SELLTGLKNCEIISPNIFFGILRLKSENTDRLFVSTPDYGVLKKNNSYVEDFEFLDSY
                     GLIHDIIQLTPTFNATETPAGYYNQFASQYTKDPLEVAVLTNTGIHIYRYRTPDLILE
                     DSLNDNTFKAFAEKYGSREACSTTLYLSCRFGKSEDNKNKATQLFICGGQNASLNKNL
                     TPVVDNVELSDRFYAVILLISRMFRDIWSKEIFKLVPEINFDSNGFIEDGSVKKIEDR
                     IILSGLTISRNTIEYLLSSLLIILDFLEKNKRSIPGALPPTFNYENNFRDRDFEVCSQ
                     AEHIGFRAIFQLLNTMKEGLSFLLFLIEESESSKNGNFKDLVRFMSVQDQADLSSLTF
                     SQFIDNTEEQTQKLLKEILFSIINRNIVRGISVDLIIKNLQERCGSFCSTSDVLIFKA
                     FETLKRAKDISKRDPNLKVKHLQASVDLLKQANNLVSFDTIKEAVEIMLEVNYYSGAI
                     EFLLNMANASPNTTTSDAYSSDYYNTDKLLTNSSKEKDYEKRHMFYKYVFDILVDIDT
                     KAVESVQLINDTESRFQSEENQFITQNGDLITEFTQLRDTSYATCFAYQDKLFHYEFY
                     KWFIEQGVGERLLDIETPYILGFLQECAVKDLQMAKLLVAFHSKHENYYAAAKILYDL
                     ANSDFTISLSDRVQYLSQANGFCNCVCPPSVRQEMIEMSTFIADLIAVSNIQEILLQT
                     IISDERGTEESKSKAKEDLDGKILTISELFNDFINPLGYYELALIVFRISDHRNTDDV
                     LSQWELLLNKWHTDYIKNRPNESFYTVVSNLFVSVGRKLSDTETVFPVPDLFRLLAKF
                     INQSQPSESTPVGILVDIFLKSGVTYDKLYYTLKEMVESTTFEPFEGFTKFLKSEMIY
                     LIKNWYKTDRRLRDIVSSDQILSMTDYQVDTDPIYNYIRTTGIPI"
     gene            <327770..>328024
                     /locus_tag="PAS_chr4_0164"
                     /db_xref="GeneID:8201074"
     mRNA            join(<327770..327797,327861..>328024)
                     /locus_tag="PAS_chr4_0164"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493524.1"
                     /db_xref="GeneID:8201074"
     CDS             join(327770..327797,327861..328024)
                     /locus_tag="PAS_chr4_0164"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493569.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0164"
                     /db_xref="EnsemblGenomes-Tr:CAY71390"
                     /db_xref="GeneID:8201074"
                     /db_xref="InterPro:IPR015157"
                     /db_xref="UniProtKB/TrEMBL:C4R715"
                     /translation="MSRQGGKAKPLKKPKKKTQEFDEEDLAFKAKMKADAAAKKAMAE
                     KASKGGPLIGGGIKKSGKK"
     gene            <328243..>328905
                     /locus_tag="PAS_chr4_0165"
                     /db_xref="GeneID:8201075"
     mRNA            join(<328243..328288,328340..>328905)
                     /locus_tag="PAS_chr4_0165"
                     /product="GTPase, Ras-like GTP binding protein involved in
                     the secretory pathway"
                     /transcript_id="XM_002493525.1"
                     /db_xref="GeneID:8201075"
     CDS             join(328243..328288,328340..328905)
                     /locus_tag="PAS_chr4_0165"
                     /codon_start=1
                     /product="GTPase, Ras-like GTP binding protein involved in
                     the secretory pathway"
                     /protein_id="XP_002493570.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0165"
                     /db_xref="EnsemblGenomes-Tr:CAY71391"
                     /db_xref="GeneID:8201075"
                     /db_xref="GOA:C4R716"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R716"
                     /translation="MALTKYKIVFLGDQGVGKTSLITRFMYDTFNDHYAATVGIDFLS
                     KTLYLDDKTVRLQLWDTAGQERFRSLVPSYIRDSNVAIIVYDTTSKSSFQSVDKWCDD
                     VRNERGENVIICLVANKADLADQRVISTEDGEKKATGLKVDLFIETSTKKGYNVKNLF
                     RKVAKTLLEQDGSPGQDPKIDNDGVEMIDLAEANVENESQCQC"
     gene            <329619..>330962
                     /locus_tag="PAS_chr4_0166"
                     /db_xref="GeneID:8201076"
     mRNA            <329619..>330962
                     /locus_tag="PAS_chr4_0166"
                     /product="Putative transcription factor containing a C2H2
                     zinc finger"
                     /transcript_id="XM_002493526.1"
                     /db_xref="GeneID:8201076"
     CDS             329619..330962
                     /locus_tag="PAS_chr4_0166"
                     /codon_start=1
                     /product="Putative transcription factor containing a C2H2
                     zinc finger"
                     /protein_id="XP_002493571.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0166"
                     /db_xref="EnsemblGenomes-Tr:CAY71392"
                     /db_xref="GeneID:8201076"
                     /db_xref="GOA:C4R717"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R717"
                     /translation="MTSPSPPNNKDFNKTNKKRSNRSGSRTFVCTGYPNCSMSFTRSE
                     HLARHIRKHTGERPFKCEYCARKFSRMDNLRQHKQTVHAYENFVISYPGRLGDMQIQE
                     ESSAPLVNEVSGPSHRKAELPKAASEGLIPHSSMPRSPPMAASKSESYLSLPNSGPNR
                     MLLSDHSQIPHGKQHENHALPSLNPQQPIQHRPANFYTTNHPQIQPSNQQQDVQNSTV
                     HGFTNSSQPQGLPRFPNVSFLQGASNHQELPNPGPVPSPHPTNENKNKPQLQHNSTSS
                     SSSMNFQPLQFRPMSYRPKPLSSPLPPNNNSKNTPGNLLGAPLSSLPLSQSQSQSQSP
                     FYSSPQQHSTGFVPSSLRRPGTINENASPSSKGSPSQAISVPQTPISTTSSSTASSVG
                     STHTRFWLNSVLNNNDPVAEPDYGNQNGSPSPTSTSSSTSTLESTKCNIDSLLNE"
     gene            <331174..>334809
                     /locus_tag="PAS_chr4_0167"
                     /db_xref="GeneID:8201077"
     mRNA            <331174..>334809
                     /locus_tag="PAS_chr4_0167"
                     /product="UDP-glucose:sterol glucosyltransferase (Sterol
                     3-beta-glucosyltransferase)"
                     /transcript_id="XM_002493527.1"
                     /db_xref="GeneID:8201077"
     CDS             331174..334809
                     /locus_tag="PAS_chr4_0167"
                     /codon_start=1
                     /product="UDP-glucose:sterol glucosyltransferase (Sterol
                     3-beta-glucosyltransferase)"
                     /protein_id="XP_002493572.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0167"
                     /db_xref="EnsemblGenomes-Tr:CAY71393"
                     /db_xref="GeneID:8201077"
                     /db_xref="GOA:Q9Y751"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002213"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="InterPro:IPR004276"
                     /db_xref="InterPro:IPR011993"
                     /translation="MSQLRPRDSSAGKSSSPRRTDRNPESIDVNSKGGSEGMTSGLVP
                     GTAPHKEDETEAEDDIDCGRLITSKSLATMLTTASMYAGVSQLDDDAIESSALDEPIP
                     YVPYEEDAESVMSESTVGVDTVRDTDSSEQINPEIDGLVALRKKQQHTLSKFELSVVR
                     KRCSQLSLAGSSSGSTRRNSFTLDNNETTRAVKLCEKLKTTFDLSDDDEFVNDYPCWL
                     LHEVFLQGHIYITSRYLLYFAFLPKRDSTVTMSGALSIRSSTTMRFSVRRWAVLKGNY
                     FRLYANSTERYFPSLNIDLRFLLKVELSNPNLEENKPTVFKLITEARTHYFQADSLDN
                     ARSWVTDLRKHIFTAKNSGGHVTIKVPLENILDLSIETLFEASQTLKLKVLESEESYA
                     IDDYYFMFFNNGDQVLDSIRQSMKALGIELTDSDSSESDSDVSGSETNGRSTHRKSKL
                     SRSLSVLTPIPRGIGSIYKPIKSSASGIIGAIKKPQKSATRPFSSVVETVVPNDNDSE
                     LKQDHAGDAPKDSEEPSTKPSNWSAKSLVQGFLSTTSSISQSMLFASPMHYNNQLFIE
                     RGEEDPYFVTNKEEREVAQSRFRKHFSLPDSEELLASYFCHFQKNIPVYGKVYLGTTC
                     ICYRSLFPGTNTTMILPYSDIENVYNLKGFRFGYSGLVIVIRAHEELFFEFGSNESRD
                     DCDLFLLKQLDFTKSHKNAHSEQKRKRNDSIKLAESVQLADARLRYFETRIESDIGRE
                     VPIILEENQYSTSEIRSKRRYKFVLLTIGSRGDVQPYISLAKGLLAENHKVKIVTHEE
                     FKPWVESYGIEFATIAGNPAELMSLMVTHKSLSVGFLKEAKEKFTGWIGELLQSSWDA
                     CQDADVLIESPSAMAGIHIAEKLQIPYFRAFTMPWTRTRAYPHAFVVPEQKRGGSYNY
                     LTHIIFENVFWKGISGEVNKWREQVLMLPKTNLERLEQNKVPFLYNVSPTVFPPSMDF
                     PHWVKVVGYWFLDEGEADSYDPPKPLLEFMEKAKTDGKKLVYIGFGSIVVSDPKQLTE
                     AVIDAVLSADVRCILNKGWSDRLGKQTGVEVELPEEIYNSGNVPHDWLFGKIDASVHH
                     GGSGTTGATLRAGIPTIIKPFFGDQFFYANRVEDIGVGIGLRKLNSKSLSKAIKEVTT
                     NTRIIEKAKEIGKQIQSENGVSAAIRCLYQEMEYAKKLSKSKQKYWDNQSEDISDDSV
                     SGSWFEV"
     gene            <340774..>341892
                     /locus_tag="PAS_chr4_0169"
                     /db_xref="GeneID:8201078"
     mRNA            <340774..>341892
                     /locus_tag="PAS_chr4_0169"
                     /product="Transcription factor that controls expression of
                     many ribosome biogenesis genes"
                     /transcript_id="XM_002493528.1"
                     /db_xref="GeneID:8201078"
     CDS             340774..341892
                     /locus_tag="PAS_chr4_0169"
                     /codon_start=1
                     /product="Transcription factor that controls expression of
                     many ribosome biogenesis genes"
                     /protein_id="XP_002493573.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0169"
                     /db_xref="EnsemblGenomes-Tr:CAY71394"
                     /db_xref="GeneID:8201078"
                     /db_xref="GOA:C4R719"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R719"
                     /translation="MDNPFGQASAMRIPTNSGAASSANGSEPININISMTHQQHNYNH
                     SHNQQYPQGNSRRNSIHPKLRRDSIAHSQGMGGVSWGSVAIGSWLKDDVLNLAVYNQA
                     PNHQFSTNHAMFTSNMTTSSSPSIQNTGYMANLEADYCKDYSCCGQLLPTLHDLLRHY
                     EEMHIQPSPPEMETPRSKAVNSILDTVSTNEVFLSHQGMEPQFQVPEFDFAVTNNFQN
                     QHSETSGVDDPTPKTQPGATVGAGPQSQIRQGQHQQQQFPMDEDEDTEMCIDDPARHL
                     YVSEHSEHRPFKCPVVGCDKTYKNQNGLKYHRLHGHQNQKLHPNEDGTFSVIDPESNA
                     PYPDGLGLERDKPYRCEVCGKRYKNLNGLKYHRGHSTH"
     gene            <342202..>343302
                     /locus_tag="PAS_chr4_0170"
                     /db_xref="GeneID:8201079"
     mRNA            <342202..>343302
                     /locus_tag="PAS_chr4_0170"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493529.1"
                     /db_xref="GeneID:8201079"
     CDS             342202..343302
                     /locus_tag="PAS_chr4_0170"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493574.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0170"
                     /db_xref="EnsemblGenomes-Tr:CAY71395"
                     /db_xref="GeneID:8201079"
                     /db_xref="InterPro:IPR009617"
                     /db_xref="UniProtKB/TrEMBL:C4R720"
                     /translation="MFGGCSSIPLSDVGIYSRLVNLLVNMVDISLRIPLFLTRTGLYV
                     TLITTSVVLLLLPLSILSYLRFYELLIPIPKQHVPVHLNTNLISSKPDGTFYHNGDFI
                     KFGVLNSAQLIQHLDPEVDYTVTLIIKIVGTSSTSTETSVPDSNVPLRVSILSNHLLN
                     SLKIYDIKGPRNKFWPITDDLLVPSQFDKHSFSSIPETFTFTGKGVYLCTTSVQTIYD
                     YHNENELILWKSFEMKMFIPPLFKSLVPPLIFNYPDRSEDDSKVIKMTVSPQFRLPSS
                     KNHLYQLTQSHLLVELASKFNKNIPLNSDSLVLQLDVNWHGARYYIYHHPLISFFFGV
                     FLFWGFSSMSCVAIGLSLWYFFGKTTSVPTQK"
     gene            complement(<343318..>346443)
                     /locus_tag="PAS_chr4_0171"
                     /db_xref="GeneID:8201080"
     mRNA            complement(<343318..>346443)
                     /locus_tag="PAS_chr4_0171"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493530.1"
                     /db_xref="GeneID:8201080"
     CDS             complement(343318..346443)
                     /locus_tag="PAS_chr4_0171"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493575.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0171"
                     /db_xref="EnsemblGenomes-Tr:CAY71396"
                     /db_xref="GeneID:8201080"
                     /db_xref="InterPro:IPR013887"
                     /db_xref="UniProtKB/TrEMBL:C4R721"
                     /translation="MDTKSRSKSNLKRLTVYKNQPKERGIQVTKEISIDQELSAAYKF
                     LYKGICKFEGSKSGVSKTNFLRIWLLPFLRNTSVDSNILIGKIPLSVMDYGFRILLQW
                     WEILLNILTNSSQPSQKPASALKSSDIPLILECISRIISRPEWFNITQQGNENYTKYQ
                     DYLAKTLEYCIFRLNSTTKKCSLQVNGMIGKVFAYSFFHLDNVSNALLFIFNIRNSRY
                     FRMGKFHNRPSQKAENECAATNPFPQFLPASKLYDFKGRTVKEKINSQQNKHLNSMEP
                     PVGKVPGILEPRGVWVTRWVNVDTNIDVFNSFLFHYLKIVNGYICHSGISEYDILKFP
                     GFIHILCHVEEIIDHAFECRSAFKKHSSSNNNINYSSNNILSMVNSFNYELPAPIMKL
                     FKTFRYLSYDKESFDVALIDIFLSKIDRTLVKMASFISCYDYYQSCVVLDLFYQLVLH
                     VDNSATTCIDWSFWLDALFRLLTDTLNIICELKALSILFNIWSFIPLLEEPIKSETIW
                     IRSPEKGYRWNSSYYLLSHWDKFFNHWQPLLRCYYQHLIIWKVIGVLSFKSYRHDEIK
                     SLVTKKLKRSHSIALRMAELVPELEVKPSTPLLNHRLTIASNNGCKKNNGGYNFQSLL
                     SSEDLTMATTANASPNVDDDLAIDKKTNYPFEVFDDSVYTWAGVPIVVPKSSNKISKH
                     SSSATLSTIQDTDEAPKSPSSSGSSFVHSLESALKFFKNKSDSATNSPTGSPKTQSVP
                     GSEATTPKESLGTCVARKKFSSSLSLSSLKSAFDSPTSSVVNVSLDDESSNFDIKSVS
                     SDKSGLSMFDDTFGGVLGLTSDSQPREFKIMLNIPKVIKPLYKFQLIPVDSQMNKHLR
                     LMGPKSRILEERSIITVPRLPRLSSSIYRENSGIGLIYSSSSDSGASVSDSESLYLSM
                     ADGKYKEKKYCTPLSSPSLDTNASESGKTKTDKLFQNQHHHLVQKWGTIGKSLNEWDS
                     FVKEYETFCNEKQLQLELGDMNVGMLNSGTTFSQTGVRRYEHNPDNVHAEMELLIPYL
                     PAESPNKMNAN"
     gene            <347453..>349576
                     /locus_tag="PAS_chr4_0172"
                     /db_xref="GeneID:8201081"
     mRNA            <347453..>349576
                     /locus_tag="PAS_chr4_0172"
                     /product="E3 ubiquitin ligase for Rad6p"
                     /transcript_id="XM_002493531.1"
                     /db_xref="GeneID:8201081"
     CDS             347453..349576
                     /locus_tag="PAS_chr4_0172"
                     /codon_start=1
                     /product="E3 ubiquitin ligase for Rad6p"
                     /protein_id="XP_002493576.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0172"
                     /db_xref="EnsemblGenomes-Tr:CAY71397"
                     /db_xref="GeneID:8201081"
                     /db_xref="GOA:C4R722"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013956"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C4R722"
                     /translation="MSVEDRKRLVDDNPPQPDHKKPKLPKVLDQLSEPGEMLTQNDIV
                     FFKKEAIWRQMNHFKSNVNLIGSELEKYKSGYAKSVSHLSTVNEWIDQLVAAFLEQGF
                     KVSDEINDKLVVDFDCSPDQEEGEHVSQLLEKLREKRITLIKLFTPLLNSKLGDTSED
                     TAALKDSLARAHRERSTLIQENKILNSTLKDIKQQYLDIVKVKDRLESKSLSRINGNT
                     EEGQPAENNIKLEPSDGNDSETISTTAAKTETNGTPVNNETTDHDEDLQNNLEKVKLE
                     NSLLLQQLQETQQKLSINEKKLHELNLVLNNLSGDMLLKNSVVYSSLYSNYNDLEAKF
                     KELQDADKLNVEIVSKLQANNLDFEKKIVQEFEKEKNLLQKQLAKNEQDLARIRSNRD
                     ELLSQVSMLKAEKDKDLLYQELQKLIDIQNARIDQLSAEKQVNEFEDKGEDRDVLLKK
                     IQLLLAELKDIEAVFKKTREIESEKLKQYVDSSSVITKLTTEKNKADQKYFATMRLKD
                     SLAMENKLLKTSLSKSKELIDKNKELIAEYQSKVNILQNELLTTLTELNKKTNVDIST
                     MQKSLNELINSNTILKQQLSLRDAEVENKSLEVLEKDVELKENKRLIESLKFEKEKLT
                     DRIQRYRETKSLGDLDDQSTSLESFRKLVYCDICERNFKKVAVTTCGHTFCKECIDDR
                     INSRMRKCPNCNKPFSKMDVLEIHL"
     gene            <350142..>355640
                     /locus_tag="PAS_chr4_0173"
                     /db_xref="GeneID:8201082"
     mRNA            <350142..>355640
                     /locus_tag="PAS_chr4_0173"
                     /product="Urea amidolyase, contains both urea carboxylase
                     and allophanate hydrolase activities"
                     /transcript_id="XM_002493532.1"
                     /db_xref="GeneID:8201082"
     CDS             350142..355640
                     /locus_tag="PAS_chr4_0173"
                     /codon_start=1
                     /product="Urea amidolyase, contains both urea carboxylase
                     and allophanate hydrolase activities"
                     /protein_id="XP_002493577.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0173"
                     /db_xref="EnsemblGenomes-Tr:CAY71398"
                     /db_xref="GeneID:8201082"
                     /db_xref="GOA:C4R723"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003778"
                     /db_xref="InterPro:IPR003833"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR014084"
                     /db_xref="InterPro:IPR014085"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C4R723"
                     /translation="MAVIDTTGWTTSQWIKYHSEHDPEESFQLLSALVSSQKTAPEDP
                     VWISLVSEDDLLHQWKILQSKSDKFQLPLYGVPIAVKDNIDVKGLPTTGACPSFKYSP
                     QSDATIVSLLRDQGAIVIGKTNMDQFATGLVGTRSPYGKPTSAFSDKHVSGGSSSGSA
                     VVVAKGIVPISLGTDTAGSGRVPAHINNLIGLKPTKGVFSCHGIVPACKSLDCPSIFS
                     LTLSDAQLAFNIMAQPDLAQDEYSRPMPSNPKKYFSSALKIAIPQDIPWFGDSENKKI
                     YTAAVESASKLGAEVVALDFSPLLDLAKCLYEGPWVSERWESMKDFYSTNPDNKDLDP
                     TVTSIIKGGEKFDAATTFRFEYKRNAILQKVKASFSDFDALLVPTAPLNPTLEEVEKE
                     PVLVNSRQGVWTNFVNLADMSALAVPAGFRSDGLPCGVTFLSAKFNDYALLDLANRFF
                     KVHYHEGVRRLGATNAENGIGDELLPLPKPNLDDCVKLAVVGAHLKGFPLHWQLIKCN
                     ATYLASPKTAKSYRLYALPLKGGPIAKPGLRRVDADIGEQIQLEVYAIPKEHFGTFIS
                     LVPEPLGIGSVELESGEWVKSFICEEIGYKAKGTEDITSFGGWKNYQDSLKKHAESQK
                     KPFDVVLVANRGEIAVRIIKTLKKLKIKSVSVYSDPDKYAEHVLISDESVALNGVSAA
                     ETYLDVEKIVKACKDTGAQAVVPGYGFLSENADFSDRLGKEGIVFVGPSGDAIRRLGL
                     KHSAREIAEKAGVPLVPGSGLVTSTKEAKEIAAKLEYPVMVKSTAGGGGIGLQKVDSE
                     ADIERVFETVQHQGKSYFGDSGVFLERFVENARHVEIQMFGDGYGKAIALGERDCSLQ
                     RRNQKIIEETPAPNLPEATRLKMRKAAEQLGSAMNYKCAGTVEFIYDEKRDAFYFLEV
                     NARLQVEHPITEMVTGLDLVEWMLYIAADMPPSFDQEIKVTGASMEARLYAENPIKDF
                     MPSPGQLTEVEFPKWARIDGWVKKGTVVSAEYDPTLAKIIVHGKDRQDALKKLRQALN
                     ETVVHGCITNIDYLRSIANSQMFETAKVATKVLDSYDYVPKALEILAPGAYTTVQDYP
                     GRVGYWRIGVPPSGPMDDYNFRLSNKIVGNAKAAPAIEITLNGPTILFHHDAVIGVTG
                     GNVDVTVNGTSVSMYEPVKLSKGDKLAIGKLTTGCRAYLAIRGGIDVTEYLGSRATFA
                     LGNLGGYNGRVLKFGDVLFLGQPELPACSLPYPESEPQAVPKALIPQLPAKEWVIGVT
                     CGPHGSPDFFQQDTVEEFFKEQWKVHYNSNRFGVRLIGPKPQWARPDGGSAGLHPSNT
                     HDYVYSLGAINFTGDEPVILTCDGPSLGGFVCQAVVAQAEMWKIGQVKPGDLIKFVPI
                     TCETAVSIKASQDASCDDLSGKLVEISSVKQLDGPINPVLYTIKPDKETGLSATYRQA
                     GDRYILVEYGDNNMDLNMSYRVHTLISMVEKHKTVGIVEMSRGVRSVLVEYDGTAISQ
                     KELVEILLRYEREIRFVNKWKVPSRVIKLPMAFEDKKTLDAVTRYQETIRSTAPWLPN
                     NVDFIANVNNIQRSEVKDMLYSARFLVLGLGDVFLGAPCAVPLDPRQRFLGTKYNPSR
                     TFTPNGTVGIGGMYMCIYTMESPGGYQLVGRTIPIWDKLVLGQHSKKFNDGNPWLLSP
                     FDQVEFYPVSEEEVDKFTEEANCGQFDVDIVDSVFDHTKYLEWIQANQESIQAFHDKQ
                     GGEQLAEFNRLIQIANEELKNSSSVQEVKADEFSEDAELVYSEYSGRFWKPLVQTGDV
                     VTEGQGLVVVEAMKTEMVVNSPRAGKVVKIVHTNGDMVDAGDLVVVIE"
     gene            complement(<355765..>357804)
                     /locus_tag="PAS_chr4_0174"
                     /db_xref="GeneID:8201083"
     mRNA            complement(<355765..>357804)
                     /locus_tag="PAS_chr4_0174"
                     /product="Deubiquitinating enzyme anchored to the outer
                     mitochondrial membrane"
                     /transcript_id="XM_002493533.1"
                     /db_xref="GeneID:8201083"
     CDS             complement(355765..357804)
                     /locus_tag="PAS_chr4_0174"
                     /codon_start=1
                     /product="Deubiquitinating enzyme anchored to the outer
                     mitochondrial membrane"
                     /protein_id="XP_002493578.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0174"
                     /db_xref="EnsemblGenomes-Tr:CAY71399"
                     /db_xref="GeneID:8201083"
                     /db_xref="GOA:C4R724"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C4R724"
                     /translation="MDLEETLSNHLTNFLFRSSPQHPSLIIAQPSTYTFQTSPVVQWL
                     SKRKFSSLLTLALLSLSYYIIAPSIPCLNREPRGMFKKRPDKTTTGLINATVDCFANS
                     TVQALASLPGLNVYLNDFFSTQSALGKLLEDRRSNEEPHNDTRSSDLSVPSTPLHEAL
                     SILLSQLQETIYERRSISVWSFLNVLEKIFNSRISKSQHDAHELLQLILETLEKEYVS
                     VQLFIGVNEELFNDSPVSIPQFPFSSLSINQLRSVECGGSSSLGFDHMAIYSLPTPRK
                     PFISLPDLIKENQREVIEGYNCVKCNVLFCIDVLSKSPDPTPTERENLKQLKKLNVTL
                     KINDDLPPSLQAFVDQTCKRYKYQLKSTLIRNHGLAKPPKILPIHLSRSIFLQSQAVR
                     NSCKVEFDEILALDINESILEEAQKFIDEKLKEAIQDAKERKPIDNNSSETLPPNLLF
                     TEDEKHVGIEEPMFVENAGQDSEDESLSSNEHIESSNTVTNADNESKNLESSAKVESE
                     TSIKKCTYKLQAVICHQGSHRIGHYECYRRKPHYYKTSTSNEFLSDVPELLFKAPAEE
                     TAGPPPETPLSDPSPEVDESNQDIPSDAVKSPESSGSRFRRRMSSIISMPKLNDDNSP
                     ANSSDQQSKPTRKLVSSSVKNPFWKISDSKITEYKLEDVLKDSGAAYMLFYELLP"
     gene            <358800..>359249
                     /locus_tag="PAS_chr4_0175"
                     /db_xref="GeneID:8201084"
     mRNA            <358800..>359249
                     /locus_tag="PAS_chr4_0175"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493534.1"
                     /db_xref="GeneID:8201084"
     CDS             358800..359249
                     /locus_tag="PAS_chr4_0175"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493579.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0175"
                     /db_xref="EnsemblGenomes-Tr:CAY71400"
                     /db_xref="GeneID:8201084"
                     /db_xref="GOA:C4R725"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C4R725"
                     /translation="MTDRNSLRVPPMRGPPNSSSRKPLLETSLSAPGAGPRRQKIGLK
                     PGHSAMDWAQLKQNKGNALKGNIDPSHFPLRVTKEELKRHNSRDDCWVALNRKVYNIS
                     PYLDFHPGGVDILMKCAGKDGTLLFQKYHHWVNADRILDSCWVGIMV"
     gene            complement(<359276..>361171)
                     /locus_tag="PAS_chr4_0176"
                     /db_xref="GeneID:8201085"
     mRNA            complement(<359276..>361171)
                     /locus_tag="PAS_chr4_0176"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493535.1"
                     /db_xref="GeneID:8201085"
     CDS             complement(359276..361171)
                     /locus_tag="PAS_chr4_0176"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493580.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0176"
                     /db_xref="EnsemblGenomes-Tr:CAY71401"
                     /db_xref="GeneID:8201085"
                     /db_xref="UniProtKB/TrEMBL:C4R726"
                     /translation="MRGIQEFVSVQSHKERDKEKIKLASTSHQHPSIPEMFRKLKRYS
                     NKPRPLSIDFGAPSHDIWMGFKDDTNIMKGIIGSIDVDFWNSVEKFGAGALPEEEPRC
                     CLNKAEGFNRGSSESPLRRSEKFQVKKSPQTPSTASSANSSPSTPTRNPTQHSKVEPP
                     CTPQNIVNRKASLLWKIKEAGKYLNEDDSNGELIVPYIGDIKKILRHSFQEEPETQWP
                     NNINTNSKSPFIEDDSIKTSKQLASLKEPISDFEAKESLLDSAVDQYYSSLGKHKNEV
                     ITKFMNKLNSSPMGKFIKDNEQAIFAEMGPNITLWQLWERGESKWRELPRSTKDNYLT
                     SLPDTKRATYEYSPILRERKLTPNTQRHYLGEYYEGSWMQELEEIPLTKSGIPKGTVK
                     KLASFFTEEANKLVETPESPKKEFKSAELKDDEAGSTDTATKQDPKSDETKSSINLPD
                     SPLRTPIQTMKEPSFKVLKESNFRKNSPKSNQSDRILQPKHTNTSSTSSSSSGDQILK
                     LSKTTASFLKENDKPAFKISDNLSSPKWTSELKLKKTYLSPAVELLEELAQDADEPML
                     PQQLFSLYRQIIPEIDAEWSDIPISEQQKYFQVTQKVFGLFPKNVCLSTGYDDSVDSM
                     DDHFIAV"
     gene            <361651..>362400
                     /locus_tag="PAS_chr4_0922"
                     /db_xref="GeneID:8201086"
     mRNA            <361651..>362400
                     /locus_tag="PAS_chr4_0922"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493536.1"
                     /db_xref="GeneID:8201086"
     CDS             361651..362400
                     /locus_tag="PAS_chr4_0922"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493581.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0922"
                     /db_xref="EnsemblGenomes-Tr:CAY71402"
                     /db_xref="GeneID:8201086"
                     /db_xref="GOA:C4R727"
                     /db_xref="InterPro:IPR001087"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="UniProtKB/TrEMBL:C4R727"
                     /translation="MTTKDLLYKKFVLFGDSITQRTFDQYILGGDPSRLDYSLGAQLT
                     SIYNRKLQVLNRGFSGYNTEHARHILPELLRIEHDESNSKVELMWIFFGSNDAVEKGL
                     QKVELERYEQNLNFLTQLALDRGIKVILITPGVVDDSVLSQRDPEWKDGHFRTTTRNK
                     MYAAAVKRVGKHFNVPVLDLLSALETHGNFEQLLVDGLHFLGKAYQILFRELLNLIET
                     EYPELHPDKLPMKLPYWRDIDSSDIEGSLNG"
     gene            <362730..>364325
                     /locus_tag="PAS_chr4_0177"
                     /db_xref="GeneID:8200955"
     mRNA            <362730..>364325
                     /locus_tag="PAS_chr4_0177"
                     /product="Non-essential protein of unknown function"
                     /transcript_id="XM_002493537.1"
                     /db_xref="GeneID:8200955"
     CDS             362730..364325
                     /locus_tag="PAS_chr4_0177"
                     /codon_start=1
                     /product="Non-essential protein of unknown function"
                     /protein_id="XP_002493582.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0177"
                     /db_xref="EnsemblGenomes-Tr:CAY71403"
                     /db_xref="GeneID:8200955"
                     /db_xref="GOA:C4R728"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:C4R728"
                     /translation="MLKLGSVIYSAVKPIFKIYMIMGCGFYFARKNVLSVDTGKNISD
                     MIITLILPCLAFSKIVNNIDNSDIKEIGIIVLASVVLYGFGYLGSFFVSLLPFFPKGR
                     CEGTCLSVGGFPNISDLPIAYIQTLSSGLVFSEAEGEKGVAYICIFLAVQLICQFNLG
                     GYRLIQRDFKNFTPTDTASLSGTEGDHKFEEVKSITPSKTQTRNSVSLPPTLRPMPTI
                     QDEQSIDSQIDPSVTSNSDELSSTSAYAEPQNPAPLVRENTSDIHRRGSIISRSNRSQ
                     TSLVSNLELRSMPSQNLRDLVKYYSHAEEDATGPMERPPVDAESNQPASKSTWHQFLH
                     GFKKFLFELIDNCRRPASIGIIAAIIISMIPWVRALFVLNDQAFVDNAPDQLPPLSFV
                     MDFVNYIADACVPLGLLMLGATIARLQFNGLPKGLWKVPLLLTILRLIILPILGVLVL
                     TKWQHNGWFDDNKILEFVCAINFGLPPATSLIYLCAFYTPPGYPHTIQVDILALCYIF
                     HYSAIVISLPFLTTYVLKVSLKL"
     gene            complement(<364322..>366178)
                     /locus_tag="PAS_chr4_0178"
                     /db_xref="GeneID:8201087"
     mRNA            complement(<364322..>366178)
                     /locus_tag="PAS_chr4_0178"
                     /product="Dihydrouridine synthase"
                     /transcript_id="XM_002493538.1"
                     /db_xref="GeneID:8201087"
     CDS             complement(364322..366178)
                     /locus_tag="PAS_chr4_0178"
                     /codon_start=1
                     /product="Dihydrouridine synthase"
                     /protein_id="XP_002493583.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0178"
                     /db_xref="EnsemblGenomes-Tr:CAY71404"
                     /db_xref="GeneID:8201087"
                     /db_xref="GOA:C4R729"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:C4R729"
                     /translation="MSDKRTAEESLQDTTKKVHIEQPSNDSKPVHDHDHFAKGVTPIK
                     KEFLVSTDKQVVYADEESSLDRLNGSEKPQAKKSKKKRGQNKDRDLKQTKEAVKLCPS
                     LVDPETPKECRFGADACRFTHNIEEYLNSKPQDVQGVCPVFAAIGYCPNGLKCRWLSS
                     HYKSGKLIKDEILCDKVSKVDYEVNHISQNAKTDLSRKKFQFDTADKMILFLDSKVQV
                     HDKTKQELQKENANNYVEPPFKVSEKKKLNVKNAKIVSPLTTVGNLPYRRLMKTLGAD
                     ITYSEMALSLPLIQGTNSEWALPKAHSSEYPGFGVQIATSKHWTGAKAAEAIAKLTPQ
                     VSEINLNCGCPIDLLYRQGQGSALMEQPPKLLRVLKGMNYCSGEIPVTFKLRIGTRDN
                     HPLAENLVKRVCEEGDIGCVTLHGRTRQQRYTKEADWSYISKVGQVVRDYNHNQLDDK
                     EQSDRDPIYFVGNGDCFTHEDWHKAVSDPNIDSVMVARGALIKPWIFEEINSEQYIDK
                     SATERLALLEQYSKFALQHWGSDDYGVNTARRFMCEFMSFTHRYVPVGIMERLPPKLN
                     QRPPTWKGRNELETLLGSPDYRDWIKITEMFLGPTTEGFSFTPKHRSNSYKS"
     gene            <366405..>367463
                     /locus_tag="PAS_chr4_0179"
                     /db_xref="GeneID:8201088"
     mRNA            <366405..>367463
                     /locus_tag="PAS_chr4_0179"
                     /product="Dihydrouridine synthase"
                     /transcript_id="XM_002493539.1"
                     /db_xref="GeneID:8201088"
     CDS             366405..367463
                     /locus_tag="PAS_chr4_0179"
                     /codon_start=1
                     /product="Dihydrouridine synthase"
                     /protein_id="XP_002493584.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0179"
                     /db_xref="EnsemblGenomes-Tr:CAY71405"
                     /db_xref="GeneID:8201088"
                     /db_xref="GOA:C4R730"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R730"
                     /translation="MNKEPDDMNNVVESIRMLSIRPKSKQPIEIIRNSTKPVTIAGPM
                     VRYSKLPFRELVRFYNVDLVYTPMILAREFVRNKVARYSDFTTNIRDTPTIVQIGCNN
                     SVDLLRMVDMIHSYVDGISLNCGCPIKEQVREGIGAALMTEPEKVSQMVRVVKEKYGD
                     SVCIETKIRIHNDIQETIRFVKQVQDAGVDYITVHGRTKTTRSSKPVDLESIRIIKEV
                     ARVPVIANGDCVDVKSFEHILDVTKCDGVMSVRGLLENPSLFSGYNKTTWGCVERFFS
                     LSMHYGLPFRIIQHHLSCMTSQIFTKKEHLQLNQCNNMIELLDFFDRDFELKRMGENG
                     FGEDVEVRRRNPEGIVGT"
     gene            complement(<368091..>368444)
                     /locus_tag="PAS_chr4_0180"
                     /db_xref="GeneID:8201089"
     mRNA            complement(<368091..>368444)
                     /locus_tag="PAS_chr4_0180"
                     /product="60S ribosomal protein L31"
                     /transcript_id="XM_002493540.1"
                     /db_xref="GeneID:8201089"
     CDS             complement(368091..368444)
                     /locus_tag="PAS_chr4_0180"
                     /codon_start=1
                     /product="60S ribosomal protein L31"
                     /protein_id="XP_002493585.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0180"
                     /db_xref="EnsemblGenomes-Tr:CAY71406"
                     /db_xref="GeneID:8201089"
                     /db_xref="GOA:C4R731"
                     /db_xref="InterPro:IPR000054"
                     /db_xref="InterPro:IPR020052"
                     /db_xref="InterPro:IPR023621"
                     /db_xref="UniProtKB/TrEMBL:C4R731"
                     /translation="MASAGLNDVVTREYTINLHKRLFGVQFKKRAPKAVKEIKKFAKL
                     HMGTEDVRLDPKLNMAVWKRGIKGVPFRMRLRISRKRNEDEDAKYKLFSYVEPVNVPT
                     VKGLETVVIEEDDEE"
     gene            <368758..>369762
                     /locus_tag="PAS_chr4_0923"
                     /db_xref="GeneID:8201090"
     mRNA            <368758..>369762
                     /locus_tag="PAS_chr4_0923"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493541.1"
                     /db_xref="GeneID:8201090"
     CDS             368758..369762
                     /locus_tag="PAS_chr4_0923"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493586.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0923"
                     /db_xref="EnsemblGenomes-Tr:CAY71407"
                     /db_xref="GeneID:8201090"
                     /db_xref="InterPro:IPR013951"
                     /db_xref="UniProtKB/TrEMBL:C4R732"
                     /translation="MSNIELPPISFINDSLPQNKVDTKTNILPHPAVLGIDRRKQSLS
                     ESGSLAPIIDILDRNNSPASSSKDTQIQISKERKVLEFGNDVDVDNSSIFRDIQELGF
                     PRKHLGFVVYNQLPTVNNVTHQLSIPYYPNVAEDNNKVYPLLPPNLTDYINCTIDVRI
                     PYFQTVNNQNVKIRQLWGTDLYTDDSDVVAMCYHDGILLGKAPFDTKIIDQHVVEMKE
                     RYNLELHDKSSEYIVKTPGNQKNPKSIIKIADGDATDLIVTLLILPTLTHYQGAFQNN
                     YNSRTFNNSHNGATISIYEVKYVPLNSIYKDLRSKLPEELDVAQVVNEVDFFSQSVKV
                     "
     gene            <370136..>370819
                     /locus_tag="PAS_chr4_0181"
                     /db_xref="GeneID:8200956"
     mRNA            <370136..>370819
                     /locus_tag="PAS_chr4_0181"
                     /product="High-affinity copper transporter of the plasma
                     membrane"
                     /transcript_id="XM_002493542.1"
                     /db_xref="GeneID:8200956"
     CDS             370136..370819
                     /locus_tag="PAS_chr4_0181"
                     /codon_start=1
                     /product="High-affinity copper transporter of the plasma
                     membrane"
                     /protein_id="XP_002493587.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0181"
                     /db_xref="EnsemblGenomes-Tr:CAY71408"
                     /db_xref="GeneID:8200956"
                     /db_xref="GOA:C4R733"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:C4R733"
                     /translation="MTTYFRHAGHDHSETSSTAVDLMMSMSTTTGSATSTETGMSDMT
                     GMSDMSDSSSHMGMNMYFTTSYLRYPVIFRDLKASNKGAAFGIFCVLFFAAFFLKGLF
                     FLSAYLEQKVFHNVQNSVIIQEVDNCACDDDSDPEKVLTEKTKNPHVLRQIFFPPVGE
                     LGKDFIRLIIAFVSAMFGYALMLAVMTFSLVYFFAVVLGIAFGEVFFNRVGIVLGTNK
                     NSALCGDLH"
     gene            complement(<370916..>371920)
                     /locus_tag="PAS_chr4_0182"
                     /db_xref="GeneID:8201091"
     mRNA            complement(<370916..>371920)
                     /locus_tag="PAS_chr4_0182"
                     /product="BAR domain-containing protein that localizes to
                     both early and late Golgi vesicles"
                     /transcript_id="XM_002493543.1"
                     /db_xref="GeneID:8201091"
     CDS             complement(370916..371920)
                     /locus_tag="PAS_chr4_0182"
                     /codon_start=1
                     /product="BAR domain-containing protein that localizes to
                     both early and late Golgi vesicles"
                     /protein_id="XP_002493588.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0182"
                     /db_xref="EnsemblGenomes-Tr:CAY71409"
                     /db_xref="GeneID:8201091"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:C4R734"
                     /translation="MSFKFPSLQSFGQSLQQTSQQLGQQIQEGIQNVSKEATSLNQNL
                     SPIFKRTQRSLQEKLGQIDDISALPEEYIDLEKKADALRIVYKKILAITSQYEIESYD
                     YPPNLKESVFDVTKTIGEKIQGLSHATTTAEAEAVLIAPAGNQYPKTFSHSLSKVVTA
                     SNDNLLKSQNDQESSLTQALLKLADTEYRIGDKRLEQDKLIINEFNNKIRYVLEHSFT
                     ETTKHRRNVETSRLTFDTIRAEIKKAQAGDDTAEVPAEMEKKLELAEDELVHSTEVAV
                     ESLKKLLQPTDSINLLKVFTKIRLNYYKSVSESLSELVDQLDALPEDEDDAEDARFTE
                     "
     gene            complement(<374727..>376580)
                     /locus_tag="PAS_chr4_0184"
                     /db_xref="GeneID:8201092"
     mRNA            complement(<374727..>376580)
                     /locus_tag="PAS_chr4_0184"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002493544.1"
                     /db_xref="GeneID:8201092"
     CDS             complement(374727..376580)
                     /locus_tag="PAS_chr4_0184"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002493589.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0184"
                     /db_xref="EnsemblGenomes-Tr:CAY71410"
                     /db_xref="GeneID:8201092"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="UniProtKB/TrEMBL:C4R735"
                     /translation="MRRAANSLLPNKNRLLKSLKLDFRSIREFYITLDEPHRSYHPGD
                     EVKGSIALVLDRDLVNLVVTLSLSGTVKIKNPTRASTLRGISKNITLFDHTISLYGDQ
                     QSNTNSGLSNGLSKGEHRFPFIVKLPKRNVFTSISFEKGSIRYGLKCAVGDKSTFSLL
                     SLASNINNSNILVCEKFINIVKPINVARLPALKPKTLVVKSPTRRLHRIKSSASSVVS
                     DQSNNSQGMNAADESNLTPDFSQTVDDLPKKTSSKSIKLSVEYPHLGYLPGESIPVKI
                     KLQHTKYIQNSNGIIVTLIRVCKFDFGPEGAVQTFRKDLSQAILPLVTDPNLHTGEVS
                     TSLKIPADVFPSIIGCPLVSFQYSVECVVNLSTTNSLKVFLGKTKFSPTDTKHLIDDE
                     NINDIVSYSHSLNNESIDENEGPDMSDNSLLGTSSIPTPTSDNNEDSPVKVYSVKQSS
                     TNYSSNTNNSNIFNVDKLKRLRDVITLNSEVVIGTYRRVERASRARSQASSMQNSPGD
                     IQEGVAFESTTAIRPNRQYEVTDSRHHYTQPPPLEEYPYSYPEPIEDSPIYSSLADEQ
                     YPSVPGQSGLTEKQILQIQENALLPSEPFIEPELNDSESLRVPELPASPEL"
     gene            complement(<377454..>378542)
                     /locus_tag="PAS_chr4_0185"
                     /db_xref="GeneID:8201093"
     mRNA            complement(<377454..>378542)
                     /locus_tag="PAS_chr4_0185"
                     /product="Nucleolar protein that binds nuclear
                     localization sequences"
                     /transcript_id="XM_002493545.1"
                     /db_xref="GeneID:8201093"
     CDS             complement(377454..378542)
                     /locus_tag="PAS_chr4_0185"
                     /codon_start=1
                     /product="Nucleolar protein that binds nuclear
                     localization sequences"
                     /protein_id="XP_002493590.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0185"
                     /db_xref="EnsemblGenomes-Tr:CAY71411"
                     /db_xref="GeneID:8201093"
                     /db_xref="GOA:C4R736"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R736"
                     /translation="MAKSSKVSSKSAAKASKGEKKSKKQESSSSESSSGSSSESSGSE
                     SESEEESVKESKKEANSSESESESESESEAESDKKEEAAESGSESESESESESEKEDE
                     KSAKRSAEESEEEPAKKAKTEEITTLFVGRLSWSIDDEWLKKEFEHIGGVVGARVMME
                     RATGRSRGYGYVDFDNKASAEKALEEMQGKEIDGRPINVDMSNSKPAAPAARNNDRAS
                     QYGDKRSPPSDTLFLGNLSFQADRDTLFELFSKHGNVTSVRIPTHPETEQPKGFGYVQ
                     FSSVDEATGALEALNGEYVDNRPIRLDYSTPRDPSASGGRGGRGGRGGRGGFRGGRGG
                     FSGDRSFGSGANSAPVNSGFQGQKKTFN"
     gene            complement(<378776..>382834)
                     /locus_tag="PAS_chr4_0186"
                     /db_xref="GeneID:8201094"
     mRNA            complement(<378776..>382834)
                     /locus_tag="PAS_chr4_0186"
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter"
                     /transcript_id="XM_002493546.1"
                     /db_xref="GeneID:8201094"
     CDS             complement(378776..382834)
                     /locus_tag="PAS_chr4_0186"
                     /codon_start=1
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter"
                     /protein_id="XP_002493591.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0186"
                     /db_xref="EnsemblGenomes-Tr:CAY71412"
                     /db_xref="GeneID:8201094"
                     /db_xref="GOA:C4R737"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R737"
                     /translation="MSSLNSSSKEDDSASLEKQILPEMARQKRLFSFLLPSTIPPLPT
                     DQERKPYPAGVQFSDIPYHQWVPAFISRIFFWWVVPLLKTGYVRTIFPNDLYYLERSL
                     KVEALADKFKKVYQKEVDKRASPNEPMKLTTFMKPLFKTIGVYYFYAIGFKIIFDCGT
                     TLAPLLTKELIKYVSLKSVGVEPGIGKGVGYALGASFLIIVPGICLNHSLYYSTLCGQ
                     VLYSVLNKMVLEKSFRLDGVAEHNYPIAKINSMLGTDLSRLELAFTFSPFMMTIPVTM
                     AIAITLLIINIGVSALAGLGMFFLCLVIVFSAIPLIIKIRIKIMGSTDKRVSHIKELA
                     NYLKFVKFYSWENSYFSSLTNARTTEMKYTFRMHAIRNSLTALAVSTPALSSMLAFVV
                     AHAVSRDRTPAEIFSSLSLFNVLSMIVFLLPMCLFLSADALLGLKRVCNFLQAPEAHL
                     YDEQETLKTDVALQAKNGTFYWETFENEDDTVAIDHKTTENNKAFSRLKNINLEVKKG
                     EFLVITGLIGTGKSSLLAALSGQMKRESGSVSHQGSLLLCGEPWIQNTTIRENIVFGQ
                     PFDETKYWEVIKCCALTQDLDMLDHGDITEVGERGITLSGGQKARINLARAVYNDRDI
                     LLMDDVLSAVDARVGKHIMDNCIMGLLHDKTRILATHQLSLISTADRICFLNGDGTID
                     VGTFEELSARNQNFTNLMVFNSESSESKDEEKELKLIKSTTLTIEEKLPRFHDINDGK
                     LMKKEQRAINGIPIDVYKTYISMGSGVFGKLFSPMFILVVAVTTFCQLFTNVWLSFWT
                     SNRFSHLSEGIYIGIYIMFTFLSMITVTTEYTLIAYLTNKASTKLNIAAMKRFLHVPM
                     SYLDTTPIGQIINRFTKDTDTLDNEIGEQFRMVVYPSANVIGVLIMCIAYLPWFAIAL
                     PFLFLLFLLICSFYQATAREVKRIESIQRSFVFSHVNEVLNGMHTIKSYQREDSFISK
                     NDLLLNNMNEASFITNVAQRWLAVILDTIGAGFAFLITMLCVTRQFDIGPSSVGLLVT
                     YLFQIVGQMSLLIRSITQLENNMNSVERLYEYSYNLPQEASYDSPSRPSPPSTWPENG
                     VIDFKDVSLRYRPGLPLVLKNINIHIPSRFRVGICGRTGAGKSSIMTALYRINELAGG
                     QIVIDDVDISTLNLYDLRSNLSIIPQDPVLFKGTIRKNLDPFGEKEDDVLWAALLKSG
                     IVESSSELEQVKLQKKKGQEELHKFHLDQVVEDEGSNFSLGERQLIALARAIVRDSKI
                     LILDEATSSVDYKTDAKIQSAIVREFNKCSILCIAHRLKTIVNYDRILVLEAGQVAEF
                     DTPWRLYHKSSGIFRAMCEKANIMEHDFDNRS"
     gene            <384342..>388298
                     /locus_tag="PAS_chr4_0188"
                     /db_xref="GeneID:8201095"
     mRNA            <384342..>388298
                     /locus_tag="PAS_chr4_0188"
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter"
                     /transcript_id="XM_002493547.1"
                     /db_xref="GeneID:8201095"
     CDS             384342..388298
                     /locus_tag="PAS_chr4_0188"
                     /codon_start=1
                     /product="Plasma membrane ATP-binding cassette (ABC)
                     transporter"
                     /protein_id="XP_002493592.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0188"
                     /db_xref="EnsemblGenomes-Tr:CAY71413"
                     /db_xref="GeneID:8201095"
                     /db_xref="GOA:C4R738"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R738"
                     /translation="MGQKLEKDGDLVLKKRWLTPLLLNKKVPPVPDPSERKSYPLHKT
                     NLLYRAGFWWLIPLLNIGYRRPLQPDDLYTLEDNEAHFLKVEDMHDRFQYYFNRRLEK
                     AYRSWESNGKKQTPFKYPDNILFWTLLETFKYEYVKANTWKFLGDVATALTPLLSREL
                     IKFVQMQPVLNSPVGKGIGYSFGIAALVLVRSFLQLHFFHDTGLTGAKVRALLTKLLL
                     DKSFRLSDKSRNLYPQGKITSILGADISRIDLAVTYFSFIWQFPVGLAIPIALLIVNI
                     GVSALAGVAVLILTLFTVIASVKPLLKFRKKASVHTDARVKSLKEILYNMKIIKFYSW
                     EIPYFNQVSEQRQKEMVQILKLLFSRNVVTAISINSTTVSSAVAFLTMFGERGMQSAA
                     DVFSSLQFFNVLSLQLVLLPMAFSTATDGYLGLKRLTEFLGAEEFYEDDLDDSSYNRS
                     SSEKDMLLEDVALKVEKGNFSWPSFELDQEDSVGLKDINLEVKKGEFLVITGLIGTGK
                     SSLLAALSGQMKRKSGSVSHQGSLLLCGEPWIQNTTIRENIVFGQPFDETKYWEVIKC
                     CALSQDLDMLDHGDMTEIGERGITLSGGQKARINLARAVYNDRDILLLDDVLSAVDAR
                     VGKHIMDNCVMGLLHDKTRILATHQLSLVSTADRICFLNGDGTIDVGTFEELSARNQN
                     FTNLMVFNTNETPETEDKQEIEREKESQPNRNFTEKEGKTMVQESRSDSLSKWEVIPI
                     FFKAGAQRFTLLLLLAIILTVVISAFLVVFCNVWLSYWVSYHFEHLTNGQYIGIYILL
                     TFLGVLMVILEFFFISYVVNKASQNLSLQGLNTLLHTPMSYLDVTPMGQILNRFTKDT
                     DTVDNEMADQLRLVVFGFSSIVAVLILCVVYLPWFAIAIPILVLFYCVMSNFYGASGK
                     EMKRIENIERSFVYNNFNECLTGMNTIRAYGMVDKFLTKNTRLLNRMNEAYYLTVAGQ
                     RFLAANLHFIATVMTLLVALLAVTQSFSISASSTGLLLSYTLQITGLLMMLTKSLTMV
                     QLQMTAIERLVECAIGLPQEAAYIKPGESEDDDTDEDNWLKRGEIEFDNVSIRYRPEL
                     PLVLKNISLKIASGQRIGICGRTGAGKSSIMTALYRINELASGRITIDNVDISTLGLH
                     NLRKRLSIIPQDPILFKGTIRKNLDPFGQKTDEELKVAMINSGVPSDPKFDLDSQVTD
                     GGGNFSNGERQLLALARATVRQSKILILDEATSSVDYETDSKIQTTIATQFNDCTILC
                     IAHRLKTILDYDNIVVVEKGEVAEYDTPLNLFNKNGIFRSMCDQSNISRGDFPTKN"
     gene            complement(<388441..>389394)
                     /locus_tag="PAS_chr4_0189"
                     /db_xref="GeneID:8201096"
     mRNA            complement(<388441..>389394)
                     /locus_tag="PAS_chr4_0189"
                     /product="Cyclin-like protein that interacts with Pho85p"
                     /transcript_id="XM_002493548.1"
                     /db_xref="GeneID:8201096"
     CDS             complement(388441..389394)
                     /locus_tag="PAS_chr4_0189"
                     /codon_start=1
                     /product="Cyclin-like protein that interacts with Pho85p"
                     /protein_id="XP_002493593.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0189"
                     /db_xref="EnsemblGenomes-Tr:CAY71414"
                     /db_xref="GeneID:8201096"
                     /db_xref="GOA:C4R739"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C4R739"
                     /translation="MFYSGYNQAPPPLMGHHQTESVGYHHHQRQYSSHLGSSYLPNNN
                     YDMYNNGQLFGVQNQPPAPVHQVAQNNNKSVSNAMSYDIETMVDFVCVMTHFKTPSSL
                     SSVLYATNLPETTIFGALIYYNQLVDPSETDNDYTIFTNLVLAFMVSNKYMDDQTFTN
                     RSWSNASGLPIELLNSMERDWLNRLSWNLSINERYHQMENIYFNYLSQRICSSSVNSS
                     YMAAQVSYNSGRVQSPLANSYEFQQPHPVDYYNLYYPQVPMNPHSYQNGPMYPGPPLA
                     TSQVHMDPGARNYYGSYYTPHSGMMSPYSYNKPANSGLVAF"
     gene            <390380..>391303
                     /locus_tag="PAS_chr4_0190"
                     /db_xref="GeneID:8201097"
     mRNA            <390380..>391303
                     /locus_tag="PAS_chr4_0190"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493549.1"
                     /db_xref="GeneID:8201097"
     CDS             390380..391303
                     /locus_tag="PAS_chr4_0190"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493594.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0190"
                     /db_xref="EnsemblGenomes-Tr:CAY71415"
                     /db_xref="GeneID:8201097"
                     /db_xref="InterPro:IPR021750"
                     /db_xref="UniProtKB/TrEMBL:C4R740"
                     /translation="MNIHKKKYPNNGASVVADRSPLTSPSRENSYKYLSSDEDSLLSH
                     DLVGRDEVIDYDRLHRFLRRSNNLPKQDVKTPLVRERAAQMPLSHSTPMNLHYQEPKS
                     HNNPGQRIAELVSDVSEEGDNGSTTNLLTPPGTHDSSMTIKEGEHETQTDDKDEQIRR
                     LKEMIDHKDSLIFTLKEQSTEKDSKIAKINQQLQESKTLNSKLVHQLATRIGKVRSLN
                     KSDFEGDKYNELGLAVVDNLSLRRLQNFVKQMLVDLNVPYARIDSIVEHHLVLQSFVQ
                     DLHRMIYSNSIDPKLTKQCCQGMNAYIKRHL"
     gene            complement(<391316..>393061)
                     /locus_tag="PAS_chr4_0191"
                     /db_xref="GeneID:8201098"
     mRNA            complement(<391316..>393061)
                     /locus_tag="PAS_chr4_0191"
                     /product="Malate synthase"
                     /transcript_id="XM_002493550.1"
                     /db_xref="GeneID:8201098"
     CDS             complement(391316..393061)
                     /locus_tag="PAS_chr4_0191"
                     /codon_start=1
                     /product="Malate synthase"
                     /protein_id="XP_002493595.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0191"
                     /db_xref="EnsemblGenomes-Tr:CAY71416"
                     /db_xref="GeneID:8201098"
                     /db_xref="GOA:C4R741"
                     /db_xref="InterPro:IPR001465"
                     /db_xref="InterPro:IPR006252"
                     /db_xref="InterPro:IPR011076"
                     /db_xref="InterPro:IPR019830"
                     /db_xref="UniProtKB/TrEMBL:C4R741"
                     /translation="MTPQQTYINPQSPQIYRFITKMAAPRTYGSLEGVQLYGKVDSTP
                     LYDSPITPADILTKDALKFVVLLHRTFNSTRKELLENRQKVQAKLDKGEKLTFLPETK
                     YIRDDPNWKCKAPAPGLTDRRAEITGPPERKMVVNALNTDVYTYMTDFEDSCSPTWSN
                     IIYGQVNLYDALRDQIDFTLPATGKSYKVKKEGRNPPTIIVRPRGWHMVESHVTVDGE
                     PISASLFDFGLYFFHNARQLLDNGVGPYFYLPKMEHWLEAKLWNDVFNVAQDALAIPR
                     GTISATVLIETLPISYQLNEVLYALRDHSAGLNCGRWDYMFSTIKRLRNDPKHILPDR
                     GLVTMKVPFMTNYVKQLIKVCHQRGVHAMGGMAATIPIKNDAERNAKAMQAVHDDKLR
                     EVLAGHDGTWIAHPALAPIALEVFNKHMPTPNQLHKIPVYDREVTEEDLVDTNIDGFK
                     ITKDGILINIYIGLNYMEAWLQGSGCVSINHLMEDAATAEVSRLQLFSWVKHGVKLTD
                     TGEKITKDLVVKLIDDEVAKLSPSRPNNKFDIAADCLKKEISGEVEVAEFLTDLLYPD
                     VVTLESSPVDLDSLK"
     gene            complement(<393652..>395157)
                     /locus_tag="PAS_chr4_0192"
                     /db_xref="GeneID:8201099"
     mRNA            complement(<393652..>395157)
                     /locus_tag="PAS_chr4_0192"
                     /product="Flavin-containing monooxygenase"
                     /transcript_id="XM_002493551.1"
                     /db_xref="GeneID:8201099"
     CDS             complement(393652..395157)
                     /locus_tag="PAS_chr4_0192"
                     /codon_start=1
                     /product="Flavin-containing monooxygenase"
                     /protein_id="XP_002493596.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0192"
                     /db_xref="EnsemblGenomes-Tr:CAY71417"
                     /db_xref="GeneID:8201099"
                     /db_xref="GOA:C4R742"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:C4R742"
                     /translation="MKAKHSDSFAIIGAGPSGLSAIKGLHKELGPDFDKVKIKVFDRR
                     DKIGGLWNYIPNPDPIPTRKEIEEERGLNEQLQKLENIAEGEEVVTDQSKKPVAYNTS
                     GIYNYLQTNLPSVVMQFSYNPLKPEDVKETLLKDNYLFKGYEGDYEKYPFRHYTSVYQ
                     YIRDTFDQFLDKVQLNTNIERVQKDPETGKWKLTIRQFKDGKDVWSIEYFDSVIVCVG
                     QNNIPYIPANIEDAVEQIRAENPDLIEHSQTFRRIEDYKGLKLVVVGASYSACDFISD
                     VYPICQLPINVVTRGGEMKEYPFRKPIYEGDEKNINITHEITTLEKDSNGKLRITTKD
                     GQILEDVDKLIIATGYKHYFPFLKEEDGLNLINKNGRVSQLYQHIFYIPDPSLTFLSV
                     ANGTYTFTVFEYQSALIARFLTGKVELPEREEQEAWIQNRVNLKSDTTFFHMIPYEEA
                     GEYFQDLVRLAADPELTFDSDKIYNATKAGQELKSKYWARNKEIRKLGTSA"
     gene            complement(<395886..>396785)
                     /locus_tag="PAS_chr4_0193"
                     /db_xref="GeneID:8201100"
     mRNA            complement(<395886..>396785)
                     /locus_tag="PAS_chr4_0193"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493552.1"
                     /db_xref="GeneID:8201100"
     CDS             complement(395886..396785)
                     /locus_tag="PAS_chr4_0193"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493597.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0193"
                     /db_xref="EnsemblGenomes-Tr:CAY71418"
                     /db_xref="GeneID:8201100"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="UniProtKB/TrEMBL:C4R743"
                     /translation="MLRIGYIPEHFSTPIWFAKEKGFFENSGVEVELIPYPSGSGHLI
                     QSLKNDEIDIAVGLTEAFVAGICKNDTQYKIAGTYVESPLCWAISSGVNRTDINSPEE
                     LHGKRIGVSRIGSGSYIMSFVLALQSEFSRPYYKSFPVLHNFANLRDSVNLKDGVEPS
                     DAFMWEHFTSKRYYDNGEIKRIGEIYTPWPSWVIVGSSKLDQTQLQRALRAVQEGVDY
                     FEEHKTEAVEHISTHLDYSKEDAMEWLKTVKFSGDVTRVDYNRSIVNTARILKTAGVI
                     QQENEPDEVIDERLAAGISASKD"
     gene            <397051..>399768
                     /locus_tag="PAS_chr4_0194"
                     /db_xref="GeneID:8201101"
     mRNA            <397051..>399768
                     /locus_tag="PAS_chr4_0194"
                     /product="Catalytic subunit of the Dcp1p-Dcp2p decapping
                     enzyme complex"
                     /transcript_id="XM_002493553.1"
                     /db_xref="GeneID:8201101"
     CDS             397051..399768
                     /locus_tag="PAS_chr4_0194"
                     /codon_start=1
                     /product="Catalytic subunit of the Dcp1p-Dcp2p decapping
                     enzyme complex"
                     /protein_id="XP_002493598.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0194"
                     /db_xref="EnsemblGenomes-Tr:CAY71419"
                     /db_xref="GeneID:8201101"
                     /db_xref="GOA:C4R744"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR007722"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:C4R744"
                     /translation="MSIQLRDGFINESQDKVLEDLLVRFVVNCPPEDLSSIERVFFQI
                     EEAQWFYTDFVRQLNPQLKNLSMKTFSQKIIEKCPLIWRWGNPEDALVRFGKYKSTIP
                     VRGCALFNSDYTKLLLVQGYQSKSWGFPRGKISKAESDLTCALRELKEETGFDASNYI
                     DENEYIERTIKGKNYRIYLVSDVPEDTPFEPLVRNEISDIQWKDVKKLSVACKNSNKL
                     FLVDAMIKPILNFIKRKTSSEDYLKQKATFELSSLLGIGEEEETADYGRELMNIIQQM
                     VLKDKSQSNAPQKEISSQQYPHPQPNFPDISNTNINNSVPIPVFPNFPFIQNLPPQQI
                     PAFMNGQLPPLPFLAQPFPYIPGGMPPTAMFPPAMPQQQQQQQPNGPPFVPQDTGPKP
                     ETFNRPTFYRSKEADASQLLDILRNPAPSPAPPSATQTESKNSAELLSILKQPNSNTA
                     NLTENTMKQFNKDVSSTPKEQSEILLKYLNESSTDRNSIPTRVPSTPPTTGATSSKNR
                     IRILKRGTALDDLSTRTVEQGSHIDESFMKEVSFNSDNRQNDNSSTSSKTISRIAPSK
                     RGTDAPKSPFLNGPSVPQITQSGNDNDDDEFGDFNQLHEQHYSENDSQIDLYEGLDSD
                     MDEYVPPPKVQAASVVQSISASKNAIQPSDVNKCKKSKEKKEAQVAVEPVKARKKITI
                     LKKGDSLEELLRRSNEGTPEPQSFKPTEASVDLDATKDLTNILFQKSQSNENQSAEPP
                     KEQPLKSNPIPQPNGNSGSQLGLLGLVKQNTALNGNSSELLDMLKRPSFREESPAKSN
                     GSSELLDILQRREPSIPPTEPPAPANSSLELLSILKSPDQQKKSEDSSELLSVLKGNV
                     QDNEPVINNEIRKETSNGSSELLGILKGNSSSSAELLGMLKGSNSVAHI"
     gene            <400432..>401670
                     /locus_tag="PAS_chr4_0195"
                     /db_xref="GeneID:8201102"
     mRNA            <400432..>401670
                     /locus_tag="PAS_chr4_0195"
                     /product="Essential serine kinase involved in the
                     processing of the 20S pre-rRNA into mature 18S rRNA"
                     /transcript_id="XM_002493554.1"
                     /db_xref="GeneID:8201102"
     CDS             400432..401670
                     /locus_tag="PAS_chr4_0195"
                     /codon_start=1
                     /product="Essential serine kinase involved in the
                     processing of the 20S pre-rRNA into mature 18S rRNA"
                     /protein_id="XP_002493599.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0195"
                     /db_xref="EnsemblGenomes-Tr:CAY71420"
                     /db_xref="GeneID:8201102"
                     /db_xref="GOA:C4R745"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="UniProtKB/TrEMBL:C4R745"
                     /translation="MKLDISHMRYLTNDDFRVLIAVELGSRNHEVVPTPMIHQIGGLR
                     SPSTTNRSISDLAKLSLISKLRNAKYDGYRLSYLGFDYLALKSMLKKGSLYSMGSPIG
                     VGKESDIYLVSDPKGVEKVLKVHRLGRTSFKTVKRNRDYLKNRQSCNWMYLSRLAAEK
                     EYMFMSILYSNGFSVPEPFDSSRHCIIMEWIRGVTMRRLRTHKDYKKLYSELMRFAVN
                     LANHGLIHCDFNEFNVIIRDDPKPDEPGFVVIDFPQCISIEHPDASFYFKRDIECIRK
                     FFRKVFNYGPTSDTSMMDEDGFGEGFKYAYPVFERDVKRINNLDVLVEASGFKKNKKN
                     SDLETAVQGMREYTYEEEEGEGSTEEESDYEDSLEFDDSKSEGEQSDLAEENERIVQA
                     LTSGVENLKMDKLGNYILDD"
     gene            <401967..>402296
                     /locus_tag="PAS_chr4_0924"
                     /db_xref="GeneID:8201103"
     mRNA            <401967..>402296
                     /locus_tag="PAS_chr4_0924"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493555.1"
                     /db_xref="GeneID:8201103"
     CDS             401967..402296
                     /locus_tag="PAS_chr4_0924"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493600.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0924"
                     /db_xref="EnsemblGenomes-Tr:CAY71421"
                     /db_xref="GeneID:8201103"
                     /db_xref="GOA:C4R746"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR011171"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C4R746"
                     /translation="MEALIYHIDTSSYEIKAETDVITSLEDLVDEVPDSSPRFILLSY
                     PITLQDGRKSSPLVLVYFRPQTSTQEGKMLYAGAVELFRNKAGVSKVLDIDEEEELLD
                     IPDLLQH"
     gene            complement(<402351..>403886)
                     /locus_tag="PAS_chr4_0196"
                     /db_xref="GeneID:8200957"
     mRNA            complement(<402351..>403886)
                     /locus_tag="PAS_chr4_0196"
                     /product="Folylpolyglutamate synthetase, catalyzes
                     extension of the glutamate chains of the folate coenzymes"
                     /transcript_id="XM_002493556.1"
                     /db_xref="GeneID:8200957"
     CDS             complement(402351..403886)
                     /locus_tag="PAS_chr4_0196"
                     /codon_start=1
                     /product="Folylpolyglutamate synthetase, catalyzes
                     extension of the glutamate chains of the folate coenzymes"
                     /protein_id="XP_002493601.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0196"
                     /db_xref="EnsemblGenomes-Tr:CAY71422"
                     /db_xref="GeneID:8200957"
                     /db_xref="GOA:C4R747"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="UniProtKB/TrEMBL:C4R747"
                     /translation="MGQPDMPLHRSYKDAIRALNSLQSNYATIEAIRKSGNNRSANNI
                     PEMVEWTRRIGYSPTEFNRLNIIHVTGTKGKGSTCAFVQSILKRYKNKDFATASRNSS
                     SSTLASSRSNELEKPHITKVGLYSSPHLKSVRERIRINGKPLTEDLFTKYFFEVWDRL
                     ENSESNPSTFPQLSPGLKPAYFKYLTLLSFHVFMSENVDSAIYEVGVGGEFDSTNIIE
                     KPTVTGVSALGIDHTFMLGNTLTDIAWNKSGIFKEGVPAVSVPQPEEGMNELVRRAEE
                     RKVKFFKVVPDRDLSDIKLGLAGAFQKENANLAIELAAIHLQKLGFKVDVKDDLPDEF
                     VEGLSSATWPGRCQIIEEPENQITWYLDGAHTKESIEASSQWFTEKQTKSDQTVLLFN
                     QQTRDGEALIKQLHGVVYPKLKFNHVIFTTNLTWSDGYSDDLVSLNISKEEIDNMDVQ
                     KALAETWNSLDKASRKHIFHDIETSINFIRSLEGSVDVFVTGSLHLVGGFLVVLDRKD
                     LPN"
     gene            complement(<404230..>405432)
                     /locus_tag="PAS_chr4_0197"
                     /db_xref="GeneID:8201104"
     mRNA            complement(<404230..>405432)
                     /locus_tag="PAS_chr4_0197"
                     /product="Small subunit of the ribonucleotide-diphosphate
                     reductase (RNR) complex"
                     /transcript_id="XM_002493557.1"
                     /db_xref="GeneID:8201104"
     CDS             complement(404230..405432)
                     /locus_tag="PAS_chr4_0197"
                     /codon_start=1
                     /product="Small subunit of the ribonucleotide-diphosphate
                     reductase (RNR) complex"
                     /protein_id="XP_002493602.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0197"
                     /db_xref="EnsemblGenomes-Tr:CAY71423"
                     /db_xref="GeneID:8201104"
                     /db_xref="GOA:C4R748"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:C4R748"
                     /translation="MSVQETPTKGAKAALSNLDINLSKKDLTSVLQAAADQKEKVNAP
                     VKEESKLDDDHKAFLAKHKVHRHKLKEMEKDEPLLVENKRRFVLFPLKYHDIWQMYKQ
                     AEASFWTAEEIDLGKDLHDWNNRMNDNEKFFISRVLAFFAASDGIVNENLVENFSAEV
                     QLPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESEFLFNAIETIPCIKEKADWAM
                     RWISDDDALFAERLVAFAAVEGIFFSGSFASIFWLKKRGLMPGLTFSNELICRDEGLH
                     TDFACLLFSHLNNRASEEIVEKIITEAVEIEKRYFTDALPVSLLGMNCSLMCQYVEFV
                     ADRLLVALGNKKVYNVNNPFDFMENISLAGKTNFFEKRVSDYQKAGVMASTDKTSNDD
                     AFAFDEDF"
     gene            complement(<405823..>406475)
                     /locus_tag="PAS_chr4_0198"
                     /db_xref="GeneID:8201105"
     mRNA            complement(join(<405823..406056,406092..>406475))
                     /locus_tag="PAS_chr4_0198"
                     /product="C-8 sterol isomerase"
                     /transcript_id="XM_002493558.1"
                     /db_xref="GeneID:8201105"
     CDS             complement(join(405823..406056,406092..406475))
                     /locus_tag="PAS_chr4_0198"
                     /codon_start=1
                     /product="C-8 sterol isomerase"
                     /protein_id="XP_002493603.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0198"
                     /db_xref="EnsemblGenomes-Tr:CAY71424"
                     /db_xref="GeneID:8201105"
                     /db_xref="GOA:C4R749"
                     /db_xref="InterPro:IPR006716"
                     /db_xref="UniProtKB/TrEMBL:C4R749"
                     /translation="MNLYKWFFSLALVYAFLEISFRTWLPNNYVFDKKLLQTLSQEAL
                     ARHPDGNATNILIDLAGTIKEEYGDIINDLNFEEWVYNNAGGAMGTMFILHASISEYL
                     IFFGTAIGTEGHTGVHYADDYFTILKPEVYLPGSQHHLPKGHVKQYAMPSESWALELA
                     QGWIPAMLPFGFLDTISSTLDLNTFMWTAYYTARDMGKNLAKGKF"
     gene            <406766..>408994
                     /locus_tag="PAS_chr4_0200"
                     /db_xref="GeneID:8201106"
     mRNA            <406766..>408994
                     /locus_tag="PAS_chr4_0200"
                     /product="Cytoplasmic component of the nuclear
                     aminoacylation-dependent tRNA export pathway"
                     /transcript_id="XM_002493559.1"
                     /db_xref="GeneID:8201106"
     CDS             406766..408994
                     /locus_tag="PAS_chr4_0200"
                     /codon_start=1
                     /product="Cytoplasmic component of the nuclear
                     aminoacylation-dependent tRNA export pathway"
                     /protein_id="XP_002493604.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0200"
                     /db_xref="EnsemblGenomes-Tr:CAY71425"
                     /db_xref="GeneID:8201106"
                     /db_xref="GOA:C4R750"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R750"
                     /translation="MNFLAKTVASLSGGFSSIPYNFGDVIVTGVENDIYSNSIWNVYK
                     GTSKSDKTVNCSIFMVDTKSVTDELFVDMIGNAFKFSKVLKLPGVLNVLHASNNDSHY
                     YIVTEQAIPLDKYLSQNDLTSEQLLFGLYNISEALKFINVEGATAHCNVNRHSIFVTE
                     SGEWKLFGFELATNAQNISTSLVPMGFRLPSFKDTLAPPEYLKDSQTCVQSLLQAIKI
                     DAWQLGVLTYELFNDVKMTDSSLMNSFTKIPKNLVPYLRKLLSPSVASRCSPQQFFEV
                     GTSTFFKSPLVDMVKILNEFSLAADHEKLAFFQNLQTEEITPPNGFLENKVLPHLLTF
                     FKQTTQENKPMLLHLILKLSLTIPKERFTDHIKPVILEMIHVPDRSIRMTLLTTLPLY
                     VEKLDKQDINNRFFAAFLTGFNDSNVAIREETIKSSVLLAPFLNERPLNNELLRYLAK
                     TQMDEAAEIRSTTILCLNKIASHLSVGSRSNVLIIAFSKSIRDPHIPSRLNALTAFND
                     NIDLFTPEECCSRVLSAIAPLLLDKFSTIRSECDRVFKLYMEKIEKAAKEIPDDTDDA
                     IELVNDEMNKQENLKEQIGSFGDFGWSALTNITNKIGGTLNAEVNQVTPGPSQAQTPT
                     QSFTNLPSQVLQPTISKATEDDSWNFDMEKEPSSQRFNTEEKLPQHRSKPITLGKKSL
                     SLKTLSLKPNANTPNTKISNKMDQNAWDDDNDNWDNDFEFGDNNIEGEEAEEDEGWGD
                     QW"
     gene            complement(<409081..>411134)
                     /locus_tag="PAS_chr4_0201"
                     /db_xref="GeneID:8201107"
     mRNA            complement(join(<409081..409460,409901..>411134))
                     /locus_tag="PAS_chr4_0201"
                     /product="Essential ATP-dependent RNA helicase of the
                     DEAD-box protein family"
                     /transcript_id="XM_002493560.1"
                     /db_xref="GeneID:8201107"
     CDS             complement(join(409081..409460,409901..411134))
                     /locus_tag="PAS_chr4_0201"
                     /codon_start=1
                     /product="Essential ATP-dependent RNA helicase of the
                     DEAD-box protein family"
                     /protein_id="XP_002493605.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0201"
                     /db_xref="EnsemblGenomes-Tr:CAY71426"
                     /db_xref="GeneID:8201107"
                     /db_xref="GOA:C4R751"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R751"
                     /translation="MTYNNGGYDNGSYGNGGGYNNGGFNGGFRGGRGGGNYDSYDSFG
                     SNLKVQEWDLDKMPKFEKNFYNEHPDVTARTQEDVEAFRKEHDMNCYGKDIPKPITSF
                     DEAGFPDYVLTAVKAQGFPSPTAIQCQGWPMALGGKDMVGIAATGSGKTLSYCLPAIV
                     HINAQPLLKPGDGPVALVLAPTRELAVQIQKECSKFGSSSRIRNTCVYGGVPKGQQIR
                     DLARGAEIVIATPGRLIDMLETGKTNLRRVTYLVLDEADRMLDMGFEPQIRKIVDQIR
                     PDRQTLMWSATWPKSVQALARDYLHDYIQVNVGSLELAASHNIKQVIEVLSEYEKRDR
                     LTKYLEQASEDKTSKILVFASTKRTCDELTTYLRSDGWPALAIHGDKEQRERDWVLQE
                     FRSGKSPIMVATDVAARGIDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAVSF
                     FTNANARMADDLVPILKEANQIIPEDLQAMCRRRGGFGGGRGGRGGRGGRGGRGGRGG
                     YGGNRGFGGGNGGYRSSGANNAPLPNRKF"
     gene            complement(<411421..>411831)
                     /locus_tag="PAS_chr4_0925"
                     /db_xref="GeneID:8201108"
     mRNA            complement(<411421..>411831)
                     /locus_tag="PAS_chr4_0925"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493561.1"
                     /db_xref="GeneID:8201108"
     CDS             complement(411421..411831)
                     /locus_tag="PAS_chr4_0925"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493606.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0925"
                     /db_xref="EnsemblGenomes-Tr:CAY71427"
                     /db_xref="GeneID:8201108"
                     /db_xref="GOA:C4R752"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:C4R752"
                     /translation="MANEENISKSKPEEMDIDEVEQNVEEDVEVQSNKITLLPGASED
                     GTAASFQILDEDHTLGNSLRYIIIKNPEVEYCGYSIPHPSEAKLNIRIQTYGGMTAVE
                     ALRKGLDDLVDICDHVEKKFSDVIAAGDYSTEEP"
     gene            <412344..>414689
                     /locus_tag="PAS_chr4_0202"
                     /db_xref="GeneID:8200958"
     mRNA            <412344..>414689
                     /locus_tag="PAS_chr4_0202"
                     /product="Zinc-finger transcription factor"
                     /transcript_id="XM_002493562.1"
                     /db_xref="GeneID:8200958"
     CDS             412344..414689
                     /locus_tag="PAS_chr4_0202"
                     /codon_start=1
                     /product="Zinc-finger transcription factor"
                     /protein_id="XP_002493607.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0202"
                     /db_xref="EnsemblGenomes-Tr:CAY71428"
                     /db_xref="GeneID:8200958"
                     /db_xref="GOA:C4R753"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R753"
                     /translation="MQSIHTNTESAPTVPPNNDSYRMSPNSKTPGDSDKEQAGENANN
                     SRSGMDPSHSNTGNNSTGAIVNQAVSDIDHSAFPRNDSLSQFFPRFSFDSNASNSLSM
                     SFGGDGTPSFSYNSNSELPRGYSVVGPALNNVSFNKKGSTSKETKSKPPNNEVYALPY
                     QGSDYFNRRPSDQLDPFIPSLQSSRSRQGSMLHRPRQMSILASNTGGESQSDFDSFLR
                     KDGFKGMLVDQGDLLDNIGNFDGQYHRNSILPFPRLSISAPSNQGLYGNQTPPFAPQT
                     TGVQQNTNPNQYQNQNQLNYRGKPGPYIKTDPTKQDDEERRGPQDATQPKQEYTFNSK
                     VASKEPSLSPSPAASYPPEDKKAHTQQNATGSINVNNSINNVQGSKQFQYQQVPTAGQ
                     YYTQNPPLPSQNDQGQHITQVPQIPSHPLAPDHLQQQQQQQPQQQQQQPQQQAYGRQQ
                     NYSMSQYQPKANMYYQQYPQSGFQYPNTSNTQIPMTPQNQQQNRSTKKAKTIQSQSAI
                     ASPRDLSPGSPPTSGNETVRPLVGATKIDQLMLVIQARNKGITKPIARAPDGSIIEDE
                     TVIPKVNDLVGGIEKPHSKGSKQHECPHCFKKFTQATHLEVHIRSHIGLKPYACEYCG
                     KRFTQGGNLRTHLRLHTGEKPFECNTCHKKFSRKGNLQAHRLTHENFKPFVCKLDDCN
                     KTFTQLGNLKAHQNRFHFESLNMLTTKLASLSASGEEDLQTAFNKLPQQERELLEYFS
                     NLYKNLNRGIRGRGGGAHSPQQQLPQEEEKQVDQQQNYYMT"
     gene            complement(<414815..>417784)
                     /locus_tag="PAS_chr4_0203"
                     /db_xref="GeneID:8201109"
     mRNA            complement(<414815..>417784)
                     /locus_tag="PAS_chr4_0203"
                     /product="Proposed transcriptional activator, member of
                     the Gal4p family of zinc cluster proteins"
                     /transcript_id="XM_002493563.1"
                     /db_xref="GeneID:8201109"
     CDS             complement(414815..417784)
                     /locus_tag="PAS_chr4_0203"
                     /codon_start=1
                     /product="Proposed transcriptional activator, member of
                     the Gal4p family of zinc cluster proteins"
                     /protein_id="XP_002493608.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0203"
                     /db_xref="EnsemblGenomes-Tr:CAY71429"
                     /db_xref="GeneID:8201109"
                     /db_xref="GOA:C4R754"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R754"
                     /translation="MPPKHRLEQSIQPMASQQIVPGNKVILPNPKVDAKSTPNISVQK
                     RRRVTRACDECRKKKVKCDGQQPCIHCTVYSYECTYSQPSSKKRQGQSLSLSAPSNIN
                     ATSSVQKSVKPPEIDFQRMRDALKYYEDLLNQLIYPNSAPTVRVNPIRLASILKQLRA
                     DKSSDELISVKALSDNYIEMLHKTMQQPVQQPAPPSLGQGGSFSNHSPNHNNASIDGS
                     IESNLGREIRIILPPRDIALKLIYKTWDNACVLFRFYHRPAFIEDLNELYETDLANYT
                     NKQQRFLPLVYSVMACGALFCKTDGINHGQKSSKPKDSSDESLIDDEGYKYFIAARKL
                     IDITDTRDTYGIQTIVMLIIFLQCSARLSTCYSYIGIALRAALREGLHRQLNYPFNPI
                     ELETRKRLFWTIYKMDIYVNTMLGLPRTISEEDFDQEMPIELDDENISETGYRFDLQG
                     TKLSSSGIANAHTRLIFIMKKIVKKLYPVKLQKPTSNSGDTPLENNDLLAHEIVHELE
                     MDLQNWVNSLPAELKPGIEPPTEYFKANRLLHLAYLHVKIILYRPFIHYISEKDKVGN
                     SSIPPSPEEITSIEKAKNCVNVARIVVKLAEDMINRKMLSGSYWFSIYTIFFSVACLV
                     YYVHFAPPKKDNGELDPQYMEIKKDTESGREVLNILKDSSMAARRTYNILNSLFEQLN
                     RRTAKVNLAKAQQPPSGLNNPAATQYQKQGEHRQLQPSNYSGTVKSVDPENIDYSSFG
                     SQFENTNIEDGSSNTKIDQKVNGVNYIDGVFTGINLNMPNLSETSNTQGIDNPAFQSI
                     NNSNLNNNFVQTKYIPGMMDQLDMKIFGRFLPPYMLNSNKVEQGQNERNLSGQPSSSN
                     TPDGSQPVTVLDGLYPLQNDNNNNHDPGNSKSVVNNSNSVENLLQNFTMVPSGLSSTV
                     QNPEAAQKFNNHMSNISNMNDPRRASVATSDGSNDMDHHSQGPINKDLKPLSNYEFDD
                     LFFNDWTTAPDTINFDS"
     gene            <418396..>419346
                     /locus_tag="PAS_chr4_0204"
                     /db_xref="GeneID:8201110"
     mRNA            <418396..>419346
                     /locus_tag="PAS_chr4_0204"
                     /product="Subunit of TFIIH and nucleotide excision repair
                     factor 3 complexes"
                     /transcript_id="XM_002493564.1"
                     /db_xref="GeneID:8201110"
     CDS             418396..419346
                     /locus_tag="PAS_chr4_0204"
                     /codon_start=1
                     /product="Subunit of TFIIH and nucleotide excision repair
                     factor 3 complexes"
                     /protein_id="XP_002493609.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0204"
                     /db_xref="EnsemblGenomes-Tr:CAY71430"
                     /db_xref="GeneID:8201110"
                     /db_xref="GOA:C4R755"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004575"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015877"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="UniProtKB/TrEMBL:C4R755"
                     /translation="MDTEEYCPICKTDKYLSPDMKFLINPECYHKICESCVDRFYSLG
                     PSKCMYPNCNKILRRNKFKTQVFDDLSIEKECDVRSRVMKVFNKNEEDFSDLKDYNQY
                     LEEIEDIVNNLVNNVDIEETEKKLKDYELLNQKEILENNTKQVEKDQIQADLTKLETQ
                     LKQEKRRHEKQTAEEDKLLKKANEAALIDQMQNESAQPPQAVRMHNTNVLRKSSARKK
                     HIKELEEQINMHRRALGAGGHGIESSVPPQTPFTPFNGDKDRTKYYQFQDNYYDPIFN
                     DMVSKDPTFTASGYDIKKYFKRSLAEAFTGLNIFVSEEIS"
     gene            <419632..>421419
                     /locus_tag="PAS_chr4_0205"
                     /db_xref="GeneID:8200877"
     mRNA            <419632..>421419
                     /locus_tag="PAS_chr4_0205"
                     /product="Forkhead family transcription factor with a
                     major role in the expression of G2/M phase genes"
                     /transcript_id="XM_002493565.1"
                     /db_xref="GeneID:8200877"
     CDS             419632..421419
                     /locus_tag="PAS_chr4_0205"
                     /codon_start=1
                     /product="Forkhead family transcription factor with a
                     major role in the expression of G2/M phase genes"
                     /protein_id="XP_002493610.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0205"
                     /db_xref="EnsemblGenomes-Tr:CAY71431"
                     /db_xref="GeneID:8200877"
                     /db_xref="GOA:C4R756"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:C4R756"
                     /translation="MSSPRKRPIDDDLNGIPFQDDPVELINQVTLTLTTPPDGIPTNV
                     SLEYNNSKNVQNEIQAYAKISGCDWTFYVKSLNVVIGRNTEFNQNGYGDEETKVDIDL
                     GPSKVVSRKHASINYNLNSRKWELKILGRNGLKIDGIRYSYSKDEGAVTELKSGNIID
                     VGGTQMMFILPDSSPVIAKQFLLNLKNKKLKNSDSSTMLNKMPTEYHQQYNFYNNTLK
                     GFQLYNKQIPPQELSKPQSSSISYDQLSQQNQTQQSMIELDSEQDLSKDDAKDIKPPY
                     SYATMITQAILTNEQGILSLSEIYDWISSHYSYYRFSKTGWQNSIRHNLSLNKAFEKV
                     PRRPNEPGKGMKWQISEAYKQDFMKKWRDGTLNKVRRGSSVTRQLQLHLIKNKRLPES
                     RPTTGSGPILQVNPSAPSSLPASAPQLPPMNQTIPFATHDVNSLNYINKAGSHLSSPM
                     KYSNFQPNNVNSVGQGQPGPLPLPNSQPIVRRPESSQERSTQVSRTLQSAQATNGTSS
                     TDLANYPASPQKRFLTEAYTPERSKDKNGTQNSSPALWNFVQFSTPIGPDSKDNKSPV
                     NSPTATKNESTQNALSDLKNIDLAKGFKN"
     gene            <421685..>422362
                     /locus_tag="PAS_chr4_0206"
                     /db_xref="GeneID:8200878"
     mRNA            <421685..>422362
                     /locus_tag="PAS_chr4_0206"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493566.1"
                     /db_xref="GeneID:8200878"
     CDS             421685..422362
                     /locus_tag="PAS_chr4_0206"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493611.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0206"
                     /db_xref="EnsemblGenomes-Tr:CAY71432"
                     /db_xref="GeneID:8200878"
                     /db_xref="UniProtKB/TrEMBL:C4R757"
                     /translation="MDNSNDGIKLLFISGHRVLLEPQVLCEYAGVSDLNFVTIASVLG
                     YILEHWKEVGDVEEAPQSVEQIHLLHLGSRLDGEVRLDQINLSISNIFHVSITPPQLV
                     LPPGGHQTRKLSAFKGVIKSRRGSQLSETKMTSVNLKTEQQTAESPRTHLTVKDLPIE
                     QQQPSQKRSVDEPKTPKNEEMASDQSLRSSRIDQRQEGGARQPESLGRNLERNQPETK
                     SHCCVIM"
     gene            <422754..>423426
                     /locus_tag="PAS_chr4_0207"
                     /db_xref="GeneID:8200879"
     mRNA            join(<422754..423075,423128..>423426)
                     /locus_tag="PAS_chr4_0207"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493567.1"
                     /db_xref="GeneID:8200879"
     CDS             join(422754..423075,423128..423426)
                     /locus_tag="PAS_chr4_0207"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493612.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0207"
                     /db_xref="EnsemblGenomes-Tr:CAY71433"
                     /db_xref="GeneID:8200879"
                     /db_xref="UniProtKB/TrEMBL:C4R758"
                     /translation="MVTRLLSSPDTKVVHICMSGSYPEDHLQNVLKSLSFGDEKKKLP
                     LDDKTKNTILDSIWLAYPDDLNESYEQLEKLQEENSAGLSKLMIVIQDLDDMAELYAF
                     RDFTSACATLMNFMLKLRKISQLGATVIVTNINHDSGVSMIFSYIAKFYDNKLTFSFH
                     KGSILLEIRPLTISTELQLSTTTLSINPQTMYHMLFPSSENALIST"
     gene            <423661..>424260
                     /locus_tag="PAS_chr4_0208"
                     /db_xref="GeneID:8200880"
     mRNA            <423661..>424260
                     /locus_tag="PAS_chr4_0208"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_002493568.1"
                     /db_xref="GeneID:8200880"
     CDS             423661..424260
                     /locus_tag="PAS_chr4_0208"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_002493613.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0208"
                     /db_xref="EnsemblGenomes-Tr:CAY71434"
                     /db_xref="GeneID:8200880"
                     /db_xref="GOA:C4R759"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023563"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:C4R759"
                     /translation="MSSFESVVIDGKGHLLGRLAAVVAKQLLNGHKVTVVRCEELNIS
                     GDFFRNKLRYHDYLRKGTRFNKNRGPFHFRAPSRILYKAIRGMIPHKTARGKAAMNRL
                     SVYEGIPAPFDKRKKVVVPKALRVLRLKPGRKFTTVGKLSTSVGWKYESVVEKLEEKR
                     KAEEAEYQEKKRAYTQRLDAASAEFAQTEEGKQLAAFGY"
     gene            <425013..>425927
                     /locus_tag="PAS_chr4_0210"
                     /db_xref="GeneID:8200881"
     mRNA            <425013..>425927
                     /locus_tag="PAS_chr4_0210"
                     /product="ADP/ATP carrier protein"
                     /transcript_id="XM_002493569.1"
                     /db_xref="GeneID:8200881"
     CDS             425013..425927
                     /locus_tag="PAS_chr4_0210"
                     /codon_start=1
                     /product="ADP/ATP carrier protein"
                     /protein_id="XP_002493614.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0210"
                     /db_xref="EnsemblGenomes-Tr:CAY71435"
                     /db_xref="GeneID:8200881"
                     /db_xref="GOA:C4R760"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R760"
                     /translation="MADNNKSNFFVDFMMGGVSAAVSKTAAAPIERVKLLIQNQDEML
                     KQGRLAKKYDGIAECFKRTAADEGIASFWRGNTANVIRYFPTQALNFAFKDKFKAMFG
                     FKKDEGWWKWLAGNLASGGLAGATSLFFVYSLDYARTRLANDAKASKGSGERQFNGLI
                     DVYKKTLATDGIAGLYRGFLPSVVGIVVYRGLYFGLYDSLKPIVLVGPLEGSFLASFL
                     LGWTVTTGASTASYPLDTVRRRMMMTSGQAVKYNGAFDAFRKIVAAEGIKSLFKGCGA
                     NILRGVAGAGVISMYDQLQMIMFGKKFK"
     gene            <426175..>427137
                     /locus_tag="PAS_chr4_0926"
                     /db_xref="GeneID:8200882"
     mRNA            <426175..>427137
                     /locus_tag="PAS_chr4_0926"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493570.1"
                     /db_xref="GeneID:8200882"
     CDS             426175..427137
                     /locus_tag="PAS_chr4_0926"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493615.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0926"
                     /db_xref="EnsemblGenomes-Tr:CAY71436"
                     /db_xref="GeneID:8200882"
                     /db_xref="UniProtKB/TrEMBL:C4R761"
                     /translation="MKKFGLEKDGDGIFRLKRRSSSPNKKGKTTLPPFSSPPNLAHDS
                     PTGPPILPTLRTRVSETDTLVDGISDTVNIPSPQAMNARAGSPIRPMLGSPTKSFNDE
                     ADAELAQIIMLLSKIVRLGFNFVKDLTLESSFISVENYTTLHLPSFMVGIALALFFTS
                     GGSDESSSRSRSHESSTSSAFGILRKFVMGFLVISLVVFFVSFQSGDQASNSGSDELP
                     LVNYKQETTAPSPSTHPSGRSSPKRYSVFKEDLSPLQEPLQELLEPDEPLFLDSQQSQ
                     QDNQYRNRGRPPTLANRRANTGSPTPKYRLPTDHYNSFIQKANR"
     gene            complement(<427251..>427817)
                     /locus_tag="PAS_chr4_0211"
                     /db_xref="GeneID:8200959"
     mRNA            complement(<427251..>427817)
                     /locus_tag="PAS_chr4_0211"
                     /product="40S ribosomal protein S7"
                     /transcript_id="XM_002493571.1"
                     /db_xref="GeneID:8200959"
     CDS             complement(427251..427817)
                     /locus_tag="PAS_chr4_0211"
                     /codon_start=1
                     /product="40S ribosomal protein S7"
                     /protein_id="XP_002493616.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0211"
                     /db_xref="EnsemblGenomes-Tr:CAY71437"
                     /db_xref="GeneID:8200959"
                     /db_xref="GOA:C4R762"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:C4R762"
                     /translation="MSSAKILNEEPTELELQVAQSFVDLEANSPDLKADLRPLQFNSI
                     KEIETESGKTAIVIFVPVPLLTAFHKVQIKLTRELEKKFPDRHVVFLAERKITPKIPR
                     GPKVVQKRPRSRTVKVVHEKILEDLVFPTEIIGKRIRYLVGGDQITKVLLDSKDSSNI
                     DYKLDSFQAVYGKLTGKQVVFEIPSETL"
     gene            <428135..>428873
                     /locus_tag="PAS_chr4_0212"
                     /db_xref="GeneID:8200883"
     mRNA            join(<428135..428297,428383..>428873)
                     /locus_tag="PAS_chr4_0212"
                     /product="Ribose-5-phosphate ketol-isomerase"
                     /transcript_id="XM_002493572.1"
                     /db_xref="GeneID:8200883"
     CDS             join(428135..428297,428383..428873)
                     /locus_tag="PAS_chr4_0212"
                     /codon_start=1
                     /product="Ribose-5-phosphate ketol-isomerase"
                     /protein_id="XP_002493617.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0212"
                     /db_xref="EnsemblGenomes-Tr:CAY71438"
                     /db_xref="GeneID:8200883"
                     /db_xref="GOA:C4R763"
                     /db_xref="InterPro:IPR004788"
                     /db_xref="UniProtKB/TrEMBL:C4R763"
                     /translation="MSEELIEKSKKLAAFAAVNENVSKSDRIIGVGSGSTVVYVAERL
                     GQLENKEKFIYVAFDGADEIDTNLNLIKGGGAALYQEKLVASLSRKFVVVADFRKQSP
                     ERLGHFWRKGVPIEVVPNSYVKVLKDLFKLGANSATLRDAGKAKAGPVVTDNGNFVID
                     ADFGEIPLNKVKELDEKLIRLVGVVETGFFVDYAEKAYIGNEDGSITSLSVSVPARL"
     gene            <428999..>429757
                     /locus_tag="PAS_chr4_0213"
                     /db_xref="GeneID:8200884"
     mRNA            <428999..>429757
                     /locus_tag="PAS_chr4_0213"
                     /product="Ribose-5-phosphate ketol-isomerase"
                     /transcript_id="XM_002493573.1"
                     /db_xref="GeneID:8200884"
     CDS             428999..429757
                     /locus_tag="PAS_chr4_0213"
                     /codon_start=1
                     /product="Ribose-5-phosphate ketol-isomerase"
                     /protein_id="XP_002493618.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0213"
                     /db_xref="EnsemblGenomes-Tr:CAY71439"
                     /db_xref="GeneID:8200884"
                     /db_xref="GOA:C4R764"
                     /db_xref="InterPro:IPR004788"
                     /db_xref="UniProtKB/TrEMBL:C4R764"
                     /translation="MYRRFLSKATTRTMSSLVEQSKKLAAYKAVDENLKDSHSVVGVG
                     SGSTVVYVAERLGQLEHKSSFVCIPTGFQSKELILSNGLRLGSVEEYSSIDIAFDGAD
                     EIDSQLNLIKGGGACLMQEKLVASCSKQLFIVADYRKRSPEKLGHAWRQGVPIEVVPA
                     AYNKVLNDLKNLEGYKSAKVRYGGTFKAGPVVTDNSMFIIDADFGEIPVEKVSTLHSQ
                     IKGLVGVLETGLFANMTTAAYIGNEDGSVATLTL"
     gene            complement(<429843..>430380)
                     /locus_tag="PAS_chr4_0214"
                     /db_xref="GeneID:8200885"
     mRNA            complement(join(<429843..430288,430338..>430380))
                     /locus_tag="PAS_chr4_0214"
                     /product="Glucose-repressible ADP-ribosylation factor"
                     /transcript_id="XM_002493574.1"
                     /db_xref="GeneID:8200885"
     CDS             complement(join(429843..430288,430338..430380))
                     /locus_tag="PAS_chr4_0214"
                     /codon_start=1
                     /product="Glucose-repressible ADP-ribosylation factor"
                     /protein_id="XP_002493619.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0214"
                     /db_xref="EnsemblGenomes-Tr:CAY71440"
                     /db_xref="GeneID:8200885"
                     /db_xref="GOA:C4R765"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R765"
                     /translation="MRILMLGLDNAGKTTILYKLKLGKAKNTVPTVGFNVETIKYKNL
                     IMHTWDIGGQERIRALWRHYFSGTDALIYVVDSADQSRLSDAKNELLKVISDKELAGC
                     YIAVLANKQDLPNALTPTELIDQMGLKELTSHNWCVIPTVAINGTGLTEALSWISTNA
                     LS"
     gene            complement(<430621..>432444)
                     /locus_tag="PAS_chr4_0215"
                     /db_xref="GeneID:8200886"
     mRNA            complement(<430621..>432444)
                     /locus_tag="PAS_chr4_0215"
                     /product="SH3 domain protein implicated in the regulation
                     of actin polymerization"
                     /transcript_id="XM_002493575.1"
                     /db_xref="GeneID:8200886"
     CDS             complement(430621..432444)
                     /locus_tag="PAS_chr4_0215"
                     /codon_start=1
                     /product="SH3 domain protein implicated in the regulation
                     of actin polymerization"
                     /protein_id="XP_002493620.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0215"
                     /db_xref="EnsemblGenomes-Tr:CAY71441"
                     /db_xref="GeneID:8200886"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C4R766"
                     /translation="MDLSIGNELKDSFDETNKWVKGGIEWLSDVEEFYRTRASIEKEY
                     SSKLLALSNDFIKRKLKVSTSLSVGETPTITPGSLEAASMVAWTEVLTRTEEIAKHRK
                     DFSRSLEKKVLLELESIRSKYDSIRHQWKEFNEKIVVDRDHYYSEVDKAKKEYDSSCQ
                     IMEQTRQKTERSSSEKAQKKYKEKEIDMNILKNTYLIKINVANRLKDKYFYQDLPEIL
                     DGLQDLNESRVSRLNNILLTTTALEKSCNEKVNECLNAMDVVIKQNVPSLDTAMFIKH
                     NLKDWKEPQDFYYIPSSIWHDDESMVTEPAEMNHLRIQLSTANAKYEKFVKTCETEKQ
                     ILEEVLLKKKGLKEKYITGDELISKEEGYKYDELLMKYLKTLQNFTQDDVIRVVAEVE
                     METIQSSSDGNDLTAPIHEEKKSKRFGLFGKKTRHYTVPDTSDITSVHSNTNTMLSRS
                     STTTFSKARLFGSLLKSNTTTDSGSNAKALYDYEANGDDEVSISQGETFNVVNFDTDG
                     SGWTEITKSSGEKGLVPTSYIETLESKASKIPPKVAPRRGAKKVQYLEALFDYEAAGD
                     DELTIHAGDKIELITDDTDGWTEGKLNNVAGLFPSSYVKKL"
     gene            <432869..>434434
                     /locus_tag="PAS_chr4_0216"
                     /db_xref="GeneID:8200887"
     mRNA            <432869..>434434
                     /locus_tag="PAS_chr4_0216"
                     /product="Non-essential protein of unknown function"
                     /transcript_id="XM_002493576.1"
                     /db_xref="GeneID:8200887"
     CDS             432869..434434
                     /locus_tag="PAS_chr4_0216"
                     /codon_start=1
                     /product="Non-essential protein of unknown function"
                     /protein_id="XP_002493621.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0216"
                     /db_xref="EnsemblGenomes-Tr:CAY71442"
                     /db_xref="GeneID:8200887"
                     /db_xref="GOA:C4R767"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:C4R767"
                     /translation="MDGNISLGLVIYSAVKPIIKLYLALGLGFLLSRVNLLSVETSRG
                     ISDLVLMIFLPFLVFDKIVTNLSIADLKTIGIIFLSAFFMYGVGATASSLIALVFKPP
                     KRFKYGFIVGGILPNVSDLPIAYLSNGISFFTDQQSQKGIAYICIYLATYILVQFNFG
                     LFQVVEWDFREKKEDKETQLVDLSKVLSHKLQPQETTPTVSSIDSNIDEQDLQPIPIA
                     PDNLVSLSSETSHVDLQSLGRIPSARLREPEQHSTRNSVSSITSHRLLSRIISNQDEE
                     NQIVKEYSKAEPFNAHIDPLMKIVTETNLSATDINVSGNKIKFVQKYKLQWLVFFYQN
                     LKKPCSVALVSSLIIALIPWVKALFVETTKNIPSAPDNKPPLSFLMDLTSFIGQAAVP
                     MGILLLGATLGRLKVSSFPPGYWKCVVSLTVFKLCIMPIIGTVFSNRLAKIGWISDEV
                     VQFIVILQWSLPSATVQLFLTASNTRLEDGPNGKATGHVQLDCLSIYLLGQYMILFIT
                     LPFVVAYTVKCTL"
     gene            <434760..>436598
                     /locus_tag="PAS_chr4_0927"
                     /db_xref="GeneID:8200888"
     mRNA            <434760..>436598
                     /locus_tag="PAS_chr4_0927"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493577.1"
                     /db_xref="GeneID:8200888"
     CDS             434760..436598
                     /locus_tag="PAS_chr4_0927"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493622.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0927"
                     /db_xref="EnsemblGenomes-Tr:CAY71443"
                     /db_xref="GeneID:8200888"
                     /db_xref="InterPro:IPR019236"
                     /db_xref="UniProtKB/TrEMBL:C4R768"
                     /translation="MEPKRNRFIGFVQERSAYIPTITKSISNFATNAFDSSNEVPKSV
                     PPNSKILLYNTYTRMETHEGNTKYITDVQGNFNCPATPGSMTRRNRLLLSMAKQFVKN
                     PSTFNTDQFEHELESEMANPDTTLDQLSGVPEFSRTSTMSTTASSISQTNSMADLDDT
                     LVQRLEGFLCKSIPDQEVRVTIGSETRSHNQVLKSKTVRTFANGDFVTQVATDYVPSI
                     IQVSSTYDDQIFSFQQIMLIPDWGIGVISDIDDTIRQSGVIGDKRSLFTNIFVKPYRL
                     CEVPNISRWFNSLAESCNVSFHYVSNSPWQLYPTTYQFFEEIGLPTGSIHLKKYSGNL
                     LSSFMQPASERKRIALQKILRDFPHRKYILIGDSGEQDMEAYLEICIEFPSQILGVYI
                     RVVDNSLSDFDDDKIFNELQQIMDRDHKNCRTPALNPLDEDLIDLDTEIEQTATEHKP
                     PHLYRKPPMIPPKPKVLKGAPIVPKKPVELKGRSVVPQQMSSSSTTSLSTTNGKGTLT
                     SSNLDPPPLPRRTSSSPSSLVYTKLSSLSSNDREKRFRDAGTTEYINSAGDQVTYTIY
                     DKKGELWKQRIHALKDRLPDHIDFQFWWNIDDKLIDQSIEKIKKSM"
     gene            complement(<436629..>437732)
                     /locus_tag="PAS_chr4_0217"
                     /db_xref="GeneID:8200960"
     mRNA            complement(<436629..>437732)
                     /locus_tag="PAS_chr4_0217"
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /transcript_id="XM_002493578.1"
                     /db_xref="GeneID:8200960"
     CDS             complement(436629..437732)
                     /locus_tag="PAS_chr4_0217"
                     /codon_start=1
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /protein_id="XP_002493623.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0217"
                     /db_xref="EnsemblGenomes-Tr:CAY71444"
                     /db_xref="GeneID:8200960"
                     /db_xref="GOA:C4R769"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C4R769"
                     /translation="MPPKKNQPDLSKKNKQKKSQKSLEDKTFGLKNKNKSKKVQEYIS
                     QVKSTSVSSASKEAAAAKRRAEEKKAAEQAKLEAAKLFNPVAIEQKVPFGVDPKSILC
                     VNFKQGVCKKGPKCKFSHDLEIGRKVVKKDLYTDARAPDSKTDDTMEDWDEEKLRSVI
                     SSKQGNPQTTTDKVCKFFIEAVENSKYGWFWECPNGKDCKYKHSLPPGFTLKTKEQKR
                     LERLAADQQPKITLEELIEKERDKLPKKDLTPITWETFVKWKAEHVKRKQELQAKKDI
                     KDKKPKTGKEIILEKFSDKFFQAEEISADKGVAFDLSQFRISDNNIADEGVAFRDYGD
                     GSAAFAESQRLPPKTSFPLREHEKIFPFPIAYR"
     gene            <437965..>439770
                     /locus_tag="PAS_chr4_0218"
                     /db_xref="GeneID:8200889"
     mRNA            <437965..>439770
                     /locus_tag="PAS_chr4_0218"
                     /product="Mitochondrial type 2C protein phosphatase
                     involved in regulation of pyruvate dehydrogenase activity"
                     /transcript_id="XM_002493579.1"
                     /db_xref="GeneID:8200889"
     CDS             437965..439770
                     /locus_tag="PAS_chr4_0218"
                     /codon_start=1
                     /product="Mitochondrial type 2C protein phosphatase
                     involved in regulation of pyruvate dehydrogenase activity"
                     /protein_id="XP_002493624.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0218"
                     /db_xref="EnsemblGenomes-Tr:CAY71445"
                     /db_xref="GeneID:8200889"
                     /db_xref="GOA:C4R770"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:C4R770"
                     /translation="MLVFTVRPRVLRLLPRELIKSTSRTLKKESSSQLMLPQQGQARQ
                     ASSTTRTPRKRRNMRNLNVAFVSGILVVASYVSITNQGKNYLSDTGGAAVGAASNLRN
                     GVSGTLGAFFSTSSQEGSSQSSEKSGVFKLSDEEISARLRRMEESYTVNRGKGVVRYD
                     VSQLPSNNPIEDDRAERMVEVRYRDTESPSDKSKAIADPGAGEVPADWMLWGVFDGHS
                     GWNTSATLRDRLLDYVVEELSNVFRLGDRGPAARTVPSSDAIDRAIKAGFTKLDDQIV
                     NKSVEKLFSGTPKVSAPELLMPALTGSCALVAFYDTHLRELRVALTGDSRAVLGSLGA
                     DDKWTATALTVDQTGSNPSEAARLAAEHPGEPNVVRNGRILGSLEPSRAFGDARYKWA
                     KDIQDRVCRQFLGRTPPPALKTPPYVTAEPVVTSARIRPGKKDFLVLASDGLYELLSN
                     EEIVGLVVRWMEKTGMVPPPSKSLKEKLLGGRGQSSTLTPVIDTSDASTKSSQRPPIR
                     RSSQTATGSRPTYLLEDSNVATHLIRNALSDGGSPENVSMLLGIPSPLSRRYRDDLTV
                     TVVFFGERDEVGGDTALSVQLTPDATLGLQPKPKL"
     gene            complement(<439861..>440517)
                     /locus_tag="PAS_chr4_0219"
                     /db_xref="GeneID:8200890"
     mRNA            complement(<439861..>440517)
                     /locus_tag="PAS_chr4_0219"
                     /product="GTPase required for transport during endocytosis
                     and for correct sorting of vacuolar hydrolases"
                     /transcript_id="XM_002493580.1"
                     /db_xref="GeneID:8200890"
     CDS             complement(439861..440517)
                     /locus_tag="PAS_chr4_0219"
                     /codon_start=1
                     /product="GTPase required for transport during endocytosis
                     and for correct sorting of vacuolar hydrolases"
                     /protein_id="XP_002493625.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0219"
                     /db_xref="EnsemblGenomes-Tr:CAY71446"
                     /db_xref="GeneID:8200890"
                     /db_xref="GOA:C4R771"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R771"
                     /translation="MSSNKQITAVKLVLLGEAAVGKSSLVLRFVSNDFQENKEPTIGA
                     AFLTQRCTIGDKTIKYEIWDTAGQERFQSLAPMYYRNAQAALVVYDVTKPKSFIKARH
                     WVNELHEQASKNIIIALCGNKYDIVESEDNDVSTENEDDDSRKRKVSVQEGQTLADDE
                     GLLFFETSAKTGFNVNEVFTTIGKHIPEATSSENAAGQERVDLTNRLDSSSTESTCQC
                     "
     gene            complement(<440719..>441906)
                     /locus_tag="PAS_chr4_0928"
                     /db_xref="GeneID:8200891"
     mRNA            complement(<440719..>441906)
                     /locus_tag="PAS_chr4_0928"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493581.1"
                     /db_xref="GeneID:8200891"
     CDS             complement(440719..441906)
                     /locus_tag="PAS_chr4_0928"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493626.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0928"
                     /db_xref="EnsemblGenomes-Tr:CAY71447"
                     /db_xref="GeneID:8200891"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R772"
                     /translation="MDEYKAVAAILKAFYDFGDWERHEIIQPRTLKWKSLSKDEQELL
                     AWFPDHLTSLSQCIASNELFMRELASKVAADWGNSEDSSKWGNSVGSDLDKVRSTMLQ
                     FTREWSELGAKEREICYGRITQELESMYPEVEERQRVKILVPGCGLGRLVVELVKRGF
                     QTQGNEFSYHMLLASNFILNHTFVANNYQIFPFIHRFSHNKKRNLQLAPVFIPDYNPG
                     DISFLQRDYPDIPVADLMSMTAGSFVDLYGPPNLVHSDIYTADDEASQFRALNKGTWD
                     VVVTTFFLDTASNVIEYLKSIHHCLKPHGYWINFGPLLWHYENDENVRTRVRTENGMQ
                     VESVEPLKGLELTRDDLIQLITDIGFIFLKHESEISSRYCGDERELGGWEYKCEYWLC
                     QKA"
     gene            complement(<442058..>443992)
                     /locus_tag="PAS_chr4_0220"
                     /db_xref="GeneID:8200961"
     mRNA            complement(<442058..>443992)
                     /locus_tag="PAS_chr4_0220"
                     /product="Vacuolar cation channel"
                     /transcript_id="XM_002493582.1"
                     /db_xref="GeneID:8200961"
     CDS             complement(442058..443992)
                     /locus_tag="PAS_chr4_0220"
                     /codon_start=1
                     /product="Vacuolar cation channel"
                     /protein_id="XP_002493627.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0220"
                     /db_xref="EnsemblGenomes-Tr:CAY71448"
                     /db_xref="GeneID:8200961"
                     /db_xref="UniProtKB/TrEMBL:C4R773"
                     /translation="MSQDSERAAHYYGTPTARQNLRIALNLKQVIDRAIIIPAEIHEI
                     TRPDSTLLNANVVEAVYNAAGGVGKGKEGTSSRKYRSALPFCLLKVSEWYMQLADMEL
                     SAAQLHESRSVAAQQLSKIIIEQQQDERYLFIAMLTRRFTINLNTEDSYPQNVLELSV
                     DMHSTMIISSSGYQRCVTWIWRGWIIQSRENPLSYVLYDGVNDTRFLSHFNPDRIRTP
                     QYQNILEILFSIVYLILYTFIVNTEASASIDFFELCFYIFTLGYVVDEIVKVYHIGSN
                     YIQFWNAFNDTMYALLSVSIMFRIMAVRAGSPVNMNKFDTISYRLLSCAAPFMWTRLL
                     LFLDVNKFVGTMIVVIKVMMKESAIFFFLLTVILVGFLQGFLGLDQADGRRDATTKIL
                     SVLVHTVIGGPDFQSFNKFAPPYAQILYYVFTFFITVILLNILIALYSTAYSEIVDNS
                     TNEYLALVAQKTLRYVRAPDENVYVAPYNLVEFFILPLQWLVQPSTYHSINKAVMTII
                     YLPLILYVASEEVKIAKRVNYNRGRNLPDDANEHDTEWSLTDGFDDDTDAEEAEQQIN
                     ENLSVQLQAELEDPEFQAGRKEWLRSVQRLVPPIHESSKMGVSLETYDVMKKLETLTA
                     LVGQLVEDNKELRQQLLEKK"
     gene            <444331..>447063
                     /locus_tag="PAS_chr4_0221"
                     /db_xref="GeneID:8200892"
     mRNA            <444331..>447063
                     /locus_tag="PAS_chr4_0221"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493583.1"
                     /db_xref="GeneID:8200892"
     CDS             444331..447063
                     /locus_tag="PAS_chr4_0221"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493628.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0221"
                     /db_xref="EnsemblGenomes-Tr:CAY71449"
                     /db_xref="GeneID:8200892"
                     /db_xref="GOA:C4R774"
                     /db_xref="InterPro:IPR025279"
                     /db_xref="UniProtKB/TrEMBL:C4R774"
                     /translation="MTGTRTEKPNTQDYVAGRDVMFDYQTALSHTNGYENKSRHKNKS
                     HRTKKVRHETPPVSVDINDPDADYPVSRVIKQTENGEVVVSEYQSADPYNFWGALTIN
                     SEEHEGLKEFWNSMTPDQRKSLVSIDKEELLSSLKYIECGACRCQACGDKKALEQDLI
                     ELYDSYYAHIGEHEIKTLEPFFSNDLESFKSMLGDYECLDTEVDLDSEEYESDERDYE
                     HEHHTICEPLAQDLPTDNTDNIQDGQIEVKMPTSNQLSTIADDILNHDGRSFITMMER
                     LAINMNRLEDCNNKNSSTSNISDNISTAPTNSINIQADSDVQKSVSKIEDVFRTNIGV
                     FNPTFLKNALIKYAERTDADWTKTPNTPGETEAWLNGIADSLALKGRDRQEFIATPKK
                     LMQLKDEWKRTEDEQGEDEHVWTDEQSKLFLERVENAINTVSSEEQEYQEVEEVNQDF
                     EDEIYEDEDEDEEDQEILEKEYLDKKRLQQAFRMLQVMTTQIVKERFVTAYREKVAED
                     TRNQLLAELEMEEALQKEKEKEEKRRKEELLEKKRLEEIAKEQERRRKEAEKLEEERK
                     REEEQRRRTEEGIRRKEEQRRKKEEERRKVLEEKRRKEQELKRLEEERLEKERLENER
                     VEKEKLEAQRLEEEKQRLQQRSSAQQGNVPNSRQGPTGYQQQYQSLVPPKTSQPVEEN
                     SFEEVNALLRKAESSLRDENSNISNTPVYGAPANNFFNQNKHYPSEISGAQMPAHFSG
                     WGSDPNGFASPSSPGNVFLPGRTSQSGFNAGYNGGFFEQNRPDANPAGAAHISGATLF
                     GGNNSIWSYPGSVGSIWSAQLGVNDYERIQLATFQAIKNFKDDSGEYNLQGLFNFSKP
                     ALTMYPTLTLDQFVVALQHDLRGILPFRFEILYELGLASRVRFMPSWPKTDQMR"
     gene            <447320..>447907
                     /locus_tag="PAS_chr4_0222"
                     /db_xref="GeneID:8200893"
     mRNA            <447320..>447907
                     /locus_tag="PAS_chr4_0222"
                     /product="Non-essential small GTPase of the Rho/Rac
                     subfamily of Ras-like proteins"
                     /transcript_id="XM_002493584.1"
                     /db_xref="GeneID:8200893"
     CDS             447320..447907
                     /locus_tag="PAS_chr4_0222"
                     /codon_start=1
                     /product="Non-essential small GTPase of the Rho/Rac
                     subfamily of Ras-like proteins"
                     /protein_id="XP_002493629.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0222"
                     /db_xref="EnsemblGenomes-Tr:CAY71450"
                     /db_xref="GeneID:8200893"
                     /db_xref="GOA:C4R775"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R775"
                     /translation="MSVENIINRKLVIVGDGACGKTSLLYVFTLGEFPTEYHPTVFEN
                     YATDCRVDGKAVRLALWDTAGQEEYERLRPLSYAKAHAILIGFALDTPDSLDNVGTKW
                     IEEVRSFVPNAPRILVGLKKDIRQQQCNPEDPESVRQFVFPQQGEAMAKRIDARKYIE
                     CSALTGEGVDDVFETATRASLLVTYKPTQTCCLIL"
     gene            <448041..>450686
                     /locus_tag="PAS_chr4_0223"
                     /db_xref="GeneID:8200894"
     mRNA            <448041..>450686
                     /locus_tag="PAS_chr4_0223"
                     /product="Protein involved in DNA replication"
                     /transcript_id="XM_002493585.1"
                     /db_xref="GeneID:8200894"
     CDS             448041..450686
                     /locus_tag="PAS_chr4_0223"
                     /codon_start=1
                     /product="Protein involved in DNA replication"
                     /protein_id="XP_002493630.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0223"
                     /db_xref="EnsemblGenomes-Tr:CAY71451"
                     /db_xref="GeneID:8200894"
                     /db_xref="GOA:C4R776"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C4R776"
                     /translation="MAPPRRKRIIEDSSDEEIEDVDFHASSSNSMRSSPPPPATLGLP
                     PSSPTLPFDDDEQEIGEEEIPIIDEEEVDEEDDAEDLIGDNMFDDYRQNRDQDHYDID
                     QIDDNEYEQMDPEERRKVDKLLNEKDRLQKQALAADRDIYLGDGADMDVEIDTRTGLP
                     VQSRRRRTAYDDDRLGHDDDDLEDIDPLAEELTLESLADVKAESILQWILTPNVNRTI
                     ARELKSFLLEYTDENGRSVYGARIRALGEVNSESLDVSYTHILESKAILALFLASCPD
                     QILQIFDVVAMEATELHYPDYAQIHSEVHVRITDFPNISSLRELRETHLNALVRVTGV
                     VTRRTGVFPQLKYVKFDCLRCHMVLGPYIQDSTQEVKVSYCTNCQSRGPFKMNAERTL
                     YRNYQRITLQEPPGAVPPGRLPRHREIVLLWDLVDAAKPGEEVDITGVYKNSYDGALN
                     AHNGFPVFATVIEANCLRRRDASGSTNPALDSSGSVPWTDEDESQIIQLSKQRGIVDK
                     IIGSMAPSIYGHRDIKAAIACSLFGGVPKDINGKHSIRGDINVLLLGDPGTAKSQILK
                     YVEKTAHRAVFATGQGASAVGLTASVRKDPVTREWTLEGGALVLADKGTCLIDEFDKM
                     NDQDRTSIHEAMEQQSISISKAGIVTSLQARCSIIAAANPVGGRYNPTMNLAHNVNLT
                     EPILSRFDILCVVRDLVDPSVDERLAKFVVDSHIRSHPHDDANDSDDSEGEIEGDRTV
                     SQVQHDVSVNKGKRERRQQLQREKENQISPIPQDLLVKYIHYARTKLYPKLTQMDRDK
                     VARVYADLRTESITTGSFPITVRHFESILRIAESFARMRLSEFVSSSDLDRAIKLSID
                     SFVGTQKLSVRKQLQRSFMKYTLPK"
     gene            <450886..>451965
                     /locus_tag="PAS_chr4_0224"
                     /db_xref="GeneID:8200895"
     mRNA            <450886..>451965
                     /locus_tag="PAS_chr4_0224"
                     /product="Evolutionarily conserved subunit of the CCR4-NOT
                     complex involved in controlling mRNA initiation"
                     /transcript_id="XM_002493586.1"
                     /db_xref="GeneID:8200895"
     CDS             450886..451965
                     /locus_tag="PAS_chr4_0224"
                     /codon_start=1
                     /product="Evolutionarily conserved subunit of the CCR4-NOT
                     complex involved in controlling mRNA initiation"
                     /protein_id="XP_002493631.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0224"
                     /db_xref="EnsemblGenomes-Tr:CAY71452"
                     /db_xref="GeneID:8200895"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R777"
                     /translation="MYPQRQVYNDPQVQSQLPQRGFGYPSNVVNSGLTSDTAPIQTTM
                     AASLSAGPPGGIATNIPGGVPAGTSSGPPPGASVSSGGAPNTNKALNDEKVYAWILEL
                     AYGPNKEQALLELGKKRELYDDLALVLWHSFGVMTSLLEEIVAVYPLLSPPQLTTPIS
                     NRVCNALALLQCVASHPDTRNAFLNAHIPLFLYPFLNTSSKQRPFEYLKLTSLGVIGA
                     LVKNDSPEVVSFLLTTEIIPLCLKIMESSSELSKTVAIFIVQKILFDDSGLAYVCQTF
                     ERFSAVSNVLKSMVEQLVLQPAPRLLKHVVRCYLRLSDNVDAKKALKECLPEPLKDGT
                     FSSVLVNDAATKRCLSQLLVNVSQE"
     gene            <452161..>454884
                     /locus_tag="PAS_chr4_0225"
                     /db_xref="GeneID:8200896"
     mRNA            <452161..>454884
                     /locus_tag="PAS_chr4_0225"
                     /product="Gamma subunit of coatomer, a heptameric protein
                     complex that together with Arf1p forms the COPI coat"
                     /transcript_id="XM_002493587.1"
                     /db_xref="GeneID:8200896"
     CDS             452161..454884
                     /locus_tag="PAS_chr4_0225"
                     /codon_start=1
                     /product="Gamma subunit of coatomer, a heptameric protein
                     complex that together with Arf1p forms the COPI coat"
                     /protein_id="XP_002493632.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0225"
                     /db_xref="EnsemblGenomes-Tr:CAY71453"
                     /db_xref="GeneID:8200896"
                     /db_xref="GOA:C4R778"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="UniProtKB/TrEMBL:C4R778"
                     /translation="MSTLSYKKFEDSDSGVLPDKMTVFQDCLQAFNASPVQAKRCRML
                     LARLLRLLYSGDSFPSTESTTLFFSISKLFQHKDVSLRQMVYLTIKELSKTSEDVLMV
                     TSSIMKDAQNGDITYKPNAIRTLARVLDASTVNATERLFKNSVVDKNQSISSAALISS
                     YHMLPVAKDVVKRWTNETQGTISASKVFLTSPVANHEQYGSQNLSSFIYQYHALGLLY
                     HLRNHDKMALMKMIQSLSSNNVLKHPAALVQLTHYIAKVLETDSSLAGNFESYFEIAL
                     QNRSDMVALEAVKTIVTIPALSGLIVKAIYVLDTFLSAPRTVVRFAAVRLLNKISLTN
                     PENIVVCNGSLEGLINDSNRAISTYAITTLLKTGNNDNVDRLIKTIAGFMDDISDEFK
                     IVVIDSIRSLSLKFPEKHKSMLSFLNDRLREEGGFNLKNSIIEAIFDVIKFVPESRES
                     CLEKLCEFIEDCEFTELAVRILHLLGNEGPKTSKPTLYIRHIYNRVVLENSIVRSSAV
                     IALSKFALIGDASINKSISILLTRCLNDVDDEVRDRAALALKLLSTEKFDEARAFIDP
                     GFSYSLPILEQKLAQYVNGDEESFNVPFDGSNIPKISEDEARAYEYKEKLNSIEESIQ
                     KESKQPKEEVSEFAKHNLLQQQYAQELSSIPELAAYGDLLRSSHVVDLTEKETEFVVT
                     CVKHIFAGHIVLQFNVENTLTDLQLDNVTMVSEPDFEEFVEDFVAPIESLKPQTTGST
                     YVSFTRSETLEGCLFTNNLTYIAKEVDPATGEAAEGDEGFEDEYRVESVDIVPGDFIV
                     PSFAGNFTSVWDSLPNPCSSVFNLSDAKGIADVVAKLIKDSSMSPCDSSELVGSHASH
                     TLKLFGKSINNENIAAVIRFVYKESVGVMVKVEAKSVNAELGTFFANEIIV"
     gene            <454981..>455997
                     /locus_tag="PAS_chr4_0929"
                     /db_xref="GeneID:8200897"
     mRNA            <454981..>455997
                     /locus_tag="PAS_chr4_0929"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493588.1"
                     /db_xref="GeneID:8200897"
     CDS             454981..455997
                     /locus_tag="PAS_chr4_0929"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493633.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0929"
                     /db_xref="EnsemblGenomes-Tr:CAY71454"
                     /db_xref="GeneID:8200897"
                     /db_xref="GOA:C4R779"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R779"
                     /translation="MPSLPEGKPEVLAKIDERVSFKKDEEKWIFEDGDEEFEYDDDLQ
                     RWVPEKRKIENDERELKEELKKEKKRKIEELKEQERNKPKSPPQTGVYITNLPSDTTL
                     EEIEDAFGKLGTIGENLITGEKKIKLYRNEENQFKGDALVVYLKPESVDLAIEMLDGI
                     QWRPLSKETIHVEKADFSHKESDSKAHNKDLTEEQKQVIKKRLQRLKSRSDDWKDDIQ
                     VEYERRQAEERFKHFVVLKNVFDLKTSEDDLFEIKQDIREGCEEIGSVTNVVLYDLEP
                     EGIVSVRFSSKDDAARCAQEMNGRYFDGKKLEAFIYDGKSKYRRKEVSKEDQSDRFGT
                     WLEG"
     gene            <456157..>457341
                     /locus_tag="PAS_chr4_0226"
                     /db_xref="GeneID:8200962"
     mRNA            <456157..>457341
                     /locus_tag="PAS_chr4_0226"
                     /product="P-loop ATPase with similarity to human OLA1 and
                     bacterial YchF"
                     /transcript_id="XM_002493589.1"
                     /db_xref="GeneID:8200962"
     CDS             456157..457341
                     /locus_tag="PAS_chr4_0226"
                     /codon_start=1
                     /product="P-loop ATPase with similarity to human OLA1 and
                     bacterial YchF"
                     /protein_id="XP_002493634.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0226"
                     /db_xref="EnsemblGenomes-Tr:CAY71455"
                     /db_xref="GeneID:8200962"
                     /db_xref="GOA:C4R780"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R780"
                     /translation="MPPKKHIEEKKVLLGRPGNNLKSGIVGLANVGKSTFFQAITRSP
                     LGNPANYPFATIDPEEARVIVPSPRLDKLTEVVKPKAKIPAFITVYDIAGLTKGASAG
                     EGLGNAFLSHIRAVDAVFQVVRCFDDAEIIHIEGDVNPVRDLEIISNELRLKDIEFAQ
                     KHLEAVEKITKRGGQSLEVKQKRDEAEFVKKLIALLEDGQRVANQNWGPKEVEIINSM
                     QLLTAKPSIYLINLSEKDYIRKKNKHLLPIKQWVDKYSPGDVIIPFSVCLEEKLSQME
                     TDEEREEELKRLGTTSALPKIITIMRKTLGLISYFTCGPQEVREWTIREGTKAPQAAG
                     VIHNDLMNTFILAQVQKYEDLIEYGDEAAVKAAGKLQQKGKDYVVEDGDIIYFRAGAG
                     KN"
     gene            <457484..>458398
                     /locus_tag="PAS_chr4_0227"
                     /db_xref="GeneID:8200898"
     mRNA            <457484..>458398
                     /locus_tag="PAS_chr4_0227"
                     /product="Copper-binding protein of the mitochondrial
                     inner membrane"
                     /transcript_id="XM_002493590.1"
                     /db_xref="GeneID:8200898"
     CDS             457484..458398
                     /locus_tag="PAS_chr4_0227"
                     /codon_start=1
                     /product="Copper-binding protein of the mitochondrial
                     inner membrane"
                     /protein_id="XP_002493635.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0227"
                     /db_xref="EnsemblGenomes-Tr:CAY71456"
                     /db_xref="GeneID:8200898"
                     /db_xref="GOA:C4R781"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:C4R781"
                     /translation="MLGRTRIPLRLRAPLGVPFRQVYRPISISHALLQEQKKQEGLNT
                     TDGAETPKRKPLSRIPIGAIPEGNSQKIGSTGTVEFSTWKAVVLFAVVGTVVTFFFKK
                     EKKRLELQKEADQNRGMGKPLVGGPFDLIDTNGEQFTQEKLKDKFSLIYFGFTHCPDI
                     CPDELDKLGLMLDELKSKYNIQIQPIFITCDPARDSPAIIKEYLKDFHPDIIGLTGTY
                     DKIKECCKNFRVYFSTPRDVKAGQDYLVDHSIFFYLMDKEGEFIDVLGRQYDASGAVE
                     KIKGHIDAYVPKDQRDKQKNSWYGFLFK"
     gene            complement(<458458..>460686)
                     /locus_tag="PAS_chr4_0930"
                     /db_xref="GeneID:8200899"
     mRNA            complement(<458458..>460686)
                     /locus_tag="PAS_chr4_0930"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493591.1"
                     /db_xref="GeneID:8200899"
     CDS             complement(458458..460686)
                     /locus_tag="PAS_chr4_0930"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493636.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0930"
                     /db_xref="EnsemblGenomes-Tr:CAY71457"
                     /db_xref="GeneID:8200899"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="UniProtKB/TrEMBL:C4R782"
                     /translation="MGKASSATKKFLSKHLKRTVKHRKKVQKHAKLVASHKRRGTGEP
                     KEDDESKGKIFKDMDVDQFFESGFEIPQEKKSKNSKRESKTVEDESLESEDDSVVEVD
                     SESGEKLDEPEEKEEESDFNVGSQPDDDEPDHKDERSSKLRTKTQSKTNDEDEDESSE
                     DDNDMEQDLEDLKAEDPEFYKYLAKNDKDLLDFKPVNPLDMIDDDEDEDEYEEDKEES
                     RIPTEEKINITNTLLKEWEIQLESPTFILLKQLVEAFKDAVRIQDANEEDGSKYVIND
                     PKTFNHLMILAVSKVPSAFQTLVPFKKNHKGVRKLIDSPEFPKVKVLLKSHAPTLVTL
                     LSDTQSVETGALVLSSLQELLPYITLSKSLLKQIITAVVNLWATTNEVDIQITTFAFL
                     NNSAKEYPGDILEITLKAMYSTFVKQSRKTNAHTMPLINFQKNSSIELFGIDPNVGYQ
                     VGFEYIRQLAIHLRNSIISKEKEKYKAVYNWQFCHSLDFWSRLLSAHCNPEREQGKES
                     PLRQLIYPLVQVTIGTIKLIPSPQFFPLRFYLIRSLIRVSQNTGVFIPIFPLLSDILN
                     SSVLTRSPKHSSLHAFDFDHNIRANQAYLGTRVYQEGSCEQIVTLLGEYFVLYCKQIA
                     FPEVTTPAVIYLRRFIKKSKNVKFNRQLSNLIQKLNQNVDFITKARSNVDFTPKNRGA
                     VNNFLKDTAWESTPLGAYIVVQREIEENRRKILRDSLENKQDIKDQRVDGDDDLDLVD
                     LE"
     gene            complement(<460849..>462855)
                     /locus_tag="PAS_chr4_0228"
                     /db_xref="GeneID:8200963"
     mRNA            complement(<460849..>462855)
                     /locus_tag="PAS_chr4_0228"
                     /product="Acetolactate synthase, catalyses the first
                     common step in isoleucine and valine biosynthesis"
                     /transcript_id="XM_002493592.1"
                     /db_xref="GeneID:8200963"
     CDS             complement(460849..462855)
                     /locus_tag="PAS_chr4_0228"
                     /codon_start=1
                     /product="Acetolactate synthase, catalyses the first
                     common step in isoleucine and valine biosynthesis"
                     /protein_id="XP_002493637.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0228"
                     /db_xref="EnsemblGenomes-Tr:CAY71458"
                     /db_xref="GeneID:8200963"
                     /db_xref="GOA:C4R783"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012846"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C4R783"
                     /translation="MFAIRTASRRYALSNRAQRSLLQGVRFKSAVATAPTPASAKRPR
                     PAPSFNQSTDPEPLSSNQKQMMDDSFIGLSGGEIFHEMMLRHKVDTVFGYPGGAILPV
                     YDAIYNSSHFKFVLPRHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVITPMADALA
                     DGVPLVVFSGQVVTSAIGTDAFQEADVIGISRSCTKWNVMVKDVAELPRRINEAFEIA
                     TSGRPGPVLVDLPKDVTAAILKTPIPISSTLPNKTLSRLTEEVASEFTMKNIKEAAHL
                     LNIAKKPILYVGAGILNDENGPGLLRELADKAQIPVTTTIQALGAFDQRDHKSVDMLG
                     MHGSAVANLAMQNADLIIALGARFDDRVTGTISKFAPQARLAAVQHRGGIVHFEISPK
                     NINKVVDATVAVEGDVTKNLNNFIPLVETVSERPEWFKQIDEWKEQYPYAYQLETPGS
                     AIKPQTLIAEISKQCQKQDKEVIVTTGVGQHQMWAAQHWTWTQPRTMITSGGLGTMGF
                     GLPAAIGAQIAKPDAMVIDIDGDASFNMTLMEMSSAVQADAPVKVVVLNNEEQGMVTQ
                     WQSLFYEHRYSHTHQTNPDFMKLAEAMGFKGIRVKKQEDLVGKVTEFLEASEPVLMEV
                     FVEKKVPVLPMVPGGKALDEFIYWDPEVEKEQTELRRKRTNGKH"
     gene            complement(<463110..>464915)
                     /locus_tag="PAS_chr4_0229"
                     /db_xref="GeneID:8200900"
     mRNA            complement(<463110..>464915)
                     /locus_tag="PAS_chr4_0229"
                     /product="Catalytic subunit of TRAMP
                     (Trf4/Pap2p-Mtr4p-Air1p/2p)"
                     /transcript_id="XM_002493593.1"
                     /db_xref="GeneID:8200900"
     CDS             complement(463110..464915)
                     /locus_tag="PAS_chr4_0229"
                     /codon_start=1
                     /product="Catalytic subunit of TRAMP
                     (Trf4/Pap2p-Mtr4p-Air1p/2p)"
                     /protein_id="XP_002493638.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0229"
                     /db_xref="EnsemblGenomes-Tr:CAY71459"
                     /db_xref="GeneID:8200900"
                     /db_xref="GOA:C4R784"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:C4R784"
                     /translation="MITEAQKAVTLVSKNHADSTISQSLNGIKNEGGIMLKETEEATS
                     VQTQLISPEPKKIQSNELTENKDFISFDFSSDEESDHHTEQVLEQDGRIADYDAYQSA
                     DEEGVPLDDKPIQQYPWIKNRDHSKQLELSDWLTLEIKDFINYISPSIAEIEARNNAV
                     KRLRKEITTNLWPDCYVNVFGSFATDLYLPGSDIDMVITSDSGKYCAKSYLYQLSSFL
                     RSKNLGVNIETIARAKVPIIKFIEPRSKIHIDVSFEKTNGLRAAERIQGWLRETPGLR
                     ELVLIVKQFLAVRRMNNVHHGGLGGFSIICLVHSFLSLHPRLITNSIDPLDNLGVLLI
                     EFFELYGYNFGYDNVILSYNPTVCYLKKEEHSYLGASNTFALAIQDPDDPSNNISRSS
                     YDIRNIKRSFIGAFELLTNKCYELQAASYKERLGQSILGGIIRYTGKERDFEDARDKI
                     INEAYVSVSRSETPQDIYTTGGLPPLPSELNKGKGKKRKRDRPTLEEEYADITVESSD
                     SDITNVVMPPVRKRRKSGKKNKIPKAQSTGVRADIFMSLDDHEDDDYKETVEKDNNSK
                     AMDDEADVKAKLDSRSKSKVSRDSKNRYWLDKAGF"
     gene            complement(<465024..>467189)
                     /locus_tag="PAS_chr4_0931"
                     /db_xref="GeneID:8200901"
     mRNA            complement(<465024..>467189)
                     /locus_tag="PAS_chr4_0931"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493594.1"
                     /db_xref="GeneID:8200901"
     CDS             complement(465024..467189)
                     /locus_tag="PAS_chr4_0931"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493639.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0931"
                     /db_xref="EnsemblGenomes-Tr:CAY71460"
                     /db_xref="GeneID:8200901"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C4R785"
                     /translation="MKLGIERRSYGISCSNLAPLIENDVNSLVLIRHDRLEVQQYCDG
                     KLHHLLDITINEKILCLKSLPVIKDDPSDRRHWLVCLTESNQLWLIAFSDQQNSFVVV
                     DRVTFEGLKGEICTMTVTEDGNFIAISSIDNFVHIMYLDPSKQQLYKQALEHNPPAGK
                     INRTLKKNRIFLKPCNIYLADELIQNCHFLADNILALVVRDSNLKYLVKYYRVVKHSS
                     RFSEFNCELLRKFQPLPETPVLSIPLPNGCLMVLGEEIHSIYPSGKTIFKFENNASFG
                     INKLAAVKILTRELANLRAKITQKQIFTVFHVIDEHRVILGSNTGDYYLVSFDIHALP
                     KTEEELEREQELLNAQRQLELEIESQDFYSISSWKFVHVGKSTIGNDMVHLEDQKFFI
                     SSTTDKSLIVDIGRYEITQLLSLESDGFLGPLTAGLCYGHGNVLLAQGTISKSHLFGV
                     DGRSITVPGVIRKILLRGESFYVLGLKEVGSEIHSFIYILDQKLQIKHIKTYAEEMLD
                     IVVDKYFYVSSNDHKSDQSVIRSFNFDLQKLKEVRVPIGTISQLATRGGFLVAVGSHL
                     KIYNEELEDQILFSVVGIASSCLSFFNDSKLLIGDFKLGVSCQDIDLDKPYIGSIKAL
                     PVEDKLSLCSLVSVLSDQCLLTSDSFGNINLFQKTEDGFILKSSLKIGESITFICKGF
                     HQPKTVSLEFELANENKLALKNSVAFVGTMSGNVYSLHN"
     gene            complement(<467195..>467803)
                     /locus_tag="PAS_chr4_0230"
                     /db_xref="GeneID:8200964"
     mRNA            complement(<467195..>467803)
                     /locus_tag="PAS_chr4_0230"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493595.1"
                     /db_xref="GeneID:8200964"
     CDS             complement(467195..467803)
                     /locus_tag="PAS_chr4_0230"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493640.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0230"
                     /db_xref="EnsemblGenomes-Tr:CAY71461"
                     /db_xref="GeneID:8200964"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:C4R786"
                     /translation="MGQDREQVTDKTKLQRNDPKESQYEEYKMYRERSSYNRDSSSVN
                     TKRDQSPKRPTFNIGPSGILGQQDSKDLKSKSSSEKEKNYSEPPEKTSPPKDKYYIFL
                     FNDIYPDGKRISLNNSFYTLGNTDDCDFKLADVDIGQVNTVIQFRKMKGTIKPYIIDL
                     GSMSGTNVNDIPIPPKRYLELKNSDSIIIGDSSSEFIFMITG"
     gene            <467913..>470213
                     /locus_tag="PAS_chr4_0231"
                     /db_xref="GeneID:8200902"
     mRNA            <467913..>470213
                     /locus_tag="PAS_chr4_0231"
                     /product="Putative nucleolar DEAD box RNA helicase"
                     /transcript_id="XM_002493596.1"
                     /db_xref="GeneID:8200902"
     CDS             467913..470213
                     /locus_tag="PAS_chr4_0231"
                     /codon_start=1
                     /product="Putative nucleolar DEAD box RNA helicase"
                     /protein_id="XP_002493641.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0231"
                     /db_xref="EnsemblGenomes-Tr:CAY71462"
                     /db_xref="GeneID:8200902"
                     /db_xref="GOA:C4R787"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R787"
                     /translation="MARNQKISTQERRNLREKHQQAQKDRQEKLAQLDPKEYTKFTKF
                     SELPLSRQTLIGLRGAHFIEMTGIQKEAIPPALQGQDILGAAKTGSGKTLAFLIPLIE
                     MLLREDWNEFDGVGALIISPTRELAMQIYEVLLNIGKHSSFSCGLVIGGKDFKYESER
                     IGKINVLIGTPGRLLQHMDQSANLNINNLQMLILDEADRILDMGFKKTLDSIISSIPP
                     QRQTLLFSATQTKSVQDLARLSLTNPKYINSSSDLDLATPDSLEQSYIVVPLNEKINT
                     LWSFIKTHLKSKILVFLSSSKQVHFLYEAFRKLQPGISLMKLHGRQKQTARIETTVKF
                     SHAQHCCLFATDVVARGLDFPAIDWVVQLDCPEDASTYIHRVGRCARAGKEGKSLLIL
                     TPSEEEAFVRRLEAKNIKNISKLNVRGAKKKTIEPQMQALCFKSPELKYLGQKAFIAY
                     FKSVFIQKDKEVFQVQKLPVEEYAKSLGLPGAPKIKLLEKSAKAMTEEQLSKLKERKN
                     ASRQLLTLSKLDENGEEKPEDKKKVRTKYDKMFERQNQNVLSEHYRNLNAEQDDEEED
                     FISVKRTDHDLTENVPELDNLPTSKRAAKKALSKKAMSKAGANPKKLVFDDDGKAHEI
                     YELAGEEEFHEQGDALDQKTKFIQQESTVMAEADSEDKVVAKEKKVEKKRRRQDIERK
                     AKEESDLSEEDDEEDEDEEELPDIARDYDSDSSGDDEPDRKKTKKWFENDRGINGTDF
                     NTKVIELEKPDTIDDMEALAEQLLHG"
     gene            <470358..>471599
                     /locus_tag="PAS_chr4_0232"
                     /db_xref="GeneID:8200903"
     mRNA            <470358..>471599
                     /locus_tag="PAS_chr4_0232"
                     /product="Protein with carboxyl methyl esterase activity"
                     /transcript_id="XM_002493597.1"
                     /db_xref="GeneID:8200903"
     CDS             470358..471599
                     /locus_tag="PAS_chr4_0232"
                     /codon_start=1
                     /product="Protein with carboxyl methyl esterase activity"
                     /protein_id="XP_002493642.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0232"
                     /db_xref="EnsemblGenomes-Tr:CAY71463"
                     /db_xref="GeneID:8200903"
                     /db_xref="GOA:C4R788"
                     /db_xref="InterPro:IPR016812"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R788"
                     /translation="MTDGNLISDLMRKNLLESLNSGSDHEDEVEEEEEETDAVGELNH
                     KEWSGSNAKDCDSRFNVANGFEESPYQLKEWTAQTYYQPFQSESVKPVIFIAHHGAGS
                     SGLTFTLLAKELVSISKDSQINSGDELDIPGFFCFDMRGHGQSKFVETVESKDYSIQT
                     LCVDFISILNEFFARNEFDTVKCRPSIFFIGHSLGGSILTKILKEDMIENQFIKDCIK
                     GLVLLDIVEEIAVKALDGMQGYIDHRPKSFASLSDALQWHLDSGLLHNEESGLISIPF
                     LFSKRETEGSPVYEWVTDLKSTKPYWKGWFTGLSNGFITISSRIAKMLVLSNHENLDK
                     YLTIGQMQGKFQLVVFRNQQNSQFGHFIHEDIPNKVAYSILDFVDRNDFTRPKSVLHH
                     DEGTSQRELIQKLNAKWGVKN"
     gene            complement(<471614..>473752)
                     /locus_tag="PAS_chr4_0233"
                     /db_xref="GeneID:8200904"
     mRNA            complement(<471614..>473752)
                     /locus_tag="PAS_chr4_0233"
                     /product="Glutamine-dependent NAD(+) synthetase"
                     /transcript_id="XM_002493598.1"
                     /db_xref="GeneID:8200904"
     CDS             complement(471614..473752)
                     /locus_tag="PAS_chr4_0233"
                     /codon_start=1
                     /product="Glutamine-dependent NAD(+) synthetase"
                     /protein_id="XP_002493643.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0233"
                     /db_xref="EnsemblGenomes-Tr:CAY71464"
                     /db_xref="GeneID:8200904"
                     /db_xref="GOA:C4R789"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR014445"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="UniProtKB/TrEMBL:C4R789"
                     /translation="MPHYITLATCSLNQWALDFEGNRDRILQSIKEAKEAKASLRVGP
                     ELEISGYGCLDHFLENDTYLHSWEMYASILQNESTHGILLDIGLPIMHKNRRYNCRIL
                     SYDGKILLIRPKIFLANDGNYREMRYFTPWLQPQYVEEFVLPRLLQKITGQITVQFGD
                     AVISTLDTCIGAETCEELFTPQAPHIAMALDGVEIVANSSGSHHELRKLNTRMDLITE
                     ATTKCGGIYLYSNQKGCDGDRLYYDGCALIVVNGKVLAQGSQFSLKDVEVITATVDLE
                     DVRSYRNMISHGLQSRSTPVYERVHAAIELSPDSKSFDPTIVPTSPREIRYHLPEEEI
                     AFGPACWLWDYVRRCKGSGYFVPLSGGIDSCATSVIVFSMCTLVVKEALEGNEQVIRD
                     AQLVANMPEGWIPETPQELCNKIFHTCYMGTTNSSIETRARSRDLAARIGSYHVDLNM
                     DSVVTALVSLFEVVTGRKPVFKVFGGSQIENLALQNIQARLRMVLAYLFAQLLPWTRG
                     RTNTGGLLVLGSANVDEQLRGYLTKYDCSSADVNPIGGISKTDLISFIKFSINRFDLP
                     ILRDFVDATPTAELEPITDTHVQSDEADMGMSYEELSIFGRLRKVNKCGPYSMFIKLL
                     HEWSPRLTPEEIGTKVKRFWWFYAVNRHKQTVSTPSYHAEQYSPDDNRFDLRPFLIDP
                     SFSWARKKIDQVVETLEKNNTSQLDTMTVD"
     gene            <473963..>474634
                     /locus_tag="PAS_chr4_0234"
                     /db_xref="GeneID:8200905"
     mRNA            <473963..>474634
                     /locus_tag="PAS_chr4_0234"
                     /product="Integral membrane protein of the early Golgi
                     apparatus and endoplasmic reticulum"
                     /transcript_id="XM_002493599.1"
                     /db_xref="GeneID:8200905"
     CDS             473963..474634
                     /locus_tag="PAS_chr4_0234"
                     /codon_start=1
                     /product="Integral membrane protein of the early Golgi
                     apparatus and endoplasmic reticulum"
                     /protein_id="XP_002493644.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0234"
                     /db_xref="EnsemblGenomes-Tr:CAY71465"
                     /db_xref="GeneID:8200905"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:C4R790"
                     /translation="MILQLLSYVGIVSGFVSITLAIASGLYYLSELVEEYTEFTRRLI
                     GRLIIAIVGVFLLLLFLDGFPIKLSIFSLLTYYIYYKNLKTFPFIDLTGPVFVSSCIL
                     AVLNHYMWFQHFSNPYIPTIEERISPNYIPPHIPTFAEIASFFGICIWLVPFTLFISL
                     SASENTLPSTLNDINRFDKKNDDTTRQRGVGLVKLAIGFAYETFYNFGRLLGYEWDPN
                     QGRII"
     gene            complement(<474676..>477528)
                     /locus_tag="PAS_chr4_0235"
                     /db_xref="GeneID:8200906"
     mRNA            complement(<474676..>477528)
                     /locus_tag="PAS_chr4_0235"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493600.1"
                     /db_xref="GeneID:8200906"
     CDS             complement(474676..477528)
                     /locus_tag="PAS_chr4_0235"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493645.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0235"
                     /db_xref="EnsemblGenomes-Tr:CAY71466"
                     /db_xref="GeneID:8200906"
                     /db_xref="GOA:C4R791"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C4R791"
                     /translation="MSMEALNTHLVNHYWSSGYEKGINHVFSILWENHANLVKLEKLL
                     KGYQSKLVSSRVDLLNDWINTAEQDLFDLNGTFPDSKKKSVNDMLNLIINRTIDEADN
                     ELALSSQLTNQILSPTQQYIAKYKNFLNYVETELQNSFNEYDDCLTETRNLKDKLVKH
                     ILTISDLSTNSSDHAIIPTNIQHSLASFTSKISNLNLKSKAMTEKEQEREIELRESLQ
                     RLAEDNSDNISSDSEPSEAEDNLKQFEDEHPAYVFSKDFPIVLCDKLLGFNSIEEFKG
                     FAIKLVKEIPLERSKIPFMSSYIESIKGTDLIDWMILNIAPPSSRDVSKRAGAISRYQ
                     VEKICQRLLDLGLIKSKSLLQFSSYKFRSDDDRATFEWTALMKDILEFDSNQVEEKKR
                     SYIEERSKDRAARREKRIQAKREARLAKRLAKEKDLAKLSTATTQPSLAPTISITPSG
                     TTNTKLNHYLLTYEPLYQDFVLANQHLSQARGQLETNISHFYNAIEEHEVGRAKFLYD
                     VISKFTEITHNTTVKNASISEQSLKGTQDYDDSSTVQEINDFLKANIPSNKTFKTKPS
                     WVKNAIKISKPYIENELGGYLSVNPVDNQLWNTVKAYEYNSSYLQARSQFHKTKSLLF
                     GSEVSSQVTNSNESDLSTKSVPLFLMKVLERISASGFDKTLWTKPYELITATQLRNLY
                     YMNTHNWEMLFSEEDNKVSVDEFVMDQFINKLEELYPDNVAIWILLLKLWLLELSDSL
                     LGQFSYTSLVKLFSKEESASSDLMKVLELELPQANAAATWYLFNYLSDRIDASTQDEL
                     GKQLNNSEAIGSIPFVHFILRPPPDVKQQDSFNMIPSAVGDRLLANLLNRNFLQSLKQ
                     MVIDKEEVNAQREKRLSKLRAEQDLSIEQNRSRSNTANSGSSDKLRPFSLGSNISNSV
                     ETDSTSKQPRNLPFISPTRRPTPSIETPDSPSTSRN"
     gene            complement(<480926..>482569)
                     /locus_tag="PAS_chr4_0238"
                     /db_xref="GeneID:8200907"
     mRNA            complement(<480926..>482569)
                     /locus_tag="PAS_chr4_0238"
                     /product="Subunit of TFIIH and nucleotide excision repair
                     factor 3 complexes"
                     /transcript_id="XM_002493601.1"
                     /db_xref="GeneID:8200907"
     CDS             complement(480926..482569)
                     /locus_tag="PAS_chr4_0238"
                     /codon_start=1
                     /product="Subunit of TFIIH and nucleotide excision repair
                     factor 3 complexes"
                     /protein_id="XP_002493646.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0238"
                     /db_xref="EnsemblGenomes-Tr:CAY71467"
                     /db_xref="GeneID:8200907"
                     /db_xref="GOA:C4R792"
                     /db_xref="InterPro:IPR004598"
                     /db_xref="UniProtKB/TrEMBL:C4R792"
                     /translation="MSDSSNLLKTTVNDYLENLPESVHNKLYQSSITCLAIFRLLPSL
                     AKFYVMSLLFNEHSVSYIDLTRWIRPDNMTHLVSSSTKSSSSSAVTNFPGAIGKNKMY
                     QNECLKRLKQLNLIKDVRKQWTNPNTGQLTNVVVLQLNPMFRKNFRNALTGSQMSNDL
                     NNDIEMTDVEEVSEEFLDRYSLMKWENILHFMVGSEVPELPSIGVLSLLRHSGLMDIG
                     EENEFIATPKRFKGDNMDLKSMKITQDGFQFLLQDINAQIWQLLLQYLRMSEKLMMNP
                     VDVLNFIFMLGSLELGKQYPVTLLSDTQVIMLEDLVDYGLIYYPEKNRYFYPTRMATT
                     LTSEKTTFKTASMSMNQVLEGGPEVKDHGSIVLETNFKLYCYTTSPLQIAILNLFVHL
                     RTRFANMVTGMITRESVREALRNGITADQIIKYLETHAHSQMKKLAEEKLLKKLEFDS
                     NATETQQIGSQVKLEVIPPTVVDQIKLWQLEMDRLQTFAGFLFKDFANAQEFEQLANY
                     ADEVGVMLWRDDDKRKFFVTEEGIGQLNDYANRLKRHRA"
     gene            <482791..>486267
                     /locus_tag="PAS_chr4_0239"
                     /db_xref="GeneID:8200908"
     mRNA            <482791..>486267
                     /locus_tag="PAS_chr4_0239"
                     /product="Second-largest subunit of RNA polymerase III"
                     /transcript_id="XM_002493602.1"
                     /db_xref="GeneID:8200908"
     CDS             482791..486267
                     /locus_tag="PAS_chr4_0239"
                     /codon_start=1
                     /product="Second-largest subunit of RNA polymerase III"
                     /protein_id="XP_002493647.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0239"
                     /db_xref="EnsemblGenomes-Tr:CAY71468"
                     /db_xref="GeneID:8200908"
                     /db_xref="GOA:C4R793"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:C4R793"
                     /translation="MPPRKKPLNKPVKTEEADDAFGELLKPIYKGKALADPINTAEDK
                     WNLLPAFLQVKGLVKQHLDSFNYFVDKDLKKIIKANEKVLSDVDPEFYLKYLDIRVGY
                     KSTEDLQKVKRNMIPPHQCRLSDTTYSAPIYVDVEYTRGRKIIMHRDLEIGKMPIMLR
                     SNKCILESKDESQMASLCECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADDKKQI
                     VQASVTSSTHERKSKTYVVTKNNKIYLKHNSISEEVPIVLVLKAAGIVSDLEIMQLVC
                     GDDSTYQDLFTINFEEAAKLDIHTQRDALEYIGKRVKTMRRLGAPKLSIYQEGVEAIA
                     NTIVAHISVEDLNFREKAIYLAIMTRRVVMAMHNPTMIDDRDYVGNKRLELAGQLMSL
                     LFEDLFKKFNSDFKANIDKILKKPNRASEFDALLSINVHSNNITTGINRAISTGNWSL
                     KRFKMERAGVTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTSDT
                     PEGEACGLVKNLALMTHITTDDEEEPVRKICYLLGAEDIKIVDSSVISSRSNFGVYLN
                     GTMIGVIRYPTVFVTKFRKLRRSGKVSAFISIYINSHHKAVHLAADGGRICRPLIIVE
                     NGVSKVEAHHLQKLKDGEWQFDSFLTNGLVEYLDVNEENDSLIALYEKDIKNYTTHLE
                     IEPFTVLGAVAGLIPYPHHNQSPRNTYQCAMGKQAIGAIGYNQFNRIDTLLYLMVYPQ
                     QPMVKTKTIELIGYDKLPAGQNATVAVMSYSGYDIEDALVLNKASIDRGFGRCQVFRK
                     NTTLLKRYPNHTKDILGGMSVNDQGEPIFQHRSLGPDGLGEVGLPLESGQVYVNKFVP
                     INSEESIIGQTPDDSQRKEQHRETPMVYRGPEPSYIDQMMMSLGENDQVLVKALLRQT
                     RRPELGDKFSSRHGQKGVCGIIVQQEDLPFNDDGISPDIIMNPHGFPSRMTVGKMIEL
                     ISGKAGVLDGSLQYGTCFGGSDLKEMSQILIDKGFSYSGKDQLYSGITGECLQAYIFF
                     GPIYYQKLKHMVLDKMHARSRGPRAVLTRQPTEGRSRDGGLRLGEMERDCVVAYGASQ
                     LLLERLMISSDAFEVDVCNTCGLMGYNGWCPTCKSSEFIIKMTIPYAAKLLFQELVSM
                     NIAPRLELGDVF"
     gene            complement(<486364..>488484)
                     /locus_tag="PAS_chr4_0240"
                     /db_xref="GeneID:8200909"
     mRNA            complement(<486364..>488484)
                     /locus_tag="PAS_chr4_0240"
                     /product="Ferric reductase, reduces siderophore-bound iron
                     prior to uptake by transporters"
                     /transcript_id="XM_002493603.1"
                     /db_xref="GeneID:8200909"
     CDS             complement(486364..488484)
                     /locus_tag="PAS_chr4_0240"
                     /codon_start=1
                     /product="Ferric reductase, reduces siderophore-bound iron
                     prior to uptake by transporters"
                     /protein_id="XP_002493648.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0240"
                     /db_xref="EnsemblGenomes-Tr:CAY71469"
                     /db_xref="GeneID:8200909"
                     /db_xref="GOA:C4R794"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:C4R794"
                     /translation="MLQFIPVLLASLLFTIAQAKYSDPGAMALYSCSYFSFLFDYTPI
                     TKDTYWEINCHYEPAFQTIAICLNQFDDGSYAERGFHALQESCSKYGSLSNLTQDYFE
                     DQAKNGSQYLIQADSFNATADILHNPVQLNLTFVDLYYKSYVQFYWNFDFSQDTVAIV
                     LHVYVVGILLMFVLVNLMKKFGLITKFKGNRVINAFRRYISLPALVGRKHTEAAGFWK
                     VFTTLLPTRLDFFIIGGYLVAYIVMMSVHYNVAHDVIFLNKTEARIRYFADRTGIIAF
                     VQLPLLFLFGGRNNILSFCTGLNFSSFIVYHKWIARIMVFNAIMHSAAWTWLERDYLP
                     EMFADTYWKWGVVATIVCSLMVLFSFHCVRNTMYEFFLYAHIILGCLFVVGIWYHCIE
                     LGWMQWVYASIAIWAFDRLIRLVRIAYYGFPKATIQVVGEETMKVSFPKPSRWKSNPA
                     NHIFLYFGDKLRFFQSHPFTPVIYDDKIVVYIKVKKGITKKIYEQAVKTANGQITMRV
                     GVEGPYGHSSPLHKYDRALLVAGGNGIPGPFDHAFKLVTDKNPTIASQKVKLVWISQS
                     FHTIKSFLPELVLLKEKCPQNKALEVQIYLTRETPIPMYVSEDDFKDTVNKEKESVSD
                     SFSLLEIDNVSVDNIKDFVHFSFGRPDLKSIIVDEFTEAEDCSVGIVTCGPTKMVDEI
                     RELVAHNLNKCKGRVDLFEELELW"
     gene            <490508..>492667
                     /locus_tag="PAS_chr4_0241"
                     /db_xref="GeneID:8200910"
     mRNA            <490508..>492667
                     /locus_tag="PAS_chr4_0241"
                     /product="Putative ATPase of the AAA family"
                     /transcript_id="XM_002493604.1"
                     /db_xref="GeneID:8200910"
     CDS             490508..492667
                     /locus_tag="PAS_chr4_0241"
                     /codon_start=1
                     /product="Putative ATPase of the AAA family"
                     /protein_id="XP_002493649.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0241"
                     /db_xref="EnsemblGenomes-Tr:CAY71470"
                     /db_xref="GeneID:8200910"
                     /db_xref="GOA:C4R795"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R795"
                     /translation="MFKRKHKHSQTPLNTLLELYNEVANTALNNIHLEQSGNPAEALQ
                     GWKALHTTVLYKLDAVDKVINNIALTEEEEHVLSEIQILQSQSDDHLTRLQTKLNEDN
                     QARQKQRSKSNPGSLTSSSLNVPTLRTSNPQPMQTRKRAMQKTLRTTTSNNRSATSNN
                     AKTAASLSWTQDEEHAHRNNWSPSSSLNVNKATKSYSSMFDSFSDTIMTKSDTALKEL
                     EREATLRELEKAGNSSREQRTKSPHLATEENLIDLDTELQSLELTRLKSPPSNSATEP
                     SSTHTNSTPASRKAAYVYKQPSVPKFVITKQKQSYKNPSNTSARPQLTRPPPKSASLV
                     SVKKTINPATASSTKPSSSSKKPSTPRSRSVPTSRKKSPSLSPNRPPTKKESLSSDTS
                     DNSQDDSDKIDDSEALIASLRGVDPLAAKQILNEIIVHGDEVHWEDIAGLESAKNSLK
                     ETVVYPFLRPDLFSGLREPARGMLLFGPPGTGKTMLARAVATESKSTFFSISASSLTS
                     KFLGESEKLVRALFQLAKKLAPAIIFVDEIDSLLSSRNQDGENESSRRIKNEFLVQWS
                     DLTKAAAGKDSGEDLQRVLVLAATNLPWAIDEAARRRFVRRQYIPLPEEETRKAQLSK
                     LLSYQNHTLSNEDFTALVKLTEGFSGSDITALAKDAAMGPLRQLGDKLLMTNKNEIRP
                     VSLEDFKSSLNYIRPSVSKEGLLQFEEWAKLYGSSGV"
     gene            complement(<492720..>493973)
                     /locus_tag="PAS_chr4_0242"
                     /db_xref="GeneID:8200911"
     mRNA            complement(<492720..>493973)
                     /locus_tag="PAS_chr4_0242"
                     /product="Nuclear type II J heat shock protein of the E.
                     coli dnaJ family"
                     /transcript_id="XM_002493605.1"
                     /db_xref="GeneID:8200911"
     CDS             complement(492720..493973)
                     /locus_tag="PAS_chr4_0242"
                     /codon_start=1
                     /product="Nuclear type II J heat shock protein of the E.
                     coli dnaJ family"
                     /protein_id="XP_002493650.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0242"
                     /db_xref="EnsemblGenomes-Tr:CAY71471"
                     /db_xref="GeneID:8200911"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:C4R796"
                     /translation="MVKDTEYYDVLGVSPDAKDIDIKKAYRKKAMLTHPDKNPNDSEA
                     AKKFQIIGEAYQVLKDPQLRKNYDEFGKEQAVPEQGFEDPGEMFSSIFGGESFKDWIG
                     ELSMMKDLTRTTEVLEKLDIDEETVPETTDVSHPNSETSEAKPTLTEKDRKKKVTAKQ
                     REELLKLRDEQREEQKKRVEELSEKLVNKINLLVDTTQESEIKPESIQNFKDKVLNKE
                     IEDMKIESFGLEMLHLIGKIYIFQSTSFIKAQKPIMGKFSKVFSSVKQKHNSAKSLFG
                     MLSSAVDAQTTMEEISKMQEKSGSLDEYTKAEMDRLMTGKALHTAWVSSKYEIQNTLK
                     KVCANILHDKAVNLPVRVMRAKALLIIGNEFLNAKRSPDEEEDARVFEELVNEAKGVR
                     VKDLRNPKRHNPITVDVHENVNGKE"
     gene            complement(<494135..>495982)
                     /locus_tag="PAS_chr4_0243"
                     /db_xref="GeneID:8200912"
     mRNA            complement(<494135..>495982)
                     /locus_tag="PAS_chr4_0243"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002493606.1"
                     /db_xref="GeneID:8200912"
     CDS             complement(494135..495982)
                     /locus_tag="PAS_chr4_0243"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002493651.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0243"
                     /db_xref="EnsemblGenomes-Tr:CAY71472"
                     /db_xref="GeneID:8200912"
                     /db_xref="GOA:C4R797"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="UniProtKB/TrEMBL:C4R797"
                     /translation="MTTKRANSTSKAAIKKQDITIKPTDEEEAKARTYFNQEIFDDEY
                     KNGLKSSIKTSKPYHWGTITELMNDQLLRDVRAEILSEIVFTKKETDIYKVYQSGDLA
                     NMSGLNWDDLSRLPNLYKLRSAIYSKTFRDYISYVTGCGKLSGIKTDMSINTYRKGCH
                     LLTHDDVIGTRRVSFILYMPEPGRTWKPHYGGSLRLFDSIVPNVPKSDFECKLTPQFN
                     QIAFFTVQPGLSFHDVEEVRVDKHRLSIQGWFHIPQKGEEGFIPGEQERTEARSTLQQ
                     LESKGLKEYDFPKIRRTEISPDDISHYEADVDRNLVLSQQDLTYLGQFINPAVLNTSS
                     VKKLNESFVNESVIEIQSFLNNEYASILKKVLRRHELDGSLPQKQDEVEFPWKLAIPP
                     HKQRYIYMDGLDEQPIDNADTIDFVNHVAPQELPNFGMTSKYFSQLDSAQSDKKHETK
                     EDNGYAASSKLCELASLFKSIAFKKWLTLVSGLVVVRDQVLVRRFRPGQDFILATQLD
                     KTGEGLIDGILEATLNLTPSSGWETGEVGGYELCMMSNDDNEEDDDPAIYKQSENDED
                     VLYTSQASWNKLTIMLRDSSVLKFVKYVSFNAPGSRWDINATWDAKSTD"
     gene            <496744..>497475
                     /locus_tag="PAS_chr4_0244"
                     /db_xref="GeneID:8200913"
     mRNA            <496744..>497475
                     /locus_tag="PAS_chr4_0244"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493607.1"
                     /db_xref="GeneID:8200913"
     CDS             496744..497475
                     /locus_tag="PAS_chr4_0244"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493652.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0244"
                     /db_xref="EnsemblGenomes-Tr:CAY71473"
                     /db_xref="GeneID:8200913"
                     /db_xref="GOA:C4R798"
                     /db_xref="InterPro:IPR012923"
                     /db_xref="UniProtKB/TrEMBL:C4R798"
                     /translation="MSDELDPDNVLGASADTQSKDIDETNQDLLGPKKSTSTRRKLYV
                     LNEDVLLSSKGYPDLLRQCQNFKFKKRKPYKEFTRSYHMENMEKLLQMYQLWGHQVYP
                     RANFNDFTKVCARASNRPRVKRWRVQTTKDEINRKFYNETGQFDDILVENGEKDELPV
                     RESTPGETTVFSNTEPQDSTLNTHLFVDDDDDDIYTTMPSNSTSTSASKDPTHEEMLD
                     IDEPTVQNQELDFQDELEAMREMGM"
     gene            complement(<497544..>498194)
                     /locus_tag="PAS_chr4_0245"
                     /db_xref="GeneID:8200914"
     mRNA            complement(<497544..>498194)
                     /locus_tag="PAS_chr4_0245"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493608.1"
                     /db_xref="GeneID:8200914"
     CDS             complement(497544..498194)
                     /locus_tag="PAS_chr4_0245"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493653.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0245"
                     /db_xref="EnsemblGenomes-Tr:CAY71474"
                     /db_xref="GeneID:8200914"
                     /db_xref="UniProtKB/TrEMBL:C4R799"
                     /translation="MSETTAEQTVVEQFHLPQPFWPTTKTKEGEYVPKDSIREASKVF
                     IGSGVLLGGMHFRRLMQYKKGSARPGLAKYLNLFSLSKSQLIGFPVALGAFSFLSHSF
                     ANLQEGQTATGEFAASSIASLIGLSIFRTKKPLSSNVAIAVGMGSLFGFLTWAGNFNL
                     GDNSYRAALEAGNGNEGGFDNKVIKTERQGFWEGVYRRPLSQTVEDLGEGRGIITQ"
     gene            <498569..>500821
                     /locus_tag="PAS_chr4_0932"
                     /db_xref="GeneID:8200915"
     mRNA            <498569..>500821
                     /locus_tag="PAS_chr4_0932"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493609.1"
                     /db_xref="GeneID:8200915"
     CDS             498569..500821
                     /locus_tag="PAS_chr4_0932"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493654.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0932"
                     /db_xref="EnsemblGenomes-Tr:CAY71475"
                     /db_xref="GeneID:8200915"
                     /db_xref="GOA:C4R7A0"
                     /db_xref="InterPro:IPR006179"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C4R7A0"
                     /translation="MGLLEKRVITLSIVTLLVLVNLLDFRSVSNGSTSQDYRANNILF
                     KLNLRHADAIDSRQQLQSRFINYYDQLRSFNTGELNFLHTTDTHGWYMGHPTQPQYSS
                     DWGDFLSFVQRLKDLLFQEGKDLILVDSGDRHDGNGLSDCTSPNGLRSNNIFSAIDFD
                     LLTVGNHELYSEAVSELEFSTVIPHYGDRYISTNVEYLTGDGEWVPFGNSQYRVWKSK
                     NTRRTILGLSFMFDFRYTGNERVRVTSISTMIQTGSLDAIIETIKSNHRPEIIVVVGH
                     LPVHHVWAESRMLHDYLRSKFPDKIIQYFGGHSHIRDFVVHDDLSTGLQSGRFCETIG
                     FLSMNNIDSATSKDTSNWAWDNIDRKYIDFNLHSMLFHTNISKVSEFNTEEGVTLSDK
                     IISTVSELNLTKEYGRVPRNYYLAGRPYPHHQNLYSLISDEILPTLPYRVKLGDEPFE
                     PSNARVVIINTGAIRYDLYKGIFSENTKYTISPFLNQWRVIPAVPKKIALQILPTLNQ
                     LDYIISNLDKNADQDFSLDIMSDYYNGDHSSRDRLFGQDIVDLTTLMSPFARSNLIEK
                     LIMMGKFQSDVRNAKEKEQQPFLPHHEQHVLVKLLEFFNWNKLTHGYVTNDDFGDEGD
                     DTKHKQISFYEPPCVIQSYQRHYNDSISNIIFDLVIPDDEDEVIDVVFYDFIEPYILY
                     ALRQILNVDLDKRSWVQPREPVYLQSATKVGNTTLYQSFLRSIQVYNDVENEWNVGEM
                     LKRYVTENWA"
     gene            <501177..>502241
                     /locus_tag="PAS_chr4_0246"
                     /db_xref="GeneID:8200965"
     mRNA            join(<501177..501190,501407..>502241)
                     /locus_tag="PAS_chr4_0246"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_002493610.1"
                     /db_xref="GeneID:8200965"
     CDS             join(501177..501190,501407..502241)
                     /locus_tag="PAS_chr4_0246"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_002493655.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0246"
                     /db_xref="EnsemblGenomes-Tr:CAY71476"
                     /db_xref="GeneID:8200965"
                     /db_xref="GOA:C4R7A1"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:C4R7A1"
                     /translation="MARGPKKHLKRLAAPSHWMLDKLSGTYAPRPSPGPHKLRESLPL
                     IVFLRNRLKYALNGREVKAILMQRHVQVDGKVRTDATFPAGFMDVITLEATNENFRLV
                     YDVKGRFAVHRITDEEATYKLGKVKKVQLGKKGIPYLVTHDGRTIRYPDPDIKVNDSI
                     KIDLATGKILDFVKFDVGKLVMVTGGRNLGRVGVITHREKHEGGFDLVHIKDALENQF
                     VTRLSNVFIIGEANAPIISLPKGKGIKLSIAEERDQRRQQQGLDVEAEEEVEEEADVD
                     SEVDFE"
     gene            <502438..>503268
                     /locus_tag="PAS_chr4_0933"
                     /db_xref="GeneID:8200916"
     mRNA            <502438..>503268
                     /locus_tag="PAS_chr4_0933"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493611.1"
                     /db_xref="GeneID:8200916"
     CDS             502438..503268
                     /locus_tag="PAS_chr4_0933"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493656.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0933"
                     /db_xref="EnsemblGenomes-Tr:CAY71477"
                     /db_xref="GeneID:8200916"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C4R7A2"
                     /translation="MYSLSNRVLPSYTSRNVSKRIVLSCSRGLIRSSRFNSTTTPLQT
                     PRRGGYWKYYLGAFALGGLAASQLPLYSIYQLSATSLPEDGDSFEYAEYMTSLELQLQ
                     GLPIVKALSNDPRYVKFRAWQNLEGNILENSLIGGTLNVPGGFAVMPVAFVNESTEEM
                     ITVVHVGRKLCGYPLLVHGGILATILDENLKRCSILEFNKKKNLNLKYNDEMSYNMIH
                     TKTLTISYRSPTLADNFIVIKSQCQPGGDKDSVNVKANIETVNQRVLVNGDAVFKIDK
                     "
     gene            complement(<503286..>503921)
                     /locus_tag="PAS_chr4_0247"
                     /db_xref="GeneID:8200966"
     mRNA            complement(<503286..>503921)
                     /locus_tag="PAS_chr4_0247"
                     /product="5,10-methenyltetrahydrofolate synthetase,
                     involved in folic acid biosynthesis"
                     /transcript_id="XM_002493612.1"
                     /db_xref="GeneID:8200966"
     CDS             complement(503286..503921)
                     /locus_tag="PAS_chr4_0247"
                     /codon_start=1
                     /product="5,10-methenyltetrahydrofolate synthetase,
                     involved in folic acid biosynthesis"
                     /protein_id="XP_002493657.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0247"
                     /db_xref="EnsemblGenomes-Tr:CAY71478"
                     /db_xref="GeneID:8200966"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:C4R7A3"
                     /translation="MSKSIVRSQIKKCLSQLSIDYISHQSNHIASLLLTLPEYQNASK
                     IALYMNMPHGEVQTLPLIRKIFEDGKRLFLPRITKLEDGSFQRFPGQKSYLQMLEVPN
                     LSQVLTLKPRGVYKLLEPESNSGVNGLESGIDIVVLPGVAFTKDCYRMGHGAGFYDDY
                     IKRYQESTGNPRPLLIGIGLKEQLVDSLPIEAHDEKLDYVLIDSDIYRRSS"
     gene            <504239..>505456
                     /locus_tag="PAS_chr4_0248"
                     /db_xref="GeneID:8200917"
     mRNA            <504239..>505456
                     /locus_tag="PAS_chr4_0248"
                     /product="Mitochondrial branched-chain amino acid
                     aminotransferase, homolog of murine ECA39"
                     /transcript_id="XM_002493613.1"
                     /db_xref="GeneID:8200917"
     CDS             504239..505456
                     /locus_tag="PAS_chr4_0248"
                     /codon_start=1
                     /product="Mitochondrial branched-chain amino acid
                     aminotransferase, homolog of murine ECA39"
                     /protein_id="XP_002493658.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0248"
                     /db_xref="EnsemblGenomes-Tr:CAY71479"
                     /db_xref="GeneID:8200917"
                     /db_xref="GOA:C4R7A4"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:C4R7A4"
                     /translation="MQTFVKRSIRNIPKMATSAHQNFAKYLATDHMASDLVPLDASKL
                     QVTRTTQPKSKLPKEKLVFGQSFTDHMLTVEFDQASGWGTPEIKPYGPLSLDPSACVF
                     HYAFELFEGMKAYKDSQGKIRLFRPDMNMARFNKSAARICLPTVDGEELIKLISELLK
                     LDQSFVPEGEGYSLYIRPTLIGTSSGLGVGAPDKALLYVICSPVGPYYPTGYKAISLE
                     ATDYATRAWPGGVGDKKLGANYAPCIKPQLSAAKNGHQQNLWLFGEEKFITEVGTMNV
                     FFVFKNADTGKKELVTAPLDGTILEGVTRDSILKLARDRLDPNEWEVNERYYTAHEVA
                     EKAENGLLVEAFGSGTAAVVAPIKNIAFNGKDYDVPLVPGEQYGEMAKTVADWIADIQ
                     YGVVDSEWSRVIN"
     gene            <505605..>505874
                     /locus_tag="PAS_chr4_0249"
                     /db_xref="GeneID:8200918"
     mRNA            <505605..>505874
                     /locus_tag="PAS_chr4_0249"
                     /product="Proposed transcription factor"
                     /transcript_id="XM_002493614.1"
                     /db_xref="GeneID:8200918"
     CDS             505605..505874
                     /locus_tag="PAS_chr4_0249"
                     /codon_start=1
                     /product="Proposed transcription factor"
                     /protein_id="XP_002493659.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0249"
                     /db_xref="EnsemblGenomes-Tr:CAY71480"
                     /db_xref="GeneID:8200918"
                     /db_xref="InterPro:IPR015419"
                     /db_xref="UniProtKB/TrEMBL:C4R7A5"
                     /translation="MTTLDYKLDLNIPLESLQHVEYVKNSLSPDPVLKPTEIQVDFYS
                     SKELLSDDIALIIKFQGQSDRILRVAVNNMIENLKTCIECLEVFG"
     gene            complement(<505948..>507969)
                     /locus_tag="PAS_chr4_0250"
                     /db_xref="GeneID:8200919"
     mRNA            complement(<505948..>507969)
                     /locus_tag="PAS_chr4_0250"
                     /product="DEAD-box protein required for efficient splicing
                     of mitochondrial Group I and II introns"
                     /transcript_id="XM_002493615.1"
                     /db_xref="GeneID:8200919"
     CDS             complement(505948..507969)
                     /locus_tag="PAS_chr4_0250"
                     /codon_start=1
                     /product="DEAD-box protein required for efficient splicing
                     of mitochondrial Group I and II introns"
                     /protein_id="XP_002493660.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0250"
                     /db_xref="EnsemblGenomes-Tr:CAY71481"
                     /db_xref="GeneID:8200919"
                     /db_xref="GOA:C4R7A6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7A6"
                     /translation="MLNLVLFRNELLRTSYFMRGSTVRMFSSRSFQLSSERQETLFEK
                     SHKSSQETVEASENPTIKPINVKAIETPSHVNLINGKHVKDSNLAHHIKQAFMKLVGQ
                     TFTPVQEATIDEFLTAERGLVVRAKTGTGKTLAFGLPLLHKLKHRKHPNVPHVETVIF
                     APTRDLAIQTSDAIHNLMRNCSLPINNKNIEKIVGGQDMRQQIKKCTQFQKPPIVAAT
                     PGRFLDLITNSKNFQSAFTRVENVIIDEADELLSMSFKEDLERIMDKLKELNTSDVDP
                     KFKVLLFSATIDKNVLSLAENIMGKDYKFIDTNVGSESEVNQSVEQTLVVSDSIFHSY
                     AALVDYVYQHKDEPKFKPMIFLPNTYSVDFVFNLLNKIIPKPPMNARDKRDYVCRLHG
                     KLTQGRRNMAQLTFKIRKRAILVCSNVASRGLDFPDVTHVLQIGVNHDVSNYTHRVGR
                     TGRAGKIGKSILFTTDFEQPFVEKLKENGNKFHEVIESKPNEDIERKIRNTVKNEDFD
                     QIATSNLGIYNQLPEKFGKISKKDYVKHCALLYRDMKYGPGGAFEDVEESAQEKPFLS
                     SRAASGLGINTDYSRRYYDIPGSATSRGSSGYRNKSGAGNRGGYRNNDRGGYRKNDRG
                     GFGGENKGGFSRDRGNYKSSGKNSRTWEERGGSSNKNSNNFRNDRYSKY"
     gene            <508463..>510340
                     /locus_tag="PAS_chr4_0251"
                     /db_xref="GeneID:8200920"
     mRNA            <508463..>510340
                     /locus_tag="PAS_chr4_0251"
                     /product="Hydrophilic protein, involved in vesicle
                     trafficking between the ER and Golgi"
                     /transcript_id="XM_002493616.1"
                     /db_xref="GeneID:8200920"
     CDS             508463..510340
                     /locus_tag="PAS_chr4_0251"
                     /codon_start=1
                     /product="Hydrophilic protein, involved in vesicle
                     trafficking between the ER and Golgi"
                     /protein_id="XP_002493661.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0251"
                     /db_xref="EnsemblGenomes-Tr:CAY71482"
                     /db_xref="GeneID:8200920"
                     /db_xref="GOA:C4R7A7"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:C4R7A7"
                     /translation="MLHLNEPIVDNGSDIQAELTWKVLILDSRSTAIVSSVLRVNDLL
                     SSGITMHSNIRSKRAALPDVPVIYFVEPNAENINFIIDDLERDQYAHFYINFTSSLNR
                     DLLEEFAKKVATIGKSYKIKQVYDQYLDYIVTEPNLFSLDLVNIYSQLNNPNSLEDEI
                     NKVADKISNGIFAAILTMNGIPTIRCCRGGPAELIASKLDQKLRDHVINTKSSASFTN
                     SKLVLILLDRNIDLASMFAHSWIYQCMVSDVFELKRNTIKIPSQKPNESTKEYDIDPK
                     DFFWAANNSLPFPDAVENVENELSRYKADAAELTRKTGVSSLQDIDPNAITDTTDIQL
                     AVKSLPELAFRKSILDMHMKVLASLLQELESKSLDSYFEIEQNYKDPKNQKQFISILN
                     NGNEHTLNDKLRTYIMLYLLTDLPGSFVEECEEYFKKNSAELGSLSYIKRAKEVIKLS
                     NYELSMSIDASHSTTSGLVNEAQKSALFQGLSSKLYGLTDGGSRLTEGVGSLITGLKN
                     LLPDKKQLPITNIVESIMEPSLATQESIKLTDDYLYFDPISTRGVHSKPPKRQQYNNS
                     IVFVVGGGNYLEYQNLQEWVTKTNTSNVNGTKSVIYGSTSIVTANEFLKECSLLGAEA
                     K"
     gene            complement(<511111..>511764)
                     /locus_tag="PAS_chr4_0252"
                     /db_xref="GeneID:8200921"
     mRNA            complement(<511111..>511764)
                     /locus_tag="PAS_chr4_0252"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493617.1"
                     /db_xref="GeneID:8200921"
     CDS             complement(511111..511764)
                     /locus_tag="PAS_chr4_0252"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493662.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0252"
                     /db_xref="EnsemblGenomes-Tr:CAY71483"
                     /db_xref="GeneID:8200921"
                     /db_xref="GOA:C4R7A8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4R7A8"
                     /translation="MTNTSVCLAEPVSLTSTYKKRMASPNGYGNNFWQMPLLHPQGSL
                     KQPVKNRASKDSEQQYNSFEAPRLARTMTTPTDPVDDMGISNKVTLEDVMFQNERHGS
                     SSRSDQYTVTDSCQSATPELQMDSRSPDSESSNNKKSKRSRNGCLTCRYRKKRCCETK
                     PACKECSRLGLDCKWPAPGTENKNRSKNNRQSRDEMDHEVYGTIKILRGIVAYKSDE"
     gene            <512697..>513440
                     /locus_tag="PAS_chr4_0253"
                     /db_xref="GeneID:8200922"
     mRNA            <512697..>513440
                     /locus_tag="PAS_chr4_0253"
                     /product="Mitochondrial ribosome recycling factor"
                     /transcript_id="XM_002493618.1"
                     /db_xref="GeneID:8200922"
     CDS             512697..513440
                     /locus_tag="PAS_chr4_0253"
                     /codon_start=1
                     /product="Mitochondrial ribosome recycling factor"
                     /protein_id="XP_002493663.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0253"
                     /db_xref="EnsemblGenomes-Tr:CAY71484"
                     /db_xref="GeneID:8200922"
                     /db_xref="GOA:C4R7A9"
                     /db_xref="InterPro:IPR002661"
                     /db_xref="InterPro:IPR023584"
                     /db_xref="UniProtKB/TrEMBL:C4R7A9"
                     /translation="MLPATLFTSVHRSIVSSRVRSIVPSVAPAIFSCRYITHNAVLLK
                     AKKKHSNHHEIVEEAPEVVNPKQVLKEIEDRFKLTLQEHQKKINEIKLGKSNPKIFDS
                     LKVSIAKDLQPFPSVAQTTSKGRNLLVTVFDPSLVKYVVSSILSSGLNLNPEVDPKNP
                     QLLKVPLTAPTAETKKETLKALKNNLEHYRHSITNKHSLASIRAHYLKEFKGNKEDSI
                     KKLVNEIEKVHKDYSNSIHEQFKKVEKTL"
     gene            complement(<513441..>515351)
                     /locus_tag="PAS_chr4_0254"
                     /db_xref="GeneID:8200923"
     mRNA            complement(<513441..>515351)
                     /locus_tag="PAS_chr4_0254"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002493619.1"
                     /db_xref="GeneID:8200923"
     CDS             complement(513441..515351)
                     /locus_tag="PAS_chr4_0254"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002493664.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0254"
                     /db_xref="EnsemblGenomes-Tr:CAY71485"
                     /db_xref="GeneID:8200923"
                     /db_xref="GOA:C4R7B0"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:C4R7B0"
                     /translation="MNSNLTQLLQQLNSTLHLTSQQLMSIEIQELALLKHLPDSVSQS
                     SYFIPVNIFVFVLLTLGLTYVFIYRKVSPDNDKPIKFEWATPDEAKPHWKGKRLYPTG
                     VRASEDPSMIQCYCPATGQFLGKFKAFAPEDIDNAIRESQIAQKEWKKTTFSQRKKVL
                     RTLNEYIANNQEGIARVACRDSGKTMIDASMGEILVTLEKLNWILKNGEKALKVSSRP
                     GPANILMQYKKAEVRYEPLGVVGALVSWNYPFHNLMGPLLASIFTGNAIVIKCSENVY
                     WSSRWFIGLAKMALKVCGHDENLVQLVCTWPEDADYFTSHESLSHLTFIGSKPVAHKV
                     LEAASKSLTPVVVELGGKDSIIVCDDVMDVEAISSIILRGTFQSAGQNCIGIERVIAM
                     PKVYDQLVQILSHRVQELRLGSDIDQLEDIDMGAIITDARFDAMEKLVEDAISKGACL
                     LSGGKRYLHPNYPQGHYFQPTLLIDVTSDMDIAQNEVFGPILTMMKVDDVEEAIRVTN
                     DTPYGLGSSIFSRSFKTADYIANNIESGNVAINDFATFYVCQLPFGGVKKSGYGKFGG
                     EEGLQGLCVAKSVCYDRFSFINTQIPKPLDYPIANEKKAWKFVTALNKCGYHNSKWEK
                     VKSLFQLARNAN"
     gene            complement(<515603..>516178)
                     /locus_tag="PAS_chr4_0255"
                     /db_xref="GeneID:8200924"
     mRNA            complement(join(<515603..515871,516103..>516178))
                     /locus_tag="PAS_chr4_0255"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493620.1"
                     /db_xref="GeneID:8200924"
     CDS             complement(join(515603..515871,516103..516178))
                     /locus_tag="PAS_chr4_0255"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493665.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0255"
                     /db_xref="EnsemblGenomes-Tr:CAY71486"
                     /db_xref="GeneID:8200924"
                     /db_xref="GOA:C4R7B1"
                     /db_xref="InterPro:IPR005124"
                     /db_xref="UniProtKB/TrEMBL:C4R7B1"
                     /translation="MGLGNFWLERNITNKHLVRSSNFAEDRTQRLKEAKLDAAKDIKE
                     YKQKKEKELKEHEAQFSGSNDDLEKAAESEVQTELVEIDKSAEAKKEDVVKLLLDAIT
                     HPKPELHVNARA"
     gene            <516405..>517445
                     /locus_tag="PAS_chr4_0256"
                     /db_xref="GeneID:8200925"
     mRNA            <516405..>517445
                     /locus_tag="PAS_chr4_0256"
                     /product="Essential protein required for the accumulation
                     of box C/D snoRNA"
                     /transcript_id="XM_002493621.1"
                     /db_xref="GeneID:8200925"
     CDS             516405..517445
                     /locus_tag="PAS_chr4_0256"
                     /codon_start=1
                     /product="Essential protein required for the accumulation
                     of box C/D snoRNA"
                     /protein_id="XP_002493666.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0256"
                     /db_xref="EnsemblGenomes-Tr:CAY71487"
                     /db_xref="GeneID:8200925"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:C4R7B2"
                     /translation="MEKKKEKCHMCSDKVSKYKCPVCATMTCSLACVKQHKVEMDCSG
                     IIDYTKYISKKELNNISVNRDYNFLMKVGRELDIVKDDTNKKAYNIINGGKRNRPGNQ
                     ERNKRLKENDNEEEFGMNAAPLVVKRDVNVRMLPPGMFRSNSNKSGFDKKRSCFTWTI
                     EWILLDNEGKTINKATSFRLAENIPLGTLFPLKAFSKDLSTTDNLKFYIRDYSTIEES
                     KKLIELDSNQMLGTLLKGKTVIEYPTIYASHFDQTESEDSDNDSDTSSDSSTDDSDSS
                     DSSNDSDNDDPAQDDISEKDTSNISCNNSDPESPPEESSTQQLQDIPTTDSNTLTKNC
                     LEETQICPPTGP"
     gene            complement(<517432..>519429)
                     /locus_tag="PAS_chr4_0257"
                     /db_xref="GeneID:8200926"
     mRNA            complement(<517432..>519429)
                     /locus_tag="PAS_chr4_0257"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493622.1"
                     /db_xref="GeneID:8200926"
     CDS             complement(517432..519429)
                     /locus_tag="PAS_chr4_0257"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493667.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0257"
                     /db_xref="EnsemblGenomes-Tr:CAY71488"
                     /db_xref="GeneID:8200926"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="UniProtKB/TrEMBL:C4R7B3"
                     /translation="MSSKALRKLNKLQLEDELKGIASFDEPETAEGLPTKSKAQNSFA
                     FLPSEDDSDDDSQQDDRIVSSVSRRAKPTEKVVDESSDEFFDATEENKLVIKKPLKGK
                     SSGKHKKTQNTKQPMNSDEELDQILEQLKIKQKEEELIVSESDSDNEYECTETVDTVD
                     SGYKYFTLKKFAKTVKLLKIHTANLDPDYEFRSLFGKISDETIKDADSTSSGFVSPEV
                     LQQIKKLSRMTRGWGGRDHRSIPGTTRKLKLTKIRDDWIPTVKKSLAMEEIPKQELIS
                     LRVASRPDDWRDALEEEVSKEISQDIKYYRFKFNLDHLAENANFYASVVIAPDHQALI
                     DSLQRSPYHIPTLLQISTILMRQGDKSNSSGLVERALFVFDRGFLQNFELGNGKGRFP
                     FESFLNRQFYLALFRYIEALTQRSTFLTALTYCKLLLSLNPTEDPYGVRFFIDFYCIM
                     SEEYEYLIDLSQSSLVTTYKEWLTPGIAFSTSLAYLRSGETTENVHKAATSLKSAFQK
                     FPYIGFKIYESLNSIITSQITKLFKNIPAEQEILAQHYIVRLKTLWSDPKSLTFLEEE
                     LYKSCSTYSGTPEADSGLTLPTNLLRHVILSGEGTVMAKLPETFWNQNEVYEFDVLPP
                     TNGDSITDYMDDKIVTEAVMQATSGDSDMTAIRRLIETMDQ"
     gene            complement(<519551..>520604)
                     /locus_tag="PAS_chr4_0258"
                     /db_xref="GeneID:8200927"
     mRNA            complement(join(<519551..520513,520566..>520604))
                     /locus_tag="PAS_chr4_0258"
                     /product="Essential component of the Rix1 complex (with
                     Rix1p and Ipi3p)"
                     /transcript_id="XM_002493623.1"
                     /db_xref="GeneID:8200927"
     CDS             complement(join(519551..520513,520566..520604))
                     /locus_tag="PAS_chr4_0258"
                     /codon_start=1
                     /product="Essential component of the Rix1 complex (with
                     Rix1p and Ipi3p)"
                     /protein_id="XP_002493668.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0258"
                     /db_xref="EnsemblGenomes-Tr:CAY71489"
                     /db_xref="GeneID:8200927"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024679"
                     /db_xref="UniProtKB/TrEMBL:C4R7B4"
                     /translation="MAKKKTNKQRDFQKKKLKVGKSNNLPNNFTDTSFKAKSITLPNQ
                     TLVKSHDDKELAHYLAMVRHHSPSTRKEILIHLDKHLPSDPAQYKEILKNVTPLIIDT
                     SPSVREALVTLLDDIGSKYPTFIELHANSIVLFISSAMSHINTDIRNDSTKFLRVILK
                     YGPGIIVRSSWVKMLKNYCQLMNWHLEEAKKSLVLAVNSSSVIVNKKPKESHLQVLAE
                     FLKLGTSGEKEAQSTLKFKAIHPLTAVYMFPTTPQPFGQLNLYKKTELIVSHKESEEE
                     TIRDLDSINCEDEHTRITVFIQHFKKPVIDGLKSLIKEGGGLGKEANSLLTAVESIV"
     gene            <520736..>521863
                     /locus_tag="PAS_chr4_0934"
                     /db_xref="GeneID:8200928"
     mRNA            <520736..>521863
                     /locus_tag="PAS_chr4_0934"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493624.1"
                     /db_xref="GeneID:8200928"
     CDS             520736..521863
                     /locus_tag="PAS_chr4_0934"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493669.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0934"
                     /db_xref="EnsemblGenomes-Tr:CAY71490"
                     /db_xref="GeneID:8200928"
                     /db_xref="GOA:C4R7B5"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:C4R7B5"
                     /translation="MDELQSLSLDEKRSNVDHFVDYLINNGEEAESTVRCRRPEYIND
                     PMDIDSTVCEDEPMLMDNDLDFNLDISLNDKLQFQEEKEAKKPLHSPKNTRNGILNTM
                     LSPTSLGLKVATASNNTTPNKENHWEEIIPNNENPVGNTNTLRERFQNVDWSKTPISL
                     QMHHHHYYPPADNISNYNQINNKYTTDNNEKLPLPWQPDSSPEDKTPYIITSCFQLLL
                     NFTATVYCFSLIYGCIKTVKSDISAKMAQKVQELLVERAVCKRNWNENGCSPDRIVPA
                     LEQQCAAWEKCINKDPYSAAGYSSISAETLGMIINSLLEPIGIKSFLFLLGSMAVLFL
                     SNFSFGFLRAKSYYGWNYQHNRDPDERIKPNTEKPNIQYLT"
     gene            <521976..>523460
                     /locus_tag="PAS_chr4_0259"
                     /db_xref="GeneID:8200967"
     mRNA            <521976..>523460
                     /locus_tag="PAS_chr4_0259"
                     /product="Delta(9) fatty acid desaturase"
                     /transcript_id="XM_002493625.1"
                     /db_xref="GeneID:8200967"
     CDS             521976..523460
                     /locus_tag="PAS_chr4_0259"
                     /codon_start=1
                     /product="Delta(9) fatty acid desaturase"
                     /protein_id="XP_002493670.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0259"
                     /db_xref="EnsemblGenomes-Tr:CAY71491"
                     /db_xref="GeneID:8200967"
                     /db_xref="GOA:C4R7B6"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR009160"
                     /db_xref="InterPro:IPR015876"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C4R7B6"
                     /translation="MDIPTAKYSEEDMKAALQPTEPEFFKVKVSKKKKTRRKVKHDTT
                     ASTIRRHISESKWTISNWYRHIHWKNVVLVVIVPLLALVGSLTVPLTRTGFYWMGFNY
                     IITCTFVIMGYHRYWAHRSFQTTKEMSFLFAMVGASAGVGSAKWWCASHRAHHRFCDT
                     ERDPHNIRKGFWYSHFGWMLLIHHPKVQAAIKESESEDISSDPVILWQYENYFHMFLV
                     TGILIPAIIGWWLFEDFAGGLVYGGLVKIFLVQNTIFSVNSLCHCCGDQPFDDAKSSR
                     NSILLSLITFGEGQHNFHHEFPSDCRNGVEWYDFDPVKWVIFTLNALGVIYNVHAAPT
                     TAINQLRVQQAQRILDKERSQLNWGIRIDKLPTLTSAEFSKLAKESQPERALVVISGI
                     VHDVTPFLHDHPGGVALIKSSIGKDATNAFNGAVYSHSNAARNLLATMRIAVILGSEQ
                     EVWKQQQKENKDVPLKNDSEGKKIVRSGEQITMTKTPSTTAGAA"
     gene            <523651..>524625
                     /locus_tag="PAS_chr4_0936"
                     /db_xref="GeneID:8200929"
     mRNA            <523651..>524625
                     /locus_tag="PAS_chr4_0936"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493626.1"
                     /db_xref="GeneID:8200929"
     CDS             523651..524625
                     /locus_tag="PAS_chr4_0936"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493671.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0936"
                     /db_xref="EnsemblGenomes-Tr:CAY71492"
                     /db_xref="GeneID:8200929"
                     /db_xref="InterPro:IPR021211"
                     /db_xref="UniProtKB/TrEMBL:C4R7B7"
                     /translation="MVTKVPSLVKKVFDTFPLKVYSSDEDADQLEFDESYFELRRFSF
                     QSTGVSAVAKFQLGVYSLSPCIYDSSILLPVDPLCLSTCLIMCVKNGLKLPQIGGEHG
                     RETSMVVMAYQASPDSELPLLVEDDLNGQKRVVRPYQTVKDFQDSRANNVKETMLIEL
                     IDGVLFDAWLVMVIFELPKELTVQLYGLVDKEDPVVLSHDIGISWLDSLRYSRILNSS
                     IRRNGFQLRHPNIAQYLGSLTDRYSGLSSKMEFERKRIIDRACHIINQFEGILNEARD
                     VSLGSVVDYKLAAFTYCILHLGRGDLSQAVKISNSLKSHCQRVINECI"
     gene            <524902..>526383
                     /locus_tag="PAS_chr4_0937"
                     /db_xref="GeneID:8200969"
     mRNA            <524902..>526383
                     /locus_tag="PAS_chr4_0937"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493627.1"
                     /db_xref="GeneID:8200969"
     CDS             524902..526383
                     /locus_tag="PAS_chr4_0937"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493672.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0937"
                     /db_xref="EnsemblGenomes-Tr:CAY71493"
                     /db_xref="GeneID:8200969"
                     /db_xref="GOA:C4R7B8"
                     /db_xref="InterPro:IPR003120"
                     /db_xref="UniProtKB/TrEMBL:C4R7B8"
                     /translation="MVEEKSEADSCVEESLRLIDDLKFFLATAPANWQPNQVIRRYYL
                     NSVEGFVSCVYWNDLYYITGTDIVRCISYKFEKFGREVTDRKKFEEGIFSDLRNLKCN
                     KDAILETPKSEFLSFLHKNACLRTKKKQKVFFWFSVPHDKLFADALERDMKRESDDLS
                     ATTKPVKEPALSFKMDKSSGSEPLFDQITNHLETKWKSVKTADVASNPIKTEEFIPAT
                     ASNVPVDQKSSETDDFPIDYFQAADDYFHEPKSALDLNQDFFMSATPSKVKFNDEYLV
                     NQTIPLYTSQIVQNDQIPTSARLIHKKIASPQESQIVADSSYFNDQYFKENEDPYLVG
                     MNPEYYETAYEPEAYQTYASLPSQVQMQPQPTAFAPQMYIKTPVYLHPGNTPHYNYYD
                     PTGTTGMVATTGGTVTTPYLQQRTPIYNQVQFFPPQQQPQQQMQHTSSQNIHPNYKNN
                     RGISKPPVMRKPVFKNPNLQHLNLEDLNLPAEKQKEYGVKMTE"
     gene            <526809..>529127
                     /locus_tag="PAS_chr4_0260"
                     /db_xref="GeneID:8200970"
     mRNA            <526809..>529127
                     /locus_tag="PAS_chr4_0260"
                     /product="Nonessential putative serine/threonine protein
                     kinase of unknown cellular role"
                     /transcript_id="XM_002493628.1"
                     /db_xref="GeneID:8200970"
     CDS             526809..529127
                     /locus_tag="PAS_chr4_0260"
                     /codon_start=1
                     /product="Nonessential putative serine/threonine protein
                     kinase of unknown cellular role"
                     /protein_id="XP_002493673.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0260"
                     /db_xref="EnsemblGenomes-Tr:CAY71494"
                     /db_xref="GeneID:8200970"
                     /db_xref="GOA:C4R7B9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4R7B9"
                     /translation="MGSWTTTEGALLNNRYLKVRDISEGSFGLVFLAKDTKENDKLVA
                     VKYVASPNEITRYKEMRLKNNFSDISDTASSDNNSVPTTSTDATSLVNVDAVHPDSAD
                     KSKEPTNLTNLIRETKLEVDILRKLGLHINIATLYDTFENYIVLEYCSRGDLYEAIRN
                     GVGPSSTHDVIDVMMQLIEAVEYCHAHSVYHRDIKPENILIAEDWSIKLSDFGLATTS
                     KFSSDFDVGSERYMAPELFDKNDSEYFDQTYDAEKADVWSIGICLLNIVFGKNPFQRA
                     NGSDKMFLHFASNRETLFDIFPSMSFDLFGVLRHSLTLDPNNRNLYNMKQELLKLKSL
                     TIEEEFHPFDDTDELGEIQEKKELEVVEISEEPASLPVQETTDTEEKSLAVSFKQTNS
                     LLKSRRPLGVPTSDNIDIKVTKKPANSEHGYADNDIDNGNDGFKRQDFLTPRSVFNNY
                     MDKIEKNRVNKETKNFHHTNHGLQLNSTNHQSHNTQNQPPSYSTYHTPSSQNHYHPHS
                     NKPGYYRRSFSNGNGNTYSPQYQEHYHTKSNNYNPQRKAWRRRKKSNHRMPRKQSTSV
                     GGSYKPNRISFHTNQRARDSFKGSFSSHKKTGLMAKGAMANTNTPATGKYVPPGLRSP
                     VKFQGIPNESAIVTDDDDVDELFVLEGDFDQGVLAEKFDTTMKIGYKDKGSKEKEKVK
                     KDIYIPPHQRRNSEDKHSRPFGSKPFGNHISPPNSGKNLPYSKFKMGNRRHEKKISFD
                     NNDDSISSSLPNLSWFDKKEKWDKDKESDYVY"
     gene            complement(<529185..>530330)
                     /locus_tag="PAS_chr4_0261"
                     /db_xref="GeneID:8200930"
     mRNA            complement(<529185..>530330)
                     /locus_tag="PAS_chr4_0261"
                     /product="ER membrane glycoprotein subunit of the
                     glycosylphosphatidylinositol transamidase complex"
                     /transcript_id="XM_002493629.1"
                     /db_xref="GeneID:8200930"
     CDS             complement(529185..530330)
                     /locus_tag="PAS_chr4_0261"
                     /codon_start=1
                     /product="ER membrane glycoprotein subunit of the
                     glycosylphosphatidylinositol transamidase complex"
                     /protein_id="XP_002493674.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0261"
                     /db_xref="EnsemblGenomes-Tr:CAY71495"
                     /db_xref="GeneID:8200930"
                     /db_xref="GOA:C4R7C0"
                     /db_xref="InterPro:IPR001096"
                     /db_xref="InterPro:IPR028361"
                     /db_xref="UniProtKB/TrEMBL:C4R7C0"
                     /translation="MKILYILLGILCCVAASSNTDDDQKSTHTNNWAVLVSSSRFWFN
                     YRHMANVLSFYRTVKRLGIPDSQIILMMSDDVACNPRNAFPGSVFNNKDRALDLYGDN
                     IEVDYRGYEVTVENFIRLLTDRWGPDHPRSKRLLTDENSNIFIYLTGHGGEDFLKFQD
                     AEEISSYDIADAFQQMAEKKRYNEIFFMIDTCQANTMYSKFYSPNILAVGSSRLDESS
                     YSHHSDTELGVAVIDRFTYYNLEFLEQIEKDSNKTMADLFETYTFEDIHSHAGIRTDL
                     YNRNLSKVLLTDFFGNVQKVEVGNLEDDLLYLAMTNEDGSPKQFSAQLSQHRQTNVSS
                     DRKPRPLNKDSSKENYINLESTEPPLVRKLLIALLLVSTLGFTYTLK"
     gene            <530593..>531159
                     /locus_tag="PAS_chr4_0262"
                     /db_xref="GeneID:8200931"
     mRNA            <530593..>531159
                     /locus_tag="PAS_chr4_0262"
                     /product="GTP-binding protein involved in beta-tubulin
                     (Tub2p) folding"
                     /transcript_id="XM_002493630.1"
                     /db_xref="GeneID:8200931"
     CDS             530593..531159
                     /locus_tag="PAS_chr4_0262"
                     /codon_start=1
                     /product="GTP-binding protein involved in beta-tubulin
                     (Tub2p) folding"
                     /protein_id="XP_002493675.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0262"
                     /db_xref="EnsemblGenomes-Tr:CAY71496"
                     /db_xref="GeneID:8200931"
                     /db_xref="GOA:C4R7C1"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7C1"
                     /translation="MGLLSIIRKQKLKDKEIRVLLLGLDNSGKTTIVKSLLNEDVKEV
                     SPTMGFNINTLSYQEFTLNIWDIGGQSTLRPFWFNYFERTDSLVWVVDVSAINRLRES
                     FQEFEKVLQEDRLVGCNLLILLNKIDIIPTDKSLDAIVSDVVEELHLKEITNHCWNVL
                     PVSAYTGQNLHQGIDWVVEEVKKRLYIL"
     gene            <531660..>534272
                     /locus_tag="PAS_chr4_0263"
                     /db_xref="GeneID:8200932"
     mRNA            <531660..>534272
                     /locus_tag="PAS_chr4_0263"
                     /product="Karyopherin beta, forms a dimeric complex with
                     Srp1p (Kap60p)"
                     /transcript_id="XM_002493631.1"
                     /db_xref="GeneID:8200932"
     CDS             531660..534272
                     /locus_tag="PAS_chr4_0263"
                     /codon_start=1
                     /product="Karyopherin beta, forms a dimeric complex with
                     Srp1p (Kap60p)"
                     /protein_id="XP_002493676.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0263"
                     /db_xref="EnsemblGenomes-Tr:CAY71497"
                     /db_xref="GeneID:8200932"
                     /db_xref="GOA:C4R7C2"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027140"
                     /db_xref="UniProtKB/TrEMBL:C4R7C2"
                     /translation="MSDINISQVLQNAILATDANKRSEAENQLNGLLNSNFHEYLRLL
                     TNTLADENERTEVRMLAGLGLKNQLTAKDERTKQARANRWIELETEAKKQIKETALKA
                     LLTEDTRVANSVAQLVAAIADIELPRSEWPELMSIIVENTKADKPVNVKRASLLTIGY
                     ICETADPLNAGVVSQANGILIAIVQGAQASEPSKIVRLTAINALVNSLEFIRYNFERE
                     GERNFIMQVVCETTQADDPELQASAFGALAKIMSLYYPYMSVYMERALYGLTVSGMQS
                     SNEKVACMAVEFWSTVCEEELEIALQKEEYAETGTAAEDLTSYNFALVAIQDVLPTLL
                     TLLTRQNEDAEDDSWSVAMAAGACLQLFAQNTGNYVVQPTLQFVEGNLTGPTWRNKEA
                     AVMAFGSILDGPDREQLKVLISQALQPILQLMQDESLHVKETVAWCLGRIADLVIDAI
                     DINQHLPAVIQAVVQGLADHPKVSTNCCWTLINLMEQLCANGSQLETTPMSQYYETLV
                     PTLIKLSGSEENEYSARTSAYETLATLVYYSSNDVMPIVNQVASEVLNRLEATIQMQQ
                     HVETAEEKANLEELQSSILSLLTNVIRRAGLEVSAVSDNLMELFLRLLQAQENNALIE
                     EDIFIAISSIATAIEKGFVKYMDAFLPFLVAALQNIESPVCNTAIGLIADISHSLGDG
                     ILPYVPNLINILGAALMNQNIKRDLRPIILSCFGDIASSIGEHFLPYLEVVMNICASA
                     QSLQVEDGSIENLDYILTVRESVLDAYVGIIGGLHSHPEAIFPYTQQVMDFLLSVYSD
                     INMSSSDTVSRSAVGILGDLALMFPNGEIKQIYTQDWVTQFIKSTRSNPSFQQSTKDT
                     ARWAREQQKKQLSL"
     gene            <534374..>535111
                     /locus_tag="PAS_chr4_0264"
                     /db_xref="GeneID:8200933"
     mRNA            <534374..>535111
                     /locus_tag="PAS_chr4_0264"
                     /product="Dolichyl pyrophosphate (Dol-P-P) phosphatase
                     with a luminally oriented active site in the ER"
                     /transcript_id="XM_002493632.1"
                     /db_xref="GeneID:8200933"
     CDS             534374..535111
                     /locus_tag="PAS_chr4_0264"
                     /codon_start=1
                     /product="Dolichyl pyrophosphate (Dol-P-P) phosphatase
                     with a luminally oriented active site in the ER"
                     /protein_id="XP_002493677.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0264"
                     /db_xref="EnsemblGenomes-Tr:CAY71498"
                     /db_xref="GeneID:8200933"
                     /db_xref="GOA:C4R7C3"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C4R7C3"
                     /translation="MSALVPFDHTFVLYDSSDLISLAAAVWSLVPIFILVFYFSWFVC
                     TREIEAVIVAAGHVANDVVNSLVKNTLKQERPELASELAGFRVVGNGFNEFLGTQYGM
                     PSAHSQFMGFFASYFVLKLWLQWSRSEGKAPSQQMKVFGTLCFLLAAYCVCASRVYLF
                     YHTLEQVAVGVSLGAFLGTCYFLLISFARAISLVNWVVNWPFSSWLSVKDSWAEGGLT
                     LKEERLQWLERCKGCKLGTSESEKKGN"
     gene            <535563..>535995
                     /locus_tag="PAS_chr4_0265"
                     /db_xref="GeneID:8200934"
     mRNA            join(<535563..535616,535879..>535995)
                     /locus_tag="PAS_chr4_0265"
                     /product="Putative protein of unknown function identified
                     by fungal homology comparisons and RT-PCR"
                     /transcript_id="XM_002493633.1"
                     /db_xref="GeneID:8200934"
     CDS             join(535563..535616,535879..535995)
                     /locus_tag="PAS_chr4_0265"
                     /codon_start=1
                     /product="Putative protein of unknown function identified
                     by fungal homology comparisons and RT-PCR"
                     /protein_id="XP_002493678.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0265"
                     /db_xref="EnsemblGenomes-Tr:CAY71499"
                     /db_xref="GeneID:8200934"
                     /db_xref="UniProtKB/TrEMBL:C4R7C4"
                     /translation="MSLLILPIWTQHSSWCLCAKKEIAAPEFRVWSPTTLLGQALSSL
                     TTVDRTGNGAFC"
     gene            complement(<536285..>537793)
                     /locus_tag="PAS_chr4_0266"
                     /db_xref="GeneID:8200935"
     mRNA            complement(<536285..>537793)
                     /locus_tag="PAS_chr4_0266"
                     /product="Similar to
                     6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
                     enzymes"
                     /transcript_id="XM_002493634.1"
                     /db_xref="GeneID:8200935"
     CDS             complement(536285..537793)
                     /locus_tag="PAS_chr4_0266"
                     /codon_start=1
                     /product="Similar to
                     6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase
                     enzymes"
                     /protein_id="XP_002493679.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0266"
                     /db_xref="EnsemblGenomes-Tr:CAY71500"
                     /db_xref="GeneID:8200935"
                     /db_xref="GOA:C4R7C5"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C4R7C5"
                     /translation="MTEEIQEPVIPGNYSARKQTRWEKLDTVKGKKAVHLDGIHDSVD
                     STYISPGQLYSTESGRMFHAGQVCVCICGQPARGKTNLSISLCRYLRWLGLKSNLFHM
                     GNYRRAKTGTITDDFFKPVPDTEEAFKMRKELTESCVQDMKAFFQGDHGQVAIYDAVN
                     AISKERVELVERMKLYGIRVLFIESLVTDDNLLRANIQDASKSPDYQNWDSKQAVEDY
                     KKRVEMVAPHYQEMNEPSLSYVKFINFGERLIVKNSNHDFLTSKIVFFLMNSKIKRGS
                     VYMARCSNNKLSFKSDPPLTEAGREYSQKVMKTVLGHISKFKGENFYHNVQRPKIEAT
                     KRQPAYGVDGQHENSLVVWTSVRRRTVEAAQMFKDLGITTRHRQQLTQLNPGDAEGLT
                     LEELKEKFPHDYEEHLADPYHHRYPRAESYHDLAVKVEPLLFEMERMRGDVLIIADET
                     VLRVLYGYLMACHSYDIPTLKFPENEVIQITYNAYTNTATRIPVEGLEQTED"
     gene            complement(<538316..>538699)
                     /locus_tag="PAS_chr4_0267"
                     /db_xref="GeneID:8200936"
     mRNA            complement(<538316..>538699)
                     /locus_tag="PAS_chr4_0267"
                     /product="60S ribosomal protein L26"
                     /transcript_id="XM_002493635.1"
                     /db_xref="GeneID:8200936"
     CDS             complement(538316..538699)
                     /locus_tag="PAS_chr4_0267"
                     /codon_start=1
                     /product="60S ribosomal protein L26"
                     /protein_id="XP_002493680.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0267"
                     /db_xref="EnsemblGenomes-Tr:CAY71501"
                     /db_xref="GeneID:8200936"
                     /db_xref="GOA:C4R7C6"
                     /db_xref="InterPro:IPR005756"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR005825"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:C4R7C6"
                     /translation="MAKVSQDVSSSRRKSRKAYFTAPSSVRQILMSSPLSKELREQHG
                     IKSIPIRKEDEVRIVRGSKKGQEGKVSSVYRLKYGIQVSKVTREKSNGASVPLNIHPS
                     NVVITKLYLDDNRKDYIQRNGGKLE"
     gene            <539150..>539911
                     /locus_tag="PAS_chr4_0268"
                     /db_xref="GeneID:8200937"
     mRNA            <539150..>539911
                     /locus_tag="PAS_chr4_0268"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493636.1"
                     /db_xref="GeneID:8200937"
     CDS             539150..539911
                     /locus_tag="PAS_chr4_0268"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493681.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0268"
                     /db_xref="EnsemblGenomes-Tr:CAY71502"
                     /db_xref="GeneID:8200937"
                     /db_xref="UniProtKB/TrEMBL:C4R7C7"
                     /translation="MNVVIFKSDPLSYDQVRALDKIFTDHGIQVNVVSKFHPDSSELK
                     ADLYLILTPGKELESKFFVRQCASHISKVDAMNPVILFDHQLNSTFPVLFNCLVKKGS
                     LKSRPVYGLPVSHLDTSSLNSGDLRVLIDLGMSGIAQYFDYIISLSRTEEASQIVQAM
                     VNHGKQNFNNEFIQSLSYFYLPVSLQKGQLSVFDPLTDPQTIQKFKNLNLSCLDDSVT
                     SLEELMEACIYNDRVIHSVSRHQELAFNYTHGTKL"
     gene            complement(<539945..>542752)
                     /locus_tag="PAS_chr4_0269"
                     /db_xref="GeneID:8200938"
     mRNA            complement(<539945..>542752)
                     /locus_tag="PAS_chr4_0269"
                     /product="Essential nuclear protein with a possible role
                     in the osmoregulatory glycerol response"
                     /transcript_id="XM_002493637.1"
                     /db_xref="GeneID:8200938"
     CDS             complement(539945..542752)
                     /locus_tag="PAS_chr4_0269"
                     /codon_start=1
                     /product="Essential nuclear protein with a possible role
                     in the osmoregulatory glycerol response"
                     /protein_id="XP_002493682.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0269"
                     /db_xref="EnsemblGenomes-Tr:CAY71503"
                     /db_xref="GeneID:8200938"
                     /db_xref="GOA:C4R7C8"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C4R7C8"
                     /translation="MNRHEIRLPGSLLDQIRSNEESSVNGSDVRDFTSKRKRPQVNRK
                     DKRRQLRQDKKEKHKQKQRSAKANSQRSKKVDEAETLLKSSLKAKSENTEKTKSVKFA
                     DFDSDSSVSDAADLSTDSSPLEKLKALKAEKNISGQSTERVVNLSDLSDDEVSDLGDS
                     SKEEAEEENLINDDGEEEEDPLAQLAALKGKSRSTKTTKSTERIISLSDLSDDEVSDL
                     DGDEDEDEDGDDEEVDEDQLEHYEEEEEEEEEEGDTNQKKHKSKSKNETVRILSPHER
                     ALIEKEEEEMKYYARKLGLKADSKLNKNDENDAIGGLLDGLDTIFDGSQEQSSGSASE
                     EQDGDDEEFDSDERRELAEMEKIETSDSAADSDSDEGPRVKENPFVAPVSQSSKYVPP
                     ALRRKQTQDSEQVQKIIKQVKGPLNKLTEQNMMTIVSQLQLLYNDNPRQVVTEVITDV
                     ILKTIMTPGRLLDGFVLVYSGLVSAIYRNRYEFGTHIIQVAITKLEEFFQGTLSVESK
                     EIVNLTSFIGFLYNFNVFGCKLIYDIIRERLVTDSNEVKVELLLKLIRCCGSKLRSDD
                     ISLLKDILELLNKDFVNSKQSTRAKFLIETMTNLKNNKLKGFDVENTAQMIVRIKKVL
                     PIGKIVEPIQVSFDDILHVEDRGKWWLIGSAWKGTDSTSVEGDETQTEKTVGKFQVND
                     SSDFMVDSEPNWQELARTQRMNTDVRRAIFISIVSAEDYVNAFEKLEKLRLKRQQQKE
                     IPQILLHCVTMEDTYNPFYGFLAKKLCEDHMMRKSFQFTLWDILKDFESHDDKDNDSD
                     TGLAFSFHNDEENINEETQLKRVLNLGRFFGFLFGQSSLALHLLRNVNFLTTLATTTL
                     FLEIMFITFLDQLCLKKDLQKLQQALQNCNEQPLLLKGLKYFLPEKVQNSQLTKGRKQ
                     KERINWGVERCEEIIDQLLPE"
     gene            <543289..>544365
                     /locus_tag="PAS_chr4_0270"
                     /db_xref="GeneID:8200939"
     mRNA            <543289..>544365
                     /locus_tag="PAS_chr4_0270"
                     /product="Mitochondrial protein involved in sorting of
                     proteins in the mitochondria"
                     /transcript_id="XM_002493638.1"
                     /db_xref="GeneID:8200939"
     CDS             543289..544365
                     /locus_tag="PAS_chr4_0270"
                     /codon_start=1
                     /product="Mitochondrial protein involved in sorting of
                     proteins in the mitochondria"
                     /protein_id="XP_002493683.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0270"
                     /db_xref="EnsemblGenomes-Tr:CAY71504"
                     /db_xref="GeneID:8200939"
                     /db_xref="GOA:C4R7C9"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7C9"
                     /translation="MNRFRLDAKVVTDLALFVGTSLSIYYLISTLLGDGAPHSLKSKE
                     SKKKAKASLERLKALNPDLNLDLNDYEKVVLSSVITPSEINVGFDDIGGLEPIIDDLR
                     ESVLVPLNHPELFNQYSQLLQAPKGVLLYGPPGCGKTMLAKALASESGANFISIRMSS
                     VMDKWYGESNKLVDAIFSLANKLQPCIIFIDEIDSFLRERQAMDHEITATLKAEFMTL
                     WDGLTSTGRILVLGATNRPNDIDSAFMRRMPKRFSVNLPDTEQRFKILNVLLKDVAYD
                     FDLIDLAVKTAGASGSDLKEMCRNAAVNATRQYIRKNMGASGKMKTTEKIKLRPLNLG
                     DFLTTISPSDPVHRNVIPAAPNVD"
     gene            <545401..>546785
                     /locus_tag="PAS_chr4_0271"
                     /db_xref="GeneID:8200940"
     mRNA            join(<545401..545441,545498..>546785)
                     /locus_tag="PAS_chr4_0271"
                     /product="Protein containing GATA family zinc finger
                     motifs"
                     /transcript_id="XM_002493639.1"
                     /db_xref="GeneID:8200940"
     CDS             join(545401..545441,545498..546785)
                     /locus_tag="PAS_chr4_0271"
                     /codon_start=1
                     /product="Protein containing GATA family zinc finger
                     motifs"
                     /protein_id="XP_002493684.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0271"
                     /db_xref="EnsemblGenomes-Tr:CAY71505"
                     /db_xref="GeneID:8200940"
                     /db_xref="GOA:C4R7D0"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C4R7D0"
                     /translation="MQTYNSNSRQEGLRLPSFGELSAATGRPIERPTSPLDNGLGYGP
                     GSAFPTPDGTQPRARYVFPPAAGPPSAGPPVFAGFQQPHVQQQPQQRHHHHQPVPPPK
                     QQQQQQQQQQQPPSSTVMAPPLPIPPQNDTNVGPRSGLDPPQLPPYRNQTQPAVFVKE
                     PNQPPPAMLSFHRSSHSEPLIALADASEMMSQRNDSDPPIAQQQNQDVGLLYDIRAGA
                     LEIDQLNQKIQRIAQDLQGLLENGSVTPKVIDEFLLRPDYEELTKMAFQLGFMSSTLH
                     RWIQAHEFLKHNVERQASAMNSNNPNNSHASNNSGSNNNIAVISPTSKQSMNNLRKES
                     ISLKVSPQTPVTKAQDTLDLDNRGSRANISTNIPPRCLQCGSGDTPEWRRGPYGARTL
                     CNACGLFHAKLTKKKGAPEAARIMQSRRRLGLGSERRISLLSGSELEQDR"
     gene            <547078..>548802
                     /locus_tag="PAS_chr4_0272"
                     /db_xref="GeneID:8200941"
     mRNA            <547078..>548802
                     /locus_tag="PAS_chr4_0272"
                     /product="Cytochrome b2 (L-lactate cytochrome-c
                     oxidoreductase)"
                     /transcript_id="XM_002493640.1"
                     /db_xref="GeneID:8200941"
     CDS             547078..548802
                     /locus_tag="PAS_chr4_0272"
                     /codon_start=1
                     /product="Cytochrome b2 (L-lactate cytochrome-c
                     oxidoreductase)"
                     /protein_id="XP_002493685.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0272"
                     /db_xref="EnsemblGenomes-Tr:CAY71506"
                     /db_xref="GeneID:8200941"
                     /db_xref="GOA:C4R7D1"
                     /db_xref="InterPro:IPR000262"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR008259"
                     /db_xref="InterPro:IPR012133"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R7D1"
                     /translation="MNGRLLFQGYRSSIRATAFAGRNLRPLQASRKLSSILPKAGSEK
                     SHSSSKILTRGGLVIGLALVATTATIWSQSLASPISNDDERKVTPEELAKHNTGTDCW
                     VAINGKVYDLTEFLPQHPGGRNVILKRAGKDASKVFNPIHPPDAISKFLPADKFVGVL
                     DGELPEEEEVLTDAEIERQERIANKPPLSSMFNVYDFEYVAQNILDEAAWAYYSSAAD
                     DEITLRENHFAYHKVFFRPRILVDVTNIELETEMLGIKTSAPFYISATALAKLGHPEG
                     EVGIAKGAGRGDIIQMISTLASCSLDETVAAAKEGQSQWFQLYVNSDREVAYNMIKHC
                     EELGIKGIFVTVDAPSLGNREKDRRMKFTEDTDVDLSGDGKTEVNRSNGAAAALSSFI
                     DTAVTWKDIAEFKRRTNLPIVIKGIQRTEDVILAAEHGVDGVVLSNHGGRQLDGAPPS
                     LQVLAECMPVLRQRGLDKKLEVFVDGGIRRGTDIMKALCLGAKGVGLGRPFLYANSAY
                     GPDGVEKAIDILKNELIMNMRLLGVTKISDLSPEFVDTRPLFGLTANDRLFNNNYLDI
                     EFPKFKDE"
     gene            <549232..>550245
                     /locus_tag="PAS_chr4_0273"
                     /db_xref="GeneID:8200942"
     mRNA            <549232..>550245
                     /locus_tag="PAS_chr4_0273"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493641.1"
                     /db_xref="GeneID:8200942"
     CDS             549232..550245
                     /locus_tag="PAS_chr4_0273"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493686.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0273"
                     /db_xref="EnsemblGenomes-Tr:CAY71507"
                     /db_xref="GeneID:8200942"
                     /db_xref="UniProtKB/TrEMBL:C4R7D2"
                     /translation="MFSHGNYLTPNEFKQKARSQVLQQFGNNISFVRAPPVSSASSLR
                     SEVYSRASNSSYVFNDQKSLESSNSLDTHHYYNNISLPPLRPSLRHFMISRVLEDLSQ
                     EISFSNNIDNLGLLVYSQLNSLNLTDVLDWKLNTVRCLLLLSEIPHCWANKMDHHSIP
                     PIRLSSSHASKDTVIPEIYKSEIIKVQEKTPHTQFSRIVRRKIQGDLDSPVFELKLLP
                     PNPTDSEFVDFLVHSNLYKEFKLESSFKRQVAMVSVSKARKLQTETEHSDPDESLGLI
                     YLAIGLQNYFLNILVASLTLFEFHYAVCEILTKERKLSKAEHETLWNNIREKNYAKIS
                     KLW"
     gene            complement(<550437..>551180)
                     /locus_tag="PAS_chr4_0274"
                     /db_xref="GeneID:8200943"
     mRNA            complement(<550437..>551180)
                     /locus_tag="PAS_chr4_0274"
                     /product="Essential nucleolar protein involved in the
                     early steps of 35S rRNA processing"
                     /transcript_id="XM_002493642.1"
                     /db_xref="GeneID:8200943"
     CDS             complement(550437..551180)
                     /locus_tag="PAS_chr4_0274"
                     /codon_start=1
                     /product="Essential nucleolar protein involved in the
                     early steps of 35S rRNA processing"
                     /protein_id="XP_002493687.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0274"
                     /db_xref="EnsemblGenomes-Tr:CAY71508"
                     /db_xref="GeneID:8200943"
                     /db_xref="InterPro:IPR014810"
                     /db_xref="UniProtKB/TrEMBL:C4R7D3"
                     /translation="MSKVSPITELEELPMESLLADPKSAEQESTSEPQKSFDEIFAEL
                     NAEYLKNELEKKEEPPANLAEKDENEILAGLKDDKDEFEQVQSTLSKMPKLQSEFRLD
                     ADMKTLIKNYELKETKAKILKISDPIVTQLSRRKKKEKEHAGDKWFNMPKGELTPQVK
                     RDLEIVKNRAVLDPKRHYKKDNWKTPEFFQFGTIVESNTGYYNKLTKKQRGKTLIDEI
                     LHDDDSTKYFKRKYEQIRQDQGKKKKVRN"
     gene            complement(<551437..>552327)
                     /locus_tag="PAS_chr4_0275"
                     /db_xref="GeneID:8200944"
     mRNA            complement(<551437..>552327)
                     /locus_tag="PAS_chr4_0275"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493643.1"
                     /db_xref="GeneID:8200944"
     CDS             complement(551437..552327)
                     /locus_tag="PAS_chr4_0275"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493688.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0275"
                     /db_xref="EnsemblGenomes-Tr:CAY71509"
                     /db_xref="GeneID:8200944"
                     /db_xref="GOA:C4R7D4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R7D4"
                     /translation="MSDSDFEWDEALSADLSKSKVARAFIPESEIIDNFNTVQHCLWT
                     DCNDKFDNLDQVVSHINHTHISNDSNKDHCCNWRDCSRKGIPQASRFSLMSHVRSHTG
                     ERPFYCLLPECPKHFTRSDALLKHIKTIHNIDSPNEAQEEVFPWWYPSLESDKQKLEF
                     VNEKTVRDRYLDLLERFESGELSKDNLSNYGALFNINHIDVNNNLKKHILERAKEHYE
                     TLAENNVHLPSDDDIDKLGTEELVHLADTLERYESQLKAFHDNVYTEYGNELNETKKW
                     SYKLLTVQNAVFMDKLEKEL"
     gene            <552563..>554053
                     /locus_tag="PAS_chr4_0276"
                     /db_xref="GeneID:8200945"
     mRNA            <552563..>554053
                     /locus_tag="PAS_chr4_0276"
                     /product="Alpha subunit of cytoplasmic phenylalanyl-tRNA
                     synthetase"
                     /transcript_id="XM_002493644.1"
                     /db_xref="GeneID:8200945"
     CDS             552563..554053
                     /locus_tag="PAS_chr4_0276"
                     /codon_start=1
                     /product="Alpha subunit of cytoplasmic phenylalanyl-tRNA
                     synthetase"
                     /protein_id="XP_002493689.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0276"
                     /db_xref="EnsemblGenomes-Tr:CAY71510"
                     /db_xref="GeneID:8200945"
                     /db_xref="GOA:C4R7D5"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:C4R7D5"
                     /translation="MSDLQHRILQVLDAQDVIQDTKVQFPELDSQTVQAALNSLLARS
                     MIKYTNIETDYWLLTDEAKDIVQNGSHEFRLLQEVTKNLEGLKIADVGTVLGKNGKLG
                     QAKAFKNGWISKDGDRLLTKFKDSPLPKDETAQNLRDIQENQGAGVDKKELQDLKKRK
                     LITMSKIVSYKVEKAAEFSLEIVQLNADITSDMIQSGSWKTAKFKPYNFNSEGVFPHS
                     GALHPLNKVREEFRQIFFSMGFTEMPSNQYVESGFWNFDTLFVPQQHPARDLQDTFYL
                     KDPALAKRPEDKEYWENIQRVHQDGAFGSIGYRYPWKEDESLKMVLRTHTTAISAAML
                     KKLAEDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNLTLGDLIGFMQSFFD
                     KMGVHDLRFKPAYNPYTEPSLEIFAYHKGLGKWVEIGNSGMFRPEMLEPMGLPKNLRV
                     LGWGLSLERPTMIKYKLSNIRDLLGHKVSLDFIESNPAARLDEDLV"
     gene            <554321..>557053
                     /locus_tag="PAS_chr4_0277"
                     /db_xref="GeneID:8200946"
     mRNA            <554321..>557053
                     /locus_tag="PAS_chr4_0277"
                     /product="Protein that interacts with Sin3p in a
                     two-hybrid assay"
                     /transcript_id="XM_002493645.1"
                     /db_xref="GeneID:8200946"
     CDS             554321..557053
                     /locus_tag="PAS_chr4_0277"
                     /codon_start=1
                     /product="Protein that interacts with Sin3p in a
                     two-hybrid assay"
                     /protein_id="XP_002493690.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0277"
                     /db_xref="EnsemblGenomes-Tr:CAY71511"
                     /db_xref="GeneID:8200946"
                     /db_xref="UniProtKB/TrEMBL:C4R7D6"
                     /translation="MTDLPSFLPIGRNENVSLTKPESSAPQESTSSEQLDTANASKTV
                     SGRSWTPKTFIIPDTRAIDLLLNDMPPSFLVVEKVDITGFEMYIVEQWALTRRVGTTI
                     TIYTGDDHNVLKAYKITVTIDEENLWPMSFKKYVNSLILSQSTTLREISDAYLFVTNL
                     SQFPTNLNLIPVKEGSLADIWDLFVTNLNMKRLSCAGRSLITLTNPANSIHDKFTSRY
                     SIHPDVPLMYAARELVLIVQTFLYYFRLIRPLAVDGMACTHTEEAICQWWEQFGIKSY
                     PMVIKPKDFFSPLSLCGLIGFVLTIRERLASFSMSIYVPSDPLLINDFKVSVGQFQRH
                     IRKLAHSSNGDGLGISPLPNQSSESAKNTWYLDVDTVDILLRYTSHKGSNKPNLMHDI
                     NKVRRMFKNTVQDLSSGKSLQSFKNTVTDLSTGRTLQNLGVHSDVPACSAFEFPGIEV
                     LTDFKLLVPRMKGKRMNYLWKGKGKPFDIERNCISSLTLQYTAKSWREKTKHESFSKN
                     RSSTFLPEGRLEDSSSNHYERYDYYLSNEAQKESGNTEREEFTIERLKEKLKSKIWFE
                     EDETTSSGKEKTKSPVAKSKLSKGEQADNNDTEAHRSQTELCNLLEREPKIETVNHNE
                     KFYSLLHRRNSIPSAQVEANLNTISYQKEYAVVDTVQRQEPFISTSIKLKRSKSFSEV
                     EPVVNQWNWSFCPSVERLALAYIRIKCNMDRGFSVQASQFNQDYEEVTHLLATCVNDF
                     APLAKVSLDRKLSCGEGYLFDMLKGILDKSKNLEFQLNDIDSLNAKLDYELRLLSQKV
                     KDAEQSLVQLKDFKVNNLIRSLDNCGNMNFSKRIRNQIKQKGYDTQVGQYSKEQGYYV
                     FFQTLVQVLLGTIVDIWLAFFPGINYERVKKIWIKVDPRGRTNRFIGRIVPTNT"
     gene            complement(<557840..>559405)
                     /locus_tag="PAS_chr4_0278"
                     /db_xref="GeneID:8200947"
     mRNA            complement(<557840..>559405)
                     /locus_tag="PAS_chr4_0278"
                     /product="Protein involved in pre-rRNA processing, 18S
                     rRNA synthesis, and snoRNA synthesis"
                     /transcript_id="XM_002493646.1"
                     /db_xref="GeneID:8200947"
     CDS             complement(557840..559405)
                     /locus_tag="PAS_chr4_0278"
                     /codon_start=1
                     /product="Protein involved in pre-rRNA processing, 18S
                     rRNA synthesis, and snoRNA synthesis"
                     /protein_id="XP_002493691.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0278"
                     /db_xref="EnsemblGenomes-Tr:CAY71512"
                     /db_xref="GeneID:8200947"
                     /db_xref="InterPro:IPR002687"
                     /db_xref="InterPro:IPR012974"
                     /db_xref="InterPro:IPR012976"
                     /db_xref="UniProtKB/TrEMBL:C4R7D7"
                     /translation="MAYVLTETAAGYALLKASDKKIYKSSTLIQDLNSADKVVNQFKV
                     AAFSKFSSAANALEEATAVIDGKVSNQLQKLLEEAKSDKKSTLIVSDTKLANAVNKLG
                     LNFSVVSDAVTLDLYRAVREYLPELLPGLSDKDLSTMSLGLAHSIGRHKLKFSADKVD
                     TMIVQAIALLDDLDKELNTYAMRSKEWYGWHFPELAKIVTDSVAYARIILTMGVRTNA
                     QDTDLSEILPEEVEQQVKTAAEVSMGTEITDIDLENIKALAEQIVEFAAYREQLSNYL
                     SSRMKAIAPNLTVLVGELVGARLIAHAGSLISLAKAPASTIQILGAEKALFRALKTKH
                     DTPKYGLLYHASLVGQASGKNKGKIARVLAAKAAVSLRYDALSEDRDDSGDVGLDFRA
                     KVESRLSTLEGRDLRTTTRLVREQKKVELTEAPAYNADADAVPESVKDEDSDDESDSE
                     EDTVEKKRKRDESEEEEEEEEEKPKKHKKDKKDKKEKKEKKEKKEKKEKKEKKEKKEK
                     KEKKDKKSKKQKK"
     gene            <559692..>563932
                     /locus_tag="PAS_chr4_0279"
                     /db_xref="GeneID:8200948"
     mRNA            join(<559692..561917,561965..>563932)
                     /locus_tag="PAS_chr4_0279"
                     /product="Essential tripartite DNA replication factor with
                     single-stranded DNA-dependent ATPase"
                     /transcript_id="XM_002493647.1"
                     /db_xref="GeneID:8200948"
     CDS             join(559692..561917,561965..563932)
                     /locus_tag="PAS_chr4_0279"
                     /codon_start=1
                     /product="Essential tripartite DNA replication factor with
                     single-stranded DNA-dependent ATPase"
                     /protein_id="XP_002493692.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0279"
                     /db_xref="EnsemblGenomes-Tr:CAY71513"
                     /db_xref="GeneID:8200948"
                     /db_xref="GOA:C4R7D8"
                     /db_xref="InterPro:IPR014808"
                     /db_xref="InterPro:IPR022765"
                     /db_xref="InterPro:IPR026851"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7D8"
                     /translation="MSPPSKRVKPGGRRRTYFFKPEDSLTTNQEEDVLPLAQSTGLQN
                     SLENTMTPTRPRKRVSKITETLRNRKLNGLSSDDMVFWQGTPKSDSISSLSPDKPTTH
                     NLPSSPTRQIPISNVVYDPIGELAEKYNTTFDNLASQTPITSTNKMQRRSSDSQPASR
                     KKVGDLFNFEHSPSIRRTKTAGLENLAIGAPVEGKVGVTKKFEKLLDEFHQSFSGSPV
                     DVPISSKESSKSPGHSASEQDQSGFSDELDMDDINHLLEMTQPKPKVQIATPKTELPV
                     SKDTIKEEQDSSFDDTSDDDDFEMLFNQLESQNSVKKLSTQEKKIRQSDMESVEIFQR
                     HIKQEYANDTRHNKCKENKAKLAVPKKDVFRYQVVKIRKAKYKLDNSKGEQLILTVSD
                     ACSVQRNIVIRDFWAELDIEEGDVIHIIGKDPSLTDKRTNILIWNPDLLLSSTLVSES
                     ISCKRRSFLKNKLTFPGESSIPLIVGVIVHTVFQQCLAAGNITDDFISTLIESELNAN
                     LFSIFSINESRETVREKIQEHVPFIKQWHDTYTRSIPVSKSSTAIGGTKDKAMVSASN
                     ILDIEENIWSPVFGLRGLIDVTVEACIKGPNNDGRFVVPLELKTGSREYISHRAQVSL
                     YSLLVRERYDIDSDYFFLVFTKLKSVQLHNIKQHDLRLIVQLRNELSGYLKLTNGLNK
                     LPPLIKQSECDRCDVLVPCMALNKLIENGTSEDSGILEQKYELLTSHLDKEEYKFFFK
                     KWTDMDIDGYRKRQNGGTCLGGLEIIEMEESSVSNYNYRYVLNRDCNSSNAPLTSAQF
                     SKYDRILVSDEEGHYALAVGCIDLITPTTVIIRTDRRIVNSSLKLPGFNARNNQTFQS
                     VLSKRDFEMLPAEVKNKTFRIDKNEFYNGLALARFNILNLFLPEYGDEKRRRMVVELK
                     APSFSNKPLPYNVSKLGSFNPDQLAAVKKALCTEDYSLILGMPGTGKTTVIAQIIRIM
                     VANGKSVLLTSHTHSAVDSILLKLLDDGIDFYRVGSEAKIHPLVRKFMPQKRGSADMN
                     SIEDFQRMIHQAPVVAATCMGVGDLVFNYRTFDYCIVDEASQVSMPFCLGPLRFCDKF
                     ILVGDHFQLPPLVKNPEARNQGLDRSLFKILSEKHPQSVVSLSYQYRMCADVMLLSNK
                     LIYENRLKCGSDNVAQRSLRIPMKERLDHLLLDPSTPKNRLWLHHIFVEENRVIFLDH
                     DDVPAKERMSTDRVDNPTEAELVGQIVDSLINCGCDSKEIGVMSFYRAQVKLMKTRLV
                     SHVQNVEVMTADQFQGRDKECIIISLVRSNATNSVGNLLKEWRRINVAITRAKSKLLI
                     LGSRKTLEQLETLKAFLSLLKSRGWIYRLPLGADSVYKGLKQDNHKTEPARKDNSKMS
                     LKMIKSRPILKDIFNDLVN"
     gene            <564053..>564775
                     /locus_tag="PAS_chr4_0280"
                     /db_xref="GeneID:8200949"
     mRNA            <564053..>564775
                     /locus_tag="PAS_chr4_0280"
                     /product="Putative methylthio-ribulose-1-phosphate
                     dehydratase"
                     /transcript_id="XM_002493648.1"
                     /db_xref="GeneID:8200949"
     CDS             564053..564775
                     /locus_tag="PAS_chr4_0280"
                     /codon_start=1
                     /product="Putative methylthio-ribulose-1-phosphate
                     dehydratase"
                     /protein_id="XP_002493693.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0280"
                     /db_xref="EnsemblGenomes-Tr:CAY71514"
                     /db_xref="GeneID:8200949"
                     /db_xref="GOA:C4R7D9"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /translation="MSSCFCSKSQETEKRGAVSEDQLVISDDSTHPANLICELCKVFY
                     NNGWVTGTGGGISIREGSKIYIAPSGVQKERMVPDNMFVMDLESENYLRTPLTLKPSA
                     CTPLFLSAYKMRDAGACIHTHSQAAVMVTLLYDKVFEISSIEQIKAIPKVTEKGNLMY
                     SDRLVIPIIENTEREEDLTDSLQQAIEEYPGTTAVLVRRHGIYVWGETVWKAKVYNEA
                     IDYLLELALKMHQLGIPTVKQN"
     gene            complement(<564837..>565254)
                     /locus_tag="PAS_chr4_0281"
                     /db_xref="GeneID:8200950"
     mRNA            complement(join(<564837..565015,565227..>565254))
                     /locus_tag="PAS_chr4_0281"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493649.1"
                     /db_xref="GeneID:8200950"
     CDS             complement(join(564837..565015,565227..565254))
                     /locus_tag="PAS_chr4_0281"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493694.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0281"
                     /db_xref="EnsemblGenomes-Tr:CAY71515"
                     /db_xref="GeneID:8200950"
                     /db_xref="UniProtKB/TrEMBL:C4R7E0"
                     /translation="MSMLKPFLETQERVFHLTEETQTIDLGLFLLRGNNVVCIGLVDE
                     EEEETINWASLHGRQLGDTRHALD"
     gene            complement(<565985..>566860)
                     /locus_tag="PAS_chr4_0938"
                     /db_xref="GeneID:8200951"
     mRNA            complement(<565985..>566860)
                     /locus_tag="PAS_chr4_0938"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493650.1"
                     /db_xref="GeneID:8200951"
     CDS             complement(565985..566860)
                     /locus_tag="PAS_chr4_0938"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493695.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0938"
                     /db_xref="EnsemblGenomes-Tr:CAY71516"
                     /db_xref="GeneID:8200951"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7E1"
                     /translation="MSSLDKSIEFITPQLDQIAKTDPSERNAFIIGVSGPQGSGKSYL
                     TQHLVSRLSSIYKSINIVGMSMDDFYLTRRAQKELSDENPNNPLISGRGLPGTHDLPL
                     LIDALNRIIQRAINWQIPRYDKSLFSGLGDRSPADEWLVVDQSPIDVVVFEGWFNSFT
                     PFDNESELLIRWKKIVEISPSFVGIERENVIFLNNELERYLPVWNTFDTQIILKTNSV
                     ENVRTWRLEQEHKLIAEKGMGMTDEQVQAFIDRYMPAYYLYYEKLLNNNSICVGKTLS
                     LDISLTRQVLGSALI"
     gene            complement(<567012..>567831)
                     /locus_tag="PAS_chr4_0939"
                     /db_xref="GeneID:8200971"
     mRNA            complement(join(<567012..567635,567694..>567831))
                     /locus_tag="PAS_chr4_0939"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493651.1"
                     /db_xref="GeneID:8200971"
     CDS             complement(join(567012..567635,567694..567831))
                     /locus_tag="PAS_chr4_0939"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493696.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0939"
                     /db_xref="EnsemblGenomes-Tr:CAY71517"
                     /db_xref="GeneID:8200971"
                     /db_xref="GOA:C4R7E2"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR012255"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="UniProtKB/TrEMBL:C4R7E2"
                     /translation="MSTKLRILVPVKRVIDASLKPRINKAQTGVETKGVKFSINPFDD
                     IAVEEAAKIKAAHKGAVEKLHAVSIGGTKSQDVLRIALAKGFDTSTLVDVGEQEVEPL
                     QVSKILQKVVEKDNFNLVILGKQAIDDDSNQTGQMLAGLLNWPQATNASEVIIEGDSV
                     TVTKEIDGGAETVKAKLPLIITTDLRLNEPKFVTLPKMMKAKKKPIETLKPEDLGVSV
                     EQRLKVLKLEEPPVRKAGIKVKDVDELVARIKELI"
     gene            complement(<568021..>570396)
                     /locus_tag="PAS_chr4_0282"
                     /db_xref="GeneID:8200972"
     mRNA            complement(join(<568021..570279,570337..>570396))
                     /locus_tag="PAS_chr4_0282"
                     /product="Microtubule-associated protein (MAP) of the
                     XMAP215/Dis1 family"
                     /transcript_id="XM_002493652.1"
                     /db_xref="GeneID:8200972"
     CDS             complement(join(568021..570279,570337..570396))
                     /locus_tag="PAS_chr4_0282"
                     /codon_start=1
                     /product="Microtubule-associated protein (MAP) of the
                     XMAP215/Dis1 family"
                     /protein_id="XP_002493697.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0282"
                     /db_xref="EnsemblGenomes-Tr:CAY71518"
                     /db_xref="GeneID:8200972"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C4R7E3"
                     /translation="MDSEEPDYSSLPLKQRILHKNWKCRLTAYEEIQKLIDQDDSKEI
                     QIISEPELLRKIVTDSNVVAQEAGVAALCKFIQFVDPSLSLRTRDVVVPSLIEKTLAS
                     TRAGTKSKSIEALELYVELEDPEPVVNHILPFLQNRLPKLVAGSVEALVTIYQDFGAV
                     TVSPKLVFPSIPKLFSHADKNVRAQVSSLSLVLYQWIGDAFKDIIFSELKPIQQKDLT
                     KAFESLESTKPVQKRFLRSQQANQESENDVSMTEPDIEPVSDSSAKIDAYDLMEPQNI
                     LSLLPSDLDSRASSAKWKDRVEVLEEVQKVVAVPRMASGDYTRLVRILGKSLKDANVQ
                     VVQLTATILFLLAKGLRGEFEQYLSLVLTPLLERTKEKKPTVLVSLCDALNACFESSS
                     LSAVMEETVLQMANKTPQVKVETTKFLIRCLKNSKTAPSPQHIDLLIPVALKLVNDSQ
                     APVRNAGFEVVGTLMKIVGPRPLNEFMDKIDDRKRKNIMEFCETAEVSITETKKKQTT
                     IPSSTTRATDRRPKPSLGPTTKCSPVPSKRGPSSPLKRAPSSKQSPPSRRAIPSVASR
                     TNGLTNRSLTTARSISRVPDTNVSSAERLELENLRKEKKQWEQEKEKYEWRQQEHQTE
                     RVTLMKEINNLQEKTKELLNEETDKTVIIKSKDTQIDRLQHDLDLARERIRDLENEYK
                     TEGNGRVNTFKSDAALPADPPGRFSPTLSDGVDRLSLDHAISEHKENLYGTDYSKLLD
                     SSDESWRRAAEVTFQLKARIEKMKARSKYSRV"
     gene            complement(<570623..>571264)
                     /locus_tag="PAS_chr4_0283"
                     /db_xref="GeneID:8200952"
     mRNA            complement(join(<570623..571186,571250..>571264))
                     /locus_tag="PAS_chr4_0283"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493653.1"
                     /db_xref="GeneID:8200952"
     CDS             complement(join(570623..571186,571250..571264))
                     /locus_tag="PAS_chr4_0283"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493698.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0283"
                     /db_xref="EnsemblGenomes-Tr:CAY71519"
                     /db_xref="GeneID:8200952"
                     /db_xref="InterPro:IPR019721"
                     /db_xref="InterPro:IPR024549"
                     /db_xref="UniProtKB/TrEMBL:C4R7E4"
                     /translation="METYELIDSDPKFSRVVRYFRPSDYLTWALGTIGAPGLMVLFEK
                     IEPAKGNTFKMPPPSIMRIATTIGFFGGFYYAYTSSTKRFWGYSENAKEVAKDRYEVK
                     KALSEKKSPYGSSLLNPYQQDMSARNSTNSQLLLAIFPWFNVANHQSHGIDLRKYYEV
                     RDGEENWNFTLPPLDQVKDLDVAQYKEYSNYP"
     gene            <572333..>572641
                     /locus_tag="PAS_chr4_0284"
                     /db_xref="GeneID:8200501"
     mRNA            <572333..>572641
                     /locus_tag="PAS_chr4_0284"
                     /product="Cytoplasmic thioredoxin isoenzyme of the
                     thioredoxin system"
                     /transcript_id="XM_002493654.1"
                     /db_xref="GeneID:8200501"
     CDS             572333..572641
                     /locus_tag="PAS_chr4_0284"
                     /codon_start=1
                     /product="Cytoplasmic thioredoxin isoenzyme of the
                     thioredoxin system"
                     /protein_id="XP_002493699.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0284"
                     /db_xref="EnsemblGenomes-Tr:CAY71520"
                     /db_xref="GeneID:8200501"
                     /db_xref="GOA:C4R7E5"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C4R7E5"
                     /translation="MVQEINSAEEFDKAIASGVVLVDFFATWCGPCKMIAPVLDKFSK
                     EYEQVTFYKVDVDKLSEVAARFEISAMPTFLFFQNGEVVSKVTGANAAAIKQTITKLI
                     "
     gene            <572827..>573693
                     /locus_tag="PAS_chr4_0940"
                     /db_xref="GeneID:8200727"
     mRNA            <572827..>573693
                     /locus_tag="PAS_chr4_0940"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493655.1"
                     /db_xref="GeneID:8200727"
     CDS             572827..573693
                     /locus_tag="PAS_chr4_0940"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493700.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0940"
                     /db_xref="EnsemblGenomes-Tr:CAY71521"
                     /db_xref="GeneID:8200727"
                     /db_xref="GOA:C4R7E6"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:C4R7E6"
                     /translation="MARKKSLMSAEEIQEMANVIIEKEIQPLFDTKEPFQIISAVRYD
                     PIVNEEGITIEPTEECFFLIDRHCSRLNLSTSYFGWKVQVSKELLMEKLIESVKAAGE
                     SQSLKCRVYLDEQGNLNVATDVIPAKPFGLFEGLKPLDQYSSLLWDVVVSPEPIGISP
                     FTSFKTTNRGHYNKIREATLKGGPEGRPQEVLLYNTAGQVTEGSVTNVAFYRKFPSYV
                     GPEKGTLKWITPPLSTGPLCGVTRAELLAREDIVEDRLFLKDIKDGEDVLLMNGIQGV
                     VRGKIRMVSKSA"
     gene            complement(<573722..>574663)
                     /locus_tag="PAS_chr4_0285"
                     /db_xref="GeneID:8200973"
     mRNA            complement(<573722..>574663)
                     /locus_tag="PAS_chr4_0285"
                     /product="Phosphoserine phosphatase of the
                     phosphoglycerate pathway, involved in serine and glycine
                     biosynthes"
                     /transcript_id="XM_002493656.1"
                     /db_xref="GeneID:8200973"
     CDS             complement(573722..574663)
                     /locus_tag="PAS_chr4_0285"
                     /codon_start=1
                     /product="Phosphoserine phosphatase of the
                     phosphoglycerate pathway, involved in serine and glycine
                     biosynthes"
                     /protein_id="XP_002493701.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0285"
                     /db_xref="EnsemblGenomes-Tr:CAY71522"
                     /db_xref="GeneID:8200973"
                     /db_xref="GOA:C4R7E7"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004469"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR023190"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C4R7E7"
                     /translation="MSYRLTAISKGKSFPDGSIDKIREFVRTLHHAEIHGISMLSPNK
                     ALDLQIEINDCCDGNHLDSTKDAVRTTEIEGVDLVFNELEVRKDIRLVVFDMDSTLIQ
                     QEVIELIAAKANVESEVEKITTAAMNGELDFKQSLAQRVELLRGIESSDLWNSLKPQL
                     KFTPGARELCKGLKKAGIKLAVLSGGFVPLAEYVSNELGLDYAYANTLKTEVDASGKE
                     ILSGTTIGEVVDGARKAELLKEIATKNDIPFSSVLAVGDGANDLPMMKIAGLGVAWNA
                     KPKVQEQAPAKLNSESLADIFYVLGYSDVEIEGFLNE"
     gene            <574794..>576347
                     /locus_tag="PAS_chr4_0286"
                     /db_xref="GeneID:8200728"
     mRNA            <574794..>576347
                     /locus_tag="PAS_chr4_0286"
                     /product="Protein involved in the transcription of 35S
                     rRNA genes by RNA polymerase I"
                     /transcript_id="XM_002493657.1"
                     /db_xref="GeneID:8200728"
     CDS             574794..576347
                     /locus_tag="PAS_chr4_0286"
                     /codon_start=1
                     /product="Protein involved in the transcription of 35S
                     rRNA genes by RNA polymerase I"
                     /protein_id="XP_002493702.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0286"
                     /db_xref="EnsemblGenomes-Tr:CAY71523"
                     /db_xref="GeneID:8200728"
                     /db_xref="InterPro:IPR021752"
                     /db_xref="UniProtKB/TrEMBL:C4R7E8"
                     /translation="MSTWIKGPICGIENCSSRLYRSVDGRRVCRRGHVSEHHMDIDDD
                     DGAFVVTRRLNMSQGDDGTLLAGGARSSVFSQQQNEGAGAPRERAHGLDGRKVCWQCY
                     QYVLRKQAQWLIENHGVPAEFETVVKELWIFYLKGYEPTPKEKIDDASEIERQSGTEN
                     RVPSLLHAISIIYLALLRMQIPIFVNDLISWVSTASLPYMRAFSILPRTLQQSIPTQY
                     IRIFEPIKPPIRNELYWMILRVYQFIHRVDPNPFVVDCSLFLFKLNLELLLPLDVMLM
                     VQNCLSDIDENVYELPLLKRGIHTNYHNDVFLAKDLVKIPELRIVGLLICCTKFYFFN
                     TVSTRVKVDITRWYTLINRYNFTFNAGHLSEMIFKDSDDNKLAKWDEDQVDSYLKWFE
                     ENLLEQEKDKDSANMDPAQRRLREVFTLQGIDTGEKVKKSSKAFNSAEEKPTLVELYQ
                     SLLDGIENNDPSRSNASASPTLNSIRQLHDFLISRLSITFGVTEDRLGDITRLCQSSI
                     EGSGVKAKK"
     gene            <577083..>578861
                     /locus_tag="PAS_chr4_0287"
                     /db_xref="GeneID:8200729"
     mRNA            <577083..>578861
                     /locus_tag="PAS_chr4_0287"
                     /product="Dicarboxylic amino acid permease"
                     /transcript_id="XM_002493658.1"
                     /db_xref="GeneID:8200729"
     CDS             577083..578861
                     /locus_tag="PAS_chr4_0287"
                     /codon_start=1
                     /product="Dicarboxylic amino acid permease"
                     /protein_id="XP_002493703.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0287"
                     /db_xref="EnsemblGenomes-Tr:CAY71524"
                     /db_xref="GeneID:8200729"
                     /db_xref="GOA:C4R7E9"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C4R7E9"
                     /translation="MKNFFNSSDSEKHEEKVNDEKVQSISYSQSILSLPDLDPTLSRH
                     ASEYEADLSKIQPGVAGEKGHQLKRDLKARHISMIALGGSLGTGLLIGTANSLATAGP
                     GSVFITYSFVGLMVFFVMSALGEMATYIPLAGGFTGYSDRYAHPALGFAVGYSYLAKY
                     LIVTPNQLVAGSLVMQYWVSPEKVNPGVWITIFLVSVVLINLFGVKFFGELEFWLSSL
                     KVITVLGLIIMLFVFMLGGGPDHERLGFRYWTNPGAFAPWKGIASIPKAKFIAFVSSF
                     VYAVFAYSGTELVGVVVAEASRPRRNVPRAIKLTFYRICVFYILSVLLLGCCVAYNDA
                     ELVAARAKSTSSSASPFVVAINAQGISGLPHLMNACILIFVFSACNSDLYIATRTLYG
                     LSVQRKAPKILSRTNKTGVPYLSLAVAFCFSCLAYMACSSGSASIFGYFVNVVSIMGL
                     LTWISLLITHICFMNAMKAQGIPRKSLPYRAPFQPYASWITLFFCILVALIKNFTVFL
                     NGFNYKDFITGYIGIPYYFICFFGYKFITGAKRHKSAEVDLLTHKDVIDAEEEEYAFA
                     EAELKAERGNKKDAQWLYDRIFGWIF"
     gene            complement(<579017..>581017)
                     /locus_tag="PAS_chr4_0288"
                     /db_xref="GeneID:8200730"
     mRNA            complement(<579017..>581017)
                     /locus_tag="PAS_chr4_0288"
                     /product="Protein interacting with poly(A)-binding protein
                     Pab1p"
                     /transcript_id="XM_002493659.1"
                     /db_xref="GeneID:8200730"
     CDS             complement(579017..581017)
                     /locus_tag="PAS_chr4_0288"
                     /codon_start=1
                     /product="Protein interacting with poly(A)-binding protein
                     Pab1p"
                     /protein_id="XP_002493704.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0288"
                     /db_xref="EnsemblGenomes-Tr:CAY71525"
                     /db_xref="GeneID:8200730"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:C4R7F0"
                     /translation="MSQIKNARPNSSGTSGHRRSNSRNFNGSGPGSNRKYNGKEESSQ
                     KPAVQQSKVAAQNNDDRLLFALAHSIGSKVIVTVGSGSSYSGMLVSFNDFAADSELSV
                     IVKYPELIDGSQENDAEELPETLVFKAKDIVAVEIEQLDFSKAHNSYPAAIAEAAEGN
                     TDSKKAFKTDTDISGKSQSKERELQKWVPEGPDTDLGNLEDDTHANWDQFEVNERKFG
                     VKSTYDENLYTTRINRDDPDYERKLVEAERIAKEIESQSYNGNIHVAEERGLVVDDSG
                     IDEEDKYSGVLRDDDNSQNKGGELLLGMLKKNVKAQPSELKQYKAGRYVPPNHRAANF
                     HHDPAVLQSSAITQDTSKTKKPKEGQDSKTGDSKEQPKTKAQKEIESLKEFSSNLKLP
                     KKPAEDSVPKEKNKQETSKTPSSASKVSDESSKPATAATTTSTKKPFKMNPNTASFSP
                     MGFGGQTDFHAPHRIIPASGTSQGSFTRPKRNISQQAFFGANRVPTVAKQKILKDNFN
                     LFLEKHRKDPKAPFEKPFVTPPTWETTIEESYRVLFPINPEIPMMPDNRMFFYGGGQT
                     SPIHNTSPLPQQLIPRMIPMIPGQGPSGGPGVPQTGSQHFVPYQPQLIPPQMMMSHNQ
                     QRRGYMPPLSQSGMGVPMMAPPPFPGHYNGGKHMRSDNKDLR"
     gene            <581370..>581714
                     /locus_tag="PAS_chr4_0289"
                     /db_xref="GeneID:8200731"
     mRNA            <581370..>581714
                     /locus_tag="PAS_chr4_0289"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493660.1"
                     /db_xref="GeneID:8200731"
     CDS             581370..581714
                     /locus_tag="PAS_chr4_0289"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493705.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0289"
                     /db_xref="EnsemblGenomes-Tr:CAY71526"
                     /db_xref="GeneID:8200731"
                     /db_xref="InterPro:IPR005334"
                     /db_xref="UniProtKB/TrEMBL:C4R7F1"
                     /translation="MKIEITKEINIESLPLEKDLLVEKIKSAVEDPELELDSELVKKV
                     ISDILGELISKSSLHKFFVNVVRIQGVEGQNLNICSTSGGHWDQHKDGLLNFKVEVEG
                     GILMVSVVWLKS"
     gene            <581939..>582364
                     /locus_tag="PAS_chr4_0290"
                     /db_xref="GeneID:8200732"
     mRNA            join(<581939..581972,582030..>582364)
                     /locus_tag="PAS_chr4_0290"
                     /product="Vacuolar transporter chaperon (VTC) involved in
                     distributing V-ATPase and other membrane proteins"
                     /transcript_id="XM_002493661.1"
                     /db_xref="GeneID:8200732"
     CDS             join(581939..581972,582030..582364)
                     /locus_tag="PAS_chr4_0290"
                     /codon_start=1
                     /product="Vacuolar transporter chaperon (VTC) involved in
                     distributing V-ATPase and other membrane proteins"
                     /protein_id="XP_002493706.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0290"
                     /db_xref="EnsemblGenomes-Tr:CAY71527"
                     /db_xref="GeneID:8200732"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:C4R7F2"
                     /translation="MSTQPLLQSAPGKRIALPTRVEPKVFFANERTFLSWLNFTVILG
                     SLGVGLLNFGDKIGRISAGLFTFIAMGTMLYALITYHWRASAIRRRGSGPYDDRFGPT
                     MLCLFLLIAIVVNFTLRIRS"
     gene            <582570..>582809
                     /locus_tag="PAS_chr4_0291"
                     /db_xref="GeneID:8200733"
     mRNA            <582570..>582809
                     /locus_tag="PAS_chr4_0291"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493662.1"
                     /db_xref="GeneID:8200733"
     CDS             582570..582809
                     /locus_tag="PAS_chr4_0291"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493707.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0291"
                     /db_xref="EnsemblGenomes-Tr:CAY71528"
                     /db_xref="GeneID:8200733"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:C4R7F3"
                     /translation="MHAKVRALYKELIYLARFHPNEKKLKDSIKAGFLKNKNISSENE
                     TELFGALAHGRYMCRELTSLYELQTYRAVKRKYYT"
     gene            <583080..>583618
                     /locus_tag="PAS_chr4_0292"
                     /db_xref="GeneID:8200734"
     mRNA            join(<583080..583082,583214..>583618)
                     /locus_tag="PAS_chr4_0292"
                     /product="40S ribosomal protein S24"
                     /transcript_id="XM_002493663.1"
                     /db_xref="GeneID:8200734"
     CDS             join(583080..583082,583214..583618)
                     /locus_tag="PAS_chr4_0292"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="XP_002493708.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0292"
                     /db_xref="EnsemblGenomes-Tr:CAY71529"
                     /db_xref="GeneID:8200734"
                     /db_xref="GOA:C4R7F4"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:C4R7F4"
                     /translation="MSDAVTIRTRKVIKNPLLARIQFVIDVHHPGKANVSKDELRERL
                     AEIYKADKDAVSVFGFRTHFGGGKSSGFGLVYQSVSDAKRFEPTYRLIRYGLAQKVEK
                     PSRQQRKQKKNRDKKIFGTQEKFAKKAAKRAAE"
     gene            complement(<583732..>584934)
                     /locus_tag="PAS_chr4_0293"
                     /db_xref="GeneID:8200735"
     mRNA            complement(join(<583732..584824,584894..>584934))
                     /locus_tag="PAS_chr4_0293"
                     /product="Component of the septin ring of the mother-bud
                     neck that is required for cytokinesis"
                     /transcript_id="XM_002493664.1"
                     /db_xref="GeneID:8200735"
     CDS             complement(join(583732..584824,584894..584934))
                     /locus_tag="PAS_chr4_0293"
                     /codon_start=1
                     /product="Component of the septin ring of the mother-bud
                     neck that is required for cytokinesis"
                     /protein_id="XP_002493709.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0293"
                     /db_xref="EnsemblGenomes-Tr:CAY71530"
                     /db_xref="GeneID:8200735"
                     /db_xref="GOA:C4R7F5"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7F5"
                     /translation="MSEQIGISNLPNQRYKLASKNGGYFTLMVAGESGLGKTTFINTL
                     FQTTLKQSPDAKVRHKSDIHKTVEIEITRAELEEKNYTLRLNVIDTPGFGDNINNRNA
                     FQPIVDFIDDQHDLYMKQEQQPERARAHDLRVHACLYFIRPTGHTLKPLDVEVMKKLG
                     SRCNLIPVIAKADTLSPNEMLDFKNNIRAIIEAQDIRIYSPPIDHEDQGAAEHARQLI
                     ESMPFAVIGSEDLHEVTPGAAPVAGRKYPWGIVEVENDQHCDFRKLRSLLLRINMLDL
                     ILSTEELHYETYRSLRLSDDVPERSHEISRINNPKFLEEEKALRQAFSNQVKVEEQRF
                     KQWEQNINTERARLNHDLSEIQEQIKQMEDQIKKLEISKGIKV"
     gene            <585178..>586272
                     /locus_tag="PAS_chr4_0294"
                     /db_xref="GeneID:8200736"
     mRNA            <585178..>586272
                     /locus_tag="PAS_chr4_0294"
                     /product="Anthranilate phosphoribosyl transferase of the
                     tryptophan biosynthetic pathway"
                     /transcript_id="XM_002493665.1"
                     /db_xref="GeneID:8200736"
     CDS             585178..586272
                     /locus_tag="PAS_chr4_0294"
                     /codon_start=1
                     /product="Anthranilate phosphoribosyl transferase of the
                     tryptophan biosynthetic pathway"
                     /protein_id="XP_002493710.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0294"
                     /db_xref="EnsemblGenomes-Tr:CAY71531"
                     /db_xref="GeneID:8200736"
                     /db_xref="GOA:C4R7F6"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR005940"
                     /db_xref="InterPro:IPR017459"
                     /db_xref="UniProtKB/TrEMBL:C4R7F6"
                     /translation="MSLQNKTVLTPFIKSLLLTPPNFPPSDLTTILKLVVQGLASDVQ
                     LAAFLTALKMSRLDHNPLYVAAMASALLEFSSLIPISDSENVWFTDIVGTGGDGQNTF
                     NVSTSAAIVAAGMGLDVCKHGGKASSSASGAGDLMTFLGVDQSNVTAETFPRLRQASK
                     FSFLLAPNFHPAMAKVAPVRAQLNIPTIFNLMGPLINPAPIASRIIGVYAEDLGQLFA
                     EAFIVLDKSRYGKVGKTMVVWGCCGLDEISPIGRTKTWTVDPETETVTVGYLEPSDFG
                     LAEHTLDTVQSGTPSANAETLISILQNQPEYSEPDHPLVDYIVMNAAALAVVSGLASD
                     WKHGVILARKSISSGAALEQLRSFADASRA"
     gene            complement(<586315..>589158)
                     /locus_tag="PAS_chr4_0295"
                     /db_xref="GeneID:8200737"
     mRNA            complement(<586315..>589158)
                     /locus_tag="PAS_chr4_0295"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493666.1"
                     /db_xref="GeneID:8200737"
     CDS             complement(586315..589158)
                     /locus_tag="PAS_chr4_0295"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493711.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0295"
                     /db_xref="EnsemblGenomes-Tr:CAY71532"
                     /db_xref="GeneID:8200737"
                     /db_xref="UniProtKB/TrEMBL:C4R7F7"
                     /translation="MFGHNSFLGTPKNPKKSSSMDFTPIGISRASNNENNPTSNRTIH
                     SKDPNFRISPLHNHNLNGSSINYDEQDNDTILSDDFMPSAPPHNILSDINTNIPIDNH
                     SLFRENLVRQTDVNVQKLETENLNLKLQLTTLKNYLDSTPEDQLATLQENISLKEKLM
                     RLNDLNQQLQNAPVQHSSPKFEHENATLRADIDHLNSKLLQMSDANEDLEAQCERYRL
                     QLEHLHSSIDEGQNKEQEAQQWLKDAEEKAEELYKQLEESESERNNAENQVASYAKEL
                     EDLTKINDTLQNENESLRSRIQDIKEPHIDLEGRLHELTTKLAEKNNDISEYQSLLDE
                     QRSKYQSELDEQRRSYQLKLQEKDSELLENQREIHRLSQQLHEMERLKSTDVALNEKV
                     EELAAENKLLRKDKEHLLKDLRRVEDTSRTQQTNFTEVKRLENERDDLFDKIIKYQEY
                     VQDLEDKLEHEQSKSSKLKLELEHINQAYSSLQKENYSSAHSSEADYNALKKNYEMER
                     SSLLNELDSLKLEVSLLKNEIQKTKERDTFSTPLYIETEYRKLSTDYSNLQRKLQEYE
                     DAYNEKATELSSVKADLNIKLQQKDTKLQQLEQYRDQDRIEYEREKLSLQRKRDSLES
                     QYRMKSLEADNIRRDYESKIASLNQDFRTNDNTLQSLLETQVKDLKASNALLTRKLEE
                     QILESNKIKNRNTDVESVAERLEKLCVSMEEDKKQLTEKNQSLSDEVDTVKKHCSRLA
                     NRLQEQQKNEVPKEDVELLKSNLKMNEKILQEKELQYKQEKEKLLERYRVLFGQKLDL
                     ESRLQDQNNQLPMSPISPSKENHTPKCKLRDDSKIAKDLTITEKRLQLFQYKLLEKES
                     KLQDLIVTNRVVQLLNQDLTSSLKLHIKQIGDGTGLYPEYSLKRKKITFRTLAFTVLA
                     SIRLKNRLITSQVLKLRFNSIKKEIQQEELDLV"
     gene            complement(<589409..>589786)
                     /locus_tag="PAS_chr4_0296"
                     /db_xref="GeneID:8200738"
     mRNA            complement(<589409..>589786)
                     /locus_tag="PAS_chr4_0296"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493667.1"
                     /db_xref="GeneID:8200738"
     CDS             complement(589409..589786)
                     /locus_tag="PAS_chr4_0296"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493712.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0296"
                     /db_xref="EnsemblGenomes-Tr:CAY71533"
                     /db_xref="GeneID:8200738"
                     /db_xref="UniProtKB/TrEMBL:C4R7F8"
                     /translation="MKSYRGLSNPQLFIINCSRNMSDNERDDPFQVKQLAVQFDYVLY
                     KIKDKVEQMAETTQASILKDKEQQDLEISRVKQSISRDELLLKQCDELESEFEKLDQL
                     SVITGEFRHRIKEVEKKLRSKKR"
     gene            <589920..>591638
                     /locus_tag="PAS_chr4_0297"
                     /db_xref="GeneID:8200739"
     mRNA            <589920..>591638
                     /locus_tag="PAS_chr4_0297"
                     /product="Golgi-localized protein with homology to
                     gamma-adaptin"
                     /transcript_id="XM_002493668.1"
                     /db_xref="GeneID:8200739"
     CDS             589920..591638
                     /locus_tag="PAS_chr4_0297"
                     /codon_start=1
                     /product="Golgi-localized protein with homology to
                     gamma-adaptin"
                     /protein_id="XP_002493713.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0297"
                     /db_xref="EnsemblGenomes-Tr:CAY71534"
                     /db_xref="GeneID:8200739"
                     /db_xref="GOA:C4R7F9"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="UniProtKB/TrEMBL:C4R7F9"
                     /translation="MSMSLSQVPGVNGKLLRRIHRACKPTLDEPNLALNLEICDLINE
                     KQGSLPRQAAIAVVKLVNSRDPQVSELSLSLLDNLVKNCGYPFHLQISRKEFLNELVK
                     KFPDRPPPRYTRTQRLILGAIEEWTETICKTSRYKEDFGFIRDMHRLLGFKGYIFPEI
                     KKEDAAVLNRSDHLKSIEELQKEERLAQSAKLQELIRRGRPQDLKEANKLMKVMSGFQ
                     EDKSFEVSKQEVAENIEKLKRKADIFGDMLNNATNVGKIDPTDETISELYGTLKSSQS
                     TIQKLAQEESDDPEAVNTLLSLNDQVYSLLEKYNFLKEGDISNASKVKSGGGINLIDF
                     DDDDTGSVSPVNANTNESDAVADLLSDLTFNERQASTSVNNSNSINDLLNLGSGTIHL
                     GSPGPQSQIQEAQSPSLPQQQSNSALDDLLNFGSAAKSTGTTTAPAALDPFGMDFPST
                     TNSVVSQKRFLLHESHHIKIEYEVQSVNPFHFRFFYSNVAVQPVTSFQFLVAVPKLWD
                     LQLKPQSSNFLASNTKDAIWQDVTITSKSGDSSAKDVKIKWKIDYAVSAVTAVEDGVA
                     VIPQSQ"
     gene            complement(<591699..>594854)
                     /locus_tag="PAS_chr4_0298"
                     /db_xref="GeneID:8200740"
     mRNA            complement(<591699..>594854)
                     /locus_tag="PAS_chr4_0298"
                     /product="Component of the NuA4 histone acetyltransferase
                     complex"
                     /transcript_id="XM_002493669.1"
                     /db_xref="GeneID:8200740"
     CDS             complement(591699..594854)
                     /locus_tag="PAS_chr4_0298"
                     /codon_start=1
                     /product="Component of the NuA4 histone acetyltransferase
                     complex"
                     /protein_id="XP_002493714.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0298"
                     /db_xref="EnsemblGenomes-Tr:CAY71535"
                     /db_xref="GeneID:8200740"
                     /db_xref="GOA:C4R7G0"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:C4R7G0"
                     /translation="MSSLDSNVTASSKHDSPKRQPEDGSGTNDDPLQRILNERKRKLA
                     ELYCVSRLPLLPISPSQVSQIGENLMRFLERNDLEQGRQFNITTLTGDKSQKQPPVSK
                     EVSTADQLESPHWPVKEDEETTKDEPPRKKQKTASTSAEPQKATHKESKMTMMHQEVT
                     ESEAPTLSSLIRKYAQDEVPIRPDDPTDRDLNFELLDRNKTIIQALPEIYPHKIADSA
                     SLTELYYLTQTFPLAKLLPRSHKSLTTDAYESALLEGKIAVLYSRIEELKRQRKWSLR
                     QPKRFIDPFTRESPTHWDHLLAEMKWLSVDIMEERKFKAASCVQLAQAVSDYWTYGKI
                     VCIQRKPLIFLTDEEIKERTVTKVMKTEVDNENEHDHDDNDIFKDAQEEPRAMDQEQN
                     QPFEENATIDVAKLLERPNPKDEIIPPALPTYSMGDYKRLNQNAEPFKLHIGLDDFKK
                     EDLVLVEKLPLSFIFDDNLSDSKKKLSEYEKAPIAAISTLLAPPEDDEWYKIVIRRDP
                     ASELSASLDYQKGLFGASSQRRYNVLKPPKPPPIKNLELRTPTIWLPQDDKLLIRYVA
                     EYAFNWDIISAHLSARPARAYVANIERRTPWQCFERYIQLNDKFQFTDMRGQYAQSAQ
                     AWLEAAHKTQSTTKRRISPLGVGIESIQRGHRRLRWGSMLDAMRKCMRRRENINRSSQ
                     VERKHTSDDKRTNVPTPEELSRLKYDRDKAIQEAYMHQNSGTFSSARPHTQSSALSPS
                     KGKNAPLPTSAQQTGTHPYTNGIPPKGTLPKTTTPAPGVPSTQPGTPNTRQPQVSSRV
                     ATSQNTTPVTNRTGTPNGNRPGPNNSFTQEQLQHFLQAQRHRQMMQTSAGTPVNKSNV
                     PNRPAGITNTNVTTPANAVSSSTTPSKSAATASQQQPSPSRGINLTPAQVNALINQIQ
                     AQNPNMSKDQVTKFAVAYIQNLQNQRERSSNGHSTPQVRTVPTPTRATAGPPVSASPV
                     TSNASPTTPASLTKEKLDALENSPNLTPQQRQQITLFKAMQARNKMNQVANRGQESAS
                     ASSNLSASPNTDTKQTTDTNK"
     gene            complement(<594985..>596148)
                     /locus_tag="PAS_chr4_0941"
                     /db_xref="GeneID:8200741"
     mRNA            complement(<594985..>596148)
                     /locus_tag="PAS_chr4_0941"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493670.1"
                     /db_xref="GeneID:8200741"
     CDS             complement(594985..596148)
                     /locus_tag="PAS_chr4_0941"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493715.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0941"
                     /db_xref="EnsemblGenomes-Tr:CAY71536"
                     /db_xref="GeneID:8200741"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:C4R7G1"
                     /translation="MADPPSKDGKEPAVTEPVSTQHYNQIYAAFAPQCNSSRIGQTRA
                     LLPKTSPLVASALNGSFPLLLLVDHILSFATWTNKDPYYNFLCISVFITIVKYWGLVS
                     FYGLPLLLAIIFSSTAWFTQMVYRDSKEPPTLEEIVDTLSNINTKFDALFEPLTRMKK
                     LNSRQLFKLFIGVFALSPMYIFAMTSILSTKQAILSLGVLLLSYHSSWNIATRRLLWR
                     SLYIRKLIAVTTGLPVGLHAQLSAAQLARGLSSAEHTADMSLQEKIVTFQVFENQRRW
                     LGVDWSSYLLPFERSAFTNEFLEECHGLTQFEFPPIPTTSSRPDGKVLIMKWSWVDPD
                     WLLDLSFNDNKSPEGWVFYNNNWKSPSYTDSMTCFTRTRKWLRKAKLTVQGSI"
     gene            <596268..>596639
                     /locus_tag="PAS_chr4_0299"
                     /db_xref="GeneID:8200974"
     mRNA            <596268..>596639
                     /locus_tag="PAS_chr4_0299"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493671.1"
                     /db_xref="GeneID:8200974"
     CDS             596268..596639
                     /locus_tag="PAS_chr4_0299"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493716.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0299"
                     /db_xref="EnsemblGenomes-Tr:CAY71537"
                     /db_xref="GeneID:8200974"
                     /db_xref="InterPro:IPR007834"
                     /db_xref="UniProtKB/TrEMBL:C4R7G2"
                     /translation="MRENLDTIRNSKKYLKLSPLIYSVLLTTKFKMSTENKAETKQTN
                     FKALEEDDEFEDFPVQGKLSAVSDREVDQLTTEIDWPNDKTITAEKQEHLWDESWNDD
                     DNEDDFTKRLRQELANAEAKK"
     gene            <596935..>598206
                     /locus_tag="PAS_chr4_0300"
                     /db_xref="GeneID:8200742"
     mRNA            <596935..>598206
                     /locus_tag="PAS_chr4_0300"
                     /product="One of six ATPases of the 19S regulatory
                     particle of the 26S proteasome"
                     /transcript_id="XM_002493672.1"
                     /db_xref="GeneID:8200742"
     CDS             596935..598206
                     /locus_tag="PAS_chr4_0300"
                     /codon_start=1
                     /product="One of six ATPases of the 19S regulatory
                     particle of the 26S proteasome"
                     /protein_id="XP_002493717.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0300"
                     /db_xref="EnsemblGenomes-Tr:CAY71538"
                     /db_xref="GeneID:8200742"
                     /db_xref="GOA:C4R7G3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7G3"
                     /translation="MSTQEEAAEPQIDQEILNSSTNDIINRAKLLDNEIKLFRSELLR
                     LNHEKQVMTDKVKDNREKIKNNKQLPYLVGNVVELLDLEAEQDASKEGANVDLDSTRV
                     GKSAVVKTSTRQTAFLPIIGLVDPENLKPGDLIGVNKDTYLILDTLPAEYDSRVKAME
                     VDEKPTETYGDIGGLDKQVEELIEAVVLPMQQADKFKSLGIKPPKGALMYGPPGTGKT
                     LLARACAAQSNATFLKLAAPQLVQMFIGDGAKLVRDAFALAKEKAPTIIFIDELDAIG
                     TKRFDSDKSGDREVQRTMLELLNQLDGFGSDDRVKVLAATNRVDVLDPALLRSGRLDR
                     KIEFPLPTEESRAQILQIHSRKMTCDDNINWEELARSTDEFNGAQLKAVTVEAGMIAL
                     RNAQNVIKHEDFVDAIGEVQARKSKSVSFYA"
     gene            complement(<598250..>599143)
                     /locus_tag="PAS_chr4_0301"
                     /db_xref="GeneID:8200743"
     mRNA            complement(<598250..>599143)
                     /locus_tag="PAS_chr4_0301"
                     /product="Essential protein involved in nuclear export of
                     Mss4p"
                     /transcript_id="XM_002493673.1"
                     /db_xref="GeneID:8200743"
     CDS             complement(598250..599143)
                     /locus_tag="PAS_chr4_0301"
                     /codon_start=1
                     /product="Essential protein involved in nuclear export of
                     Mss4p"
                     /protein_id="XP_002493718.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0301"
                     /db_xref="EnsemblGenomes-Tr:CAY71539"
                     /db_xref="GeneID:8200743"
                     /db_xref="GOA:C4R7G4"
                     /db_xref="InterPro:IPR025602"
                     /db_xref="UniProtKB/TrEMBL:C4R7G4"
                     /translation="MSKKRVQEDSDSDIDLSSTDEELEQPQLQTNDEEPEIVDVDFDF
                     FDFNPEIDFHSVKNFIRQLFGDDNVDIELSALTDLLLEEGHVGTTVKTDGKGGDPFSI
                     LSVLNLTKNLKQTAVSKLVDYILAKTSKSTEFNIMLRQLLKQNSKYKTGLIFSERLIN
                     MPVETVPPMYKMLLEEMEKSEDSHEEYELDYFIVVSKVYQLVASEADKLLDDSNKRKK
                     TKTADSSKKEMDYFHYEDTVLEKNSTNYGYFNYNRKVQESDARRVFTDYGIEPKMSLI
                     LLTKAQLSKAIVEMEQQFPPF"
     gene            <599257..>600729
                     /locus_tag="PAS_chr4_0942"
                     /db_xref="GeneID:8200744"
     mRNA            <599257..>600729
                     /locus_tag="PAS_chr4_0942"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493674.1"
                     /db_xref="GeneID:8200744"
     CDS             599257..600729
                     /locus_tag="PAS_chr4_0942"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493719.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0942"
                     /db_xref="EnsemblGenomes-Tr:CAY71540"
                     /db_xref="GeneID:8200744"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C4R7G5"
                     /translation="MDIGYSSEDSHDGPEESKTEVIIPKDVITDVLTELDEPSTAFTV
                     STVKPLYEVPEETNRKFNPFQREAVDAVTFKLQKRSFNSQLNGSNRAKSKKQKSTSKG
                     DIAMVEGPNRYKGSWGSSSDESEPYSYSEPEEINSKPDYEKTVQLTAKPLEDESSVIY
                     SKEPFMHIPRGVGVDLTNEPGTRECFVPKKRIFQWEGHKRGTNKLQFFPNSGHLLLSG
                     GNDSSVLLWDVYHNRSLLQGYYGHTKPVKDISFNNNGTQFVSCSYDKTVKLWDTETGK
                     CSNKIKLASFPNVIKLNPNSDKQNELLIGLTDRKIQHYDLRSNEIIQTYDHHLGGINS
                     ITFVNENRNFMTSSDDKTVLVWDFQINAPIRFISDPHQHSMPQIALHPAGKFVAAQSM
                     NNTIVVFGATNRYKRNNKKLFKGHNTAGYSIGLAFSPDGKILGSGDTYGNAYFWDWKT
                     SRLVTKLKLDSKPLSCIDIHPQETSKVAIAGLSGKIHYLE"
     gene            <600874..>605256
                     /locus_tag="PAS_chr4_0302"
                     /db_xref="GeneID:8200975"
     mRNA            <600874..>605256
                     /locus_tag="PAS_chr4_0302"
                     /product="RNA polymerase III subunit C160, part of core
                     enzyme"
                     /transcript_id="XM_002493675.1"
                     /db_xref="GeneID:8200975"
     CDS             600874..605256
                     /locus_tag="PAS_chr4_0302"
                     /codon_start=1
                     /product="RNA polymerase III subunit C160, part of core
                     enzyme"
                     /protein_id="XP_002493720.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0302"
                     /db_xref="EnsemblGenomes-Tr:CAY71541"
                     /db_xref="GeneID:8200975"
                     /db_xref="GOA:C4R7G6"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015700"
                     /db_xref="UniProtKB/TrEMBL:C4R7G6"
                     /translation="MKEVVVDVAPKRIKGLEFNALSSDQIIAQSEVEVNTRNLFNLEK
                     GRAPAKDGALDTRMGVSSKSGECATCHGNLATCHGHFGHIKLALPVFHVGYFKAVIQV
                     LQTICKSCASVLLDEKTKRKALEDLRSPNNDNLRRMKIIKRILEQAKKQRRCLKCGAL
                     NGVVKKASAGAGPASLKVIHDTFRWIGKKPSQEKVEWYEDFDNLLINNPDLEKFLKRA
                     YDDLNPLKVLNLFKQVDPSDCELLGIDTTRGGRPEMYLWRYVPAPPVCIRPSVLMSDS
                     NTSNEDDLTVKLTEIVWISSLIRAGIEKGISINNLIEQWDYLQLSVAMYINSDAGNMS
                     MLPSAAGSAGSKSSKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLRIDE
                     VAVPDRVAKVLTYPEKVTRYNKHKLQQLVLNGPDVHPGANYLLKRDEQNRRNLRFGNR
                     QKLANTLQIGDIVERHLEDGDVVLFNRQPSLHRLSILSHFAKIRPWRTFRLNECVCTP
                     YNADFDGDEMNLHVPQTEEARSEAMNLMGVKNNLLTPKSGEPIIAATQDFITGSYLIS
                     HKDTFFDRASLVQILASMSDGIEHFDLPPPSIFKPAYLWTGKQVFSLLIKPNAKSNVN
                     INLDAKCKTFIPPPAGQPSEMSPNDGFVIVRGSKILSGVMDKSLLGDGKKHSVFYTIL
                     RDYGPHEAANAMNRMAKLCARYLGNRGFSIGINDVTPGDELSREKECMVEEAYKKCDE
                     LIKLFNHGKLETQPGCNEEQTLEAKIGGLLSKVREEVGGVCIKELPSSNAPLIMATCG
                     SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKTPQSKGFVRNSFYSGL
                     NPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSAQYDHTVRNSSSGVVQF
                     TYGGDGLDPLDMEGDAKPVNFKRTWDHAYNITFNNEDKPLLPYEIMKIADSFLDPLKD
                     RLVRLDNLGNIVNPEDADNIEYIDQFDAERTFYDTLKDFLFQKTKQLAALRESKGFPG
                     LLQEPESFVDESPDHSVSILINQLYRITEAAVTKFLELSATKYNRAKVEPGTAVGAIG
                     AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPIINAVLVNEDDE
                     RAARVVKGRIEKTILQDVVYYIQDVYKENQAYLQVKVDLETIERLQLELNIDEIRLAI
                     VKAPKLKLALEDVIITGRNKISVCVSDALLDSISKTAAAKGIDTSSTMANELFFRMQH
                     LKRVLTKVVVKGLPDISRAVINIRDDGKKELLVEGYGLKEVIATDGVVGCKTKTNHVL
                     EVYETLGIEAARSCIINEIDYTMSKHGMSVDPRHIQLLGDVMSYKGEVLGITRFGLAK
                     MRDSVLQLASFEKTTDHLFDAAFYMKKDLVEGVSECVILGQTMTIGTGAFQLVKKTET
                     QRGQLVAKPTLFDDLSEGKSISVA"
     gene            complement(<605363..>606178)
                     /locus_tag="PAS_chr4_0303"
                     /db_xref="GeneID:8200745"
     mRNA            complement(<605363..>606178)
                     /locus_tag="PAS_chr4_0303"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493676.1"
                     /db_xref="GeneID:8200745"
     CDS             complement(605363..606178)
                     /locus_tag="PAS_chr4_0303"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493721.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0303"
                     /db_xref="EnsemblGenomes-Tr:CAY71542"
                     /db_xref="GeneID:8200745"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:C4R7G7"
                     /translation="MQLQYLAVLCALLLNVQSKNVVDFSRFGDAKISPDDTDLESRER
                     KRVIGLQDNLQIKTPGEGDSLIDILRKRDEHDEEQGVLKHDIVIPANTEAFGGSEDVD
                     YTVIKPKTSQLLATTLTQLPEVSVFASYIRDNIDLTNELGADLKSNQILIFAPTDTAI
                     KELSKKPWEWPSEITETNNLKDETSTANINNFVESHVVVTSDKGLNLEEGANIGTAVL
                     TTLNGQTINLFNSDRTFYISVDDQPKFPLRQIEVVSNGAVLIIDRALDWPERH"
     gene            <606335..>606961
                     /locus_tag="PAS_chr4_0304"
                     /db_xref="GeneID:8200746"
     mRNA            <606335..>606961
                     /locus_tag="PAS_chr4_0304"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493677.1"
                     /db_xref="GeneID:8200746"
     CDS             606335..606961
                     /locus_tag="PAS_chr4_0304"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493722.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0304"
                     /db_xref="EnsemblGenomes-Tr:CAY71543"
                     /db_xref="GeneID:8200746"
                     /db_xref="UniProtKB/TrEMBL:C4R7G8"
                     /translation="MRDRYNAYIHNSKPSQVLYQDKLQNDELPFDTIPLNFANYYYSG
                     NALQQLSWETEQDEEDLLNEFQSNASAAAINMRFGKKTKKRNWNDLGTGLFLGELEGS
                     NTKNSNLEDETILETVDKSLFEPTSLKEDSLGQINVPWLSISEPSVSFDDSNSHIINA
                     ESEISNPVVQLNVTTPEVSRKPSLGRKRKTTVPSTSTVYETPISRSIR"
     gene            <607132..>608103
                     /locus_tag="PAS_chr4_0305"
                     /db_xref="GeneID:8200747"
     mRNA            <607132..>608103
                     /locus_tag="PAS_chr4_0305"
                     /product="O-glycosylated protein required for cell wall
                     stability"
                     /transcript_id="XM_002493678.1"
                     /db_xref="GeneID:8200747"
     CDS             607132..608103
                     /locus_tag="PAS_chr4_0305"
                     /codon_start=1
                     /product="O-glycosylated protein required for cell wall
                     stability"
                     /protein_id="XP_002493723.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0305"
                     /db_xref="EnsemblGenomes-Tr:CAY71544"
                     /db_xref="GeneID:8200747"
                     /db_xref="GOA:C4R7G9"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C4R7G9"
                     /translation="MKLAALSTIALTILPVALAGYAPPDDWSTLTAKGVYPGAFSSYS
                     NTFGIIVEPLTSSVILTPATTTHVVSQIDDGQIQHTNTAYVGTAHQVVSQIGDGQIQA
                     TASAVPLPTELASQIADGQIQATTPAGAPATPASQIQDGQVQATSSADAHPTAHSQAE
                     DIGAHSLSSTGLIPGTLTTVLTSTGSDTTLTLVTVETEVVTYTPEVTVTVNRNAAKVK
                     RDNIESACLTPQALGLTLKDSVLLDLQGRVGSIVANRQFQFDGPPPQAGTIYAVGWSI
                     TPNGYLALGDSEVFYQCLSGSFYNLYDQHIAEQCEAVHLKAVDLISC"
     gene            complement(<608274..>610280)
                     /locus_tag="PAS_chr4_0306"
                     /db_xref="GeneID:8200748"
     mRNA            complement(<608274..>610280)
                     /locus_tag="PAS_chr4_0306"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493679.1"
                     /db_xref="GeneID:8200748"
     CDS             complement(608274..610280)
                     /locus_tag="PAS_chr4_0306"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493724.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0306"
                     /db_xref="EnsemblGenomes-Tr:CAY71545"
                     /db_xref="GeneID:8200748"
                     /db_xref="GOA:C4R7H0"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:C4R7H0"
                     /translation="MTRFNYQSLDDLEESEHENDIPRRSVIKRRNSRRSSLTNNETVF
                     GKLLNALNRGAQASKSIRLNSTRRKLPLTFVPPSTKSPLFVYNNAIDNRSFLSLCSSS
                     HLNSERESALDDNQSVSTFRSLPSTLEHSPEPEQYNWLLEENERRFSERRSIRSSFDE
                     EDNLLPRTGLIFKGNQHARRASSIISQILVDQQEEDEEDFDTETVDFEYESKKLVRYS
                     IPLIITFVLEQLFSVVVILTVARIGKIELAAASLGSMTATITLAVFEGISTALDTLCP
                     QAYGSGNILTVGVHLQRCTYFALAISIPTSLIWFNISHLLKHIVSDPEVLKLTQQYLR
                     VSILGVPAYIMFENGKRFLQAQSIFDAGTIILFITAPLNLLTTYLLVWNRYIGLGFVG
                     APIATVINFWLMVSFLVLYVLFIDGKKCWGGFTKEALTQWTDLSKLAIPGILMLEAEY
                     FAYEILTLFASSFGTTALAAQSAVSTLASLTYMVPFAIGIASATRVANFIGSGNITAA
                     KITLKVGLYGALIVASLNCFVMMFGRSYIARFFSTDPEVIKEIVELLPLVATIQIFDG
                     LAAVESCMMRAQGLQMIGSFLNLAMYYLIAIPLSYISSRYFGLRLFGLWIGLGTGLLL
                     IATSEMYYIWNSDWNIMMEKARDRNLIVTYEEGDDDDEEQDIYF"
     gene            complement(<610588..>611697)
                     /locus_tag="PAS_chr4_0307"
                     /db_xref="GeneID:8200749"
     mRNA            complement(<610588..>611697)
                     /locus_tag="PAS_chr4_0307"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493680.1"
                     /db_xref="GeneID:8200749"
     CDS             complement(610588..611697)
                     /locus_tag="PAS_chr4_0307"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493725.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0307"
                     /db_xref="EnsemblGenomes-Tr:CAY71546"
                     /db_xref="GeneID:8200749"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:C4R7H1"
                     /translation="MQFNSVVISQLLLTLASVSMGASTAFKEHHQHQRATLEKRATTC
                     KFPTDKNLVAVTPNSKNGGWALSPDQECTAGSYCPYACPPGQLMAQWDPSATSYSYPE
                     SERGGIYCNENGEIEVPFSSKDWCYSGKGTLQASNKAGSNVAFCQTVLPGNEAMLIPT
                     NVDGGSTEDLAIPGTEYWASTAAHYYINPPGVSTEDGCVWGSTANPYGNWSPYVAGGN
                     VDDSGNSFVKIGWNPIYLEDATPFKNTKPDFGVKITCSEGQCNGLPCEIDPSKNGVNE
                     VSSSQSSNGAGGANSCVVTGSKGAKVTIEVFSTGGVSKREEVPIQSLLSNKDSSSNHT
                     NSTPVVDPINSGVSLSAASPVVVMTLVALTTFLFC"
     gene            complement(<613304..>617806)
                     /locus_tag="PAS_chr4_0308"
                     /db_xref="GeneID:8200750"
     mRNA            complement(<613304..>617806)
                     /locus_tag="PAS_chr4_0308"
                     /product="Transcription elongation factor"
                     /transcript_id="XM_002493681.1"
                     /db_xref="GeneID:8200750"
     CDS             complement(613304..617806)
                     /locus_tag="PAS_chr4_0308"
                     /codon_start=1
                     /product="Transcription elongation factor"
                     /protein_id="XP_002493726.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0308"
                     /db_xref="EnsemblGenomes-Tr:CAY71547"
                     /db_xref="GeneID:8200750"
                     /db_xref="GOA:C4R7H2"
                     /db_xref="InterPro:IPR000980"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR017072"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR023097"
                     /db_xref="InterPro:IPR023323"
                     /db_xref="InterPro:IPR027999"
                     /db_xref="InterPro:IPR028083"
                     /db_xref="InterPro:IPR028088"
                     /db_xref="InterPro:IPR028231"
                     /db_xref="UniProtKB/TrEMBL:C4R7H2"
                     /translation="MSAPSPSVSEEDINETRNSIDADASTVQDLLDQDAQEGSGSDNE
                     GSNIVDSSEEDDDEDDEEEMQKVREGFIVDDDDENDEDGIPSSTKRKHRKKHKKRSAE
                     VVEEVDEDDLQLLMENSGAVPGQQQNVKFKRLKRAEQDEKAQDSDSRGLNDMFSDEEG
                     PGGVVEEGSEEEGLEDNLTTKTQRSGNLPHDEFDDFIEEDEFSDEDDEARDERLARMR
                     SAKAAPQLAGLQGEQYQEIIEIFGDGTDYQWTLDAEEEMEQPQQDQEYDEAGEEIKGT
                     TTSLADVFEPSELKEKMLTDEDNVIRVTDLPERFQAYRKSIKNYKLSDVDYSNERDWI
                     VEQLKLEKRDFLQHLTQAHSSVAHLEEKFEASVKKIVDFIAIESFEVPFIWNHRRDYA
                     LHTYNDDSNNTIIVKLLNEDDLWRIVQLDLDYHSIHDKKAALSSIYKQLDLDVVDPTY
                     EEFFGSARTLSELQDIDDYLTFNYSSQVKNLTAVAELSIEGNGSGEDEEQTTKSSFAE
                     VKMKRKYSKYAIYDRIRQDAIYPVVQSIANISQMRENLAQSKRLHQVEDPIESPMDMI
                     ADIMSTEKDKTTFISSEKAYQAVKQFFSEQLSYEPFIRKTIRTAFQSFGVINIELTER
                     GKLQIEPESPYFDFKYAKNRPISALTATPDLYLRMIQAENDGLVNIKVELPMLSTVVD
                     HFYNILKSDGTSEISEKWNALRNDAWKQSLDKLIPLVQLNVKESIRRDCERVLYFQVK
                     NSFTKKIDQAPYQPPTYAKGTIPRVLTLSFGEGNRGDAVLGVFMDDSGDVKSQIKFDE
                     DFQSRDFSDSLTRYIKSNNINPDIIGISGFNIHTKKLFDKVNELVNEERLTIEYDNEY
                     GYDREEDGRSDKHLIRVIYVNDETARLYQHSSKSSAEYPNRPQLAKYCIGLAKYIQSP
                     LLEYLALDESMYSLHIHKHQNLLPREKLIDAVQTSIVDIVNLVGVDINEAVRAPYHAL
                     ALPYVCGLGPRKAAGLIQSIQRIGSNLVNRAHLITEQLTSKTVFLNMASFVYIVFDPD
                     VERNPQGEMDLLDSTRIHPEDYSLARKMAADALDIEDIDDDDESAMRNAIYEMVFPRS
                     PPKDEDDLTFKLDELILDDYATELERKHQLKKRSTLQIIKEELQSRYREIRRDFHILN
                     EAEIFQLLTRETVDSFRKGMVIPVYVRKVESSYMSVSTQSLIAGNIQRQDILEPNDRR
                     DPREVYSVGQTVRACILDVDYYNFKCQLSLLRQFTENQVAGLNVNRNPKFWDIESENR
                     DRQEEIDKQREESRESRVIKHPFFHNMKSKEAEDYLAARPVGDVVIRPSSKGSNHITI
                     SWKVAPQLYQHIDVLEENKDDANAIGRVLLVGKYRYHDLDELLVEYVNNVANKVELMV
                     SHDKFMSDSLDYVKEWLERYSKANGNRSHYIFTFNRKAPGWFFLLFKLNPTSEIKIWN
                     VKALPDGYLLANNVYPDTNSLCNGFKTLMSSRRQIKQRSNRAGGEYNNSHAGAYDNGY
                     SNAPRY"
     gene            complement(<617979..>618566)
                     /locus_tag="PAS_chr4_0309"
                     /db_xref="GeneID:8200751"
     mRNA            complement(<617979..>618566)
                     /locus_tag="PAS_chr4_0309"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493682.1"
                     /db_xref="GeneID:8200751"
     CDS             complement(617979..618566)
                     /locus_tag="PAS_chr4_0309"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493727.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0309"
                     /db_xref="EnsemblGenomes-Tr:CAY71548"
                     /db_xref="GeneID:8200751"
                     /db_xref="InterPro:IPR013260"
                     /db_xref="UniProtKB/TrEMBL:C4R7H3"
                     /translation="MAGESINDKLNKLKQKKQSTVAKNRSQLAKHQDKLKLESIKVQV
                     DDLKEKQSRAKKKLINLDEQKKRLKNWDYSIQQDEDWNDRLEKSDLPDDYAQIAERAY
                     TKDLSKALTPLSQEEYNTQKQEYYRTRSQGIPYVHKPSSEKLESVINHVKAKDERTLR
                     KINKNKIRNSLSGGDTNYINDKNKQFNEKLNRHYK"
     gene            <618897..>619952
                     /locus_tag="PAS_chr4_0943"
                     /db_xref="GeneID:8200752"
     mRNA            <618897..>619952
                     /locus_tag="PAS_chr4_0943"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493683.1"
                     /db_xref="GeneID:8200752"
     CDS             618897..619952
                     /locus_tag="PAS_chr4_0943"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493728.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0943"
                     /db_xref="EnsemblGenomes-Tr:CAY71549"
                     /db_xref="GeneID:8200752"
                     /db_xref="GOA:C4R7H4"
                     /translation="MVTKESIISDLEKENVGPEFGEFLNSLQTDLNSEKPLIEQVKSQ
                     LETHFNLGPETQEFSRKNDNAPVDQLLTNYYNNYEVNVLEFVLQMGFCKDLSIPLNVW
                     FVLDMISQLSTSKQDLPLDYYLVLNNSHTGKYSDFVRYLIYEAVGAEIHCFEQGDMPQ
                     QYRSSRWEDKVKGPALANRGPIRGNVGAGDRKITFHLLCKKTARMILVGDDRETDFEM
                     SDRSFVTLLLDYYQRVGTTKKIDLLLLTNNYDTNMNNKLQQLKILESLNMLKSNCYVL
                     DYQITADQVTANFNSYVEGIPAFRRHEIANFLKKRRTPKNADELIFKYVGRWNICYQK
                     KFHQGNISIHQISGYLD"
     gene            <620022..>620966
                     /locus_tag="PAS_chr4_0310"
                     /db_xref="GeneID:8200976"
     mRNA            <620022..>620966
                     /locus_tag="PAS_chr4_0310"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493684.1"
                     /db_xref="GeneID:8200976"
     CDS             620022..620966
                     /locus_tag="PAS_chr4_0310"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493729.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0310"
                     /db_xref="EnsemblGenomes-Tr:CAY71550"
                     /db_xref="GeneID:8200976"
                     /db_xref="InterPro:IPR019363"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C4R7H5"
                     /translation="MYREFRLPNATRGLHFAGDDKSKPLILFIPGNPGLIDYYHEFLK
                     RLSLAGYEVCGTDHLGYHESDSKIYTLEEQIQQKLELLKVLSLERKGYSTRKLILIGH
                     SMGCWLLQRIYIAVIQDETLSQSYQVVFNGLLTPTINDIGLSRKGVPFTWAYQKSLIP
                     SAVWVHGHFGRVMSWSGLSRYLNPLVHNVVSWVLKTEDSHCIDSTIDLTTNNQVLNQT
                     LSMAYEEMQRIDSDYEINTTFLNTCQDKGTTCWLFHVENDPWCSSLTRDQLTEFCKQF
                     NFISIDILPDCAHSFTLNPNHRKEVLSMLQKQLDQLSC"
     gene            <621195..>622319
                     /locus_tag="PAS_chr4_0311"
                     /db_xref="GeneID:8200753"
     mRNA            <621195..>622319
                     /locus_tag="PAS_chr4_0311"
                     /product="2-enoyl thioester reductase, member of the
                     medium chain dehydrogenase/reductase family"
                     /transcript_id="XM_002493685.1"
                     /db_xref="GeneID:8200753"
     CDS             621195..622319
                     /locus_tag="PAS_chr4_0311"
                     /codon_start=1
                     /product="2-enoyl thioester reductase, member of the
                     medium chain dehydrogenase/reductase family"
                     /protein_id="XP_002493730.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0311"
                     /db_xref="EnsemblGenomes-Tr:CAY71551"
                     /db_xref="GeneID:8200753"
                     /db_xref="GOA:C4R7H6"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R7H6"
                     /translation="MFKLNSNIISKQLLVSSSRMYSSITARALVYDTYGEPKDVINVH
                     KYEVHAPQGNEIVLQTLAAPINPSDINQVQGVYPSRPELTTELGTEKPSAVGGNEGLF
                     KIVAVGDQVSNFQIGDWCIPKGVNYGTWRTHLLSTQDKFQKLDNSALTKTQAATIAVN
                     PCTAYQMLTMYADLKKGDWFIQNGGNSQVGQYAIQIGKALGLQSISIVRDRPDIDELK
                     QQLYDLGATKVITEKENAAREFGKTVKEWTGGKPIRLGLNCVGGENLTNMARKLGQDA
                     VLLTYGGMSMKPVTLPTTLFIFKNLTAKGFWITENGKGDPILKEKTVEAVLDLYSKGL
                     LKEVPVNQFKLDLESLTDEKYLETFHSALQSHGKSLIVYE"
     gene            <622414..>622782
                     /locus_tag="PAS_chr4_0944"
                     /db_xref="GeneID:8200754"
     mRNA            <622414..>622782
                     /locus_tag="PAS_chr4_0944"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493686.1"
                     /db_xref="GeneID:8200754"
     CDS             622414..622782
                     /locus_tag="PAS_chr4_0944"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493731.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0944"
                     /db_xref="EnsemblGenomes-Tr:CAY71552"
                     /db_xref="GeneID:8200754"
                     /db_xref="GOA:C4R7H7"
                     /translation="MSQASRALKAYRNALRATSVAFKNDVATLDAARNEIRTHMKSQE
                     DPKGTNRSIDERLKLLDEVTVFLRHNIVQGRKVDEGKYRLNIHKDTELGDNDDIKKKK
                     DGLSNGGFTGCCGGSGAKTT"
     gene            <622978..>623604
                     /locus_tag="PAS_chr4_0312"
                     /db_xref="GeneID:8200977"
     mRNA            <622978..>623604
                     /locus_tag="PAS_chr4_0312"
                     /product="tRNA 2'-phosphotransferase"
                     /transcript_id="XM_002493687.1"
                     /db_xref="GeneID:8200977"
     CDS             622978..623604
                     /locus_tag="PAS_chr4_0312"
                     /codon_start=1
                     /product="tRNA 2'-phosphotransferase"
                     /protein_id="XP_002493732.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0312"
                     /db_xref="EnsemblGenomes-Tr:CAY71553"
                     /db_xref="GeneID:8200977"
                     /db_xref="GOA:C4R7H8"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="UniProtKB/TrEMBL:C4R7H8"
                     /translation="MSRDIVISKALSWLLRHGAQSEKLTIDKDGFVPLEEVLNHRRIK
                     GTRASFEDVQRIVDNNDKKRFTLQKRDDRWFICANQGHSIANVNGHDLKLLSTREDLP
                     KEIIHGTYLSKIPQIIASGGLSKMTRNHVHFASGLPKVDSDVISGMRNGCSALIYLDI
                     DKILGQQEIKFYISKNKVILSPGNKDGIVPTSLFLKVVKRSDNSPIAI"
     gene            complement(<623610..>625871)
                     /locus_tag="PAS_chr4_0313"
                     /db_xref="GeneID:8200755"
     mRNA            complement(<623610..>625871)
                     /locus_tag="PAS_chr4_0313"
                     /product="Member of the PAK family of serine/threonine
                     protein kinases with similarity to Ste20p and Cla4p"
                     /transcript_id="XM_002493688.1"
                     /db_xref="GeneID:8200755"
     CDS             complement(623610..625871)
                     /locus_tag="PAS_chr4_0313"
                     /codon_start=1
                     /product="Member of the PAK family of serine/threonine
                     protein kinases with similarity to Ste20p and Cla4p"
                     /protein_id="XP_002493733.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0313"
                     /db_xref="EnsemblGenomes-Tr:CAY71554"
                     /db_xref="GeneID:8200755"
                     /db_xref="GOA:C4R7H9"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C4R7H9"
                     /translation="MSFSATEYFPSDAFSNPGRAPPAPAQDYHAHLKSGSNSSEGSAN
                     SNYPYYHTKIDLKRRQTWVNIKEGDSLMSFRWSKRLMFLGESSLDFYKSENKRQDELS
                     YSIPYLNVANLVRNQIRSHCFEISNSNDKHLYVSFKTDQELYDWIDVIMAKCPINSGG
                     GTPVSKPTNFTHKTHVGFDPTSGKYTGLPNEWKSLLEHSHITNEDWNENPSAVIDVLN
                     FYSDITSDQNTQDEKDKIFNENLLKWTKPPSSSGLHLNSSTPPPVVPLPVLNPHSPAD
                     SNIPPKVLPYRPKGKESENLVPIRRAPPPPTRSPFTDQKTGQPNGVSPKPKLQLRTDE
                     NYQQKPKAKLSFEQQRYYQESNPYASSPSPGVSPGGVSPLHISPVARRVSPPKAEHQR
                     QAPKPPVASNDIRTQKPQQPQHYVPQKTQQVPKAPTNNPMSVAAAVTAQKLSPLRKSE
                     KRISTMTEAQIMSKLRSVVVHDTDPVPYFQMIEKAGQGASGSVYLAKSKRTNSNVAIK
                     QIDLQKQARKELIVNEILVMKDSRHKNIVNFLEAYLRNSYELWVVMEYMEGGSLTDII
                     ENNNSLKESQIATICLETVKGLQFLHRKHIIHRDIKSDNVLLDSQGNVKLTDFGFCAK
                     LTDQKTKRATMVGTPYWMAPEVVKQKEYDEKVDVWSLGIMAIEMIEGEPPYMNEEPLK
                     ALYLIATNGTPKLKNSSGVSIYLKKFLSICLCVDVRYRATTDELLKHSFLQSAAPVRD
                     LACLLEWKSEPVE"
     gene            <626843..>628651
                     /locus_tag="PAS_chr4_0314"
                     /db_xref="GeneID:8200756"
     mRNA            <626843..>628651
                     /locus_tag="PAS_chr4_0314"
                     /product="Phenylpyruvate decarboxylase, catalyzes
                     decarboxylation of phenylpyruvate to phenylacetaldehyde"
                     /transcript_id="XM_002493689.1"
                     /db_xref="GeneID:8200756"
     CDS             626843..628651
                     /locus_tag="PAS_chr4_0314"
                     /codon_start=1
                     /product="Phenylpyruvate decarboxylase, catalyzes
                     decarboxylation of phenylpyruvate to phenylacetaldehyde"
                     /protein_id="XP_002493734.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0314"
                     /db_xref="EnsemblGenomes-Tr:CAY71555"
                     /db_xref="GeneID:8200756"
                     /db_xref="GOA:C4R7I0"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C4R7I0"
                     /translation="MAPVKQDFNIDVQTIENTDISLSEYIYLRIAQLGVKSIFGVPGD
                     FNLNLVDELDKVPQLKWIGCCNELNATYAADGYAKASGTIGVVVTTYGVGELSAINGI
                     AGAFAEYAPVLHIVGTSAMATKRLEHVHNIHHLAGSKNFLDRPDHYIYEKMVDDICIV
                     KESLSEIENACGQIDNAIVQTYLLSRPGYLFLPRNMATMKVPRERLFNQPLALERVDL
                     HPGETLQVVEKILEKFYHAKEPALIVDYLTRPFRMMENCSKLIGALENKVNIFSRPMS
                     KGFVDESHPRYIGCYIGKQSKHPSTSDILEKKSDFILSVGTFDVETNNGGFTSKLPQE
                     HLVELNPHFTRVGTQCFSNVNMCHVLPLLASKLRGDLISMATVHPNDFSLRKKEKAQD
                     KMKALNQSHLVKSTELLLNANDTLIVETCSFMFAVPDIAFPNNTQFISQSFYNSIGYA
                     LPATLGVSIAKRDFRKPGKVVLIQGDGSAQMTIQELATMVRQKVKPTILLLNNEGYTV
                     ERMILGPTKEYNDIAPNWDWTGMLRAFGDIRGHSKSISIDTCGRLDKLVQTREFQEPT
                     HLNFVELILGRMDAPERFANMVKEIANLEHASKSIH"
     gene            <629131..>630531
                     /locus_tag="PAS_chr4_0945"
                     /db_xref="GeneID:8200757"
     mRNA            <629131..>630531
                     /locus_tag="PAS_chr4_0945"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493690.1"
                     /db_xref="GeneID:8200757"
     CDS             629131..630531
                     /locus_tag="PAS_chr4_0945"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493735.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0945"
                     /db_xref="EnsemblGenomes-Tr:CAY71556"
                     /db_xref="GeneID:8200757"
                     /db_xref="UniProtKB/TrEMBL:C4R7I1"
                     /translation="MKQTYYDPKVAEPIGSESMDDSKLDDMVQSLPPVDPLLDTPFPF
                     RSADVEQGDTFATENNAGPTQSARTNVNFLPPHQSLFDALQSSNLNMVEEIDPLRRSN
                     QPEECSPSCWNQEFSVTAWQMVHRDDVKLQNLWTHTKMYGTGSRRVPGTGNGESVLSS
                     SEYEETDLPDTPLLNEDDIEERNEHDTILMIAEDENLKDTATVSSGRQSSFVMPKVSL
                     PDSGASNSKSISWNGKHARIKVQVVGNCAERLLARLIPYRKTLWMLDFVESGADILVL
                     LLNKDNVVLPRILNKPFLPIIIKDDDAEFSSSIDTTSLFDNYNTKSTARSSSSSIISE
                     PLELKSIDDDLFDIIHALSNMELDFCGEESFQHISTQTSTIASSKQARSRRSSSRLAQ
                     RRKLHKQTQMSQSREKRSHQRCSYEYINWIRRQLTLGLTLGLISISYCIWSFSSDHNK
                     LHGYHHMNGVWMRCTV"
     gene            <630699..>634337
                     /locus_tag="PAS_chr4_0315"
                     /db_xref="GeneID:8200978"
     mRNA            <630699..>634337
                     /locus_tag="PAS_chr4_0315"
                     /product="Histidine kinase osmosensor that regulates a MAP
                     kinase cascade"
                     /transcript_id="XM_002493691.1"
                     /db_xref="GeneID:8200978"
     CDS             630699..634337
                     /locus_tag="PAS_chr4_0315"
                     /codon_start=1
                     /product="Histidine kinase osmosensor that regulates a MAP
                     kinase cascade"
                     /protein_id="XP_002493736.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0315"
                     /db_xref="EnsemblGenomes-Tr:CAY71557"
                     /db_xref="GeneID:8200978"
                     /db_xref="GOA:C4R7I2"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:C4R7I2"
                     /translation="MRRLKLSIRTQLILLVCMVAILSLVILACITGVYFTSNLTSARS
                     ERLEVISELKVSELLQSFTNLYYQAFWLSTRDTLEDSLISSKVGNSSADTSTAASATI
                     QSFLNSNEDFLQCKLYSVNFDTLSFVETSRDLAGNITSMTPSLFPLDEPTPAVLQVLG
                     SYGGYLAGPSNNGSAFFVSLTLPIYINSSIIIDSPELSGYLTVMSLANSLMSATSYST
                     VLDAADISFTQLILNPQNASIILGFKYVFPPYGHDIDSVDVLYPLDDYAPVYQLNQRQ
                     YTADGTLISTNNLGSSSKIKNPFGESVAVGYSKADLYFANWTVIVEQSRSSFMAPIVK
                     FRNIIIGVSIGMAAFFCLITFPLAHWGVRPILRLQKASEAITRGWGLRTGKDKRQTPD
                     RYTPYASMTPVSNSFPNDTDPNSRSSTTSKEHSFFIPERIPEKNRFFKDELSELTNAF
                     NTMTEELYMQYTHLEDRVKARTKELEVAKIAAEAANEAKTVFIANISHELRTPLNGIL
                     GMTTIATEYTDIGMIKDSLKVIYRSGELLLHILTELLTFSKNTLNRSKLNKKNFQIMD
                     VALQIKSIFGKISKDQHVNLIIFVKPNLLRNMILYGDANRIIQVVMNLVGNALKFTPE
                     DGTVSLQIKVVGEYDRERSKRHDYGYVFVKNPHHKCAPSISTGSHVKSDSKDQSISHL
                     KVDEESPSTPNTPNTPTSVMLNTKRRLLQVTGRNKPNDTNLQDLHSDLNPEITFHNEK
                     EEFSDCGDSITLHTLDSSDYVKVVSGFQKEGHGEQLSNDYSSDTNVEATGTELNSKDD
                     DNTDDSIFDKGGSRRLDAPREWTIEITVQDTGTGISEELQERVFEPFVQGDQTLSRSH
                     GGTGLGLSICKQLAKMMKGTLTLQSKLGEGSKFTFRFPITQTGEVFNEGEDQTFNDEF
                     NEDSKVNRRVSFMEPKFEADEEVEDEDADEDDVFELSGENICNSTVTADTELTNKNNK
                     DLNNHNNGQLPDNIKEEDEFEEIDGDAAKVEAKSMDGNSPSNSSPKLLNISSKSIKQN
                     RANAESLTLKLDGTSEKKTPASAEKTKDRPSLSAMPSSGTLSSLGTSNSGNVSIDTNL
                     RILVAEDNQVNQEVIRRMLNLDGLKDVTIVSNGQEAINTITDITSKGGYFDIVFMDVQ
                     MPILDGLKATQHIRKELHYTHPIVALTAYVDESNVAECLDSGMTGFLAKPVRKVQLRR
                     LIADICSA"
     gene            <634603..>639669
                     /locus_tag="PAS_chr4_0316"
                     /db_xref="GeneID:8200758"
     mRNA            <634603..>639669
                     /locus_tag="PAS_chr4_0316"
                     /product="Myosin-like protein associated with the nuclear
                     envelope"
                     /transcript_id="XM_002493692.1"
                     /db_xref="GeneID:8200758"
     CDS             634603..639669
                     /locus_tag="PAS_chr4_0316"
                     /codon_start=1
                     /product="Myosin-like protein associated with the nuclear
                     envelope"
                     /protein_id="XP_002493737.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0316"
                     /db_xref="EnsemblGenomes-Tr:CAY71558"
                     /db_xref="GeneID:8200758"
                     /db_xref="GOA:C4R7I3"
                     /db_xref="InterPro:IPR012929"
                     /db_xref="UniProtKB/TrEMBL:C4R7I3"
                     /translation="MSNSEQQESNPGSIAHSSDPHEDLQLDLPSLSSFLNVDRSLLEG
                     VNELLLAQINVKFNNWESLKAEKLIVDMNFEQFKHESSKSLDHLKKELNASHTKNLET
                     EKLLQEEKESKDKLTTELESAKTNISNQEKVIANLKLQAETALDEKHSVFELLNSKQS
                     QVNTLKAELDQLSSNNSSLRKQYFELENKSQSLTTELSRNKHELFALSQELELTKKNS
                     EWYDSELSNKVQELKRLRLEKRETVSQLQKELDTNRTGFISTKAKYDSLYESYNKTAT
                     ELDKALTDLKRAKDDYSKKESDFFKEMSIKDNQVRFLEESNENRKQRIDELDSIIATL
                     QSEVDNNSSKINSQLEEKEKLVEAQELQIQQLTETIEDLTNQTEHSHGFLNENAQRVL
                     KQSSSNLSLSQLYTDFQLMKKQLSNERRLKEKMQVQIDHFIEELSKKLPIIESTKEKC
                     SLMENELVEYSILLEKTRFERDDAKRQVAAWNKSIDEYEDRINSLATQSADLKSQVST
                     LVAQISLKTDGSSPLTTEEKELIKSLNGKTTSFVNGSDTDKIISERLVKFKDINELVN
                     KNAELIQALRELGKKLENQEAHQKANKATFESETLKEVRENNIRLEDELKQTQEKLLL
                     IMKERDMFRDIHKLQGEPTESTQTSSQSEKEVVALTEELDRSRTELVVLKKESKATIE
                     ELNKQIRSLWEAKSDINLQLAKANSSVTIAEERLKASYESNRFIKLELDQIKGANESL
                     SQSLNSTEENNKKLFEETLSLRSEVSNINSELRSLRSEKSIWTSFQERIKDENKQLHN
                     EKASLNSLVNNLQLMLSERENSYTDSIKRLSTSLDSAEKELENAKQRIINQSTEISLL
                     VKRRDSDLEILRARIDSLTAELSSTRESLIKETAALARADQTVELLNSQVRVLEEKIK
                     PIHGIASRRLSATSKDLNTIEEYKEALEKLESDLEIAQQSADQFKNVAEAAEAELTRL
                     GSSFDEYKNVYETKLKEYSEENGKLSSSNEDLKQSIEKVKEELQDSKTAWDEERGTLL
                     NKITNLEVDASSVNSFKHDLEAKVELLQTELTQLTEESKLQNDDLNKTKSEIDELNKV
                     NQELTLYKNSTESQITELTNRAETAEKGLKEAEISWENQRNLLLGEIKETKNKIDELN
                     VENRMLLNQLESATDSTGGSQLKKNDILTGDNDNTSQLISFLRDQKDHVSRELQQSQM
                     EVTRLRQQLSIAEEEIEQSKIEAEKLEGYEKLSNELQGEITKSAELSKIVSELRQGNT
                     DLRNENQSQVNRITALYHQLEQEKAKNEPFEIQIKQLKVEVETKGKEATMNQEQLEYW
                     KTRSLNLLNEVGSIGNEEYVKEAESLKEKLAEVEGKHSELSARFNRLKDEAQSKLKRR
                     KEDYEMLRREHEELRKTLADTNAEVSSLTEKLNLSSKTSESLTQELEQLKSKQTSADL
                     NSEKHVDELKKKQEEVERLLAENNKLKETQVQSPETSEEVEALKKELQEAKEAVKKAS
                     SQADKDDSTSIDTLKAKLAAEHEADVAARIAAAVEETRKKIRAPVEERIQSVINKRWN
                     DRKKDLENEYQKRIAEASKKSETSGNVEALKKEYETKLEEVKIAAREEGRSAARKEAE
                     LRTNLLKRKAEKAEAELRKLKQAQEKVSSQPQPLPIETAVLDTATDSKDSNGTQTPTK
                     RAAELDSPGSDSPGKKTKKE"
     gene            <639785..>641467
                     /locus_tag="PAS_chr4_0946"
                     /db_xref="GeneID:8200759"
     mRNA            join(<639785..639869,639918..>641467)
                     /locus_tag="PAS_chr4_0946"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493693.1"
                     /db_xref="GeneID:8200759"
     CDS             join(639785..639869,639918..641467)
                     /locus_tag="PAS_chr4_0946"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493738.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0946"
                     /db_xref="EnsemblGenomes-Tr:CAY71559"
                     /db_xref="GeneID:8200759"
                     /db_xref="GOA:C4R7I4"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR015408"
                     /db_xref="UniProtKB/TrEMBL:C4R7I4"
                     /translation="MSDQFGSSYVDPREYHSEGEEYEINSDQDDLKSNEIDGNYNQNE
                     SKTSEMVGYFDQQRKILELEKKLKEKEKERTKIGVFAQRVATRDELKREQEQTLENVM
                     KQRTYTFDSGELSIQKRETNEKEKFTGLYINVRYLDKGAVNAMMVDKKILRIEKLLAK
                     VYPPLYQPPLYPNWVVVGLIIRKNETKLTMNKTSNYKKMTISNFSQSVDLMLFGKALQ
                     KYWKLQVGAVIAVLNPGIWKYNFKSADNIMHQGFNLTLKDNHDSILEIGKSRDLGFCS
                     SLKRDGNVCQTPINIQKSKHCTYHTELAMKKSTSKRLELSSAFRMRYPGESNEETNAH
                     QHVYMKKGGRQLQGFLQSDPLSERELNKKELAARKQFSDSLSQKAFMEENFKRTNVNK
                     AELKSKKERQLFKELEMRRSFVEKGATFFKDEEIETNAEKAEKIRLSKAAFSSGAVNK
                     IGFNPTQRLFSKSNNLGIKAKAATNLKDFLHESETKEKHLNLSKHDIKKRRKKALEVV
                     RRFQKPNGAANVEADSVCGKIPTEVTLPDSDSDSDF"
     gene            <641681..>644194
                     /locus_tag="PAS_chr4_0317"
                     /db_xref="GeneID:8200979"
     mRNA            <641681..>644194
                     /locus_tag="PAS_chr4_0317"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493694.1"
                     /db_xref="GeneID:8200979"
     CDS             641681..644194
                     /locus_tag="PAS_chr4_0317"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493739.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0317"
                     /db_xref="EnsemblGenomes-Tr:CAY71560"
                     /db_xref="GeneID:8200979"
                     /db_xref="UniProtKB/TrEMBL:C4R7I5"
                     /translation="MLQLHILTQLRRLSRLKSYRIATRGPFVQRNCIYRQFHLTSTSS
                     AKFDSKTTTFKEEPTYDQKADDLLLELNNIYKDRIIGTKLKRKRLTEKVLDVVRSLPD
                     GVFKPVTIPFMSKVINFLGPSQFDYEELISVLQAVVSGLDSTNVRTCQYIPIFCNELV
                     NWESFKKDPLVRLQVVEIFINYITLSTNRTLLHKYLDSLDSVDSNDLVRITLEAFKTR
                     APDSKTMVKLAELSDFKDNLILNEILIKFLEACDLELGKNTQLEDSILAFLGIIDSKC
                     RNDFSAYVNVLYFCSKNNLNSLAKTTLGKIESMPNNKVIFESLSPEDTNVFILVATRY
                     SFIPLAKRAIELHKFNAGDSNDCITTSIQTLLQGEPMESLVAKLEQQIKSLENDESEE
                     AYHLQSVESYNKILEAVLNLNKSEEYIVELTNWWKTEHGLERNSDSFALLISKSLDQN
                     DYHKGLKYFEESLDEYVHWGVDEEGINMTHLYRLLSMYLMESSDAIGEKFTIFQKVKS
                     FGHRLDKETLAVMAKLMLNQAYIGDLIELLERELPPFENPKSDRYQVFQYSSLYNLLM
                     DFVLTYEKDSEINWLVYGQIQKYFHVPQESYIPVMKFFCEHERPNAAYLIFHTMRSLH
                     KKKGLDPPTEEIYTYLFSEFGKQLYEEGVFKLHLFLKMDQKVNVDINMLNSILEGYVN
                     LQDILKARDVFNNALSLPKEKGINETTINLMLKTNTYISLQHTKNFWNNLSQIDYTPT
                     ASNLKQYLIAHCYHGKYSEALEVLQTSRSYGDFEIDSGLLATVYNWTLSPKARLQLKK
                     WAESEFPQLWKQVESRNLIQENTELPTLIDVHKNIRSIE"
     gene            complement(<644240..>645622)
                     /locus_tag="PAS_chr4_0318"
                     /db_xref="GeneID:8200760"
     mRNA            complement(<644240..>645622)
                     /locus_tag="PAS_chr4_0318"
                     /product="Putative transporter, member of a family of
                     seven S. cerevisiae genes (AVT1-7)"
                     /transcript_id="XM_002493695.1"
                     /db_xref="GeneID:8200760"
     CDS             complement(644240..645622)
                     /locus_tag="PAS_chr4_0318"
                     /codon_start=1
                     /product="Putative transporter, member of a family of
                     seven S. cerevisiae genes (AVT1-7)"
                     /protein_id="XP_002493740.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0318"
                     /db_xref="EnsemblGenomes-Tr:CAY71561"
                     /db_xref="GeneID:8200760"
                     /db_xref="GOA:C4R7I6"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C4R7I6"
                     /translation="MSTSKYQNLPQVSSELDQPHGDPSDSFEIEEAIDDSEELELEGI
                     MTQKGKSNMGNAFMNMANSILGAGIIGQPYAFRNCGMVGALLIMVLLTILVDWTIRLV
                     IINTKLSGTHSYQGSVYHCFGNKGKYVILLAQGLFAYGGSMAFCVIIGDTIPHVIRSV
                     FKSAIQSNRFLDFLLSRNSIIILTTCFISYPLALNRDISKLSKASGLALVSMLVIVII
                     VLARGPVVSSELKGSMSLKNWFFDIGMFQGISVISFALVCHHNTTFIYRSMKKATLDR
                     FTQLTHISCAIAMVCCSIMGIAGFAIFKDKTKGNILNNFPADDWVVNIARFCFGFNML
                     TTFPLEIFVVRDIVKDVMNGSDAEKLSTKSHFIITTLLSFSAMFVSLLTCNLGAILEL
                     TGATSASIMAYILPPLCYAKMSPNRKGLLNWYAPYLCVAFGLSVMVISTIQTLVTSFY
                     NKSDAGHCVT"
     gene            complement(<645699..>647036)
                     /locus_tag="PAS_chr4_0319"
                     /db_xref="GeneID:8200761"
     mRNA            complement(<645699..>647036)
                     /locus_tag="PAS_chr4_0319"
                     /product="N-acetyltransferase, confers resistance to the
                     sphingolipid biosynthesis inhibitor myriocin (ISP-1)"
                     /transcript_id="XM_002493696.1"
                     /db_xref="GeneID:8200761"
     CDS             complement(645699..647036)
                     /locus_tag="PAS_chr4_0319"
                     /codon_start=1
                     /product="N-acetyltransferase, confers resistance to the
                     sphingolipid biosynthesis inhibitor myriocin (ISP-1)"
                     /protein_id="XP_002493741.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0319"
                     /db_xref="EnsemblGenomes-Tr:CAY71562"
                     /db_xref="GeneID:8200761"
                     /db_xref="GOA:C4R7I7"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:C4R7I7"
                     /translation="MEGTTSQAGRRTLRPIEEYNYQRNVLKTYSCFIVASKLSECVDK
                     EVLLFGIQKLVASRKQLRLNVFKEDGTNDLYLQEISDWSVDDVVEFKTGSDIVEEIGM
                     AHRYCFVTAINKPLWKLVVLNSQWLLLQCDHTLLDGNSAAFFHEELVCLLNNQPIGKD
                     LEEESQLSKFTTPSTRYLIGCLFSEFSPKWLSNWFGKLGKMPFTEKSQYQTDDPSWNI
                     SVKSPIKDNEFKTLKHLITINTQEFIKLKSLLKAQSVSFTSFWLYLNLSVLSQFTQLS
                     LNCSIPVNLRTLLDKRNAKSYGLFVSAVELKLSTRLVSHESFDWNYVRYIQSHLSPVK
                     LEESAQLVGMLNYVNAKDYLLQKSSKPRTCTLEISNLGLREDYKNTAAQPYLNEIIFS
                     QPNNITGPYITNDMASTSEQVNILIGAVPECGYFYDLYTSGLEALLNEFIRDI"
     gene            complement(<647131..>649668)
                     /locus_tag="PAS_chr4_0320"
                     /db_xref="GeneID:8200762"
     mRNA            complement(<647131..>649668)
                     /locus_tag="PAS_chr4_0320"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493697.1"
                     /db_xref="GeneID:8200762"
     CDS             complement(647131..649668)
                     /locus_tag="PAS_chr4_0320"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493742.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0320"
                     /db_xref="EnsemblGenomes-Tr:CAY71563"
                     /db_xref="GeneID:8200762"
                     /db_xref="InterPro:IPR024527"
                     /db_xref="UniProtKB/TrEMBL:C4R7I8"
                     /translation="MTTPIAQIQLEQEASKNPPKQHTRLSDLVEKTKGTKSWVSPFRT
                     DAKAASPKRESYPPQIVADVKPEDVDNAEEETILDHDDANATVDPIESESVLDASDIS
                     IKGSTAEDNQEEQPEPATDVLPQDAEEEVADKDTQSGDIPQDEGSQAEQEEEQAPEAQ
                     EEQVSESQEAKEDDKVDNVEAKKDVADKKVTKQTQQAIKDTEEGAKAVKEAQAKLKEA
                     ELKLLKEPVVITPDLLQPPAEDDAEKTLKDKPLLLNRYKQNKEIAESSLQKKDVENPD
                     QVVDLGGGLLLTQAQIYSIAQARVKPLLGKIDKQVDLNLKADELKKRQTEQQYHEQKD
                     LQQSKNLEKYQTQLTRENNIIVARFDTDIAALSSTILSNATLLEEFATQTRKEIDDLG
                     TKALAEEEKLAEEHETNKTKLEENAKQYKEDLETKLLNATTGQEDEKTKIEELKVKVE
                     EEKAIADDLEEKAFDKNEALNAKRAELEELVAEEAKLQATVDESEQFQKECDAKAAAL
                     SVDHTKSTKKLEKLQSHVSALGSAIEKHASKIGFLTGAAVASREVKRKHNESLKSEWL
                     AEKARIRSEVAKANERKTLEAELERERLAKEKEIERQQKEEQYAQEKLDRAEEEKRLK
                     EDVAELQRVKQLKKEKSKLSKKLASTGSFFAGGVATGAAIGAATGAAAGSAAGAAASG
                     AGAAASGASKVVSSSTNTASKGASDAAQVGNGAKKTADIKRNESFASNSPEIKIDDET
                     LNKDAKPLFTEVVEDVPTTTSKADEDIKKKNRLSFLGSIKRKASLGSKKEPEKKEPAT
                     GVVPASSSIAKDNDDGEYEEVSTLETISDAEYEAHKDDPNYFIVDPK"
     gene            <650094..>652475
                     /locus_tag="PAS_chr4_0321"
                     /db_xref="GeneID:8200763"
     mRNA            <650094..>652475
                     /locus_tag="PAS_chr4_0321"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493698.1"
                     /db_xref="GeneID:8200763"
     CDS             650094..652475
                     /locus_tag="PAS_chr4_0321"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493743.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0321"
                     /db_xref="EnsemblGenomes-Tr:CAY71564"
                     /db_xref="GeneID:8200763"
                     /db_xref="GOA:C4R7I9"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR018087"
                     /db_xref="UniProtKB/TrEMBL:C4R7I9"
                     /translation="MLSGYPEPQYSKIPSSPTLNSVTNLEMYKLKADGLASNSILTTD
                     SHGNFVEESTGRKITLRGVNLDATAKLPLNQTTYKPRGKKIFYEGDTVSFVGRPFPLE
                     DAMIHINRIKSYGFNTIRFIITWEAIEHEGPGKYDEDYINYTIELLKIIHDAKGLYVF
                     IDPHQDVWSRFTGGSGAPLWTIYAAGLDPTSFHNTEAAFVQNNSKDPQNYTKMVWTSN
                     YYRLATQTLFTMFFSGKTFFPKCIINGENIQYYLQRHFIASVAHFFSRLKETAPYVLH
                     QTVIGVESMNEPNSGLLGFKDLSKIPDDQQLRIDTTPTVFQSLMTCNDIPCEVDTYYI
                     SVFGPRKSGSRLVNEQGEVLWLKNDEADRKYNFKRDPGWKIGHCPYELHGIWDSDALT
                     LMKPDYFAVHPLTGEEVDIDYFINHEFVEHYKEYKAAIRAIDPDIFMFMQPPVMEVPP
                     VLVDSPVIDDKTVNCQHYYDGMSLMFKTWNTKYNIDTLGIMRKRYSNPIFAIVFGEKN
                     IRKSLRSQLGEMKKESRKNLGAKVPVLITETGMPFDMDDKAAFSNGNYTSQTKALDAL
                     GYALEGNNLSVTYWTYTSTNCHKWGDRWNNEDFSLWSHDDRAASFDDDRFSLRSNFLY
                     ESEDDQTFTTTLSKSKDDFKVVQTREYHRGGGYQSIWNGTRALKAILRPYPVFVNGVV
                     KCCEYDLQGSKFQLTIDSDRVHSSTKALTEIFVPRVIFHPSKIKVSCSSGTFVLGNDS
                     VQVLRWDHDINAGDQEITIHLSDSDAELSEKVGNSRLRDLLCGCFKSVQNILC"
     gene            <652689..>654245
                     /locus_tag="PAS_chr4_0322"
                     /db_xref="GeneID:8200764"
     mRNA            <652689..>654245
                     /locus_tag="PAS_chr4_0322"
                     /product="Signal recognition particle (SRP) subunit
                     (homolog of mammalian SRP54)"
                     /transcript_id="XM_002493699.1"
                     /db_xref="GeneID:8200764"
     CDS             652689..654245
                     /locus_tag="PAS_chr4_0322"
                     /codon_start=1
                     /product="Signal recognition particle (SRP) subunit
                     (homolog of mammalian SRP54)"
                     /protein_id="XP_002493744.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0322"
                     /db_xref="EnsemblGenomes-Tr:CAY71565"
                     /db_xref="GeneID:8200764"
                     /db_xref="GOA:C4R7J0"
                     /db_xref="InterPro:IPR000897"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004125"
                     /db_xref="InterPro:IPR006325"
                     /db_xref="InterPro:IPR013822"
                     /db_xref="InterPro:IPR022941"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7J0"
                     /translation="MVLADLGRRINNAVGNVTKSNVVDADVISNMLKEICNALLESDV
                     NIKLVAQLREKIRKQIDAEDKPGINKKKLIQKVVFDELVKLVDCNEAELFKPKKKQTN
                     VIMMVGLQGAGKTTTCTKLAVYYQRRGFKVGMVCGDTFRAGAFDQLKQNATKAKIPYY
                     GSYTETDPVKVTFDGVEEFRKEKFEIIIVDTSGRHRQEEDLFEEMVQIGKAIKPNQTI
                     MVLDASIGQSAESQSKAFKESSDFGAIIITKMDSNSKGGGALSAIAATNTPVAFIATG
                     EHIQNFEKFSGRGFISKLLGIGDIEGLMEHVQSMNLDQGDTIKNFKEGKFTLQDFQTQ
                     LNNIMKMGPLSKLAQMLPGGMGQLMGQVGEEEASKRLKRMIYIMDSMTKQELSSDGRL
                     FIDQPSRMVRVARGSGTSVTEVELVLLQQKMMARMALQSKNMMSGAGGPAGMASKMNP
                     ANMRRAMQQMQSNPGMMDNMMNMFGGAGGAGGAGMPDMQEMMKQMSSGQMKMPSQQEM
                     MSMMKQFGMG"
     gene            complement(<654308..>655675)
                     /locus_tag="PAS_chr4_0323"
                     /db_xref="GeneID:8200765"
     mRNA            complement(<654308..>655675)
                     /locus_tag="PAS_chr4_0323"
                     /product="Subunit of DNA primase, which is required for
                     DNA synthesis and double-strand break repair"
                     /transcript_id="XM_002493700.1"
                     /db_xref="GeneID:8200765"
     CDS             complement(654308..655675)
                     /locus_tag="PAS_chr4_0323"
                     /codon_start=1
                     /product="Subunit of DNA primase, which is required for
                     DNA synthesis and double-strand break repair"
                     /protein_id="XP_002493745.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0323"
                     /db_xref="EnsemblGenomes-Tr:CAY71566"
                     /db_xref="GeneID:8200765"
                     /db_xref="GOA:C4R7J1"
                     /db_xref="InterPro:IPR002755"
                     /db_xref="InterPro:IPR014052"
                     /db_xref="UniProtKB/TrEMBL:C4R7J1"
                     /translation="MPGLPEISSGAMSSPAVSSVQSSPNKNTKESSPMEANLIKAESS
                     SYTPSEYDMRNYYERLLPFKPVFEWLNHSPIPQTDFTMREFAFEFKSGAYQRYNSFVS
                     AKEFKDTVVRVTPTRFEIGAVYSINPSKRKTVSKNMMKPIEKEFVVDIDLTDYDDIRT
                     CCSKTGICHKCWKFINVAIEIVDTALRDDFGFEHMIWVFSGRRGAHCWVSDQRARSMN
                     DTLRKAVIDYLDVLNLKGGHKNRNLTFRRPLHPHIERSTGILLKSFKEVILEEQDPWR
                     DDKRAIEDLAKKISDAATRESLAKLWTEKPGRSSLEKWKDIDTQAKKGFAVRDWKTDI
                     VILSMYPRLDIEVSKLMGHLLKSPFCIHPKTGNVCVPFDPRVKEFWPDESPNLRSLQS
                     EIEEWDTDHPGKSVKHEWEKTSLNEYIKMFNNFKKKLNEEELQSRKRNRDQLVDQDDK
                     SQLEF"
     gene            <656185..>658542
                     /locus_tag="PAS_chr4_0324"
                     /db_xref="GeneID:8200766"
     mRNA            <656185..>658542
                     /locus_tag="PAS_chr4_0324"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493701.1"
                     /db_xref="GeneID:8200766"
     CDS             656185..658542
                     /locus_tag="PAS_chr4_0324"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493746.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0324"
                     /db_xref="EnsemblGenomes-Tr:CAY71567"
                     /db_xref="GeneID:8200766"
                     /db_xref="GOA:C4R7J2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R7J2"
                     /translation="MSNGGGPGAPSKLSRETVSLGNGKAYKVQKIRQRKIFSCIPCHQ
                     RKIKCSREKPICSSCMKLFSNVGDQSGDASEYCKYYINDKKTNLLKDTPEIEFLHNGI
                     VSSSYLTATQNHQSQPHLQSQPTVDFPQNTAIISKLLEGLPASKNRYFELLQIYQYCI
                     HPLCPVVNMSEFMDKAQLFWKYDLKDPKKAVQVINSSTSTDLELLAGPQLLSFVQLLY
                     AVFACSSLAESAFNIYHNLSSETKTYYKACTDVRYHLENKCKHYDLETFQSLVLILIL
                     GLRWNVVPLVEEVGKTIRAAQLYRLNRDPMLYHKLKNEDSIMLRRTLWWLIFSLDGRV
                     SHVLGLPPILRLDDFDTSMSIFPNDIYRRSICTAEFRYSCILSVISRYMNGMSESLPQ
                     NTVNFLTRKICDLSAMCVHNIEELTNELECNAQSNNMTSLLHYGITLLSIIPDRAFFH
                     LYNSANSSGTFDPSQFNMHLLKVDYHLTASDFYYLKYSYTDLSNALLPSLIHYIAGFI
                     SLYDSTWIQKPLGQNSVLREFSHLNWHLYSYVPMNELIYLMIIVINNFGQGDSQIYPE
                     IGAFNYDLNLKLYLINKAISILETYWKNHGELGKLVDILLESWSFIKLSLSIDVSKIM
                     VLERDEEIAHFIPQPFTKAYKSTSWLNPVPVGVDMLDPSNMEAQSHRPSSKYHHGGFS
                     LFEKQPQYDPLELFIKHTGESASIPQPIGGTISNLDINNSQVLKQLEVHRFQIRAKFA
                     ALGELYDRAIHSISDNPNGEIVLDVMSYSRDIEIAMLQLIKAAGV"
     gene            <658735..>662652
                     /locus_tag="PAS_chr4_0325"
                     /db_xref="GeneID:8200767"
     mRNA            <658735..>662652
                     /locus_tag="PAS_chr4_0325"
                     /product="Protein with an N-terminal kelch-like domain"
                     /transcript_id="XM_002493702.1"
                     /db_xref="GeneID:8200767"
     CDS             658735..662652
                     /locus_tag="PAS_chr4_0325"
                     /codon_start=1
                     /product="Protein with an N-terminal kelch-like domain"
                     /protein_id="XP_002493747.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0325"
                     /db_xref="EnsemblGenomes-Tr:CAY71568"
                     /db_xref="GeneID:8200767"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:C4R7J3"
                     /translation="MAPLDCLPSKCYTLTLPQSADARDRLDCRTGASSLLSKSRIVVH
                     GGLTLGLELESITIANINEALSKQLPSSLEINNSLLSNTVFELNIPERKWETVRVDED
                     VGHTSRPAPRMFHTICLHNHAIYVHGGLVLDEQKQFTPSNELWRFDLYRKTWSCLLAS
                     NDDDDSMFDQSSLPRFNHKMIRLKDLSVIGEPTHHGFLIVGGLNALDERIYSLEVYDI
                     VSGIWKMLPGLPVNDRLATISSKPISPLDSSPSSRQAHSKSYLSYTHSENAIFSSPID
                     VDNPLSVEKLAVLTRVDPGAQLNPILSYSLNDTEPRGSRLLLNREHHTDPFDPSIPKQ
                     LRYPEGESFGENLVIMGFLPGDLNISIFVYSKSSAKWSRLNVFCEHSTWSHRFSKGYL
                     WASHHKIILLGNEKTTRTSPSIQFFNLFVAISLPVTNSFSSLIDEQLSKNYLSANNFI
                     STSDDFRDSPEDPNNVFNEYSKYAAPAVNMTSIKSVFPPAAVTVGKIAFATTDELSDF
                     QLITDEGDRICIPLNVCMKRWGMFFRRAICKGYVEAIYEFAKTATEDDMLLFKKEFYT
                     QGRTERHSVNSSIFPSSDVSSQDNLRLKKDTGRPEFRLPFQKHEILSNKGTPQSSTNN
                     SRKNSVMSYDSSTSNSSGIDIKLFESSAIPIQLPPPQEPLPAPMGRRKSASFFESEKN
                     IFGPKTPTLPHSRTHSPASSPKSSPRGSLVHSNRDGLMPSVGNESLQETEEQKGHVSD
                     APPPWEHKGSSPQLDEGDDIASAPAGSPESIVQDAIKLAIDSIEVENYDFSTLQPFLF
                     TWAIPRSLYLPFPTKTVKAFSEFLYTGQVGATWELVPTALDVLLVAKFYEVPLLYDLI
                     LETLYRILSRKEVQLVKEAQKLKNEYVDVMSVNRGYIVDPPPIPSIDEFTEFLTKSDD
                     GFTDLSLLKRASKASRMMSDSRGSSRGSSRKSSLSFTQLAAFKEKRREEKDGETEEGV
                     DSEELADEEEVDDDERESVADLSEIEAKEEEGEEEREEEKEEEEEEEEEEEEEEEEEK
                     EEEDSDDSTFEDIKAYHLDDSSNEDIDDGSSPLHDVLAFAQSKKQRPESLKDSSASGL
                     SNSSDSGKESDSNDGPSSQQSPEEYLGTKDNVDKVKAGINPTPTLESTTRSADAVPVS
                     IIDYIYEAAVLGNDLRLLLRALNVRYMIKGFETEKPSIKRKIEQTRKETAARQEEQLE
                     QGTLLPHPHLRGQSSPFAHYQPSEDEEALQGNVNPHEGTERWESSLKPTFSIKSSARL
                     PLATKSNVGPRAVLRKAHSMANINPVEPPKILKRSFFKKNSNS"
     gene            <664233..>665645
                     /locus_tag="PAS_chr4_0326"
                     /db_xref="GeneID:8200768"
     mRNA            <664233..>665645
                     /locus_tag="PAS_chr4_0326"
                     /product="Transcriptional activator that enhances
                     pseudohyphal growth"
                     /transcript_id="XM_002493703.1"
                     /db_xref="GeneID:8200768"
     CDS             664233..665645
                     /locus_tag="PAS_chr4_0326"
                     /codon_start=1
                     /product="Transcriptional activator that enhances
                     pseudohyphal growth"
                     /protein_id="XP_002493748.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0326"
                     /db_xref="EnsemblGenomes-Tr:CAY71569"
                     /db_xref="GeneID:8200768"
                     /db_xref="GOA:C4R7J4"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:C4R7J4"
                     /translation="MNNKLPKSGASSTNYSSKPFNLKSILHEEDNDSNIGPSALQGKG
                     KSSQGSSLSGIDSPTSATSQSTYQAQDISQSSTSTVKQVSQFEERIQPGHAMGSHLNS
                     PPNTTAKETSDQNTNLPSGESSPSSTAGADIDDIIKSNNLITSVQWDEENTVVYQYVV
                     QKIPLSRRADNDYVNATKLLNLTGMRRGRRDGILKLEKQRQVVKTGTIDLKGVWVPLK
                     RAIKLAKAEQVFQKARLIFVTNIADYYHTQIDSLGLNEEQKRLVLARLRRKTKTKESS
                     TKTLQTYQLPWFSPAQPTFVTSHQTPVVHLTGSTIPSHGQRQDFYQYGQYSSPYGLGV
                     RADNVGAGIAPSYTSHVSNPPLSGLPQHSLVPLPLPKHSLGSPSMVPPITPQSAATNS
                     APQQPFQVNPFVAHHGRPPFSTTNSPSQLPTILTPRMESSSMSSASSNEIPSPYHSYS
                     HGQQPQDKNKNYDQHHSSYP"
     gene            complement(<665671..>673911)
                     /locus_tag="PAS_chr4_0327"
                     /db_xref="GeneID:8200769"
     mRNA            complement(<665671..>673911)
                     /locus_tag="PAS_chr4_0327"
                     /product="Positive regulator of the Gcn2p kinase activity,
                     forms a complex with Gcn20p"
                     /transcript_id="XM_002493704.1"
                     /db_xref="GeneID:8200769"
     CDS             complement(665671..673911)
                     /locus_tag="PAS_chr4_0327"
                     /codon_start=1
                     /product="Positive regulator of the Gcn2p kinase activity,
                     forms a complex with Gcn20p"
                     /protein_id="XP_002493749.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0327"
                     /db_xref="EnsemblGenomes-Tr:CAY71570"
                     /db_xref="GeneID:8200769"
                     /db_xref="GOA:C4R7J5"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR022716"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:C4R7J5"
                     /translation="MTELVSSLSWDQLSGSLDENLSASSTRVRISTLKRLTQLLPSDI
                     PQEDIAIIFSKLLNSYYYYQDSKSRNAVVDSLRTILSTNPDYYLPIFTQFVFNIVRNE
                     KISIALTDLLTLLDWSNTLLVFISQFPDVFAQYHVVILRCIANTFEMISRDTEESSIL
                     PLNKSSRHKRRILDSSVTQLKTSFAQSFSASPVDSYRYLDSLISVLISDKTFSPTSVL
                     LCIGLITESATQLLPTHPAVYENLKNNKPEIITYLTSQVFASKTPISPSTLLFFKSFF
                     HEFVGVEDLTNDILPSFEKAILKSSENTLGHIAPLLFSNVQDSVNLIAYLSKNKLLSQ
                     LITNLKSSKEIVRTGSLSTFKVVLSKHSGSAESSPDLLVVVNELFKGLKSVSSADLKE
                     TFASLIYSVPDDSEVVTTAILENLSTVIFKDQNEVSLTALLLAFFKHLFAALNRGLNV
                     KKYADVEKGFSEKKLNLRRCWFTALGWTMININKNTVSSQLVAFIEENLPLLVNTTKE
                     TIDTALASIAAKAIESAYVVIALPSIVKDWKNSESLIKSLENFGLAKLALTEASEKKP
                     SVLLSSRIYSKFTTTSENYWFLKALVSVLSFIDEETSRPYGHAWLYLTCSALVPNEIH
                     IQAVEIINTIYKSSPKLFAKVVIQAIDDVLESDLKDDDPLKLNISKASALVNSIILPV
                     DTLSHEDLQINCYNTLILSYHERIKIKNGWVGLTQRASLDPGLIVDKHAEIIVERLLN
                     SLLSNINRGDNASAKMMVVAISRSISTISFISPSKATPLLVQFIQESVNPLLLENLDS
                     QRLEIWNSPEGELVVDVLSQSKSKIEDRNTKDYETRKWEESVKAELAKKKTASKKLSK
                     EEQAIVSEQLRVESQIRKEVQALYTKISSGLTVISNLSAIATTVDNGKDLWLPVAVQS
                     ILSILKTEEVYILLGSQPVDTFLELSSVVSDRLGATKTAAALALLRSYKIKLEDDYLK
                     EDLAQLVSRVLFKIKFVSIQSPLDISSLMFIIPLLAKVLENGSTVAIKNSQKVISQAN
                     FEFVEEDTEEEQLLLAIELISIHSELFEDELIPRSSILEVLLSLLSVPSKRKTARSCL
                     LSLVQHIALNISDSDLKILLKGCLSPLSFVRGTILECFDSEFDLSPQKYLPEIWICTF
                     DNDPNNVELASTIWDENDFELTEDSPLSLLPYLGNEDAGIRLSVAKSIAAATSNFCDS
                     NPHVVNTVVEKLIELYEIKLQPPAPKLDEYGLPIRTSKVQKDTWEERSGVALSLTQLT
                     PVITDSKLISHLFEFLTKGGALADKEPVVGEELLDAGVQIIQMHGFENIETLAPIFEE
                     VLAEKVDKTSKAQGKTKESTTILYGALARHLTAADPRLDQIVQRLLDTLDTPVQQVQR
                     AVSQCLAPLVPLFDTKLSGYIDALLTKLFDAPNLAERKGAAYGIAGLVKGKGVCALAD
                     YDILRTLVDAAEDKKDWKRRQGVSLAFECLSQALGKFFEPYVIEVLPIILKNLGDSQT
                     EVREATDAATKVIMKNTTSFGVKKLIPLAIENLDEIAWRSKKGSVELLGAMAYLDPAQ
                     LSASLSIIVPEIVGVLNDSHKEVRKAADQALRRFGEVIRNPEIQKLVPTLLKAIGDPT
                     KYTEEALDSLIKTQFVHYIDGPSLALIIHIISRGMKGRSGATKRKACQIVGNMSILVD
                     SSDLLPYLQTLISELESAMVDPVPTTRATAARALGSLVEKLGEECFPDLIPRLMNTLQ
                     DPTKAGDRLGSAQALAEVINGLGIGKLDEILPEILQKSMDSREHIRAGFIPLLLFLPV
                     CFGNQFAPYLGSVIPAILNGLADDNEEIQETSLRAGRLIIKNYSNKAVDLLLPELERG
                     MSDISYRIRLSSVQLTGDLLFQVTGISGKTEINDDQVELTKQVNRNLVANLGQERRDR
                     VLAALFICRSDTSAAVRNASVDIWKSLVSHTPRTIKEILPVLTGIIVKHIASSEEVQR
                     KIAAQTLGETVKRVGGNALAQLLPTLEDSLVSGDTGMKQGICIALYELIESSSKDTIE
                     EFKDVFVRIIRSALMDANPLVRQAAAQAFDVLQESIGKRAVDEVVPHLLRMLESDDDS
                     EDALVALKEIMSTKSEVVFPILLPTLLSEPMDTFKANALGSLAEVAGATLYNRLSVIL
                     NALINGLMDDSIDPETKKSIETAFDRVLASVNSESGLHPLMQHLLSLVKNGDKLKRVL
                     VFGRLPAFFKSTTLDYSVYTEDIVVYGIHMLDNEDDELVKDAWTTLHEIVKHQSKESL
                     QNLVKPAQRALSTTGVKGQLLKAFALPKGPSCILPIFSQGLMYGSPEQRELSALAIGD
                     ISEKTPAKELKSFVTVMVGPLIRVVGERFSSDVKAAILYALNVLLAKIPQFLKPFIPQ
                     LQRTFVKSLSDVSNETLRTRAALALGTLIEFQPRIDPLVSELVTNAKSAKDDGVVTAM
                     LKALLEVVSKAGNKISTASKDLVMKLVEEELSAANNKLAVTYACLVGSLSKILSNEEA
                     SSIIQSKILSNVQAWNSGNVEITHDEESLKFAVLTLNAFLKDSPWTIFETGYIQKVVP
                     VAILLSNHPSPYISDNGTMALGKLLLLLDETREGYSTFEIPPAELREIVAQLCTLSTN
                     PPSHSPDTRRLALVVIRTASRHKHEQVIVPNLDLLIPSIFKCVRDPIIPIKLAAEKAF
                     LEVLRLVQDPEMTLMHSWAEKAKEESDVSAVSPQQIRSVTEYTRRVGSRLASVERDRL
                     EAGGDAETMFSDRFEDESEIWAVGGVSLQNDSVL"
     gene            <675506..>676240
                     /locus_tag="PAS_chr4_0329"
                     /db_xref="GeneID:8200770"
     mRNA            <675506..>676240
                     /locus_tag="PAS_chr4_0329"
                     /product="Member of the CCCH zinc finger family"
                     /transcript_id="XM_002493705.1"
                     /db_xref="GeneID:8200770"
     CDS             675506..676240
                     /locus_tag="PAS_chr4_0329"
                     /codon_start=1
                     /product="Member of the CCCH zinc finger family"
                     /protein_id="XP_002493750.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0329"
                     /db_xref="EnsemblGenomes-Tr:CAY71571"
                     /db_xref="GeneID:8200770"
                     /db_xref="GOA:C4R7J6"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C4R7J6"
                     /translation="MTWGQTLSVQEPLFAPTPLHFKKSRQDSLNSDFSYPVSLSPSSS
                     TSSISEDFLPIDKDMLNLIPDLWSGETDDPLVSTQKTQNPPQLCTATSTWQQRPSSWY
                     SHTPSQTQLASFNTTPLTEENLFLLSDSTIRQPQVVHVEQKELERGPQQPLSNTQSHS
                     HTSQTKSVDSNPTLNTGLYKTELCDQFNQKGHCPYGTKCQFAHGTHELKSVKRPSNWK
                     TKPCANWTKFGKCRYGKRCCFKHGDD"
     gene            complement(<676443..>677771)
                     /locus_tag="PAS_chr4_0330"
                     /db_xref="GeneID:8200771"
     mRNA            complement(<676443..>677771)
                     /locus_tag="PAS_chr4_0330"
                     /product="Methionine and cysteine synthase (O-acetyl
                     homoserine-O-acetyl serine sulfhydrylase)"
                     /transcript_id="XM_002493706.1"
                     /db_xref="GeneID:8200771"
     CDS             complement(676443..677771)
                     /locus_tag="PAS_chr4_0330"
                     /codon_start=1
                     /product="Methionine and cysteine synthase (O-acetyl
                     homoserine-O-acetyl serine sulfhydrylase)"
                     /protein_id="XP_002493751.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0330"
                     /db_xref="EnsemblGenomes-Tr:CAY71572"
                     /db_xref="GeneID:8200771"
                     /db_xref="GOA:C4R7J7"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR006235"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R7J7"
                     /translation="MPSHFDTLQLHAGQTAEAPHNARAVPIYATSSYVFRDSEHGAKL
                     FGLEEPGYIYSRLMNPTQNVFEERIAALEGGAAALAVGSGQAAQFLAIAGLAHTGDNV
                     ISTSFLYGGTYNQFKVAFKRLGIESRFVHGDDPAEFERLIDDKTKAIYVESIGNPKYN
                     IPDFEALAELAHKHGIPLVVDNTFGAGGYYVRPIELGADIVTHSTTKWINGHGNTIGG
                     VVVDSGKFPWKDYPEKYPQFSKPSEGYHGLILNDAFGPAAFIGHLRTELLRDLGPASS
                     PFGNFLNIIGLETLSLRAERHAENALKLAKYLETSPYVSWVSYPGLESHDYHEAAKKY
                     LKNGFGAVLSFGVKDHGKPALTPFEEAGPKVVDSLKVFSNLANVGDSKSLIIAPYYTT
                     HQQLSHEEKLASGVTKDSIRVSVGTEFIDDLIADLEQAFALVYEEANTKL"
     gene            <678385..>679539
                     /locus_tag="PAS_chr4_0331"
                     /db_xref="GeneID:8200772"
     mRNA            <678385..>679539
                     /locus_tag="PAS_chr4_0331"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493707.1"
                     /db_xref="GeneID:8200772"
     CDS             678385..679539
                     /locus_tag="PAS_chr4_0331"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493752.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0331"
                     /db_xref="EnsemblGenomes-Tr:CAY71573"
                     /db_xref="GeneID:8200772"
                     /db_xref="UniProtKB/TrEMBL:C4R7J8"
                     /translation="MKTVMNISTASKISRLLQLVIALISLVLTAQLAKDGSSLSSQVD
                     SINQLITDDVIRATEESVEIGTPSSSSSFHATSQNPTDQISHSVSSTLGLNVSTSWQS
                     SILSFVSTGITLVNNPLLSVFKRLVSRKLQSFYDGSVLRVGEIPYSSLHLPNHGVARA
                     QFFYLSYSASSEFVLNLVHFSNAVYQTAKYGSWSCNEVSGLLHQYQLDRNYSSAAVAD
                     FFKRLSDNDTASPFDQLEDAMQVYLPSNFSELLQTDNVDITIEKSQLFLDLSSDCTKK
                     KANMAISYVLWGVYMVSTGLISYTGVVFNQILNKKYRSIIETGTKQMIESSHLDYDEL
                     SLEEALLLRDQIFSADTSLSGSIYLVYTAAGLFPQVKDDNELKHTLDGHK"
     gene            complement(<679567..>681078)
                     /locus_tag="PAS_chr4_0332"
                     /db_xref="GeneID:8200773"
     mRNA            complement(join(<679567..680940,680992..>681078))
                     /locus_tag="PAS_chr4_0332"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493708.1"
                     /db_xref="GeneID:8200773"
     CDS             complement(join(679567..680940,680992..681078))
                     /locus_tag="PAS_chr4_0332"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493753.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0332"
                     /db_xref="EnsemblGenomes-Tr:CAY71574"
                     /db_xref="GeneID:8200773"
                     /db_xref="UniProtKB/TrEMBL:C4R7J9"
                     /translation="MSQLIQLVFAILWFQRIVYGIDIPEYSYYTNPDFDCPECVLITT
                     ASSLQGTINTSTDIPTVDDTTTTTEVPTTDETTTTTVEPPTDETTTTTVVPPTPDPTT
                     PTSVIPTPDPTTPDPEPTDHEEPQVPTTEDTPPIPPIPPIPPITTTTELVIPSEPSSE
                     ETFVETTIGPPDVTTIETPVTTSTPSVEESVVTLTSELVTTLPSLTTTIYSPVISTIL
                     TTFQPEPIVSSRVYEDRFTQTIVTFVSSAALVIRGTVTEAWSLSCTQTPVPHEITTWK
                     TVSEPINTVQYTVVLSSSPVSHLNYTTWTTFYKVKTRTNYAIYGENQVETLTEYQDRC
                     LTQYDYYTEVNTYLLWASSTTRTGYSTIVDRNTVLTTLYPEVVTNTLLVTDYVPVAVP
                     IPNVSTIAAEAPSTIYNTVYVTEFQTFTVTVTSPTVFRTSTITETLEAQVAIFTQSEP
                     EVQVFTQGEPEVQEKNIAPKISRPSYIIPLLLLLLV"
     gene            <681408..>682313
                     /locus_tag="PAS_chr4_0333"
                     /db_xref="GeneID:8200774"
     mRNA            <681408..>682313
                     /locus_tag="PAS_chr4_0333"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493709.1"
                     /db_xref="GeneID:8200774"
     CDS             681408..682313
                     /locus_tag="PAS_chr4_0333"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493754.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0333"
                     /db_xref="EnsemblGenomes-Tr:CAY71575"
                     /db_xref="GeneID:8200774"
                     /db_xref="UniProtKB/TrEMBL:C4R7K0"
                     /translation="MVSAELPNDDGGDVPSQILESDSLDVAVQKLRQIYWQQVGNNNA
                     SLINVFSTIDTEQLEVLEPGNELYGQLNEKFHLDEYFEKHNDPVPVWKEGLPDLGDWE
                     SENENDGREDDEVSASGLELPTSETLDFVFRNVMKYGSMVLMPNGEVEILDPEQLSPE
                     SYAGDIIRRDKDQFAKICRYKRVSDFDLKSVQEILQVYPFFCETHFRSLMGWGYTTAT
                     YKYRMYDRAGRQSNADLKQLEKKNNPRLSGCYLPSLPQSQQKTPQLLFVQQFLALHNS
                     AVRTKPCSCKVKGKILLLQHLSGVA"
     gene            complement(<682626..>683960)
                     /locus_tag="PAS_chr4_0334"
                     /db_xref="GeneID:8200775"
     mRNA            complement(<682626..>683960)
                     /locus_tag="PAS_chr4_0334"
                     /product="Transcription factor involved in glucose
                     repression"
                     /transcript_id="XM_002493710.1"
                     /db_xref="GeneID:8200775"
     CDS             complement(682626..683960)
                     /locus_tag="PAS_chr4_0334"
                     /codon_start=1
                     /product="Transcription factor involved in glucose
                     repression"
                     /protein_id="XP_002493755.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0334"
                     /db_xref="EnsemblGenomes-Tr:CAY71576"
                     /db_xref="GeneID:8200775"
                     /db_xref="GOA:C4R7K1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R7K1"
                     /translation="MTTAYPNARVASVRSSGDSVGDIKVGSRKSAESSNANSSSSSKK
                     SELSRPYQCPMCEKAFHRLEHQTRHIRTHTGEKPHHCNYPGCFKKFSRSDELTRHSRI
                     HNNPNPRKRGPGVVPKKTPRPKMAGKSASYSDEGNYSLGEGHQQFYGSDDASSFPLVS
                     IPTAAATTTVGKPTTPTPSSKSSQSQTAEAKFNPLRSASTLSINLLATAASQELQELR
                     AAEENSSRLQQVKSLPSLTQYFIASEDSSHGGNPPLSHPKPFSSLSGLKRMTPINPSS
                     SSSSSGGVSINKSISVTSLTRTFSNTEIADEFTTPPTMLKKSRPNSPVLTGRSPTTFQ
                     QYQQSQHTSNLAQQQSKGNFPPSHIDSKVSSAALHLLGLGLNHATPEVTPLQTPAVSP
                     KLFPKSVSNNSLETLHKALDETTEAENLQSTALPSLSSLNLPSTSLENQEKK"
     gene            complement(<684568..>685875)
                     /locus_tag="PAS_chr4_0335"
                     /db_xref="GeneID:8200776"
     mRNA            complement(<684568..>685875)
                     /locus_tag="PAS_chr4_0335"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493711.1"
                     /db_xref="GeneID:8200776"
     CDS             complement(684568..685875)
                     /locus_tag="PAS_chr4_0335"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493756.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0335"
                     /db_xref="EnsemblGenomes-Tr:CAY71577"
                     /db_xref="GeneID:8200776"
                     /db_xref="GOA:C4R7K2"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR005956"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:C4R7K2"
                     /translation="MVEPVNPLSEHVLVKDSLDLSSSLAKTNQLEGLSIDSSLMPKLA
                     NDGFVAYDHVTFYVSNAKLSSRFFINSLGFYPIAYKGLETGSKNICHHVVSNGSVTFQ
                     FVSTLRSFSDNKNEDLMIKEIQNHVAKHGDGVKDVAFQVENVSHVFELAVANGARPIL
                     KPTALEEEGSTLVIAKVGALGDVVHTLINRSQYKGVFMPGYISYEDAFGHDYMQTVTE
                     LNEKVLPKVSFACIDHCVQNQDWNEMFQSCEFYAKAFGFHQFWSVDENVICTQYSALR
                     STVMASSNELVKMPINEPAKGLKKSQIEEFLDFYEGPGVQHIALLTPNIVSTVKNMKF
                     RGVEFINVPPKYYSRLRQRLLETKRNYEIKESLDELEKAGILVDFDENGYLLQLFSKP
                     MQDRPTLFLEVIQRENHNGFGAGNFKALFETLELEQQRRGNLV"
     gene            <686332..>687399
                     /locus_tag="PAS_chr4_0336"
                     /db_xref="GeneID:8200777"
     mRNA            <686332..>687399
                     /locus_tag="PAS_chr4_0336"
                     /product="Putative dihydrokaempferol 4-reductase"
                     /transcript_id="XM_002493712.1"
                     /db_xref="GeneID:8200777"
     CDS             686332..687399
                     /locus_tag="PAS_chr4_0336"
                     /codon_start=1
                     /product="Putative dihydrokaempferol 4-reductase"
                     /protein_id="XP_002493757.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0336"
                     /db_xref="EnsemblGenomes-Tr:CAY71578"
                     /db_xref="GeneID:8200777"
                     /db_xref="GOA:C4R7K3"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R7K3"
                     /translation="MPGERVLLTGASGFIAQHITDVLLSKGYRVLGTTRRQEQADQLT
                     QQFTAEYPKIAEDKSLLQFHLVPDIGTDNAFDEVLKQNPDIDFVLHTASPFYFGDDRP
                     LKEVYLHPAVGGTENILNAIQKYASDNIKKVVVTSSFASVVNMDKFKDKRFIHNEDTW
                     NPLTWEQAEVEGETSAYRASKKYAELAAWDFVKKESPKFSLTTILPPFVFGPQKFSSS
                     AAKGTLNTSAEIVNKFLSTEYPSDDKFFDAPTHLSVDVRDVALYHVLPLEINALANKR
                     LFTVQSKFSGQRILNILNENFPELKGKIAVGQPEKTAQNEAANGPEYNNSLTVALGGV
                     EFRSLETTIIDSVKQILESAK"
     gene            complement(<687476..>688822)
                     /locus_tag="PAS_chr4_0947"
                     /db_xref="GeneID:8200778"
     mRNA            complement(<687476..>688822)
                     /locus_tag="PAS_chr4_0947"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493713.1"
                     /db_xref="GeneID:8200778"
     CDS             complement(687476..688822)
                     /locus_tag="PAS_chr4_0947"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493758.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0947"
                     /db_xref="EnsemblGenomes-Tr:CAY71579"
                     /db_xref="GeneID:8200778"
                     /db_xref="InterPro:IPR021460"
                     /db_xref="UniProtKB/TrEMBL:C4R7K4"
                     /translation="MSAPLSPLIQQMVSLMEARTNGADPGTGILPRLNSAADMLGGVD
                     RIPRELINYVQGKQLALFGDYPSGKDTAPSAIFMVVFFFIFLAHLTLFGINWSRGHKF
                     LLSFGFAFYALLRVVGFALRVAWSREITRVQVGIASEVFLIIPTILLASFNLILAQRL
                     FTWRHPYVGSSKLFWGALLTVYSVVISVVVMTIVAAVVPYVYLLSHRNYEMSKNVVKV
                     SSILVILYSLLATGLILVSYLFKPTKRDKGCLIYQPTWLESFSPTYFPLKDSAKQHEQ
                     IFIGRNGAAAFASTRIIASSYHYNAQSDVLPEPTAENLKLEPGNEDNLVRYSSSTGQL
                     KHNYSIIIVTLTTTFILIGAVFRAITCFLDRTVETQSWIFKPVVMYMLWGFLETVINV
                     IYLLGRIDLRFYRPDRFPKDMLVGNEAVEPSPVISNKERTSSISERTSNPEIVRTV"
     gene            complement(<689274..>691001)
                     /locus_tag="PAS_chr4_0337"
                     /db_xref="GeneID:8200980"
     mRNA            complement(<689274..>691001)
                     /locus_tag="PAS_chr4_0337"
                     /product="High-affinity inorganic phosphate (Pi)
                     transporter and low-affinity manganese transporter"
                     /transcript_id="XM_002493714.1"
                     /db_xref="GeneID:8200980"
     CDS             complement(689274..691001)
                     /locus_tag="PAS_chr4_0337"
                     /codon_start=1
                     /product="High-affinity inorganic phosphate (Pi)
                     transporter and low-affinity manganese transporter"
                     /protein_id="XP_002493759.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0337"
                     /db_xref="EnsemblGenomes-Tr:CAY71580"
                     /db_xref="GeneID:8200980"
                     /db_xref="GOA:C4R7K5"
                     /db_xref="InterPro:IPR004738"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C4R7K5"
                     /translation="MSSGYKTKGGNSAFHNHINDFAHIEDPKERRRLALQSIDNAKFS
                     WYHVRAIAVAGVGFMTDAYDIFAINLGLAMLVFVYWGGSIPDSTQTLLKVSTSVGTVI
                     GQLGFGWAADFFGRKKIYGLELVIMIFATVLQCTVGESKAISFPAILTFYRIIMGIGI
                     GGDYPMSSIISSEFSSVRWRGLTMGAVFANQGWGQLLAGLVALICIAGYKDDLITAKN
                     GAECGYACQKACDQMWRILIGFGCVPGVVALYFRLTIPESPRYTFDVTHEIEKAACDT
                     MKFTSGLHGAATEDDIVILRNAKQLALEVEQEELKKTAEEIKSRKVNWHDFYHHYKHW
                     KHGKILIGTAGSWFMLDIAYYGLGLNTAVILQTIGYAKNDNVYNKLFNSAAGNLILIC
                     AGSIPGYWFTAFTCDTLGRKPLQIVGFILLTMIFCIIGFGYHKIGEHGLLGCYIVAQF
                     LQNLPNTTTFIVPGECFPTKFRSTSHGISAASGKVGAIIAQTVIGTLTNHGCSKEEPN
                     CFLPHVMEIFALFMLLGTFTSLLIPETKRKSLEQLSYELHGDGDDPESSNSNTDIDSE
                     TNIIGNDKV"
     gene            complement(<691450..>692223)
                     /locus_tag="PAS_chr4_0338"
                     /db_xref="GeneID:8200779"
     mRNA            complement(<691450..>692223)
                     /locus_tag="PAS_chr4_0338"
                     /product="Peroxisomal 2,4-dienoyl-CoA reductase, auxiliary
                     enzyme of fatty acid beta-oxidation"
                     /transcript_id="XM_002493715.1"
                     /db_xref="GeneID:8200779"
     CDS             complement(691450..692223)
                     /locus_tag="PAS_chr4_0338"
                     /codon_start=1
                     /product="Peroxisomal 2,4-dienoyl-CoA reductase, auxiliary
                     enzyme of fatty acid beta-oxidation"
                     /protein_id="XP_002493760.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0338"
                     /db_xref="EnsemblGenomes-Tr:CAY71581"
                     /db_xref="GeneID:8200779"
                     /db_xref="GOA:C4R7K6"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R7K6"
                     /translation="MGYNLLQGKTVAITGAATGIGRSIAVKMADEGANVVINHFPSEE
                     QAQLAKELGKEIGEDKFLAVPGDISKPETGKDLVAKTVEKFGELNVFVSNAGICPFAE
                     FTEMPAETYLKTVEINLNGAFFSTQAAAKQMKLQGKGGSIIGVSSISALVGGGFQTHY
                     TPTKAGILSLMQSEAVALGEYGIRCNALLPGTIRTGLNEEDLANDEKRVAMEKRVPLQ
                     RLGVPDDLAGPAVFLASDMSQYVTGAQVLVDGGLFVNLQ"
     gene            complement(<692426..>693394)
                     /locus_tag="PAS_chr4_0339"
                     /db_xref="GeneID:8200780"
     mRNA            complement(<692426..>693394)
                     /locus_tag="PAS_chr4_0339"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493716.1"
                     /db_xref="GeneID:8200780"
     CDS             complement(692426..693394)
                     /locus_tag="PAS_chr4_0339"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493761.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0339"
                     /db_xref="EnsemblGenomes-Tr:CAY71582"
                     /db_xref="GeneID:8200780"
                     /db_xref="GOA:C4R7K7"
                     /db_xref="InterPro:IPR006992"
                     /db_xref="UniProtKB/TrEMBL:C4R7K7"
                     /translation="MKVIDSHVHLYSKENALDLSWMTPESPLCGDHQVVQYAESVKNS
                     AYKVEGLVFIEVDVKYSADWRYAVKEYGYVVDQFQSAKEFKVFGLIPWAPLNEGVRSL
                     TQFVEKLKVSKGEFAFQKYCKGFRYLVQDKPSGTMIKRPFIESLNWLSDNGFVFDLGI
                     DLRCGGLWQFEEAIEMCKQTRCRLIVNHLTKPDYYNMDIDQDRFDKWKHFMSEIKQHS
                     DSYMKVSGGFSELSPALSARIKAGKFEVDEVVDLINPWFETCLNLWGPERMIWGSDYP
                     VCTINGGEVAVARWIEITEKLFDRHGLTPEQKQAIYYDNVLKAYNL"
     gene            <693620..>696433
                     /locus_tag="PAS_chr4_0340"
                     /db_xref="GeneID:8200781"
     mRNA            <693620..>696433
                     /locus_tag="PAS_chr4_0340"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493717.1"
                     /db_xref="GeneID:8200781"
     CDS             693620..696433
                     /locus_tag="PAS_chr4_0340"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493762.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0340"
                     /db_xref="EnsemblGenomes-Tr:CAY71583"
                     /db_xref="GeneID:8200781"
                     /db_xref="GOA:C4R7K8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C4R7K8"
                     /translation="MDSSSNVVKRRRSSTDEEGKMVESGDPNESSNHSRLSKSCNGCR
                     ARKVRCNGEKPSCSYCLKTGITCVFSPLRKPGLKRGYGKQFDQRLDSVEEQLKTFGDE
                     IKMMKFHLGEAHSSNGELLLIKDKVSILESMTNSLNQQMNTHLNQQQLRSTPEQPNEY
                     YPLRQQLQVSQKNKPPKSLGPDCYMPLKVADQNYNSTPHSRVSDSRNVILNSYDPLMP
                     NVPPVKIVLDLYFKKIHPSFPVLHEESITATVLNKSKTVPPIYYAIVLLCLRFMNVTK
                     KEEASYNTYCKEKVIMSSLSVSTIPQLQAMLLLAYSSFGTLNNPETWSYISVISAGAV
                     HLNLLKEIPNSQQLQFFESKVRRRSTTSSDLRDEGARSVGSNSNYGQPTPSDHGGVRK
                     PLKPKSISTKSAKLLRRPDNWLEEESRRRLFWGIYMLDIFSAVSNSFPLKVPSNEITV
                     MLPVKAELWNWNPVSSQHSSPSGIYLDKRSPQSAEPVHDLLNDELYDSFGYYIELLHL
                     LGEIHTFLRIPVDIYVASEVLKFQNKFLLLYNKLMKWKSSIPERIQNLLNNSTPWNDM
                     TPMDFNLAALYITTSVRLNSAVGYPHAESDFLSSSKIAKERCINHVNEFLSLTALVEG
                     SPLFQDKSTGSCEDAYRVLGPCYTFTCWVCSRVLMVNCIYNQTPFPKELDLLVEKLLR
                     FGKYWHYATKYGIIIKFLMGDQVNLQKDRMENASVLKTEGNDDSDSEDLSNNYKIFSD
                     MRYNAYILDSIFSKKIDSLRNSTGMGETTASAEETGGNTDNQQQQPSLFGNTSNNNIN
                     NNDNNEEATEFNNFSGTGKLGVNDKVESLDNIFQWFKFPVGVSEATSNVTRPQYSVMP
                     QQVNPQHELLHGEHKSVANTPKDRSNRASPAFITSNGDTLLFRNLNMLDQVPETEFNS
                     VLESNDPSQDWLHNALNFSYRNN"
     gene            complement(<696481..>697407)
                     /locus_tag="PAS_chr4_0341"
                     /db_xref="GeneID:8200782"
     mRNA            complement(<696481..>697407)
                     /locus_tag="PAS_chr4_0341"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493718.1"
                     /db_xref="GeneID:8200782"
     CDS             complement(696481..697407)
                     /locus_tag="PAS_chr4_0341"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493763.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0341"
                     /db_xref="EnsemblGenomes-Tr:CAY71584"
                     /db_xref="GeneID:8200782"
                     /db_xref="GOA:C4R7K9"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR020624"
                     /db_xref="UniProtKB/TrEMBL:C4R7K9"
                     /translation="MSPVPPAPGIYTPVPTFFKNDGYTIDFDANVKHAKFLKDNGIAG
                     LVIMGSTGEGVHLTKEERAATIKAVHDALPDFPIIGGVVQNSVQDALDEIDSIKAAGA
                     THAVVLSSNYYGAGIKQQGIIDWFTAVADKASLPILVYVYPGVSNNLFTDPATVIKLS
                     GHPNIVGTKISHGDVSHHTIIATDKNVQQNNFNTFTGLGQLLVPTLTIGCKGTIDALS
                     GAFPKIYVKIFQLVQDGKIEEAVKLQNTVSRGEEIVVNFGVIGIKKAIHLGAGIGENY
                     LGRAPLNQDLPAGAWENLEHYFKEIQAVERTL"
     gene            complement(<697593..>700643)
                     /locus_tag="PAS_chr4_0342"
                     /db_xref="GeneID:8200783"
     mRNA            complement(<697593..>700643)
                     /locus_tag="PAS_chr4_0342"
                     /product="Acid trehalase required for utilization of
                     extracellular trehalose"
                     /transcript_id="XM_002493719.1"
                     /db_xref="GeneID:8200783"
     CDS             complement(697593..700643)
                     /locus_tag="PAS_chr4_0342"
                     /codon_start=1
                     /product="Acid trehalase required for utilization of
                     extracellular trehalose"
                     /protein_id="XP_002493764.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0342"
                     /db_xref="EnsemblGenomes-Tr:CAY71585"
                     /db_xref="GeneID:8200783"
                     /db_xref="GOA:C4R7L0"
                     /db_xref="InterPro:IPR005195"
                     /db_xref="InterPro:IPR005196"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:C4R7L0"
                     /translation="MLNRVLLVALSCVVFFHLVTTFPVGTSSDSLQIRNLLSHNFTRA
                     NISEGLSSGATYFVDEDTETYYDKELKVLRTTRFPRYNNYQLQPYVANGYIGSRIPRV
                     GSGFTYDTSDNKTSENLKNGWPLFNKRYSGAFIAGFFNSQPTVPETNFEELEKDGYES
                     IIASIPQWTSLELTVNVNGTNQTLKADDVDITHISDYSQQLSLLDGIVTTNYTWLGLV
                     NVSISVLAHRDIVSLGFVSLELSSQKNITVSVTDILDFATSTRCSYLDSGVNEQSIFM
                     KVQPSNVPTNATIYSSLMSSNSTSSLLKQNQTVSQTLRVNLSKNQAASFQKYVGVVSD
                     DYLDSIETNLTSYQFARETAKFAEIKGRSWILKSHKEAWNELLNGKSIVFHDNDFLTL
                     ASDSSIYHLMANTRSEANGGTSALGVSGLSSDSYGGMVFWDTDFWMLPSVQAFSPRHA
                     VSLSKFRDHTHDQAKKNAQTRDMNGAVYPWTSGRFGNCTSTGPCYDYEYHINIDIAFM
                     FWKLYLGGAIDDDYMKEFGYPIIEDVASFFVDYVDYNSTLDKYTTRNLTDPDEYAEFK
                     NNAAFTNVGISQLMKWALILGKHLKVGNERSYDKWEDIMTKMYLPVNHAGDVTLEYTG
                     MNNSIEVKQADVVLISYPLDDEDGALQEYFDYDEDRAISDVRYYSDKQTDEGPAMTFS
                     VYSAVNAKFNKEGCSSQTYLLKSVEPYFRFPFGQMSEQSTDQYDTNGGTHPAFPFLTG
                     HGAFLQSSIYGLTGLRFSYIYNDTDKSIKRRLAFDPLQLPCLPGGFSINGFVYMNQTL
                     DITVNDTYATIAHRGNATTINVYVDSRNEMGGKEHKIQPGKSLSIPLYQTEQNIPGSF
                     IECTVKNVTALQPGVVGDPIQAVADGDNSTIWKIESREEPTHLIFDLGDELDIEGGLV
                     VWGTYPAESFSVSVLRDFNSTNYRVINNVENYDLIYESGNVTASSPFDESHIKKVQIL
                     PHNCTNFTFSELTASRYVLFEFTDVLGYPQDYSYGAQVAEVVLY"
     gene            <700931..>701722
                     /locus_tag="PAS_chr4_0343"
                     /db_xref="GeneID:8200784"
     mRNA            <700931..>701722
                     /locus_tag="PAS_chr4_0343"
                     /product="Phosphoribosyl-5-amino-1-phosphoribosyl-4-
                     imidazolecarboxiamide isomerase"
                     /transcript_id="XM_002493720.1"
                     /db_xref="GeneID:8200784"
     CDS             700931..701722
                     /locus_tag="PAS_chr4_0343"
                     /codon_start=1
                     /product="Phosphoribosyl-5-amino-1-phosphoribosyl-4-
                     imidazolecarboxiamide isomerase"
                     /protein_id="XP_002493765.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0343"
                     /db_xref="EnsemblGenomes-Tr:CAY71586"
                     /db_xref="GeneID:8200784"
                     /db_xref="GOA:C4R7L1"
                     /db_xref="InterPro:IPR006062"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR011858"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R7L1"
                     /translation="MTVFRGCIDIHSGKVKQIVGGKLVKDDTESDEVETNFVSEQPSS
                     YYAQLYKQNQVHGTHVIKLGSLKANDDAAREALGAWRGGLQIGGGITDSNAQEWIDQG
                     ASHVIVTSWLFPEGQFSIERLQHLSSLIGKEKLVVDLSCRRQEIDGSPQWVVAMNKWQ
                     TLTSSVLDREFFQLLSQYCDEFLVHAADVEGLCQGIDQELVRKLSEWSDLPVTYAGGA
                     RSIQDLETVKHLSNGKVDLTFGSALNIFGGNLVKFEDCVKWNKTQ"
     gene            <702204..>703118
                     /locus_tag="PAS_chr4_0344"
                     /db_xref="GeneID:8200785"
     mRNA            <702204..>703118
                     /locus_tag="PAS_chr4_0344"
                     /product="RNA polymerase II third largest subunit B44,
                     part of central core"
                     /transcript_id="XM_002493721.1"
                     /db_xref="GeneID:8200785"
     CDS             702204..703118
                     /locus_tag="PAS_chr4_0344"
                     /codon_start=1
                     /product="RNA polymerase II third largest subunit B44,
                     part of central core"
                     /protein_id="XP_002493766.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0344"
                     /db_xref="EnsemblGenomes-Tr:CAY71587"
                     /db_xref="GeneID:8200785"
                     /db_xref="GOA:C4R7L2"
                     /db_xref="InterPro:IPR001514"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="InterPro:IPR011262"
                     /db_xref="InterPro:IPR011263"
                     /db_xref="UniProtKB/TrEMBL:C4R7L2"
                     /translation="MSKEPKVNIINAQDDEVELMLSDVNLSLANSLRRTMLAEVPTLA
                     IDLVEIKMNTSVLADEFISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSA
                     RHEGEEGTTDVYSSSLIKVSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAK
                     KGIAKEHAKWSPCSAIAFEYDPHNKLKHTDFWFEVDAKKEWPDSKYATWEEPPKPGEV
                     FDYKAKPNRFYMTVETTGSLKANQVFSRGIKTLQEKLANVLFELENSRPANTTAYGGA
                     TAYGGQTVYGRETSYGGNTNYGDYNAPY"
     gene            <703261..>704181
                     /locus_tag="PAS_chr4_0345"
                     /db_xref="GeneID:8200786"
     mRNA            <703261..>704181
                     /locus_tag="PAS_chr4_0345"
                     /product="Protein containing an Lsm domain, may bind RNA
                     and have a role in RNA processing"
                     /transcript_id="XM_002493722.1"
                     /db_xref="GeneID:8200786"
     CDS             703261..704181
                     /locus_tag="PAS_chr4_0345"
                     /codon_start=1
                     /product="Protein containing an Lsm domain, may bind RNA
                     and have a role in RNA processing"
                     /protein_id="XP_002493767.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0345"
                     /db_xref="EnsemblGenomes-Tr:CAY71588"
                     /db_xref="GeneID:8200786"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR025609"
                     /db_xref="InterPro:IPR025761"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="UniProtKB/TrEMBL:C4R7L3"
                     /translation="MSDKFIGKTISLVSQKDYRYVGVLKHIDGEVGTITLRNVRFFGS
                     EGRIQDPAHYIPPNQGAIDQLILKGQDVKDLQVLDVSVEEVVPEPGPFYPGYNYYGQV
                     PQMVSPQQVPPQQAPPQQIPPQQQQYQQQQQQPQRIQPQQQQVRQQPHPSQVQPQHIP
                     KAQQQPQQTEPPQSETKQQSQERPSKELESRPPKQNASSQQQNGAPARKERPRPIGEI
                     GDVDPNQEFDFESNNARFTEEAAKETQKAAQDETAQPSYNKQSSFFDTLSSHVETRPA
                     NNRGRGRGRGRGRGRSNRGRSNNGETPQWN"
     gene            <704294..>704893
                     /locus_tag="PAS_chr4_0346"
                     /db_xref="GeneID:8200787"
     mRNA            <704294..>704893
                     /locus_tag="PAS_chr4_0346"
                     /product="Catalytic subunit of the NatB N-terminal
                     acetyltransferase"
                     /transcript_id="XM_002493723.1"
                     /db_xref="GeneID:8200787"
     CDS             704294..704893
                     /locus_tag="PAS_chr4_0346"
                     /codon_start=1
                     /product="Catalytic subunit of the NatB N-terminal
                     acetyltransferase"
                     /protein_id="XP_002493768.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0346"
                     /db_xref="EnsemblGenomes-Tr:CAY71589"
                     /db_xref="GeneID:8200787"
                     /db_xref="GOA:C4R7L4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C4R7L4"
                     /translation="MTSIKPFQATDLFDINPVNLDVLTENYQPFFYLQYLVDWPPLFF
                     KSVSGSVIDSSNGSILRNDVMSGYMMGKTEGKAKEWHTHITAVTVNPTYRRLGLASFL
                     CEHLDQATDQEPYNTYFVDLFVRVTNKLAISMYHKLGYSVYRRVVGYYGDGSNENRNK
                     LDDNHDAFDMRKSQTRDVKKETVRENGEKVNVLPYEVVF"
     gene            complement(<704890..>706131)
                     /locus_tag="PAS_chr4_0347"
                     /db_xref="GeneID:8200788"
     mRNA            complement(<704890..>706131)
                     /locus_tag="PAS_chr4_0347"
                     /product="Peroxisomal adenine nucleotide transporter"
                     /transcript_id="XM_002493724.1"
                     /db_xref="GeneID:8200788"
     CDS             complement(704890..706131)
                     /locus_tag="PAS_chr4_0347"
                     /codon_start=1
                     /product="Peroxisomal adenine nucleotide transporter"
                     /protein_id="XP_002493769.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0347"
                     /db_xref="EnsemblGenomes-Tr:CAY71590"
                     /db_xref="GeneID:8200788"
                     /db_xref="GOA:C4R7L5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R7L5"
                     /translation="MSGADYQLSLTEKATFGTLSAIVSTVVLYPLDLTKALIQTQEKV
                     KTRKDHNEALKLEGGTIENILLSPGATGFENEASSIAEELIGEENDQLSQKLELELQD
                     KARINPIYYRNTVDALLKILKQEGFKGWYHGLQASVTSAAVQSFSYFYFYEALKKLYS
                     NSQKNSSKGRIFDELSISILAAALSQFFVTPFNVITTELQTSQFQKNVAHSQLIAIEE
                     SNIDLRKDSPLLYQYYKIMRNNKQEESTSLFKKLLGNNELIATGSKIVRKRGVSALWK
                     GLKVSLILTLNPSITYGSYERLKKLIYGDIKYLSAFQSLVLGMISKMIATLVTQPLIV
                     SKTVLQKSQDDPRAKQFNSFQQVLCHLWKTDKFKGLWRGLLSQIFKGALGQGLLFLFK
                     DQIELVFLSLINIYRIYTKRI"
     gene            complement(<706243..>707652)
                     /locus_tag="PAS_chr4_0948"
                     /db_xref="GeneID:8200789"
     mRNA            complement(<706243..>707652)
                     /locus_tag="PAS_chr4_0948"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493725.1"
                     /db_xref="GeneID:8200789"
     CDS             complement(706243..707652)
                     /locus_tag="PAS_chr4_0948"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493770.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0948"
                     /db_xref="EnsemblGenomes-Tr:CAY71591"
                     /db_xref="GeneID:8200789"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C4R7L6"
                     /translation="MSINEIVESLIAQYLSERGLKESLAAFKLELNRTFSDNRDLLEE
                     RLYDIVEDRYKFLELKKANEDDPQALNNSVALPVWKLPNPVIGEELVPLGSDLVVSTT
                     VGNLKLSDQPSSCIVISTSSNELQVFDLNGVKLAGFQKVLKSISKVVLIIDSSPLLLC
                     GGMDGQLSILNVATKEIQSFQLHGRLLSDMKYLPIDDSHGYLVSVGMDNNVTLTTIDF
                     TDIKNIQFSKSQFKMLTRPTCIDFFTFQNHFLVIANRVDTSLISVFIVNDEKKLVELC
                     RLSTDDSEFSSHGFQIGALAHHITEEKLLISAATNHIPYMRLITLVLPDLNELIDYWI
                     KEEGKENTEEDLLLQLRSLSINQVHEQQFTNKTHVIRNVILSSVNTSAPQDKYSVQQI
                     ATRDSKNGVWIFSDDGVIRGLNLSSGTIIEELKSHEGRIKSAAAFTSNDGDELLFTSG
                     ATDRRTKRWSVTPPRPSSG"
     gene            <707958..>708395
                     /locus_tag="PAS_chr4_0348"
                     /db_xref="GeneID:8200981"
     mRNA            <707958..>708395
                     /locus_tag="PAS_chr4_0348"
                     /product="40S ribosomal protein S23"
                     /transcript_id="XM_002493726.1"
                     /db_xref="GeneID:8200981"
     CDS             707958..708395
                     /locus_tag="PAS_chr4_0348"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="XP_002493771.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0348"
                     /db_xref="EnsemblGenomes-Tr:CAY71592"
                     /db_xref="GeneID:8200981"
                     /db_xref="GOA:C4R7L7"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C4R7L7"
                     /translation="MGKGKPRGLNAARKLRVHRRNNRWADLQYKSKLLGTAFKSSPFG
                     GSSHAKGIVLEKIGIASKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGKRGKAKGDIPGVRFKVVKVSGVSLLSLWKEKREKPRS"
     gene            complement(<708444..>709688)
                     /locus_tag="PAS_chr4_0349"
                     /db_xref="GeneID:8200790"
     mRNA            complement(<708444..>709688)
                     /locus_tag="PAS_chr4_0349"
                     /product="Protein that interacts with Spt6p and copurifies
                     with Spt5p and RNA polymerase II"
                     /transcript_id="XM_002493727.1"
                     /db_xref="GeneID:8200790"
     CDS             complement(708444..709688)
                     /locus_tag="PAS_chr4_0349"
                     /codon_start=1
                     /product="Protein that interacts with Spt6p and copurifies
                     with Spt5p and RNA polymerase II"
                     /protein_id="XP_002493772.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0349"
                     /db_xref="EnsemblGenomes-Tr:CAY71593"
                     /db_xref="GeneID:8200790"
                     /db_xref="GOA:C4R7L8"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:C4R7L8"
                     /translation="MSDEESENKKLLDQVLPEKTDQETQPEADAALAEQEAPENEPNE
                     PASDDDSDSDLSDISDVDEEKVAEGLRYLDEQTAASLSKHKAAQPSSTHKKKEPTRRR
                     PKQQTARETQYEPDVVEDEAARRTRLFEEKLDAAIKRKPNKRKKNDDVDLEQMQDELI
                     QQLKLQMEESAIRDANNIEQGKPAIFKLKLLPKVKDILLRANLADSILDNNLLASVRL
                     WLEPLPDASLPAYQIQKVLFDAIKSLPIKTSHLRESGLGKVMVFYQKSKRVEPNLKRT
                     AEKLISDWTRPIMGASDNYKDMRVRTQQFDPAQFAESLPGRVSVRPQEAKTLYEEAAE
                     RRKRAAIPQARTAAYTIAPQVNTELLMSSARRTLPSGVGSSLSGEDQYKRLNSRLNTM
                     GTKRKSSAKKGGISIEGRGLPQ"
     gene            <709912..>710061
                     /locus_tag="PAS_chr4_0350"
                     /db_xref="GeneID:8200791"
     mRNA            <709912..>710061
                     /locus_tag="PAS_chr4_0350"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493728.1"
                     /db_xref="GeneID:8200791"
     CDS             709912..710061
                     /locus_tag="PAS_chr4_0350"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493773.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0350"
                     /db_xref="EnsemblGenomes-Tr:CAY71594"
                     /db_xref="GeneID:8200791"
                     /db_xref="InterPro:IPR019603"
                     /db_xref="UniProtKB/TrEMBL:C4R7L9"
                     /translation="MNFPNQQPSEEEKKIHQQYSERTIQTAVLIGAALWLIPTAIHFI
                     KRATK"
     gene            complement(<710109..>710702)
                     /locus_tag="PAS_chr4_0351"
                     /db_xref="GeneID:8200792"
     mRNA            complement(<710109..>710702)
                     /locus_tag="PAS_chr4_0351"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493729.1"
                     /db_xref="GeneID:8200792"
     CDS             complement(710109..710702)
                     /locus_tag="PAS_chr4_0351"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493774.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0351"
                     /db_xref="EnsemblGenomes-Tr:CAY71595"
                     /db_xref="GeneID:8200792"
                     /db_xref="UniProtKB/TrEMBL:C4R7M0"
                     /translation="MSDAEPIDETRGPEEIPLEELGIEDRAVEYQADDPFAGETSFLL
                     ENQEHSQGLGNEAVFPWGSNQPVEATDGNRTPEDSFNAKSHYKEFKLKTFKVKRLPEV
                     NFNEFKLNPENYKRKSPFLMILQDGASYLYDQRKNVIVGKFDLNGQFFHRLYLQQFPP
                     SILEMMKANQFERVINHPFVTKIRQERSSAYYYSNWV"
     gene            <711122..>713347
                     /locus_tag="PAS_chr4_0352"
                     /db_xref="GeneID:8200793"
     mRNA            <711122..>713347
                     /locus_tag="PAS_chr4_0352"
                     /product="Long chain fatty acyl-CoA synthetase"
                     /transcript_id="XM_002493730.1"
                     /db_xref="GeneID:8200793"
     CDS             711122..713347
                     /locus_tag="PAS_chr4_0352"
                     /codon_start=1
                     /product="Long chain fatty acyl-CoA synthetase"
                     /protein_id="XP_002493775.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0352"
                     /db_xref="EnsemblGenomes-Tr:CAY71596"
                     /db_xref="GeneID:8200793"
                     /db_xref="GOA:C4R7M1"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="UniProtKB/TrEMBL:C4R7M1"
                     /translation="MSHLKKIQDRTPVESLSPQDKKEIKSLFDSLPLPSSDLANSYAV
                     PGSAKTGYSPTFRNSYVRNGSLIETLHPSLRTLHELFSNSVQLYGERDCLGSRLYDHD
                     VKDGYDDYFTFENYRTICERKSNLGAGIIHSVLDNEYRIDPKDGGFDLADYNTNNFIV
                     SLYGRNRAEWVLSDLACQTYSLPDTALYDTLGPTTSAYILELTKSPVVICCAEKIEKL
                     IELKTNNPESLKHFITIISMDNLDFQDFSINDLIKRANSVQIKLLDLGQTEELGKASP
                     VAEIPPLPSTIYTISFTSGTTGVPKGVVLTHKIATAAATFALSHIGLPDSGRTLSILP
                     LAHIFERQVSNLALVAGVALTFPHLPGPEHIVPNLRISKPCALTAVPRLYNKFESAIK
                     SSLLSGPETITQKLVSAIISQNIRTQSAKDGNKGNNFISRQLVTKKIRASLGLDNCQF
                     LVTGSAPIDPETMKFLKGSLGVGFMQGYGLTECYAGICISSAYLKENGSCGAIGISAE
                     MRLRDVPEMNYFSGKQLADGSYHGELQLRGPQVFSYYYKRPDETEKAFDKDGWFCTGD
                     IARIDKNGKLYIIDRVKNFFKLSQGEYVTPEKIENIYLSSSPLISQVFIHGDSLHSFL
                     VAVVGVDETFFNNLRSVDPSIIKNYELKSTEDTIEKCNANKDLKRSLLFLFNKSVESA
                     GLLGFEKIHNFHLAFEPLKIEDDTLTPTFKLRRVQAKHKFDTELANLYNEKSLLRETK
                     M"
     gene            complement(<713400..>714047)
                     /locus_tag="PAS_chr4_0353"
                     /db_xref="GeneID:8200794"
     mRNA            complement(<713400..>714047)
                     /locus_tag="PAS_chr4_0353"
                     /product="Specialized J-protein that functions with Hsp70
                     in Fe-S cluster biogenesis in mitochondria"
                     /transcript_id="XM_002493731.1"
                     /db_xref="GeneID:8200794"
     CDS             complement(713400..714047)
                     /locus_tag="PAS_chr4_0353"
                     /codon_start=1
                     /product="Specialized J-protein that functions with Hsp70
                     in Fe-S cluster biogenesis in mitochondria"
                     /protein_id="XP_002493776.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0353"
                     /db_xref="EnsemblGenomes-Tr:CAY71597"
                     /db_xref="GeneID:8200794"
                     /db_xref="GOA:C4R7M2"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004640"
                     /db_xref="InterPro:IPR009073"
                     /db_xref="UniProtKB/TrEMBL:C4R7M2"
                     /translation="MFRGLQLIPRFASSTRIRLFSQKSVLLDAAKVNYYRIFHNTFPY
                     GPPPAGSFDVDQRQLRKEFRKLQAKYHPDILNSGDDKVHLDDEEYSSLLNNAYATLKS
                     PLTRAQYILKLNANIDITTDEASKSYQFKDKALLLDILEIHEELENVSDDSELAALKI
                     SNDERIAESISKLGQLFKDEDYENAAMESIKLKYWFNIDNAIKEWEEGKPVIMTH"
     gene            complement(<714912..>716525)
                     /locus_tag="PAS_chr4_0354"
                     /db_xref="GeneID:8200795"
     mRNA            complement(<714912..>716525)
                     /locus_tag="PAS_chr4_0354"
                     /product="Nucleoporin, essential subunit of the nuclear
                     pore complex (NPC)"
                     /transcript_id="XM_002493732.1"
                     /db_xref="GeneID:8200795"
     CDS             complement(714912..716525)
                     /locus_tag="PAS_chr4_0354"
                     /codon_start=1
                     /product="Nucleoporin, essential subunit of the nuclear
                     pore complex (NPC)"
                     /protein_id="XP_002493777.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0354"
                     /db_xref="EnsemblGenomes-Tr:CAY71598"
                     /db_xref="GeneID:8200795"
                     /db_xref="GOA:C4R7M3"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:C4R7M3"
                     /translation="MSFNFGAKTNAAPGNTSTGGFSFGSNTSNNAAPAAGSSSFSFGA
                     KPTSGGLNLNTNPSSSNSGGLFGAKPAGTTGASTGLFGANTGANTGNTSNTTSGGLFG
                     NNNNTNVNNTASGGLFGNNASNANNTTSGGLFGNANANPNNGNTNNAGSGGLFGGNNN
                     TASGGLFGNKGTSTNSGGLFGTSNTGNTTNTGAPSGGLFGSTNNTGTSSGLFGGNTST
                     NTSNTAGGLFGNNANTNANNQVNNNVPTSAQPSFAWSQQQKSQPSNALQQMQSNQAVA
                     TFNNNSNNYTPTITDQIIKVKNSWDPSSPNCMLKTHFYNKLPSNESLANVQRPQDELP
                     EEWEKAMSNRPTKYNSIPVKAKGFDDLLTRANTQTEHVRQSRIILNTINDNLTDLGEK
                     HDLNTSARLTECKVKYKNLSKKLLRLAIILSVLKSRGYPLSTDEEHLKLEFEKLFNTL
                     NDPAGLGRTNELWGRLSNLRERAKNLSQQQQKESGLLITQEQVQERDLSTTSKVTDVL
                     GKQQQGIQYLYELIQTDKEKLDKLLEKVN"
     gene            <716736..>717290
                     /locus_tag="PAS_chr4_0355"
                     /db_xref="GeneID:8200796"
     mRNA            <716736..>717290
                     /locus_tag="PAS_chr4_0355"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493733.1"
                     /db_xref="GeneID:8200796"
     CDS             716736..717290
                     /locus_tag="PAS_chr4_0355"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493778.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0355"
                     /db_xref="EnsemblGenomes-Tr:CAY71599"
                     /db_xref="GeneID:8200796"
                     /db_xref="InterPro:IPR016680"
                     /db_xref="UniProtKB/TrEMBL:C4R7M4"
                     /translation="MSSTHTNDSLNSSNYVDKLKDTHFVFENDKLPSEIPDVEEVGAT
                     TAPLLSAAYFIGAKCQDYNDDFMLCQKEAKGNGPIDCLKEGRRVTRCASGVLKDLNTH
                     CSDEFRLHWQCLSFSNLEYKNCRKAESLLNKCVFEKMNLVKKIPGIPEDRQIHLKQNP
                     VLKPVALHQDSEVAFKKAQNENSI"
     gene            complement(<717373..>722298)
                     /locus_tag="PAS_chr4_0356"
                     /db_xref="GeneID:8200797"
     mRNA            complement(<717373..>722298)
                     /locus_tag="PAS_chr4_0356"
                     /product="Adenylate cyclase, required for cAMP production
                     and cAMP-dependent protein kinase signaling"
                     /transcript_id="XM_002493734.1"
                     /db_xref="GeneID:8200797"
     CDS             complement(717373..722298)
                     /locus_tag="PAS_chr4_0356"
                     /codon_start=1
                     /product="Adenylate cyclase, required for cAMP production
                     and cAMP-dependent protein kinase signaling"
                     /protein_id="XP_002493779.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0356"
                     /db_xref="EnsemblGenomes-Tr:CAY71600"
                     /db_xref="GeneID:8200797"
                     /db_xref="GOA:C4R7M5"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:C4R7M5"
                     /translation="MPMSITDNGLGNQHDPDHPGKQSLTPKYTKTRRILSKLRRTSSK
                     TDDNDPRRVSVASHRYSLVPGPIHKKKDEKMEPHHHIHIHNPAVALKNVFQTPSPSVG
                     DSRRRSTTEEPTTLSPTGSVEDLSAFISRKDDSDDEGDDANNNTLTKSFTGFNLNNLS
                     DDDIPTNGNITHMSAWQPPQSWSVKASNMKEQEKSLTLSSTSSTDAESEQSSISSFGK
                     KKDHVESEAIDPNCIHEPNTECPVHGHPHDMTVGDASNEEKKVSEPHHHLYHNQPLVG
                     RLKVFKDNNGRTLNVTINENFRQIIKRLENGHWLNPNEDYRILLRCGGLHEVLSLDDH
                     PLRIQERLLNLSGFTDPDDWKQLDMTYLYKFIFEYNEEKGLNPSIKSRISVRYGRADL
                     KNLDLRTIPNTIHQQAEDIIYLDVSKNPSIFIPLDFIQGCRNTQTLKFTGNRAHSLHK
                     NIFQFANLRNLDLETNYLRQIPKDITLLSTLTNLEISNNRITQLPSNFGELALLRYLN
                     LSSNHIKVIPQEIFDLPNLTELDLSYNSISNIPVEIKNLTKLVTLKLSGNKLAGKVSD
                     SIVEVKSIKTLDLRFNQLEDMSCLRTLDNLQNLYLTGNLCTSYTSKVASLRTLQLDLN
                     PVTHFSVIGTLESLRYLDLTKAKLTSLSPSVLSNVPQVTHLILNHNHLSFLPKEISTL
                     KKLKKLSVCNNNLTTLPDEISELQELTSLDLHLNNIKTLPITIWQLNLRELILSSNSL
                     PDTPALTGENKLGNSLLILSLSHNRLRNRYLSNLINFKNLRSLNISYNGIYDLTNGSL
                     GHLKNLTHLYLSGNELTILPDDLESLTNLTVLHLNGNRFQSLPYELSKIPRLSVLDVG
                     SNILKYDISDSPRYWNWNMNKELKYLNFSGNKSLKISSTTSTSKDMGEKTTSKFGSLQ
                     DLCILGLVDVTWNDTIENSIKTRVRSTPSTFGGYGYGISDTLGRNSSLTTRDCVVEKF
                     REKEDETLICLFDGKNNDVHVTKVLEEVFKNFLETQLDAIDSKMASGTPVDALRRAFL
                     QCNQEINTLIDDPSTGNVDPSHFPGQTKEYLARSGGKTGCSGTVILIQGRKIHVANVG
                     DTLSIKTTSTGEFDVLTQKHEPYEPSEYKRIRASGGFVTTEGKVNDVVDISRAFGFWN
                     LVPTVNAAPKISQFELKATDGAIVLATKELWKLISMDLAFDIIRNDVNNPMIAAETLR
                     DYAISYGCSGNITVIVISLRYKQMVANNQTTRDVLRQEYSNLIKLEDEIYPPVGNVAM
                     VFTDIKNSTKLWETNPISMRTAIKLHNSIMRRQLKIVGGYEVKTEGDAFMVAFPTPTS
                     ALLWCFSVQKQLLHESWPEEIIKSPHCARVQDKYGNDLFRGLSVRMGIHWGSPVCEAD
                     LITRRMDYFGPMVNLASRVSGVADGGHIALSSQFIHEFEKLDESHEKLKSFTGERFGD
                     QWKQTVAEAYGTDASYACQIESEFEQLEVDKWVFFVIGERKLKGLENPEKICLGYPGS
                     LAERIDCTEQKMDKDEMVATQVVRDRDYGIMGIIAARDIWKLRRIAFRLEHILTVLQS
                     GRVFNDTSSIITDQISMVMTSKLGDEDYFSLLEHVITRIENISNNLALRQETDIALGN
                     DGRLTVLTNEEFMSALSACLHEFKRLKHWET"
     gene            <723960..>724943
                     /locus_tag="PAS_chr4_0357"
                     /db_xref="GeneID:8200798"
     mRNA            <723960..>724943
                     /locus_tag="PAS_chr4_0357"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493735.1"
                     /db_xref="GeneID:8200798"
     CDS             723960..724943
                     /locus_tag="PAS_chr4_0357"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493780.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0357"
                     /db_xref="EnsemblGenomes-Tr:CAY71601"
                     /db_xref="GeneID:8200798"
                     /db_xref="UniProtKB/TrEMBL:C4R7M6"
                     /translation="MLTTILALAFFRALVLADSVEFYIYVWQPGFGVEDAYWGVDESG
                     LITAVGPGYVSDDIPQVLFVVTTDGKLQGNGQLVEITPPYDFLTLRQNNTGTSGFSID
                     YDDIPTLLLNGAAIDHVWSCLSPDGDHGFVISSDSPNASCSGFTVRISLQQEPGPCEG
                     DECTEPPEPPVCSDDDDECTEPPEPPVCSDDDDECTEPPEPPVCSDDDDECTEPPEPP
                     VCPDDDDECPEPPTDTTDETPTETPTETPTETPTETPTETPTETPTETPTETAYPPTL
                     PTDTTLTTAPTSTSSEVSTPSPSPSVGDANVIVNTLGLTGLIAVVAMVLLA"
     gene            <725818..>727182
                     /locus_tag="PAS_chr4_0358"
                     /db_xref="GeneID:8200799"
     mRNA            <725818..>727182
                     /locus_tag="PAS_chr4_0358"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493736.1"
                     /db_xref="GeneID:8200799"
     CDS             725818..727182
                     /locus_tag="PAS_chr4_0358"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493781.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0358"
                     /db_xref="EnsemblGenomes-Tr:CAY71602"
                     /db_xref="GeneID:8200799"
                     /db_xref="UniProtKB/TrEMBL:C4R7M7"
                     /translation="MFKKLLPLALFKAIVLADSTSFTINFGPGEGHSGTPLGVNDAGV
                     IIPSTTGVRFYVNDDSQLKVDNHELQAASPLDLLSLINSGAETKGFSLVTDPPALLLN
                     DATPSLWICESSDVSRIAISIDSPADGCIPYSIKPKLEANVRKGGLFARDDDLTDSDG
                     VDTDTEDDLTDNDGVDTDTEDDLTDNDGIDTDTDDDLTDNDGIDTDTEGDLTDNDGVD
                     TDTNDDWTDNDGVDTDTDDDWTDNDGIDTDTDSDDDQSLAGPVNPPTSATLATTSTSS
                     TSATFTSLTTGGDLTDSDPDSWTDNDGVDTDTDDDWTDNDGINTDTDTDSDDDQSLSG
                     PTNPPTSTTLATTATSSTSTTSASALATGGDLTDSDTDSWTDNDGIDTDTDSDTDSDD
                     DQSQSGPGNSPTGATLATTATTSATSTVSNGQVTSSDNGANHFAGAVGLSGAAGGVIL
                     ALLI"
     gene            <727983..>728618
                     /locus_tag="PAS_chr4_0359"
                     /db_xref="GeneID:8200800"
     mRNA            <727983..>728618
                     /locus_tag="PAS_chr4_0359"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493737.1"
                     /db_xref="GeneID:8200800"
     CDS             727983..728618
                     /locus_tag="PAS_chr4_0359"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493782.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0359"
                     /db_xref="EnsemblGenomes-Tr:CAY71603"
                     /db_xref="GeneID:8200800"
                     /db_xref="UniProtKB/TrEMBL:C4R7M8"
                     /translation="MYRKLLPLALLSVPVFADDDDSLPFVIVNSASGETHDGTYWGVN
                     NAGAVVPSSTGVRFVVNDDGELEGNDEEVEVTSNGFLTLRDDNDENEGFSLTDDDPPV
                     LLLNRQTPTVWICGSDDDARIALGSQSPQDDCVEYSIEVQLQSGSRSGSSTRTSSRTT
                     GTSATSATSATSGTSATGTTTGSTSTATDGAHKLVGGLSGLAGGVAIALLI"
     gene            <729302..>730399
                     /locus_tag="PAS_chr4_0360"
                     /db_xref="GeneID:8200801"
     mRNA            <729302..>730399
                     /locus_tag="PAS_chr4_0360"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493738.1"
                     /db_xref="GeneID:8200801"
     CDS             729302..730399
                     /locus_tag="PAS_chr4_0360"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493783.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0360"
                     /db_xref="EnsemblGenomes-Tr:CAY71604"
                     /db_xref="GeneID:8200801"
                     /db_xref="UniProtKB/TrEMBL:C4R7M9"
                     /translation="MCHVLGQFILFMTMFKTLLLPLVLWEARVLAENEDELGIPFHIV
                     NTLPEDEYYNSTASRYIDTLWGTQANAIAVAGYYYEQLIIQEVLFTLTTDGILQGNDS
                     DSKVEVTSPGGRLTYREENEGTPGFSLDLNDPPALLLDGATPTIWICPSGNTPEVHIY
                     DESPGDDCLEYLVSVQPLEPGTIDPPGDGDDGPGDGDDGPGDGDDGPGDGDDGPGDGD
                     DGPGDGDDGPGDGDDGPGDGDDGPGDGDDSPGDGDDGPGGGSGGGSGGGSGGGSGGGS
                     GDGSGGGDDEDDTTTTTSSSTTSSPATSPTTSTTSATGTSTPTSTPGTTTSAPTTTSS
                     PEATNAGGAANLVGPNGLPGLIGGVAIALLI"
     gene            <731336..>732400
                     /locus_tag="PAS_chr4_0361"
                     /db_xref="GeneID:8200802"
     mRNA            <731336..>732400
                     /locus_tag="PAS_chr4_0361"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493739.1"
                     /db_xref="GeneID:8200802"
     CDS             731336..732400
                     /locus_tag="PAS_chr4_0361"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493784.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0361"
                     /db_xref="EnsemblGenomes-Tr:CAY71605"
                     /db_xref="GeneID:8200802"
                     /db_xref="UniProtKB/TrEMBL:C4R7N0"
                     /translation="MLMFKKLLPLVLLKAKVFADDTDWHASPVTFRIVNIRPEPPYNG
                     TGTRVGYWSVQDGVIVDTGLAIEFFLNDTVLQGNGSNSKLEVTSPGGRLTFNEENEGT
                     TGFSIVLNDSAELLLNGAAPTVWICQSGDTSEIHIYDESPGDDCEQYHVALESEQFSS
                     IPEDPCDNPEYADECDDAGGSGGGSSGGNDGGSGGGSGGGSGGGSGGGSGGGSGGGSG
                     GGSGGGSGGGSGGGSGGGSGGGSGGGNDGGSGGGNDGGNDGGSGGGSGGSSGGGDDED
                     DTSTTTSGSTTSSPATSPTTSTTSATGTSTPTSAPGTTTSAPTTTSSPEATNAGGAVN
                     LVGPNGLSGLIGGVAIALLI"
     gene            complement(<734110..>735945)
                     /locus_tag="PAS_chr4_0363"
                     /db_xref="GeneID:8200803"
     mRNA            complement(<734110..>735945)
                     /locus_tag="PAS_chr4_0363"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493740.1"
                     /db_xref="GeneID:8200803"
     CDS             complement(734110..735945)
                     /locus_tag="PAS_chr4_0363"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493785.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0363"
                     /db_xref="EnsemblGenomes-Tr:CAY71606"
                     /db_xref="GeneID:8200803"
                     /db_xref="UniProtKB/TrEMBL:C4R7N1"
                     /translation="MTKLTILLSVLLQLFSVLAEVPKKTEWSSHTTYWTSTLEALRTV
                     TPTGTERAVIGEAPYEYKLIGNDQFDPGLNAKREIIDCEAVCCGAVPTSDPLKRRDVC
                     ECENVCCPGDDCETYVTTTQPWTGTYETTYTVPPSGTEPGTVVIETPEITDCEAVCCG
                     AVPTSDPLRRRDVCECENVCCPGDDCETYVTTTQPWTGTYETTYTVPPTGTEPGTVVI
                     ETPVTYVTTTQPWTGTYETTYTIPPTGTEPGTVVIETPEITDCEAVCCGAVPTSDPLR
                     RRDVCECENVCCPGDDCETYVTTTQPWTGTYETTYTVPPTGTEPGTVVIETPVTYVTT
                     TQPWTGTYETTYTVPPTGTEPGTVVIETPVTYVTTTQPWTGTYETTYTVPPTGTEPGT
                     VVIETPVTYVTTTKPWTGTYETTHTVPASGTEPGTVIIETPIKYLNTSISASTSTWTK
                     INTVTQFISCPVCTIPKTITVTPKISNETVTIIISQPHGTSSRTTTVVKTDGASVSSH
                     SYKTALTTDVKPEEKTSTKLGTVTTVSGSHSAIDTVTGSLSDYHASSIPHTVKSEEKA
                     SSTVTHTISSSTVYQVSPSNGASWLSVRLNTALSIIGTLFAAVFI"
     gene            <737201..>737599
                     /locus_tag="PAS_chr4_0365"
                     /db_xref="GeneID:8200804"
     mRNA            <737201..>737599
                     /locus_tag="PAS_chr4_0365"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493741.1"
                     /db_xref="GeneID:8200804"
     CDS             737201..737599
                     /locus_tag="PAS_chr4_0365"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493786.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0365"
                     /db_xref="EnsemblGenomes-Tr:CAY71607"
                     /db_xref="GeneID:8200804"
                     /db_xref="UniProtKB/TrEMBL:C4R7N2"
                     /translation="MQSQYLYSKLKLDHFDTRYCKVLLGKSRLRLQYMNRIRRMQKRR
                     SSRVQDNQSQRVERIGSWQSMEHHFIRSRTFNLYLFQLVGCRPSNSVVSGTIPLTPER
                     LMSIIDSVVRLSLDRKCTAHTAKLNYTPTV"
     gene            <737752..>738168
                     /locus_tag="PAS_chr4_0949"
                     /db_xref="GeneID:8201206"
     mRNA            <737752..>738168
                     /locus_tag="PAS_chr4_0949"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493742.1"
                     /db_xref="GeneID:8201206"
     CDS             737752..738168
                     /locus_tag="PAS_chr4_0949"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493787.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0949"
                     /db_xref="EnsemblGenomes-Tr:CAY71608"
                     /db_xref="GeneID:8201206"
                     /db_xref="UniProtKB/TrEMBL:C4R7N3"
                     /translation="MNPRENSTSHYAEQVASMDSRGWHFKCYSTEAQVHYATFASALR
                     VALGFLSLILYSLVCTVEHPSPEIVFRSEDSGFSSSEMLFRCYYTSHQITSKLRLKLT
                     PPHTKIQPTIHQPYFPYCLLRKISTHVCTPSLTFPC"
     gene            <738906..>740537
                     /locus_tag="PAS_chr4_0366"
                     /db_xref="GeneID:8200982"
     mRNA            <738906..>740537
                     /locus_tag="PAS_chr4_0366"
                     /product="Protein required for daughter cell separation,
                     multiple mitotic checkpoints and chromosome stability"
                     /transcript_id="XM_002493743.1"
                     /db_xref="GeneID:8200982"
     CDS             738906..740537
                     /locus_tag="PAS_chr4_0366"
                     /codon_start=1
                     /product="Protein required for daughter cell separation,
                     multiple mitotic checkpoints and chromosome stability"
                     /protein_id="XP_002493788.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0366"
                     /db_xref="EnsemblGenomes-Tr:CAY71609"
                     /db_xref="GeneID:8200982"
                     /db_xref="UniProtKB/TrEMBL:C4R7N4"
                     /translation="MSSSTRNERLERLNVKRVRDKKNLDSPRPIKRSSSDTLRTRKYD
                     YFKTLSPPPSIQRKTSRSFSNLFHRFKNPSRSSSCSKNQDLRLLTPSTVVSTPDSLFS
                     CDNGDDYSTPTSPLASKQFTFYYSDSASSSSSSVNEEFSKLTLKNCVTTDPVKRSLSS
                     RIFEIPEILNLILSCLDDSESRIPREKIKNRRKPLSLRHAKLVHGEKGDRIWRDSQEM
                     GFFEPTVKESNLYNCLFVNKLWYQSTLEILETRFYFADERKLRSLCERPVIKKTNSQT
                     NTLVLHKLFYTEQYVVDHLAQQISGCLEWLEFYVCPRIVPSPTFFEGNKIQKLCIPGS
                     AVVDDSFLKSVSKNLPNLKVLDIRACELVTDAGVYYIAHSCLNLETLNVGRHSRGELI
                     TDASIGPVVRNTKITTLGVAGCNITDRSLWQLCLNRGSQVKRLSLNNCRMLTDNSLCK
                     ILHHDYFPNLTVLEIRNCLNLSNLRPVVLFKKRQIKKGIPVLVEGCEVIDHRLREQEL
                     QIDLEVSRKIISDISGWINESADDDNDFQQLLRSR"
     gene            <740706..>741377
                     /locus_tag="PAS_chr4_0367"
                     /db_xref="GeneID:8200583"
     mRNA            <740706..>741377
                     /locus_tag="PAS_chr4_0367"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493744.1"
                     /db_xref="GeneID:8200583"
     CDS             740706..741377
                     /locus_tag="PAS_chr4_0367"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493789.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0367"
                     /db_xref="EnsemblGenomes-Tr:CAY71610"
                     /db_xref="GeneID:8200583"
                     /db_xref="UniProtKB/TrEMBL:C4R7N5"
                     /translation="MGGRYPPREYSRPNSYRGPRSGPPHPRPSSREGHGYPNRNSYRQ
                     DYRHRPDYRQDYRHDYRDDYRDDYRDDYRDDYRDYGYGQEPRNDYRHDYRNGSRNDYP
                     DSRRENAHSRPQTVEPRRQEEQSHTTQETNETGKETEITQEKETAQENKSYWVARLKI
                     DGQLREKIQTSFESLESTDDRTRNLLQKSLALEIEADNLARFVENEALRVKLCEEKLE
                     NINYL"
     gene            <741462..>742472
                     /locus_tag="PAS_chr4_0368"
                     /db_xref="GeneID:8201031"
     mRNA            <741462..>742472
                     /locus_tag="PAS_chr4_0368"
                     /product="Microsomal beta-keto-reductase"
                     /transcript_id="XM_002493745.1"
                     /db_xref="GeneID:8201031"
     CDS             741462..742472
                     /locus_tag="PAS_chr4_0368"
                     /codon_start=1
                     /product="Microsomal beta-keto-reductase"
                     /protein_id="XP_002493790.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0368"
                     /db_xref="EnsemblGenomes-Tr:CAY71611"
                     /db_xref="GeneID:8201031"
                     /db_xref="GOA:C4R7N6"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR027533"
                     /db_xref="UniProtKB/TrEMBL:C4R7N6"
                     /translation="MTLALEFESKTVTALVYLSVFTGAYKIITVVLGYLSVLLDVFVL
                     PGVSLNKYGAKKGHWAVVTGASDGIGKEYTLQLAKRGFNVVLVSRTLSKLESVQTEVQ
                     SKYNVETKLVSFDASLDSEESYQELADAIAGLPVTVLVNNVGQSHSIPVPFLETPIKE
                     LKDIITINNTATLRITQIVAPVIVTTARQKKTRGLILTMGSFGGLLPTPLLATYSGSK
                     AFLQSWSSALAGELKSDNVDVELVISYLVTSAMSKIRRTSASIPSPKAFVASVFKSLG
                     RRGGAQERYATSTPFWSHALMHWWIENTVGVYSAVANTLNLNMHQSIRARALKKAASK
                     KE"
     gene            <742713..>743681
                     /locus_tag="PAS_chr4_0950"
                     /db_xref="GeneID:8201111"
     mRNA            <742713..>743681
                     /locus_tag="PAS_chr4_0950"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493746.1"
                     /db_xref="GeneID:8201111"
     CDS             742713..743681
                     /locus_tag="PAS_chr4_0950"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493791.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0950"
                     /db_xref="EnsemblGenomes-Tr:CAY71612"
                     /db_xref="GeneID:8201111"
                     /db_xref="GOA:C4R7N7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C4R7N7"
                     /translation="MGELADYQRLEKIGEGTYGVVYKALDIRHNNRVVALKKIRLESE
                     DEGVPSTAIREISLLKELKDDNIVRLYDIVHSDSHKLYLVFEFLDLDFKKYMESIPQG
                     AGLGAAMVKRFMIQLIRGILYCHSHRILHRDLKPQNLLIDKEGNLKLADFGLARAFGV
                     PLRAYTHEVVTLWYRAPEILLGGKQYSTGVDMWSIGCIFAEMVNRKPLFAGDSEIDQI
                     FRIFRVLGTPNEENWPEVNYLPDFKPTFPKWGRKSLASVVTSLDADGIDLLERLLVYD
                     PAGRISAKRALQHSYFFDDAITAPLTDADHELHQSNMQVDTSAVYT"
     gene            <743945..>747127
                     /locus_tag="PAS_chr4_0369"
                     /db_xref="GeneID:8200983"
     mRNA            <743945..>747127
                     /locus_tag="PAS_chr4_0369"
                     /product="Subunit alpha of assimilatory sulfite reductase"
                     /transcript_id="XM_002493747.1"
                     /db_xref="GeneID:8200983"
     CDS             743945..747127
                     /locus_tag="PAS_chr4_0369"
                     /codon_start=1
                     /product="Subunit alpha of assimilatory sulfite reductase"
                     /protein_id="XP_002493792.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0369"
                     /db_xref="EnsemblGenomes-Tr:CAY71613"
                     /db_xref="GeneID:8200983"
                     /db_xref="GOA:C4R7N8"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR002869"
                     /db_xref="InterPro:IPR003097"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="InterPro:IPR019752"
                     /db_xref="InterPro:IPR023173"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C4R7N8"
                     /translation="MPSISQRGSRNNSFSSETTVPSLAEASAVSPFGLPTDPESLYGT
                     TLTSAHTVITTVPYYLSDRLFSYAAPGADGALDAAAHLWRTYLRPNAQGNVPHLTRFD
                     IRSGASNAILGYLSGLEPSAVVPVLVPGAALTYMRPVLAERRDSPVPVAFNVSALDYD
                     FETSTLVSNYVEPLNAARYLGYSVFTPLSKNEAQSIAILTHALANIEPTLNLYDGPSY
                     LKQSGKIEGILTGEKLFQLYQKLLAEIPSWSKIESYKRPAAALASLSKLTGSRLKSFE
                     YAGHNSPSTVFVIHGSVESELLLHTVERFAEKDVQIGAIAVRVPLPFNIDEFASSFPS
                     STRRIVVIGQVQSSSSSSLKKDVAASLFWKLGASAPAVAEFVYEPSFNWSSDSLESII
                     ASYEVLPKSTSATKGDYIFWTADNGRFAEVASKIAYSFSLRDDNKLSYRAKFDNINGA
                     GVLQAQLRTNSLVATDIDAADIVFVEGFKLLQAFDVVSTAKEGATLIIASSDSIEDLD
                     KVVESFPTTFKRDAATKNLKILLIDLASVGEQEGLGARTGPIACQAIFYRVAQPELAD
                     QLTRYLWEGAASETELLASVVAEVISKVEEVGIKELSVDKEWASLPTGEEEEVILPPR
                     PLETSFEPNLRESAIVPPPAISSKLELSKKLVFKESYGLTNSLRPDLPVRNFIVKVKE
                     NRRLTPDDYSRNIFHIEFDVSGTGLTYDIGEALGIHGRNDPALVEEFIQWYGLNGEDL
                     IDVPSRDDPNTLETRTIFQSLVENIDLFGKPPKRFYEALAPFALDSSEKAKLEKLASP
                     EGAPLLKAYQEDEFYSFADILELFPSAKPTASDLVQIVSPLKRREYSIASSQKMHPNE
                     VHLLIVVVDWIDKRGRQRFGQCSHYLSELSVGSELVVSVKPSVMKLPPLSTQPIVMAG
                     LGTGLAPFKAFVEEKIWQKQQGMEIGEVYLYLGARHRKEEYLYGELWEAYMDAGIVTH
                     VGAAFSRDQPHKIYIQDRIRENLKELTSAIADKNGSFYLCGPTWPVPDITACLQDIIE
                     SDAARRGVKVDADHEIEEMKESGRYILEVY"
     gene            <747294..>749414
                     /locus_tag="PAS_chr4_0951"
                     /db_xref="GeneID:8201112"
     mRNA            <747294..>749414
                     /locus_tag="PAS_chr4_0951"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493748.1"
                     /db_xref="GeneID:8201112"
     CDS             747294..749414
                     /locus_tag="PAS_chr4_0951"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493793.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0951"
                     /db_xref="EnsemblGenomes-Tr:CAY71614"
                     /db_xref="GeneID:8201112"
                     /db_xref="GOA:C4R7N9"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR005302"
                     /db_xref="InterPro:IPR005303"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C4R7N9"
                     /translation="MLSGCVISEIHQQEYANNESEIYLDNAGMPMFAKSVLAESMQMM
                     MLGPWGNPHSQSLASQRSQAMIDKTRLDVLNWFGVKAEHFGVCFTLNSTHAVKLLSEV
                     FSDKFPEFKYFYERNSHTSLIGVREHSGESQVFDLDIETPLAVSDAPTLVSWSGQSNF
                     NGQKFPTNLPLRNSGDACFRLLDASSLAGSNTVNLSESNADFIAVSFYKIFGCPDMGA
                     LIYKKDRMAQIARSKRYFGGGTVDALNLDGFVKRKEDLTLLLEDGTIPVHSIIQLQCA
                     MNVHHRLFGSMNQVSWYLKTLTEYAVNRLTSLKYSNRRPQVILYRSGLNEYGPILSFS
                     LLSESGRVLGYYDFDKFVSARGIALRTGTLCNIGGVSKFLNQSNEQIVKNSNLGHKCG
                     DSMDVINGNATGVVRISFGMCNSFQHIDFLTECISDFLSDSLAIEATLAHEKVPCTIE
                     QITIYPIKSCPGFDVPRHTAWNVTSTGLEFDRQFCLINLMTNTVMQLKSFPKMVKLLP
                     ILDRENMVLRFKNDPTIQVSLHDDRKHSTKKIESGGKAYECIMDKAILDFLYDTVKTE
                     CCLARLVPTKVNTSLQNKSAFLFISAPSLEEVERTHGGGLLRSRFRANFLVKGKMLSP
                     FIEDTWSRIEIPERRMDLTVTEKCGRCHMITIDDSGGRDFGLFKELSQTRKQQGKIYF
                     GINVDMADSKAGTVLVGDEILGVP"
     gene            <749536..>749904
                     /locus_tag="PAS_chr4_0370"
                     /db_xref="GeneID:8200984"
     mRNA            <749536..>749904
                     /locus_tag="PAS_chr4_0370"
                     /product="Protein that associates with the INO80 chromatin
                     remodeling complex under low-salt conditions"
                     /transcript_id="XM_002493749.1"
                     /db_xref="GeneID:8200984"
     CDS             749536..749904
                     /locus_tag="PAS_chr4_0370"
                     /codon_start=1
                     /product="Protein that associates with the INO80 chromatin
                     remodeling complex under low-salt conditions"
                     /protein_id="XP_002493794.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0370"
                     /db_xref="EnsemblGenomes-Tr:CAY71615"
                     /db_xref="GeneID:8200984"
                     /db_xref="GOA:C4R7P0"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="UniProtKB/TrEMBL:C4R7P0"
                     /translation="MSQEELDRVSDMLVGPLPFKNPNWHRKKKYKPARQLINDEQKRI
                     NSKENRTFDEVNYFTVQAPPSLKPRKTYCDITGLPTSYRAPHSQIRFYNMEVYEVVKN
                     MASGVDQQYLGLRGANVVLR"
     gene            complement(<749938..>750396)
                     /locus_tag="PAS_chr4_0371"
                     /db_xref="GeneID:8201113"
     mRNA            complement(<749938..>750396)
                     /locus_tag="PAS_chr4_0371"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493750.1"
                     /db_xref="GeneID:8201113"
     CDS             complement(749938..750396)
                     /locus_tag="PAS_chr4_0371"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493795.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0371"
                     /db_xref="EnsemblGenomes-Tr:CAY71616"
                     /db_xref="GeneID:8201113"
                     /db_xref="GOA:C4R7P1"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:C4R7P1"
                     /translation="MQPFSPLEHELESVKHLKLKDSSVEPPPSFIEERNTNELLKYNF
                     LSHMALDIFESPFFEPQENNRCSQLFVEDGVSVFGLLTSTGLKIVVGTDSKIDISERL
                     DPLFAQIHRSYLRVIFNPFQSIDKQDLMINTPKFDSTIKTIVENWNTKST"
     gene            complement(<750614..>751558)
                     /locus_tag="PAS_chr4_0372"
                     /db_xref="GeneID:8201190"
     mRNA            complement(<750614..>751558)
                     /locus_tag="PAS_chr4_0372"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493751.1"
                     /db_xref="GeneID:8201190"
     CDS             complement(750614..751558)
                     /locus_tag="PAS_chr4_0372"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493796.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0372"
                     /db_xref="EnsemblGenomes-Tr:CAY71617"
                     /db_xref="GeneID:8201190"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C4R7P2"
                     /translation="MLSVTALSEMFGGDSPTLREALSGIAGSTSLACWIVLLLPQLVE
                     QWKYKSAEGISIEFIALWFLGDVANLIGALWANLLPQVILLAIWYCLADFLIGFSYYY
                     YTYIYPKHHRHHHLHLNSTHSHRSGSITIDETSALVNRRHSSRSRRRSSIEVQVLSDN
                     RKHIFTNIVLPVLFVLLAGASGYFFSGETTHHTPGDGDDLPHEKIRLGPQILGYISAT
                     LYLTARLPQIYQNYVKKSCKGLSLLFFIFSTVGNLTYSLQIVLYRSDWEYVILNLSWL
                     LGSFGTIFEDSFIFFQFWLYRNNDNPDVYISDGDEPAV"
     gene            <753105..>753284
                     /locus_tag="PAS_chr4_0374"
                     /db_xref="GeneID:8200658"
     mRNA            <753105..>753284
                     /locus_tag="PAS_chr4_0374"
                     /product="60S ribosomal protein L29"
                     /transcript_id="XM_002493752.1"
                     /db_xref="GeneID:8200658"
     CDS             753105..753284
                     /locus_tag="PAS_chr4_0374"
                     /codon_start=1
                     /product="60S ribosomal protein L29"
                     /protein_id="XP_002493797.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0374"
                     /db_xref="EnsemblGenomes-Tr:CAY71618"
                     /db_xref="GeneID:8200658"
                     /db_xref="GOA:C4R7P3"
                     /db_xref="InterPro:IPR002673"
                     /db_xref="UniProtKB/TrEMBL:C4R7P3"
                     /translation="MSKSKNHTNHNQNYKAHRNGIKKVKFDRSLRLKNIDPKFRRNLK
                     FSQVGNRKAAAAKTA"
     gene            <753707..>754330
                     /locus_tag="PAS_chr4_0375"
                     /db_xref="GeneID:8200659"
     mRNA            <753707..>754330
                     /locus_tag="PAS_chr4_0375"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493753.1"
                     /db_xref="GeneID:8200659"
     CDS             753707..754330
                     /locus_tag="PAS_chr4_0375"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493798.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0375"
                     /db_xref="EnsemblGenomes-Tr:CAY71619"
                     /db_xref="GeneID:8200659"
                     /db_xref="UniProtKB/TrEMBL:C4R7P4"
                     /translation="MKRNVEMMEVQVDGTQKKERIQSTVSMPNLMLLQSKSYKAYKSI
                     DSLAQPMRDTPLPLVNRDYNNTLNVSELLDTLHGSISILLFFNPIASREWLQWFNDHY
                     YKITTHYRAHIIGVTAYTTESEWQFPVINDNKAKIASHFSLADPCGGGAYPMNALIVF
                     GPTGTNALQLHMPAVHNVAYRDRWKDATNIQQSVVSCLNYLASKPLI"
     gene            complement(<754404..>755063)
                     /locus_tag="PAS_chr4_0376"
                     /db_xref="GeneID:8200660"
     mRNA            complement(<754404..>755063)
                     /locus_tag="PAS_chr4_0376"
                     /product="Subunit of both the NuA4 histone H4
                     acetyltransferase complex and the SWR1 complex"
                     /transcript_id="XM_002493754.1"
                     /db_xref="GeneID:8200660"
     CDS             complement(754404..755063)
                     /locus_tag="PAS_chr4_0376"
                     /codon_start=1
                     /product="Subunit of both the NuA4 histone H4
                     acetyltransferase complex and the SWR1 complex"
                     /protein_id="XP_002493799.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0376"
                     /db_xref="EnsemblGenomes-Tr:CAY71620"
                     /db_xref="GeneID:8200660"
                     /db_xref="GOA:C4R7P5"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="UniProtKB/TrEMBL:C4R7P5"
                     /translation="MAPSTGKRLKGVSISRPIVYGNVAKPFGEKRPPEANAEHTHTWT
                     VFVKDPQGKDLSYFIKKVVFKLHDTYPNSTRTIESPPFQVTETGWGEFEIGIKIYFVP
                     ESNEKNVSLYHNLKLHPYGFPPGHVLTDKDREVQSILYDEIVFNEPTERMFEILTKTP
                     GSLLPPVGNNKYTFSKKMENDELDRIKQAMDKVIEEINVQKDRLKELEAEREKLVTVN
                     Q"
     gene            <755240..>756677
                     /locus_tag="PAS_chr4_0377"
                     /db_xref="GeneID:8200661"
     mRNA            join(<755240..755269,755322..>756677)
                     /locus_tag="PAS_chr4_0377"
                     /product="One of six subunits of the RNA polymerase III
                     transcription initiation factor complex (TFIIIC)"
                     /transcript_id="XM_002493755.1"
                     /db_xref="GeneID:8200661"
     CDS             join(755240..755269,755322..756677)
                     /locus_tag="PAS_chr4_0377"
                     /codon_start=1
                     /product="One of six subunits of the RNA polymerase III
                     transcription initiation factor complex (TFIIIC)"
                     /protein_id="XP_002493800.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0377"
                     /db_xref="EnsemblGenomes-Tr:CAY71621"
                     /db_xref="GeneID:8200661"
                     /db_xref="GOA:C4R7P6"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR019481"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C4R7P6"
                     /translation="MALKNIFIARHGFRSNWLPPPHPVSPTGIDSDSPLAEHGIEQAH
                     QLASYLVSIDPKPDMILTSPFYRCIETSQPIAESLDIDICLDRGVGEWYKKDRPTIPQ
                     PASVDALSKFFPKRLKTDIADISGVVPSALGESEDEILARCQEFWRNFIPQLEKVQPQ
                     VENLLIVTHAATKIALIMSLLGYNSVRDNLKPKDRVDSYETIQTGSCSLSKLTLNSSQ
                     WELKMNGMTDFLTNGTEMNWNFTSGFEAGSDEDIASRKAAAEKAEAKKKLEETSDDEY
                     EDVYFTLELPSSRHSTLANPFDVPLAPKARKKRSEPKTERGDQGGEDDDSEEGKEDPD
                     VVFQKQLETSLMSNIEPTSVLQMSGLETSKPLIQINESIFQGRWVKVNGTEMIYDDSG
                     ELVAKVDDRIQLTAGKLKRKEENPDVTADQEMSDLRIKSEKGTTFLSEVLNLADHVDE
                     EHRQNERADTP"
     gene            <756739..>757410
                     /locus_tag="PAS_chr4_0378"
                     /db_xref="GeneID:8200662"
     mRNA            <756739..>757410
                     /locus_tag="PAS_chr4_0378"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493756.1"
                     /db_xref="GeneID:8200662"
     CDS             756739..757410
                     /locus_tag="PAS_chr4_0378"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493801.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0378"
                     /db_xref="EnsemblGenomes-Tr:CAY71622"
                     /db_xref="GeneID:8200662"
                     /db_xref="GOA:C4R7P7"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:C4R7P7"
                     /translation="MTEIAPFNHPVYEALKGKRFVLASTSPRRLEILNSLGFTDVEII
                     ASNFPEDLDKSQHTPENYVLNTAIAKGRDVFEAIKNKGESVDLILAADTVVEVNGTLF
                     EKPRNREEHFNAIKTCRDSPHPVRAISGVVLLIVKGEGSSMKYTQETFTESTEIIMDK
                     DATDAMIDAYINTGEGSKVAGGFKIQGFGALFMKGVIGDYMNVVGLPFTSTFRTICHG
                     LDVSL"
     gene            <757528..>758235
                     /locus_tag="PAS_chr4_0952"
                     /db_xref="GeneID:8200663"
     mRNA            <757528..>758235
                     /locus_tag="PAS_chr4_0952"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493757.1"
                     /db_xref="GeneID:8200663"
     CDS             757528..758235
                     /locus_tag="PAS_chr4_0952"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493802.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0952"
                     /db_xref="EnsemblGenomes-Tr:CAY71623"
                     /db_xref="GeneID:8200663"
                     /db_xref="GOA:C4R7P8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C4R7P8"
                     /translation="MAKRTSRSKSNGSSKATKEEHFELPSSSDSENEDFNEPAPKKAH
                     RAQQKKGAKSTSQNERSHTVRKDIKPSAEEENKPEISSKSVLYVGNIPNGFHEVEMRR
                     YFSQFGDITRLRLSRNKITANSKHYGYIEFATKRAGQVAAETMNNYLLLGNLLKVEVL
                     PKEKIHPQLFKGANQKFVRLPWNTINQLENDRPKTLEGWKEFEKAVKAKRAEKQAKLK
                     ELGINFDLNKLLKSTTA"
     gene            <758560..>758937
                     /locus_tag="PAS_chr4_0953"
                     /db_xref="GeneID:8200985"
     mRNA            <758560..>758937
                     /locus_tag="PAS_chr4_0953"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493758.1"
                     /db_xref="GeneID:8200985"
     CDS             758560..758937
                     /locus_tag="PAS_chr4_0953"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493803.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0953"
                     /db_xref="EnsemblGenomes-Tr:CAY71624"
                     /db_xref="GeneID:8200985"
                     /db_xref="GOA:C4R7P9"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C4R7P9"
                     /translation="MSEEEELKVFTFEEVEQHKANDDCWIVYNGKVYDVTSYIEEHPG
                     GEEVILECGGADATEPFDDIGHSEDAHEILAKLLLGRVEGAPVKASVSSASTAEDSGS
                     SNNLLLAVLVAILAGVAYYFFNQ"
     gene            <759224..>761038
                     /locus_tag="PAS_chr4_0379"
                     /db_xref="GeneID:8200986"
     mRNA            <759224..>761038
                     /locus_tag="PAS_chr4_0379"
                     /product="Probable type-III integral membrane protein of
                     unknown function"
                     /transcript_id="XM_002493759.1"
                     /db_xref="GeneID:8200986"
     CDS             759224..761038
                     /locus_tag="PAS_chr4_0379"
                     /codon_start=1
                     /product="Probable type-III integral membrane protein of
                     unknown function"
                     /protein_id="XP_002493804.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0379"
                     /db_xref="EnsemblGenomes-Tr:CAY71625"
                     /db_xref="GeneID:8200986"
                     /db_xref="GOA:C4R7Q0"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q0"
                     /translation="MSNGKRSLAEVLDTEELKVQEQNEENNLESQAENEDEVDSKFCV
                     ECSDMPTEIFCVSCSENFCKPCFGMIHRKGKRKNHKREEVLPDSNGDAPQISNMSQDI
                     TGRSGLENANGSENDEEDEIVPDSSNPEKENIEKVIMSGIKKNISYIPLRLTHQERQL
                     LRLLEASLHVSEYTDKVDILSHTSKAKRIVSQLKEMCSILAGLVVASDLKLGQELIVE
                     KEFADNAEWYQKVFEIGRRYKIMNPEKMRDTFGKLCYMVMDSKLPQIEEYLEFNLYKP
                     IQTVERYLSSRDDPQVFKMFDDESIIYATAEISPGNRSRYQINRDIKLKERSIEKIAS
                     TYSSSKGFTKEEIRQVLYSIGDFNAYTNANRKPILRMITRLSKFENLSNEYSLGIKFG
                     QGGARLSHNHQKQYQYVFQSLQLWSHIMREMIHLWSLADDDLFSPQQYHMQSTGQGLH
                     RVKACPKVSRAMYKILGECERKCNGWVGSQVVHTGDRDVPNALFFLDKYNQVPQILIP
                     IDRCIDELNEAVKDKFIKTHIESQFGSVEKLCDIILTDFFRHAFDGSGADNFYDAGSC
                     IDGRLTSAWNFVQNISKRQYYKFFMMVGCTGFNGTEGW"
     gene            <761167..>762480
                     /locus_tag="PAS_chr4_0954"
                     /db_xref="GeneID:8200664"
     mRNA            <761167..>762480
                     /locus_tag="PAS_chr4_0954"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493760.1"
                     /db_xref="GeneID:8200664"
     CDS             761167..762480
                     /locus_tag="PAS_chr4_0954"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493805.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0954"
                     /db_xref="EnsemblGenomes-Tr:CAY71626"
                     /db_xref="GeneID:8200664"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q1"
                     /translation="MTRLNRSCGLTLVALCFVGLVTADDDHDSHMDMSAPKEFHPINP
                     RSKTFHWLLSLALLFMLPSVSAAYCFANRYVVSSIMQIICACYAVFEVLVLSFPDSDG
                     VENRTSVGTGWVLAILYCVTVFFGSLTNGSEFLLRNKQSDQWLSALGHTASRRVYKTL
                     SVFVVLVGWVKVCLAPVALFGFCRGRSTGQCIAHGIMGSSFIWYGFILLLVLVIPWLR
                     LRETGYSQEFFDSLLMTAWGCVNTFTEHRWGREAWSHGDYQHTSMGIIWWCGGLLGLW
                     LTRNGERSYIPALLLMFTGYGMAEHVQKLQISTKVHSFFGLALIGGGLARIVEISFVL
                     RDKRHDSKVHSFQYLPSFALVEAGVLFMGATEEQLQLVKDLGADHSSYILVVSGAAFM
                     IQLWFLLILELYLKLATSDFASNGEYTLADEEFELSDLSPVNTHE"
     gene            <762723..>766247
                     /locus_tag="PAS_chr4_0955"
                     /db_xref="GeneID:8200987"
     mRNA            <762723..>766247
                     /locus_tag="PAS_chr4_0955"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493761.1"
                     /db_xref="GeneID:8200987"
     CDS             762723..766247
                     /locus_tag="PAS_chr4_0955"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493806.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0955"
                     /db_xref="EnsemblGenomes-Tr:CAY71627"
                     /db_xref="GeneID:8200987"
                     /db_xref="GOA:C4R7Q2"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029452"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q2"
                     /translation="MSNSKSLGIVFQSSRARNNSGNFLADDDSDDADTLEALKGKLNR
                     LRLASTQTINNTKLAEIEKSIKDIESKIDSLSLDLSNESTGLKKIDTKSTQSLVFSPL
                     DSKFEGSSPTFAISGILQEMGNQNLDNKSIIENANALVSVFQMHPYLKTELSLAPFGS
                     RIQALLLNPQSEVIVSAYRISRYILLDSGTLELFNNIRLDLFLIISLSKEAKNSMEKS
                     EALKLIRAIAEIDKNIIFININIIKSLLAILDHEEDPFYPIVLETVCEFGFLFPKLMY
                     EADSFKYIIKSLMSGTSDFSECCLLWLLEMIDTPRTRKIVLYDFDPSLLVAPFIEHRV
                     RLAEGNHRVDLKLLNHTGYLVTTFLKVLPGIYIVGQEDCNLVQNLLDCLDHRAVDVCS
                     VIINILSDVFRLEVYPHPSVSHKEDRQTSYGIASDITNHGLALLLRLFLDKGLLYKLD
                     CLTEDATIFKTRKELELFTAAKDLIVGLLVLGSNLLPENYALNEIYRSLVPLGYTDMN
                     QLPAKYELLEVQFRPDRIGSKISLKDLKIPKTCNQCPLKADDPLVLRQKLMDTNVLLE
                     KDYTKWDWGLVSQLIEGPLQNPTRLEETIKSTKFLKRIMSFYRPLKYRFSKLKRLETN
                     EKFLTIGCKLMEALIKSDEGLNYLRESDLLTQVSDCLAQETTLASSKTSNSIFSAIKI
                     RTSMTYGYFSIIGVLSRTAKSVKLLSEVGLLRLYDIITDSSAEREDLTKLILKENDYH
                     ISHTMQQILTKIAISATEKFRLFCTKLIVELLHTQEEAQEFFIEVLINQMYDPQENIA
                     NLAIQEVDNYATSKAQIEKFVETQPEPSILFKMKADSLLRKVFSISKGYNYLHDLGFI
                     DDSLKNWITKESLSFVGRVEEILKHDLFIDSYSSTKSKKILYTKVPFHLYGEMVRTEE
                     GALKLKNSGVVRNCTDFVQKFRWEKIDECDPDLLTLLKSSLWSIGFICSHHLGFRLLQ
                     SSNIVEDIIKRAETCTQINVKGVCFYVLGLIARTKEGAEILDDEGWESVFDKVNGLPI
                     GICLPTDLSKFFVTEEVEHYRKRSNTLIHEDLLSFWSGSSLQPENMIVISEICKNLIN
                     IILYPQKSINQLNKIKSRYSELFDTDPNLLLIVMALFAQYNYGLRARRFILQELFKAQ
                     ELAGMCAKRSRKKLKEKEKLYRTPPPLS"
     gene            complement(<766292..>766972)
                     /locus_tag="PAS_chr4_0380"
                     /db_xref="GeneID:8200988"
     mRNA            complement(<766292..>766972)
                     /locus_tag="PAS_chr4_0380"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493762.1"
                     /db_xref="GeneID:8200988"
     CDS             complement(766292..766972)
                     /locus_tag="PAS_chr4_0380"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493807.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0380"
                     /db_xref="EnsemblGenomes-Tr:CAY71628"
                     /db_xref="GeneID:8200988"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q3"
                     /translation="MTQRTAAEYRVLYNFLLDKYHKTEKEFKENVETEAELRHFLRYN
                     TLRNAAILDIIREVYPQDEDQDDIEDTEKQIIESILEKKPELKMLESLLDDEVDHQDS
                     TLDSLMEIQFKLSPVNTFNPDATLEQDQYLARIKNKMVVKLMKDIKMLPRNYKEQDEV
                     KETDITGYTVDTSGLKVPALDIAEQTPLTNTHYLKMTNPQIFQEDPVSKKRKLEPEED
                     IEIKKVKE"
     gene            complement(<767222..>767821)
                     /locus_tag="PAS_chr4_0381"
                     /db_xref="GeneID:8200665"
     mRNA            complement(<767222..>767821)
                     /locus_tag="PAS_chr4_0381"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493763.1"
                     /db_xref="GeneID:8200665"
     CDS             complement(767222..767821)
                     /locus_tag="PAS_chr4_0381"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493808.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0381"
                     /db_xref="EnsemblGenomes-Tr:CAY71629"
                     /db_xref="GeneID:8200665"
                     /db_xref="GOA:C4R7Q4"
                     /translation="MRILLIFFVPSGILDQLFPRISILSTLRVNLTNSPLLTPNLTLY
                     SMVNGFDFSKMFGRKDPELVSKEVKQYNERRFKQMALFYGFTVATFICSKIAYRGVIK
                     RRYVPNYYQHNHVAPPFSFYRDALSAVFHSTSLAITSLGMASTGVLWYYDISSVAEFS
                     FKLKQALGGHDKEQELKKLPEDETVQEIQNSINSYLGDR"
     gene            <768005..>769636
                     /locus_tag="PAS_chr4_0382"
                     /db_xref="GeneID:8200666"
     mRNA            <768005..>769636
                     /locus_tag="PAS_chr4_0382"
                     /product="Mitochondrial protein of unknown function"
                     /transcript_id="XM_002493764.1"
                     /db_xref="GeneID:8200666"
     CDS             768005..769636
                     /locus_tag="PAS_chr4_0382"
                     /codon_start=1
                     /product="Mitochondrial protein of unknown function"
                     /protein_id="XP_002493809.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0382"
                     /db_xref="EnsemblGenomes-Tr:CAY71630"
                     /db_xref="GeneID:8200666"
                     /db_xref="GOA:C4R7Q5"
                     /db_xref="InterPro:IPR019190"
                     /translation="MLEKGTQSLVNRTIKLRVLGGLTKKLAAPQNESLPELKPQLDVY
                     QKFLENLRAFPTKNKSVPNSPIRYSYYKIANKESEAVNRNLLELFASKKYLPFLASEI
                     PKLPPPYVAAAAPMNPKISVTQLLTDSWCELRSYYDSYACSRAAPSAAMVSGTEQHKS
                     LEDRTHKPEINVTKEIQKNFTPIMMDQLKNFERTLNLISRFIDLLTIGKAREFAVTAI
                     INKETKELIDVNNLQKLAFVHQKSPCYNDQFILASGYLDYLRSESYVNGLEKEKWIQN
                     NYSLNTLLETSIKGPLTVIDVKTRGKPIVTKSKGVLIGHRYQIGLYRKFLGLMSGENV
                     SGINSPISVDQINETAYTLLVTDSVQRGYDVDEPVDPVVGLVMLANNPWIITMLEQIC
                     VNDLLGNSLYDTFHAQQSTDYSWDLSQVNPKDFYQVLEPSLLQRTEQLFTKWKRPLSL
                     RSITALISKFYPLISKKLSQNTKIMYYTDGECFHTSNYLYNPKAINTFMEDKVKFLIG
                     QRPPRPIEKSEIPQKCGFCRFQSICEYSNLYNPVT"
     gene            complement(<769717..>770241)
                     /locus_tag="PAS_chr4_0383"
                     /db_xref="GeneID:8200667"
     mRNA            complement(<769717..>770241)
                     /locus_tag="PAS_chr4_0383"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493765.1"
                     /db_xref="GeneID:8200667"
     CDS             complement(769717..770241)
                     /locus_tag="PAS_chr4_0383"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493810.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0383"
                     /db_xref="EnsemblGenomes-Tr:CAY71631"
                     /db_xref="GeneID:8200667"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q6"
                     /translation="MGLRLDNSDSDSDDATQHRTKRVRISESGDYVLPYSNNPITANN
                     SNTSNESPANIPEQSPPVRNQMTDIMSFAYLHDNSIFVQRLQEPAELRRSNAIRFRHL
                     LRPPLIFRRTDEVNLGPESFDNIFMSEKNNDSTDLQEQREEINLKAIEHGKNKFGQRL
                     ASGVVKNAGVKRTR"
     gene            complement(<770764..>771966)
                     /locus_tag="PAS_chr4_0384"
                     /db_xref="GeneID:8200668"
     mRNA            complement(<770764..>771966)
                     /locus_tag="PAS_chr4_0384"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493766.1"
                     /db_xref="GeneID:8200668"
     CDS             complement(770764..771966)
                     /locus_tag="PAS_chr4_0384"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493811.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0384"
                     /db_xref="EnsemblGenomes-Tr:CAY71632"
                     /db_xref="GeneID:8200668"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q7"
                     /translation="MKFTTLISVALLPILSLATSEFHFTNTSSTNLISANPNSLTEST
                     VCESCTTDVTVTETSASTITALSSSGSSSSGLGGIAPVVTEHPESGFTTSTYLTTSCN
                     LAGCSTLTTEIIGELYTTTVNGREVTLTRYRPKQTSTPAPHATTVPVTEQSTVTLTTT
                     SCKEDKCSVVTGEFISTEVVSTVSGNLVTLTSFIPCETTTESKAAPSTVTLTTTTCES
                     DKCKPVTSKYIASKIVSTVNSKLVTLTSFIPCETETTKTPETSKVSKTTYTTKIHGVE
                     TVVTTICPETETTKTPEPPKTKTTETSKPVVPETTIDVVPSSKTVEYIETPKVSTVVY
                     VSSVSSTPVTFTTHRSFTTPGIVVVSTDTPSTTPQIIVNTVNAARANLVPLGSGFVAG
                     VLGAIMMI"
     gene            <772871..>773860
                     /locus_tag="PAS_chr4_0385"
                     /db_xref="GeneID:8200669"
     mRNA            <772871..>773860
                     /locus_tag="PAS_chr4_0385"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493767.1"
                     /db_xref="GeneID:8200669"
     CDS             772871..773860
                     /locus_tag="PAS_chr4_0385"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493812.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0385"
                     /db_xref="EnsemblGenomes-Tr:CAY71633"
                     /db_xref="GeneID:8200669"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q8"
                     /translation="MGTCMSRPVIEDVNIESDAGDQYTLNTVIIHRSPSQPIEVPSAK
                     IQPTKINRLPFPDTVKLAMSVKDSSLADLSYSPNLQAEQINNENDMPQETTSLARKLK
                     ELTLRNKAKRKVRNSDLFGLKVIPNLNTTVTTQPLQELSNSYGNESPSRGTRRNSIEE
                     HVIPSKETTVHIPERLTDTVRESNQGTKLPILQPQNSLTSLFHPREELERPGIKVYNR
                     SVESFCDYPKLTDKRNMSHLKRCKTEGSLATSNSIPLVISKIVSIGSQLFYDRGSSKK
                     DDLSETTISECSPSPIGDTQLKDEVPRIAPISPYDEFLNNPTEFTCRDCNSSV"
     gene            complement(<773857..>775206)
                     /locus_tag="PAS_chr4_0386"
                     /db_xref="GeneID:8200670"
     mRNA            complement(<773857..>775206)
                     /locus_tag="PAS_chr4_0386"
                     /product="Gamma subunit of the translation initiation
                     factor eIF2B"
                     /transcript_id="XM_002493768.1"
                     /db_xref="GeneID:8200670"
     CDS             complement(773857..775206)
                     /locus_tag="PAS_chr4_0386"
                     /codon_start=1
                     /product="Gamma subunit of the translation initiation
                     factor eIF2B"
                     /protein_id="XP_002493813.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0386"
                     /db_xref="EnsemblGenomes-Tr:CAY71634"
                     /db_xref="GeneID:8200670"
                     /db_xref="GOA:C4R7Q9"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR025877"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C4R7Q9"
                     /translation="MEFQAIICCGKGARLSPISAIKPTGVPKPLLPVAQKPMIEYALE
                     WCDKAPFKEVIVVTDSSSFNQVNQVVKNYAKNRNKDIVPFTSVECLSMDAETTGEVIH
                     LLRDRLTSDFVLLPCDFITDLPPQVLIEAYRNRADSDIAMAFYHHNPFENVEKTFLKT
                     NYTIYSEEEDGHFSLLDLHSKTSVELNKALEIRTHMAWRYPRAIVSSKLLESFIYFCS
                     HKIMQISEGGISASKSSTKIMRDFARRSWRHRQTRETVGMFIMPREATFARCNNIPVY
                     TEANRWFMKLQAKNNQGAQVSKEKGAAVIGADASVGNNTEIGERTNVKRSVVGNNCKV
                     GMRCRLTGCIILDNVTIADDVTLENCIVGLGATVNTKARLTNCNIEGGFVAPKGLQAK
                     GENLMSLSLDGLIHEEALSESGYSDLYSDDDGDEAMDDEEEEEYEDEFSEDDGLFDR"
     gene            <775381..>776631
                     /locus_tag="PAS_chr4_0387"
                     /db_xref="GeneID:8200671"
     mRNA            <775381..>776631
                     /locus_tag="PAS_chr4_0387"
                     /product="One of six ATPases of the 19S regulatory
                     particle of the 26S proteasome"
                     /transcript_id="XM_002493769.1"
                     /db_xref="GeneID:8200671"
     CDS             775381..776631
                     /locus_tag="PAS_chr4_0387"
                     /codon_start=1
                     /product="One of six ATPases of the 19S regulatory
                     particle of the 26S proteasome"
                     /protein_id="XP_002493814.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0387"
                     /db_xref="EnsemblGenomes-Tr:CAY71635"
                     /db_xref="GeneID:8200671"
                     /db_xref="GOA:C4R7R0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7R0"
                     /translation="MSEEQDPLLAALNENDARGDAETQQAPVDEERERALIQFKNKLL
                     EHRDWESKLREMRLGIRGLEKDFQKTEDDIKALQSVGQLIGEVLKQLTEEKFIVKTSA
                     GPRYIVGCRSTINRESLKQGVRVALDMTTLTIMRILPREVDPLVYNMTTFEPGEISFG
                     GVGGLSEQIRELREVIELPLKNPELFLRVGIKPPKGVLLYGPPGTGKTLLAKAVAATI
                     GANFIFSPASAIVDKYIGESARLIREMFSYAKEHEPCIIFMDEVDAIGGRRFSEGTSA
                     DREIQRTLMELLNQMDGFDYLGQTKVIMATNRPDTLDPALLRAGRLDRKIEIPLPNES
                     GRLEVFKIHTANVKKHGEFDFEAVVKMSDGFNGADIRNVVTEAGFFAIREDRDYIQQN
                     DLLKAVRKVVETKKLEGKLEYEKL"
     gene            complement(<776764..>777696)
                     /locus_tag="PAS_chr4_0956"
                     /db_xref="GeneID:8200672"
     mRNA            complement(<776764..>777696)
                     /locus_tag="PAS_chr4_0956"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493770.1"
                     /db_xref="GeneID:8200672"
     CDS             complement(776764..777696)
                     /locus_tag="PAS_chr4_0956"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493815.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0956"
                     /db_xref="EnsemblGenomes-Tr:CAY71636"
                     /db_xref="GeneID:8200672"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:C4R7R1"
                     /translation="MSRLLKESKRYGANMKRLHPLVKAHFDNINRKGQIPAVRNDLPA
                     VREEKQFKSLEDWKYTVGDKVMIVKGALKGTVTSIIRTQKETNGFMLEDGPTKEVVIP
                     PNYWLQSESSHVVEYPKVVTSEYFKLVGTIKDETSGESRQIAANDVVFRGKYWDEDYK
                     KMMPYRCIKNKEEYIIPWPRPDKPEDDKFCTEEAVALERTYEPVSIFESDIPSDLNLR
                     DPLAKRKSRFERKQQLLTKKDLKLLQSPAMPYSDTKKAFFRERAEIRSKQITEMSAEV
                     ADFIGKRVADHLNKIKDPYMWQYIKKVSGDRKKR"
     gene            complement(<777873..>778578)
                     /locus_tag="PAS_chr4_0388"
                     /db_xref="GeneID:8200989"
     mRNA            complement(join(<777873..778026,778178..778434,
                     778504..>778578))
                     /locus_tag="PAS_chr4_0388"
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /transcript_id="XM_002493771.1"
                     /db_xref="GeneID:8200989"
     CDS             complement(join(777873..778026,778178..778434,
                     778504..778578))
                     /locus_tag="PAS_chr4_0388"
                     /codon_start=1
                     /product="Mitochondrial ribosomal protein of the large
                     subunit"
                     /protein_id="XP_002493816.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0388"
                     /db_xref="EnsemblGenomes-Tr:CAY71637"
                     /db_xref="GeneID:8200989"
                     /db_xref="GOA:C4R7R2"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:C4R7R2"
                     /translation="MNTQRGNRPMKFELLNEQKQEIREAFSLFDMNNDGYLDYHELKV
                     ALKALGFDLPKREVLEIIHTYDTDNKKLISYDDFFGVVGDKISKRDPLDEIRRAFRLF
                     DDDGTGKISLKNLRRVAKELGENLTDEELRAMIDEFDLDEDGESKYLQQPTDPLIAIT
                     Y"
     gene            <778720..>781380
                     /locus_tag="PAS_chr4_0389"
                     /db_xref="GeneID:8200673"
     mRNA            <778720..>781380
                     /locus_tag="PAS_chr4_0389"
                     /product="Large subunit of the dynactin complex"
                     /transcript_id="XM_002493772.1"
                     /db_xref="GeneID:8200673"
     CDS             778720..781380
                     /locus_tag="PAS_chr4_0389"
                     /codon_start=1
                     /product="Large subunit of the dynactin complex"
                     /protein_id="XP_002493817.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0389"
                     /db_xref="EnsemblGenomes-Tr:CAY71638"
                     /db_xref="GeneID:8200673"
                     /db_xref="GOA:C4R7R3"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR027663"
                     /db_xref="UniProtKB/TrEMBL:C4R7R3"
                     /translation="MKVGERIQVKGVDGVVRFKGQTQFADGEWVGVELDQPTGKNNGS
                     VQGVQYFTIGKPDANDTTNLYGIFVRSTILEAPDNSRLKQIVSKLQEKLQRYKATQLD
                     HLKEINDLKERNKELQSELEEVQIQLEMDFVDKELLEEKNRDLTIRLEEITDQFTDLQ
                     KDNNLLQEELQLNNDLESEQSGLDEETNHDALLKKVKKFELALLQLKKVSSANESQYI
                     KRIAQLEEKLSTLSSIEIKYEDALAALSESQEKVNDLKNNLESFDNSEEVIERLIQQN
                     VDLQEKVTTLQESISELEQLEKLDKDLEENYLQMENDLTTEIYNLKTEKETLAAKLSL
                     LEKENKALTEVIETKSTTKSRINANSSEVFGNREKDSLLHTISDLKAKLYKLNDECVG
                     HKLSSIFQDLTRQEFESMNRVMKLFLPADEDFSLNTLKLVSTLMKYARLFSILTEEEL
                     SPVILNHDIVFSRLTVENFSLIKELEIMFRIDCIYYSVNSSFLPDISAKQISDSLSQL
                     LELLKNSDIKELQAVLLQTKKLWEPFSVIKKDNEEQNILITHLQTTHRLSQVYLRNVQ
                     KARNMIAQIKSVSSNSQLSKIAQFHLHTSLQILDSVEDRILSVYNEFLPNHFPSQIKT
                     INEEIATDKSTTQALQGLVDKVTILDLKGSDNLDEMVNSFLESLNLDNLRTLEKFVQE
                     WKPVDLGVELEATWLNQAKLVRESWSQLSGISELKESLSQLTSEMNNKEQTIEYLELK
                     VALSEQKFKLLVKQHEEEMEDIKSSHELELQSEKLNRNSNYLDSVPETFGGKEYLEQT
                     AQFKQTLDNLTDLYCSDEVLVCPDIKIPNYKIPTKYMEEIKHIGSLRDELMANKFGVL
                     RIADNKDSFGYKVRLLKETYGEILERYAQY"
     gene            <782419..>784008
                     /locus_tag="PAS_chr4_0390"
                     /db_xref="GeneID:8200674"
     mRNA            <782419..>784008
                     /locus_tag="PAS_chr4_0390"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493773.1"
                     /db_xref="GeneID:8200674"
     CDS             782419..784008
                     /locus_tag="PAS_chr4_0390"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493818.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0390"
                     /db_xref="EnsemblGenomes-Tr:CAY71639"
                     /db_xref="GeneID:8200674"
                     /db_xref="GOA:C4R7R4"
                     /db_xref="InterPro:IPR024758"
                     /db_xref="UniProtKB/TrEMBL:C4R7R4"
                     /translation="MSVNLEEARSSLKPPRSKDSKAESIQARTKTGTLIQHFNSVDPT
                     ELESHLPSQSMSSPIVNESPRKKTLTRNSASAKKTDKKEKSLFSRIKEVTRSNSKTNL
                     KREASKSNIFSLGKNKNNNEAPSKVVTPEQKKVSSAEEDENSNANKELLFEHPKCQML
                     LYEGNIDRRTPGNASARKGKTVGQGKFKIYKMLKDAPYMKCGHVVYPLLPKLRIIRIA
                     MNQFIFPIHNPERYRQLVINSDDGEVLDKLELTFSQLCQYSTLFFPVPAYSEKSDDDN
                     DATEIIYDNEEDVNLNVSGDIKDFNIIKISSSTPKKLERDLSISSDMACLSEQKDQIE
                     KSQMKRVQESKVTKLNQEYSNSTLSSLEEELNMFEGQQAPTLTTIGVSQQTAETATYV
                     SAASTLKKDSSLENSFTDTAQQTDQLDESSRIQEQDSTTMDESVDTTTGFESTVLSFD
                     SLNGEKFSSTLRDYLSSQRSASTIVSAGDSSDGRTLRQYGSTLSLDKTYVYDLLRGNR
                     TKEILDLQFSSHPSIIGKIWH"
     gene            <784238..>785407
                     /locus_tag="PAS_chr4_0391"
                     /db_xref="GeneID:8200675"
     mRNA            <784238..>785407
                     /locus_tag="PAS_chr4_0391"
                     /product="Component of the TOM (translocase of outer
                     membrane) complex"
                     /transcript_id="XM_002493774.1"
                     /db_xref="GeneID:8200675"
     CDS             784238..785407
                     /locus_tag="PAS_chr4_0391"
                     /codon_start=1
                     /product="Component of the TOM (translocase of outer
                     membrane) complex"
                     /protein_id="XP_002493819.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0391"
                     /db_xref="EnsemblGenomes-Tr:CAY71640"
                     /db_xref="GeneID:8200675"
                     /db_xref="GOA:C4R7R5"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:C4R7R5"
                     /translation="MSTPNPSPLGTDISKLAIPTLPGNFPPETQKSGFWSSNPIFYYL
                     NNVYSSVSEHRQSLNLVNPGVFENLTKEVSRDVFLNQYFFTGLRADLNKAFIMNPVFQ
                     ISHALSIGSEQIPPYAFSALYANDNLFLQGNLDNNFSLSGRLHYGWDKHNITKATLQI
                     VKDQPTMAQLEQDYQGNDFSFNFKALNPSILDGRFTGVAVGSLLQALTPKLAVGLESV
                     YSVQHPSYPAEAAVSYVARYNNTNWIATAQLQAQGSLSTSFWRKVTENVEAGIETNLQ
                     ATMKPLTDPIMGAPVGFQPVIEGTTTLGAKYEFRQSVFRGQIDSQGKVACFLEKRILP
                     TVSILFSGELNHFDNTSKLGLGLQLESAGSEELMKMQQGLIDQNGNPIPGAPQTL"
     gene            complement(<785433..>786053)
                     /locus_tag="PAS_chr4_0957"
                     /db_xref="GeneID:8200676"
     mRNA            complement(<785433..>786053)
                     /locus_tag="PAS_chr4_0957"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493775.1"
                     /db_xref="GeneID:8200676"
     CDS             complement(785433..786053)
                     /locus_tag="PAS_chr4_0957"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493820.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0957"
                     /db_xref="EnsemblGenomes-Tr:CAY71641"
                     /db_xref="GeneID:8200676"
                     /db_xref="GOA:C4R7R6"
                     /db_xref="InterPro:IPR011425"
                     /db_xref="UniProtKB/TrEMBL:C4R7R6"
                     /translation="MDRLTLVNKEDTSDKEVLACFRLADVLELCYSGCLIQDRAVNWN
                     KKSTLSGSFQMFTSQVKIPSKLGTPYEIEKDFTSVEGSIRSTESEPATVDIDEETRLR
                     VDQLEKEHIALTEIRKVELLPLLLDLIEELKLGKIEPKDFDNAAGRIRAQISKIRGLL
                     DNVEGLSESSESRINKLRELDEKITRKRQELLDFREMVMKRDHTVK"
     gene            <786069..>787031
                     /locus_tag="PAS_chr4_0392"
                     /db_xref="GeneID:8200990"
     mRNA            <786069..>787031
                     /locus_tag="PAS_chr4_0392"
                     /product="Protein with similarity to oxidoreductases,
                     found in lipid particles"
                     /transcript_id="XM_002493776.1"
                     /db_xref="GeneID:8200990"
     CDS             786069..787031
                     /locus_tag="PAS_chr4_0392"
                     /codon_start=1
                     /product="Protein with similarity to oxidoreductases,
                     found in lipid particles"
                     /protein_id="XP_002493821.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0392"
                     /db_xref="EnsemblGenomes-Tr:CAY71642"
                     /db_xref="GeneID:8200990"
                     /db_xref="GOA:C4R7R7"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R7R7"
                     /translation="MSLENPNLLPYFNPKKERRVAFITGANSGIGQMTTLHLYMHGYI
                     VYMAGRSKARVDQAIKFVQKEARHRRWLPDQTFGELKYIHLDLMNLKSVERAVVEFKT
                     QEKVLHLLINNAGVMALPFYLSGDKFEVQMQTDYVAPFLLTQRLVPLMETVSDPRIIY
                     LSSIGHNFCFRRFSPDSQFVYWPNIIFTWFRYGLAKTAGILYMKTLAIQHPNILCLSV
                     HPGFVMNTNLFSHFTRLPLIGTFFWLAFQVFGWIFGVSNEDGSYSTVNCALSPKLSAS
                     SDNGKYFTTYGIETTPNRVARDLQYGKILWDWTQQELLKRGYNT"
     gene            complement(<787061..>790457)
                     /locus_tag="PAS_chr4_0393"
                     /db_xref="GeneID:8200677"
     mRNA            complement(join(<787061..790315,790419..>790457))
                     /locus_tag="PAS_chr4_0393"
                     /product="Cytosolic leucyl tRNA synthetase, ligates
                     leucine to the appropriate tRNA"
                     /transcript_id="XM_002493777.1"
                     /db_xref="GeneID:8200677"
     CDS             complement(join(787061..790315,790419..790457))
                     /locus_tag="PAS_chr4_0393"
                     /codon_start=1
                     /product="Cytosolic leucyl tRNA synthetase, ligates
                     leucine to the appropriate tRNA"
                     /protein_id="XP_002493822.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0393"
                     /db_xref="EnsemblGenomes-Tr:CAY71643"
                     /db_xref="GeneID:8200677"
                     /db_xref="GOA:C4R7R8"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C4R7R8"
                     /translation="MSAPESKTIVLENTSRRDALIEIEKKYQKIWQDEKVFEVDAPTF
                     EEEPYGIDSDELHRRRPKHFSSMAYPYMNGVLHAGHGFTLSKVEFANGFERMTGKKSL
                     FPLGFHCTGMPISAAADKLAREIEQFGEDFSRFPADAEEEEEPAPKEVKQRDDLSKFS
                     AKKSKVVAKQGRSKFQFEILQQLGIPDEEIPKFADPYYWLTYFPPLCQNDVTSFGARV
                     DWRRSMITTDLNPYYDAFVRWQMNKLKEDGKIKFGKRYTIYSEKDGQPCMDHDRQSGE
                     GVTPQEYTCIKIKITEFAPEAQGYLKQKNFDFASNEIFLVAATLRPETMYGQTCCFVS
                     KKIDYGIFEAAQGQFYICTERAFKNMSFQGLTPQRGYYKPVVQINGSVLIGSKITAPL
                     AAEKELRILPMDTILPNKGTGVVTCVPSDSPDDYINTRDLAHKSEYYGIKKEWVIEDF
                     VALIRTEKYGDKCAEYLVNELKIKSPKDAVQLAKAKELAYKEGFYNGIMIYGKFTGEK
                     VENAKRLVRDQMLEENTAFVYNEPEGVVMSRSGDECVVSLEDQWYLDYGEESWKALAL
                     ECLDNMNLFSPETEHAFEGVLNWLKNWAVSRTYGLGTRIPWDKKYLVESLSDSTVYHS
                     FYTFCHLLHSDYYGKEVGPLGITADQMTDDVFDYIFCRTEEIKSDIPAENLKKLRREF
                     EYFYPLDISISGKDLIPNHLTFCIYVHTALFPKRFWPKGIRANGHLMLNNAKMSKSTG
                     NFMTLHQIVEKFGADAARIALADAGDTTEDANLDESNANAAILRLFTFKEWAEEIVKN
                     ADSLRSGPIEKFFDVAFENEMNRLIEETYEQYSLTNFKSALKYGLFDYQTARDYYRES
                     VGAGNMHRDLVLRYIETQVLMLAPVAPHFAEYIYREVLQNKGSVQFAAFPRASKPVAV
                     SVTSALEYVKDLQRSIREVEGAGLKKKKGKQELDPSKPVKVTLYVASTFPEWQTQFIE
                     LVREAFEQQTLDDTKSLREKIEPKEIKRAMPFISILKQRLQQESPEVVFNREASFNEE
                     ETIKSVLHNLKRSPAILKVEQFQVISFKPGSKIGKDIETGGDIEITATGKVVDSAVPG
                     EPGISIKNL"
     gene            complement(<790655..>792451)
                     /locus_tag="PAS_chr4_0394"
                     /db_xref="GeneID:8200678"
     mRNA            complement(<790655..>792451)
                     /locus_tag="PAS_chr4_0394"
                     /product="Poly(A)RNA binding protein involved in nuclear
                     mRNA export"
                     /transcript_id="XM_002493778.1"
                     /db_xref="GeneID:8200678"
     CDS             complement(790655..792451)
                     /locus_tag="PAS_chr4_0394"
                     /codon_start=1
                     /product="Poly(A)RNA binding protein involved in nuclear
                     mRNA export"
                     /protein_id="XP_002493823.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0394"
                     /db_xref="EnsemblGenomes-Tr:CAY71644"
                     /db_xref="GeneID:8200678"
                     /db_xref="GOA:C4R7R9"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="InterPro:IPR005637"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:C4R7R9"
                     /translation="MSYRGRGRGGYGRNQFNGGNNYSSHQSFAAQPSFTVEIRNWNNA
                     SKDDLVSFIARKTRIKLQNVIVDHTGTIQATVNTQKDATDLVNWNGVKFAGQSLKITA
                     NTSTNGNGNAGSPDTARTIQLLKQFLLSRYNAEIRFLDLTNMVNDPTLVSQGLFSSAS
                     TSSKMFPALMKLASQENLQVDTISMANNNINDSNTYLSILGSTFPRVKNLSLQDNNIQ
                     KVRFFENCRHKFTRLRELVIMNNPLTTQSMDRNYRSEVIRHFPRLIMLDGEYVRDENK
                     VSTIFKFPAPTVSMFFENETTQGVATNFLTNYLKLWDSARDQLLQLYAPESQFSFQID
                     TAHPSPDPTGNSTVPSGNSWSYYLSNSRNLTRISNEKSRMSRLAVGQEQILRLFNCLP
                     MTSHKLLEKIDQFAIESWSFPQLNGIIVSLHGEFEETAAPVQPVQSGVRSHYKGQRSS
                     LSKRSFDRTFVIVFGPNGAMIVASDLLLIRPHIPTNAWVVTKRNQEAAVGTTPSAAGS
                     TEISRTSTPLTHPAVHPEVPNTQPQPTSQLLNTNLTPQQQELAHKVLMETKLNPEFTL
                     MLCEQSHWNYEAAIQAFRSSHQQGQIPPHAFT"
     gene            <792686..>794680
                     /locus_tag="PAS_chr4_0395"
                     /db_xref="GeneID:8200679"
     mRNA            <792686..>794680
                     /locus_tag="PAS_chr4_0395"
                     /product="Essential subunit of Sec63 complex (Sec63p,
                     Sec62p, Sec66p and Sec72p)"
                     /transcript_id="XM_002493779.1"
                     /db_xref="GeneID:8200679"
     CDS             792686..794680
                     /locus_tag="PAS_chr4_0395"
                     /codon_start=1
                     /product="Essential subunit of Sec63 complex (Sec63p,
                     Sec62p, Sec66p and Sec72p)"
                     /protein_id="XP_002493824.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0395"
                     /db_xref="EnsemblGenomes-Tr:CAY71645"
                     /db_xref="GeneID:8200679"
                     /db_xref="GOA:C4R7S0"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:C4R7S0"
                     /translation="MARVEYDYDESAETWPYFVITLLAVVLVPTTISYVSKIWSRSSS
                     GRKAQVKKYATSFKASNHDQVSQLTGSKGSGNYFLFSDKTLVFLIVGWSLFLYVGYVI
                     HTTELVADANVFDPWEILNIDSSATEKQIKSVYRKLSLKFHPDKLGSLSDEEKEDVET
                     KFVLINKAYKALTDEITKENFLKYGHPDGPQSVTHGIALPKFLVDGKLASPVLVVIYI
                     SMIAIALPFVVAKWWDNVRSHTRHGLHIKTAAAFSSYIINNNPAKLINTETIIELISK
                     AEELKSATNLSSEEIEELLLAQLNRVFFDSKKELQKLKVVSLVPKLINGLVDIAATFR
                     NSELCVKAIEAQRYLIQAVNPTGCSDIEQLLQLPFVEKKEQVSKKIPVHTLGKLTTIS
                     DGEIADLVGIDKKNAAEVRSVASSIPVIKVLKAEFKIPGESVVTPQSNAHIVVKLLIK
                     SPAQKGQAKVDDEKLEEKETFESLRDPFSIVQDQPVLACLPESPYFPVTVENSEYVNG
                     WAVLLTVQRDGKLADSVDLLTRGSLSNLELSQKAYSDGEEVQVTTYKLKLNSPTPPTP
                     GDYHFKLSFKSLSYLGSDLDIPLVMKVQEPPKVEDAGVYDIEDPEEDSIAGAMATLRG
                     EKVKTADDDDDDSASDEEDLEIESDFTDINTDTEDEGEDK"
     gene            complement(<795394..>795864)
                     /locus_tag="PAS_chr4_0396"
                     /db_xref="GeneID:8200680"
     mRNA            complement(<795394..>795864)
                     /locus_tag="PAS_chr4_0396"
                     /product="Heme-binding protein involved in regulation of
                     cytochrome P450 protein Erg11p"
                     /transcript_id="XM_002493780.1"
                     /db_xref="GeneID:8200680"
     CDS             complement(795394..795864)
                     /locus_tag="PAS_chr4_0396"
                     /codon_start=1
                     /product="Heme-binding protein involved in regulation of
                     cytochrome P450 protein Erg11p"
                     /protein_id="XP_002493825.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0396"
                     /db_xref="EnsemblGenomes-Tr:CAY71646"
                     /db_xref="GeneID:8200680"
                     /db_xref="GOA:C4R7S1"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:C4R7S1"
                     /translation="MENYIIAILVIVLVGLFIKNILFAPLSTHDPLSNVQQTANAAKE
                     DEPIVEGRFTPKSLYKFNGFDTENIYIAVKRNVYDVSKARQFYGPSGPYSNFAGHDAS
                     RGLAKNSFEMDVIRSYGEPIDDLADLTPEELESLNGWESTFKSKYPVVGVLVDE"
     gene            <796040..>796606
                     /locus_tag="PAS_chr4_0397"
                     /db_xref="GeneID:8200681"
     mRNA            <796040..>796606
                     /locus_tag="PAS_chr4_0397"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002493781.1"
                     /db_xref="GeneID:8200681"
     CDS             796040..796606
                     /locus_tag="PAS_chr4_0397"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002493826.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0397"
                     /db_xref="EnsemblGenomes-Tr:CAY71647"
                     /db_xref="GeneID:8200681"
                     /db_xref="InterPro:IPR018815"
                     /db_xref="UniProtKB/TrEMBL:C4R7S2"
                     /translation="MAFISAANFTYIRLGYLLTLSFLLLKDPVYLVHYPMIILLTRAM
                     NLPELEMDELNPIFGLISVLILLYAVHDLIPLLEGNVVYFRSIVPVRVSLFLILIFYC
                     YVGSSYYLCNGLIFSFLFMEIWFNFFLYSLLNEEKEKESQQESISAKVIQDQILRGDR
                     DDVEEIINELGEQEFENIMSDLKERGSQ"
     gene            complement(<796614..>797438)
                     /locus_tag="PAS_chr4_0398"
                     /db_xref="GeneID:8200682"
     mRNA            complement(<796614..>797438)
                     /locus_tag="PAS_chr4_0398"
                     /product="Delta 1-pyrroline-5-carboxylate reductase,
                     catalyzes the last step in proline biosynthesis"
                     /transcript_id="XM_002493782.1"
                     /db_xref="GeneID:8200682"
     CDS             complement(796614..797438)
                     /locus_tag="PAS_chr4_0398"
                     /codon_start=1
                     /product="Delta 1-pyrroline-5-carboxylate reductase,
                     catalyzes the last step in proline biosynthesis"
                     /protein_id="XP_002493827.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0398"
                     /db_xref="EnsemblGenomes-Tr:CAY71648"
                     /db_xref="GeneID:8200682"
                     /db_xref="GOA:C4R7S3"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:C4R7S3"
                     /translation="MSSIGNEYTITILGCGVMGTAVLSAILNSEFSPYPSRIICCTGS
                     QKSAEKLASTYSKIETSYGSEQNIRAVKESDIIILGCKPFYCEQIMEQVKEGLHDQLL
                     ISLLAGWTLTQLERYSKYVARVMTNTPAKFGCGMACVSLSSHAEQYEDLVLKLVGPVG
                     KAIRLPEKNMDAATALVGSGPAFCLLMMESLIDGAVQKGLPFAIAKDAAAKVMEGTAR
                     MVLETGEHPAALKSAVCTPGGTTIGGLMAMEDRGVRSGIARGVEEAANIATSLGKK"
     gene            complement(<797604..>799730)
                     /locus_tag="PAS_chr4_0399"
                     /db_xref="GeneID:8200683"
     mRNA            complement(<797604..>799730)
                     /locus_tag="PAS_chr4_0399"
                     /product="Ferric reductase and cupric reductase"
                     /transcript_id="XM_002493783.1"
                     /db_xref="GeneID:8200683"
     CDS             complement(797604..799730)
                     /locus_tag="PAS_chr4_0399"
                     /codon_start=1
                     /product="Ferric reductase and cupric reductase"
                     /protein_id="XP_002493828.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0399"
                     /db_xref="EnsemblGenomes-Tr:CAY71649"
                     /db_xref="GeneID:8200683"
                     /db_xref="GOA:C4R7S4"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:C4R7S4"
                     /translation="MRNHLNDLVVLFLLLTVAAQAHLVTFHSTEELKFDSCKKSVEEV
                     ATFCSNSTLDSKFVCMCQTKPYLQTVLYCAENYASLSHSAIEKEALDRCPKLNSTSIQ
                     KTLESLSSVTFIDIDSDTSFSKKKLVTSPIKGQKYAKWQKMYYIGSSHRYDNYKTSHY
                     LAAASVSYWLLILLLAGVCNWTRVIAPKLAQSPALNNKLVRQYRKYISLPTLFGYHAK
                     PVTKFKIFSGMAPTTLETTILSIFFVYCVLANGILGFSYQKNDPVFANQGTGYGRYHG
                     DRSGILLSYHLPLLFIFAGRNNLFQYVTKWPQSRFLTFHKSLARIIFCEILVHAISFT
                     VQTFSLGPQQVTKRLAANYYRWGIVGAVAAACVLIGAVHRIRQANYDLFVLVHIILVA
                     VFLAAAWIHAASQVYEQFYIACAAIWCFDRFIRLVRMFSFGMRTSKAELISNETIKLT
                     IPRNASFRSFPNAYGYVYFMTPLTFYRSHPFTVVPSEDGKHIHFFVKVKGGLTSYISK
                     RILQNDDLTCNFRICVEGPYGLSVPVHKYDTSLLIASGNGVPGPFAEAKEVAERNLKV
                     HTKLYWIIRDWHSLNWFYPQIKSLEKSNVEVVIYVTNTTSSVDKVNFYSSSSSSEASL
                     DENKQIAESKETTPQLDRLSFVEFRTGRPNLEEVLNRDISESNGTVSVLTCGHPHMCD
                     HVRDAIARNTPNYKKRVDYYESVQVW"
     gene            complement(<801336..>802757)
                     /locus_tag="PAS_chr4_0401"
                     /db_xref="GeneID:8200684"
     mRNA            complement(<801336..>802757)
                     /locus_tag="PAS_chr4_0401"
                     /product="Arginyl-tRNA-protein transferase"
                     /transcript_id="XM_002493784.1"
                     /db_xref="GeneID:8200684"
     CDS             complement(801336..802757)
                     /locus_tag="PAS_chr4_0401"
                     /codon_start=1
                     /product="Arginyl-tRNA-protein transferase"
                     /protein_id="XP_002493829.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0401"
                     /db_xref="EnsemblGenomes-Tr:CAY71650"
                     /db_xref="GeneID:8200684"
                     /db_xref="GOA:C4R7S5"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017137"
                     /db_xref="UniProtKB/TrEMBL:C4R7S5"
                     /translation="MLSLTNTYSGTSSCGYCKGKKPIQSQLPLNSSSKEPRSSKMSYS
                     ELQSIDTQIYEALLNRGHRRSGCLLYLPDNLNNCCRHFTIRTSLSMLKPTKEHRHHVN
                     RLAKYIGANIVTEGPFDLKSRLLDAELGCDSSRFYTEFESTAFSEAKYALFKKYQMVV
                     HGDKDVTEEGFKRFLCDNPFVDSKEDDELGYWKSLNSWKDPQFSSNGSEFLGGVHECY
                     YIDGKLAAIAVLDLLPNCVSSVYFIWDPEYAHLGLGTLSALRETVLAERLGKQFYYMG
                     YYIADCPKMKYKFKFGGQLLDLCNSQFIDFARLTMDSFYQGKFIVTDVDGKANKELKI
                     TSSLKPSSKNLSPLHDIAEDIYGPEGQAYKEAQLQITCLKDQYHIEFGAGKEKDTIPL
                     VCPGLIPLWQMSDLLKSGEMDNLQCLVFVYSKKAYLPITWYKVDDLKDEELVENIKRT
                     IFNLVRFLGDWKLLENSLIYDFS"
     gene            complement(<803100..>803873)
                     /locus_tag="PAS_chr4_0402"
                     /db_xref="GeneID:8200685"
     mRNA            complement(<803100..>803873)
                     /locus_tag="PAS_chr4_0402"
                     /product="Beta regulatory subunit of casein kinase 2, a
                     Ser/Thr protein kinase"
                     /transcript_id="XM_002493785.1"
                     /db_xref="GeneID:8200685"
     CDS             complement(803100..803873)
                     /locus_tag="PAS_chr4_0402"
                     /codon_start=1
                     /product="Beta regulatory subunit of casein kinase 2, a
                     Ser/Thr protein kinase"
                     /protein_id="XP_002493830.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0402"
                     /db_xref="EnsemblGenomes-Tr:CAY71651"
                     /db_xref="GeneID:8200685"
                     /db_xref="GOA:C4R7S6"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:C4R7S6"
                     /translation="MTTNRIVESDQMSQESGSDEEQPWIQEYCMMFGHEYFVEVSNEF
                     IEDDFNLTGLSSIVPFYREALDMILDYQPDYQIKSESLPIIHHSAELLYGLIHARYIL
                     TKPGLQAMAGKYEKAVFGTCLRVHCEGMYLLPIGRYDQVGIETVRLYCPSCNDIYLPS
                     SSKYLHIDGAFFGTSFAILFVNMFNEIQRRVNLIPKQIFDLKLFGFKINKIAPSGPRM
                     KWLRQYPTNSAEEEELQRCKFEIPTLETESETDVKMGSD"
     gene            <804100..>804696
                     /locus_tag="PAS_chr4_0403"
                     /db_xref="GeneID:8200686"
     mRNA            <804100..>804696
                     /locus_tag="PAS_chr4_0403"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493786.1"
                     /db_xref="GeneID:8200686"
     CDS             804100..804696
                     /locus_tag="PAS_chr4_0403"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493831.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0403"
                     /db_xref="EnsemblGenomes-Tr:CAY71652"
                     /db_xref="GeneID:8200686"
                     /db_xref="GOA:C4R7S7"
                     /db_xref="InterPro:IPR027538"
                     /db_xref="InterPro:IPR028945"
                     /translation="MDPFSILLTLTLIILAQNAVRIVGKSQIHQSIWNLYLRYSNDQQ
                     ILKLRNLKAESYDVYKQRSNTSAQDEYAKWTKLNRKYDQLQTEIKAVSDQVSQQQQAI
                     EKYLGLAISVTTTLPLWLFRFKYRKQPLFYFPKDTFPSYLEWILSFPSVPQGSIGIMF
                     WILLLNKFVSNLEFIVKTFSTKVEKPVPIVKVEDLSPK"
     gene            complement(<804762..>806801)
                     /locus_tag="PAS_chr4_0404"
                     /db_xref="GeneID:8200687"
     mRNA            complement(<804762..>806801)
                     /locus_tag="PAS_chr4_0404"
                     /product="Protein kinase"
                     /transcript_id="XM_002493787.1"
                     /db_xref="GeneID:8200687"
     CDS             complement(804762..806801)
                     /locus_tag="PAS_chr4_0404"
                     /codon_start=1
                     /product="Protein kinase"
                     /protein_id="XP_002493832.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0404"
                     /db_xref="EnsemblGenomes-Tr:CAY71653"
                     /db_xref="GeneID:8200687"
                     /db_xref="GOA:C4R7S8"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024604"
                     /db_xref="UniProtKB/TrEMBL:C4R7S8"
                     /translation="MDRSRRAGIIIPSGNRDLLKDLSRDPSNLRRSFTSLTLEGLLNA
                     PQSEVDVYSDANQNTNRDKNRFSVASEDTEFDDKENRRRSSKRFSMASTVSSSSSFKT
                     VAQKVANKITSVSVHSDSSRESTPLRSTCKPGVVGINRSSTASFSADSRRNSRISDHD
                     TDSLQTSAASKKRFSLRMTPSAESSSFVPETSTQSLRNSISMRSSLFRPRLNSFNSEQ
                     DTSSIASTATSHTLRLRKSFRSLKSKVSLESINSFDKTQISLPVPQASSKDKLKHKLK
                     NSSSILSINTIDSQETKVESIPQEEFDSYQFSHLLSLCTLSKSVVPFAKFVAARLQKQ
                     VKLVKINEESHSEIFVESCPITGSPQSVWKVIPFGKDEFDQTPIRDLIQEVSITQRLS
                     NLEGFVQLQGCVVVSGKYPKELLHCWDNYNSSINSRPDFYTENQNYLVMILNYGGTNL
                     SKAHLSSWTQVKELFWNIVKLIEKAENLYGFEHRDLHWDNIVVDGNMKPTLINYAYSR
                     IEGPHQVLFTGLSHQNFFKGRGNYQFEIYRLMRQNLKDGDPHSNNKRSSLRSSRSVSS
                     HSLSSLLKYEKHDEEVDWSQLCPQTNLLWIHYLLDKLLYNNGLKHFTLQDRRDNDEYR
                     AFVQMMIVYKSLDPRIPKKSRFKTRRKKGEWETFHDFHRTTDVLVWAGRNGLLET"
     gene            complement(<807214..>808248)
                     /locus_tag="PAS_chr4_0405"
                     /db_xref="GeneID:8200688"
     mRNA            complement(<807214..>808248)
                     /locus_tag="PAS_chr4_0405"
                     /product="Guanine nucleotide exchange factor for Gpa1p"
                     /transcript_id="XM_002493788.1"
                     /db_xref="GeneID:8200688"
     CDS             complement(807214..808248)
                     /locus_tag="PAS_chr4_0405"
                     /codon_start=1
                     /product="Guanine nucleotide exchange factor for Gpa1p"
                     /protein_id="XP_002493833.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0405"
                     /db_xref="EnsemblGenomes-Tr:CAY71654"
                     /db_xref="GeneID:8200688"
                     /db_xref="GOA:C4R7S9"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /translation="MDIEAEPSLRSIVNHESLKWIFVGGKGGVGKTTTSSSISIQLAL
                     HNPNKKYLLISTDPAHNLSDAFNQKFGKDARQVEGLPNLSCMEIDPDSTLENLQKNNE
                     STFGSAGGNDPLKSMMGDITGSIPGIDEAFSFMEVLKHIGETKENQIKYDTVIFDTAP
                     TGHTLRFLQLPSTLEKLLGKVNELSGRFGPMLNNLLGSQGGQSIDFASKIKEIQVQVT
                     EVNKQFQDPELTTFVCVCISEFLSLYETERLIQELMSYNMDVNSIVINQLLFSDDSEC
                     RRCNARWRMQKKYLDQMDELYEDYHLVKMPLLAMEVRGLENLKKFSKYLIEPYNSETD
                     GHVVFDLEEQ"
     gene            <808417..>808692
                     /locus_tag="PAS_chr4_0406"
                     /db_xref="GeneID:8200689"
     mRNA            <808417..>808692
                     /locus_tag="PAS_chr4_0406"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493789.1"
                     /db_xref="GeneID:8200689"
     CDS             808417..808692
                     /locus_tag="PAS_chr4_0406"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493834.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0406"
                     /db_xref="EnsemblGenomes-Tr:CAY71655"
                     /db_xref="GeneID:8200689"
                     /db_xref="UniProtKB/TrEMBL:C4R7T0"
                     /translation="MTMSDKANTSCDTSWTKKIRYAPKKKAVSQLATLQQTTEEKSHK
                     LLTKLNHDDNDKEILNHLTHEVQSRNVILLDKLEELNKELGWIKDRK"
     gene            <809530..>809841
                     /locus_tag="PAS_chr4_0407"
                     /db_xref="GeneID:8200690"
     mRNA            <809530..>809841
                     /locus_tag="PAS_chr4_0407"
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /transcript_id="XM_002493790.1"
                     /db_xref="GeneID:8200690"
     CDS             809530..809841
                     /locus_tag="PAS_chr4_0407"
                     /codon_start=1
                     /product="Protein of unknown function that associates with
                     ribosomes"
                     /protein_id="XP_002493835.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0407"
                     /db_xref="EnsemblGenomes-Tr:CAY71656"
                     /db_xref="GeneID:8200690"
                     /db_xref="InterPro:IPR006861"
                     /db_xref="UniProtKB/TrEMBL:C4R7T1"
                     /translation="MTRTNKWNTDHSHLHRDVEPKYFSKSGGHLDQDPSKVKKNGHGK
                     GNWGSLGDEINDIVDSEEGLGSLNKRRGSNHSFNEEKIRNIQSYKGPGAVLVDEDEET
                     E"
     gene            complement(<809886..>810902)
                     /locus_tag="PAS_chr4_0408"
                     /db_xref="GeneID:8200691"
     mRNA            complement(<809886..>810902)
                     /locus_tag="PAS_chr4_0408"
                     /product="Choline phosphate cytidylyltransferase"
                     /transcript_id="XM_002493791.1"
                     /db_xref="GeneID:8200691"
     CDS             complement(809886..810902)
                     /locus_tag="PAS_chr4_0408"
                     /codon_start=1
                     /product="Choline phosphate cytidylyltransferase"
                     /protein_id="XP_002493836.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0408"
                     /db_xref="EnsemblGenomes-Tr:CAY71657"
                     /db_xref="GeneID:8200691"
                     /db_xref="GOA:C4R7T2"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015864"
                     /db_xref="UniProtKB/TrEMBL:C4R7T2"
                     /translation="MLQARQEGTELYVGVHSDEEILKHKGPVVMKLPERVIAVEGCRW
                     CTKVVPNAPYVTDPLVMDQYGCKYVVHGDDITTDADGKDCYQICKDLGRFIVVKRTPN
                     ISTTDLVGRMLDINSHHHQGPISLNHPITDIRERVQSYASDPSGRDSYAGVYFNIEES
                     STLHEFVSPKNGYQKVVLVVGEFDLFHPGHIKFLQETQKYARSNDAKVIVGIYDDATA
                     KNANYPIMNLVERSLCVLQSKYIDGLVIGAPKVLDTAFLGKIPGNVIKVVVNASDLPS
                     QAQLLDPTLVHELSEYEYSDMTTSTIVNRVLDNRAEYEERQRKKGWKSELEQQLKQEV
                     AYNK"
     gene            <811148..>811702
                     /locus_tag="PAS_chr4_0409"
                     /db_xref="GeneID:8200692"
     mRNA            <811148..>811702
                     /locus_tag="PAS_chr4_0409"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493792.1"
                     /db_xref="GeneID:8200692"
     CDS             811148..811702
                     /locus_tag="PAS_chr4_0409"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493837.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0409"
                     /db_xref="EnsemblGenomes-Tr:CAY71658"
                     /db_xref="GeneID:8200692"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:C4R7T3"
                     /translation="MANIQEQVENIPGYDLVMGAWEDYAGDHFQTKDPYRETLPDGKT
                     RKRKLPEGATKDEKKSWKSIQRRAWIDDKCFLGCQPVDCGIGLAPVVAFFIPTLGPIV
                     IYVVHARLIKVACDQFDIGPKLEAKLHANILFDLLISLPPIIGALLAWLNGCSTRNAA
                     LIHSSVAKKIVQRQRIDGIDYHRQ"
     gene            <811878..>813266
                     /locus_tag="PAS_chr4_0410"
                     /db_xref="GeneID:8200693"
     mRNA            <811878..>813266
                     /locus_tag="PAS_chr4_0410"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493793.1"
                     /db_xref="GeneID:8200693"
     CDS             811878..813266
                     /locus_tag="PAS_chr4_0410"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493838.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0410"
                     /db_xref="EnsemblGenomes-Tr:CAY71659"
                     /db_xref="GeneID:8200693"
                     /db_xref="UniProtKB/TrEMBL:C4R7T4"
                     /translation="MSTDSNLGYGISISGGSRSTQSLGTSRVTPSRSANHEGKENKAF
                     SMISPKKLINKLSKSSVSSNNTSSSNHDSFVDRKYKIEIENSFSDRSVSEVDLLEDSL
                     DTTEGDSGENLVSTPTQVTLRPKRGNSQDRNENRVLKEKETAVRESQRHTGFFTESML
                     SPSDGSRQDTSDSPGSISIPTAELSKKNLSDVSKSTSENSHNRKWEARSSLLPENLSS
                     IHLDDSPIEIYEDAEEIIDETVEEPRSSIPLQNEWEMEDTILEGRLVQSASDPVITSN
                     DISKELRKSISTPALTHSDLVDFRKVIPGSSHYHVFTDPKSPFTEDPSQLAYHKIRDR
                     NFDAHYSTDPIRLSSGSSSEGSDEKNLLLGSRKPSDPYRLPYEDEDGYRFWTKTPLNR
                     ECPKRVALWLLVGAILAPPVWIMMYVGFLDSSVGRLPPKYRVISGVLALSMIILTAMG
                     IAVGFAYGLNNR"
     gene            <813508..>814953
                     /locus_tag="PAS_chr4_0411"
                     /db_xref="GeneID:8200694"
     mRNA            <813508..>814953
                     /locus_tag="PAS_chr4_0411"
                     /product="Protein of unknown function"
                     /transcript_id="XM_002493794.1"
                     /db_xref="GeneID:8200694"
     CDS             813508..814953
                     /locus_tag="PAS_chr4_0411"
                     /codon_start=1
                     /product="Protein of unknown function"
                     /protein_id="XP_002493839.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0411"
                     /db_xref="EnsemblGenomes-Tr:CAY71660"
                     /db_xref="GeneID:8200694"
                     /db_xref="UniProtKB/TrEMBL:C4R7T5"
                     /translation="MGNVPTREEASAGRRASSFSYEHRAMGHRPSHPFSPPSMDGASL
                     RKKMKGKDKDRKEKRRLKEEHAYNLIVRHTENVDGGFLAPYGTYRSNLDYDTNIVRNL
                     IIDRRIAPFYTPLQDFEDDWSDEKLLEILRSLPLHAPLTEDSLALEPEDEDDHRLHSS
                     NGSFRRKDNQKFKQTMAKKTAEWQQEAQRLQDRDRHIAKRSLGAVGNNIALDIPSDDL
                     LLLLYRRASECPICFLYYPQFFNISRCCIQPICTECFVQIKRLDPHPPHDEEGNEQLD
                     TNGEPETLISEPARCPFCASIDFGITYVPPPFRTGINAIPPSEFRSAITTIEELDENA
                     IEDDAPDSSTTTIITESKSKARAKKSYSIDPTVLLDQGRHRRNSLPPNSPSVITTDTI
                     RADWVGKLASAKSKLARRSATASAIHATSLITEEEHISNSQRRALRAARQNDEIHELE
                     ERMIEEALRLSLMENRDEVQRRRASAPESRT"
     gene            <815079..>815399
                     /locus_tag="PAS_chr4_0412"
                     /db_xref="GeneID:8200695"
     mRNA            <815079..>815399
                     /locus_tag="PAS_chr4_0412"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_002493795.1"
                     /db_xref="GeneID:8200695"
     CDS             815079..815399
                     /locus_tag="PAS_chr4_0412"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_002493840.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0412"
                     /db_xref="EnsemblGenomes-Tr:CAY71661"
                     /db_xref="GeneID:8200695"
                     /db_xref="GOA:C4R7T6"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:C4R7T6"
                     /translation="MATETALSYAALILADSEIEISSDNLLALTTKADVKVDKIYADL
                     FSKALDGKNLKDLFFNISSAPASGAAAGGAAASSADAEEAAEEKEEEAKEESDDDMGF
                     GLFD"
     gene            complement(<815730..>816410)
                     /locus_tag="PAS_chr4_0413"
                     /db_xref="GeneID:8200696"
     mRNA            complement(join(<815730..816319,816407..>816410))
                     /locus_tag="PAS_chr4_0413"
                     /product="60S ribosomal protein L13"
                     /transcript_id="XM_002493796.1"
                     /db_xref="GeneID:8200696"
     CDS             complement(join(815730..816319,816407..816410))
                     /locus_tag="PAS_chr4_0413"
                     /codon_start=1
                     /product="60S ribosomal protein L13"
                     /protein_id="XP_002493841.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0413"
                     /db_xref="EnsemblGenomes-Tr:CAY71662"
                     /db_xref="GeneID:8200696"
                     /db_xref="GOA:C4R7T7"
                     /db_xref="InterPro:IPR001380"
                     /db_xref="UniProtKB/TrEMBL:C4R7T7"
                     /translation="MAISKNLPLLKNHFRKHWQERVRVHLDQAGKRTSRRNARAAKAV
                     NLAPRPLDSLRPIVRCPTVKHNRKVRAGRGFTIEELKAVGLNANYARTVGIAVDTRRK
                     NRSEEGFELNVQRLKEYQSKLVVFKSRAEAKDAKQISLGASFPVEQPAIEVGPRAVVV
                     PEKTAFETLKQARLDQKYAGQVAKRAKEAAEAEANKK"
     gene            <816923..>817508
                     /locus_tag="PAS_chr4_0414"
                     /db_xref="GeneID:8200697"
     mRNA            join(<816923..816958,817101..>817508)
                     /locus_tag="PAS_chr4_0414"
                     /product="40S ribosomal protein S16"
                     /transcript_id="XM_002493797.1"
                     /db_xref="GeneID:8200697"
     CDS             join(816923..816958,817101..817508)
                     /locus_tag="PAS_chr4_0414"
                     /codon_start=1
                     /product="40S ribosomal protein S16"
                     /protein_id="XP_002493842.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0414"
                     /db_xref="EnsemblGenomes-Tr:CAY71663"
                     /db_xref="GeneID:8200697"
                     /db_xref="GOA:C4R7T8"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:C4R7T8"
                     /translation="MSQEAKSVQSVQTFGKKKSATAVAHVKQGSGLIKVNGSPITLVQ
                     PEILRHKVYEPLLLVGLDKFANIDIRIKVTGGGHVSQVYAIRQALAKGLIAYTQKFVD
                     ESTKNELKKIFQSYDRTLLIADSRRKEPKKFGGRGARARFQKSYR"
     gene            <818192..>819604
                     /locus_tag="PAS_chr4_0415"
                     /db_xref="GeneID:8200698"
     mRNA            <818192..>819604
                     /locus_tag="PAS_chr4_0415"
                     /product="Cytosolic serine hydroxymethyltransferase"
                     /transcript_id="XM_002493798.1"
                     /db_xref="GeneID:8200698"
     CDS             818192..819604
                     /locus_tag="PAS_chr4_0415"
                     /codon_start=1
                     /product="Cytosolic serine hydroxymethyltransferase"
                     /protein_id="XP_002493843.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0415"
                     /db_xref="EnsemblGenomes-Tr:CAY71664"
                     /db_xref="GeneID:8200698"
                     /db_xref="GOA:C4R7T9"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:C4R7T9"
                     /translation="MSHYALSPEHKQMVEGHLAETDPEVNQIIKDEVDRQKHSIVLIA
                     SENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGSR
                     WGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTDTRKISAVSTYFE
                     TMPYRVDLETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLV
                     VDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGVRSVNPKTGKEI
                     YYDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEF
                     KRLGYKLVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGDRSALVPGG
                     VRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKVQSELPIEANKLKDFKAKIAEGSD
                     EITQLKNEISAWAGEFPLSV"
     gene            complement(<819647..>820888)
                     /locus_tag="PAS_chr4_0416"
                     /db_xref="GeneID:8200699"
     mRNA            complement(<819647..>820888)
                     /locus_tag="PAS_chr4_0416"
                     /product="Alanine:glyoxylate aminotransferase (AGT),
                     catalyzes the synthesis of glycine from glyoxylate"
                     /transcript_id="XM_002493799.1"
                     /db_xref="GeneID:8200699"
     CDS             complement(819647..820888)
                     /locus_tag="PAS_chr4_0416"
                     /codon_start=1
                     /product="Alanine:glyoxylate aminotransferase (AGT),
                     catalyzes the synthesis of glycine from glyoxylate"
                     /protein_id="XP_002493844.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0416"
                     /db_xref="EnsemblGenomes-Tr:CAY71665"
                     /db_xref="GeneID:8200699"
                     /db_xref="GOA:C4R7U0"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR024169"
                     /db_xref="UniProtKB/TrEMBL:C4R7U0"
                     /translation="MIFQRHPLLISMFSKLQRFVQPIRSMSTITIPNSKQPAHRLTMI
                     PGPIEFSDDVLDAMSTPSQAHTSPDFIPVFQEVLQNTRKLFKSSNPTSQPIVISASGS
                     LGWDIVGANFLNRGEKTLVFSTGFFSDRLADALSYYTETDVDVVKAPLGESVPLSEVE
                     KALSAKSYDVVTITHVDTSSAVISDVEAIAKKIRSIQPEALVVVDAVCSAGVEDIQFD
                     NWGLDYVLTASQKAVGVPAGLSISIASERAVKKAFAKKRPTSYYANLQKWIPIMQAYE
                     HGKGAYYATPPIQLIHAYRVSLREILEQGLDNRFAKHAETSNKFKDNLESLGLKLVAK
                     REFGANGLTAVYFPKSINGPDLLKKISEKGVTLSTGIYAGIATEYFRVGHMGVSAVGK
                     DRHDVDIVFRLIKETLEELEK"
     gene            complement(<821021..>821869)
                     /locus_tag="PAS_chr4_0417"
                     /db_xref="GeneID:8200700"
     mRNA            complement(<821021..>821869)
                     /locus_tag="PAS_chr4_0417"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493800.1"
                     /db_xref="GeneID:8200700"
     CDS             complement(821021..821869)
                     /locus_tag="PAS_chr4_0417"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493845.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0417"
                     /db_xref="EnsemblGenomes-Tr:CAY71666"
                     /db_xref="GeneID:8200700"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C4R7U1"
                     /translation="MAVPFEIEPYEILGVNNEATPVEIKKSYYKLCLIHHPDKKSGSD
                     SSNDEHFQKIQFAYSILSDSKRRKRYDSTGSLDDTALDEDGFDWKEYFETMKSQPVTE
                     DLIEEDREKYKGSDEEKQDIIDALQFYEMDVPKLFEAIPHLEFDESEEERIFHLVTEL
                     VDSKQVETTNKWDKYKHNRKSFIKRQLRKLEKEAVEAEKLQKKLAKQKKADQDISTLQ
                     GLQSIIQAKQRSSNQKLDSLINKLETEEDAKVKSKRGKKRGTKRAAVPDIDEEEFQRI
                     QAKLKR"
     gene            <822075..>823100
                     /locus_tag="PAS_chr4_0418"
                     /db_xref="GeneID:8200701"
     mRNA            <822075..>823100
                     /locus_tag="PAS_chr4_0418"
                     /product="Delta-aminolevulinate dehydratase, a
                     homo-octameric enzyme"
                     /transcript_id="XM_002493801.1"
                     /db_xref="GeneID:8200701"
     CDS             822075..823100
                     /locus_tag="PAS_chr4_0418"
                     /codon_start=1
                     /product="Delta-aminolevulinate dehydratase, a
                     homo-octameric enzyme"
                     /protein_id="XP_002493846.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0418"
                     /db_xref="EnsemblGenomes-Tr:CAY71667"
                     /db_xref="GeneID:8200701"
                     /db_xref="GOA:C4R7U2"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C4R7U2"
                     /translation="MVHKAEYLDDHPTQISSILSGGYNHPLLREWQHERQLNKNMFIF
                     PLFVTDRPDEEELIPSLPNIKRFGVNKLIPYVGGLVSKGLRAVILFGVPLKPGVKDEE
                     GTAADDPEGPVIQAIKHLRKNFPDLYIITDVCLCEYTSHGHCGILYEDGTINRELSVR
                     RIAAVAVKYAQAGANSVAPSDMTDGRIRDIKEGLLSAGLAHKTFVMSYAAKFSGNLYG
                     PFRDAAGSCPSQGDRKCYQLPSGGKGLAHRALIRDMNEGTDGIIVKPSTFYLDIVADA
                     YQLCKDYPICCYQVSGEYAMLHAAAEKNIVDLKSIAFEAHQGFLRAGARLIISYFTPE
                     FLEWLSE"
     gene            complement(<823173..>825629)
                     /locus_tag="PAS_chr4_0419"
                     /db_xref="GeneID:8200702"
     mRNA            complement(<823173..>825629)
                     /locus_tag="PAS_chr4_0419"
                     /product="Putative ATPase of the AAA family"
                     /transcript_id="XM_002493802.1"
                     /db_xref="GeneID:8200702"
     CDS             complement(823173..825629)
                     /locus_tag="PAS_chr4_0419"
                     /codon_start=1
                     /product="Putative ATPase of the AAA family"
                     /protein_id="XP_002493847.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0419"
                     /db_xref="EnsemblGenomes-Tr:CAY71668"
                     /db_xref="GeneID:8200702"
                     /db_xref="GOA:C4R7U3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7U3"
                     /translation="MAKSRPIVISKDLEDKITNAISKLLDEKTERLKIKNAKNGQEEA
                     STFPVLARDLKASEILLYAQGSDFSLKRTKKFILEKAIEKVWKEIKLEESEELKGLGL
                     DEEIDKETFLAEKNLMEVVDTNSMNRSIVGLWGSGPKEDEKDEKDKSEEKSDENDANT
                     ETSDKKEKKRKGKDSEKPNKRIKSKDRTPPSLTLSQLGGLDDIITELMEVVGMPILHP
                     EIYLATGIHPPRGVLLHGPPGCGKTTIANALAGELQVPFISLSAPSVVSGMSGESEKK
                     IRGIFEEAKELAPCLIFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELSLDKTDG
                     KPVIIIGATNRPDSLDPALRRAGRFDREICINVPNELARYNIMESMMKTIKASGDLQL
                     MKLAKMTPGYVGADLKALVSAAGISAIKRIFSTLSQEQEKKFIEAMYEEEKQDEDTMD
                     IDEGITDKTRELTHLSTIQKFLLKHPHPLTEEQLAPLSITYEDFITALPTIQPTAKRE
                     GFATVPDVTWKSVGALSKTRVELHMAIVQPIKRPEIYEKVGITAPAGVLMWGPPGCGK
                     TLLAKAVANESKANFISIKGPELLNKYVGESEKAIRQVFSRARASIPCVIFFDELDAL
                     VPRRDASLSESSSRVVNTLLTELDGLNDRKGIFVIGATNRPDMIDPAMLRPGRLDKTL
                     YIELPTADERLEIMKTVIRVNGTPISSDVNLESIAHDERCRNFSGADLSSLVREAGVI
                     SLKRRFFTEINQGVEDICISDSEQIMVTPSDFETALDSVNPSVSDRDRQKYERLNRRL
                     GWSKTTGGPHGDNKDAEEDN"
     gene            <825974..>826588
                     /locus_tag="PAS_chr4_0420"
                     /db_xref="GeneID:8200703"
     mRNA            <825974..>826588
                     /locus_tag="PAS_chr4_0420"
                     /product="Myristoylated subunit of ESCRTIII"
                     /transcript_id="XM_002493803.1"
                     /db_xref="GeneID:8200703"
     CDS             825974..826588
                     /locus_tag="PAS_chr4_0420"
                     /codon_start=1
                     /product="Myristoylated subunit of ESCRTIII"
                     /protein_id="XP_002493848.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0420"
                     /db_xref="EnsemblGenomes-Tr:CAY71669"
                     /db_xref="GeneID:8200703"
                     /db_xref="GOA:C4R7U4"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C4R7U4"
                     /translation="MGNSGSKGLSEQDKAILQLKLQRDNLHKAQTRINLVIEKENQVA
                     RQLLRNGQKERAKLALRKKRYQESLIKQVFGQMDTLEQLISTIEFKLIEKDVLYGLQE
                     GNKVLGQLNNEMSLDKVDKILDESDEAIRYQEEITDLLGTRMNQADETAVEEELEALE
                     RETKKTVVLPDVPTVRVGVEDDKETRNEQKEDKPLQTQKTPVAA"
     gene            complement(<826624..>828577)
                     /locus_tag="PAS_chr4_0421"
                     /db_xref="GeneID:8200704"
     mRNA            complement(join(<826624..828494,828565..>828577))
                     /locus_tag="PAS_chr4_0421"
                     /product="Protein of unknown function, required for cell
                     growth and possibly involved in rRNA processing"
                     /transcript_id="XM_002493804.1"
                     /db_xref="GeneID:8200704"
     CDS             complement(join(826624..828494,828565..828577))
                     /locus_tag="PAS_chr4_0421"
                     /codon_start=1
                     /product="Protein of unknown function, required for cell
                     growth and possibly involved in rRNA processing"
                     /protein_id="XP_002493849.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0421"
                     /db_xref="EnsemblGenomes-Tr:CAY71670"
                     /db_xref="GeneID:8200704"
                     /db_xref="GOA:C4R7U5"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029007"
                     /db_xref="UniProtKB/TrEMBL:C4R7U5"
                     /translation="MGSKSSAFAALNHPTPTSRDDTPDLELNDSADPREEEITNGLSE
                     ESDTLNQFQIQEFLETSALEPLDTSNFTVTEENVVFGETYVRFSLKEEEYLLLGGQYE
                     LSVQKGAVIVNGISMNSGSNPVNVVAPMFKALPVIKSVHSDDASSVLSQSFQSVILVR
                     DYSTGLQNVGELLPPLRNIFSFVSSDSKKSLSPYEAKFYGHTFTPILPPQKSRTSGTL
                     ISDQWKLAMNTVTKGSRILVIGTKNSGKSTFVTNLINQLLQSTTVNVMDIDPGQPEFS
                     SQDCISLSEVDSPIFGMNMHQCKLLVEHYTGFSSPSRQPTRYISAMKALTNYYWCHLH
                     KKNLPLLINTPGWIKGFGIELLKDMCSFIKPTQVIFLTYPDSDEENELMNSLRTELFL
                     KITGVHNYNTAKSLPSHLRSLRILQYFHQISPLPRYNFTPLLHKAPYRVSFSDNALID
                     GVAISFVTILDAYELHHDDIPGALDGCVVAVYSVPATKVEDLFSSGNVSITKGLPNYV
                     SDSVFSTAFDDLYDLEGCHFFGHALIHSVDLVRKVFNVYMPKNSTPARSSDQTLILIR
                     GRTEIPIGEIAPKLICDQTDVARRNGKIIAAPYVTFHKRMGKGSKELRFRRNILRNSH
                     GAK"
     gene            <828787..>829029
                     /locus_tag="PAS_chr4_0422"
                     /db_xref="GeneID:8200705"
     mRNA            <828787..>829029
                     /locus_tag="PAS_chr4_0422"
                     /product="Subunit VIb of cytochrome c oxidase"
                     /transcript_id="XM_002493805.1"
                     /db_xref="GeneID:8200705"
     CDS             828787..829029
                     /locus_tag="PAS_chr4_0422"
                     /codon_start=1
                     /product="Subunit VIb of cytochrome c oxidase"
                     /protein_id="XP_002493850.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0422"
                     /db_xref="EnsemblGenomes-Tr:CAY71671"
                     /db_xref="GeneID:8200705"
                     /db_xref="GOA:C4R7U6"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:C4R7U6"
                     /translation="MSENIELKTVGFDARFPQQNQTKHCYQSYLDYHKCITVKGEDFA
                     PCKVFWKTYNSLCPSAWVEEWDEQREKGIFPGNLKV"
     gene            complement(<829205..>829819)
                     /locus_tag="PAS_chr4_0958"
                     /db_xref="GeneID:8200706"
     mRNA            complement(<829205..>829819)
                     /locus_tag="PAS_chr4_0958"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493806.1"
                     /db_xref="GeneID:8200706"
     CDS             complement(829205..829819)
                     /locus_tag="PAS_chr4_0958"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493851.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0958"
                     /db_xref="EnsemblGenomes-Tr:CAY71672"
                     /db_xref="GeneID:8200706"
                     /db_xref="GOA:C4R7U7"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="UniProtKB/TrEMBL:C4R7U7"
                     /translation="MSRYESSKKRQKMDDSSKFEISSIEQMSQSLPQKLRVPDTNCLI
                     IKKNANVKKTLDRLLQILIGGDDSIVLTAQNENIQKMFTILEIIKQKALQNENNSDTI
                     IGDSNVTLEFVEYHQYNKLDYLRVLKPSRAPSTEYKSVDDDASRRSEIMNNPLTKQDK
                     ELLEVEKPISVPILTVYLRFARSGASISQDQGLIMNGWSFQKSK"
     gene            complement(<830037..>831374)
                     /locus_tag="PAS_chr4_0959"
                     /db_xref="GeneID:8200991"
     mRNA            complement(<830037..>831374)
                     /locus_tag="PAS_chr4_0959"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493807.1"
                     /db_xref="GeneID:8200991"
     CDS             complement(830037..831374)
                     /locus_tag="PAS_chr4_0959"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493852.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0959"
                     /db_xref="EnsemblGenomes-Tr:CAY71673"
                     /db_xref="GeneID:8200991"
                     /db_xref="UniProtKB/TrEMBL:C4R7U8"
                     /translation="MLYPQPELDILKKDQEKDTETNGETKNPKFEISPFKVTSSIQGD
                     FNDPIMLLNKTPKHKGLKRRPAAFQQNLPPEVRDDPMRNNLSPIKLPQREPPLPQPAK
                     QDTPEKSPPKESKDAHSIPVDEPKRSPPPLTDLISIDDDISSRDTDFEYEEYPTMDKT
                     AKEFNNETPVRATKLTSFDGIVRPKKTPEVTAKTQSLSAESPPQNDFILHTPLRARVR
                     TFQSMSNYEGVDESSENQQRPKRSRTSSNTLNSGLNTVKANRGSDSTQKEYLNGQFSE
                     YDVSDTISKARSFIHSKKLEKTRLGRPSRRVIPNNTFLSEKATDDTYVSMNSRMLEFD
                     SSSNNQNGEGELLSGLDDERALNKQNLESLDESTRAKQLDTWGLEKWRKLAGVLKLYG
                     VTKNEELLDPKFIQSELGCEPNELVARSIILVKWKELKSLRKMQRSSNKERSK"
     gene            complement(<831653..>833604)
                     /locus_tag="PAS_chr4_0423"
                     /db_xref="GeneID:8200992"
     mRNA            complement(join(<831653..832405,832798..>833604))
                     /locus_tag="PAS_chr4_0423"
                     /product="Putative GTPase that associates with pre-60S
                     ribosomal subunits in the nucleolus"
                     /transcript_id="XM_002493808.1"
                     /db_xref="GeneID:8200992"
     CDS             complement(join(831653..832405,832798..833604))
                     /locus_tag="PAS_chr4_0423"
                     /codon_start=1
                     /product="Putative GTPase that associates with pre-60S
                     ribosomal subunits in the nucleolus"
                     /protein_id="XP_002493853.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0423"
                     /db_xref="EnsemblGenomes-Tr:CAY71674"
                     /db_xref="GeneID:8200992"
                     /db_xref="GOA:C4R7U9"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012971"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR024929"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7U9"
                     /translation="MGTAKKEKQRRVKENDLRDGNLRVKGENFYRDAKKVKHLNMYKQ
                     GRAVRNAKGDIIKAAYLQDTKVPTARVDPNRRWFGNTRVISQDALTHFRDALGEKQHD
                     SYQVLLKRNKLPMSLLEEKDDTKAARPNILETESYEKTFGPKAQRKKANVAASSLEEL
                     AAITDGDHVKYQEQLELNSTLGLMGENDEEDGVSTEAKEAIFSKGQSKRIWNELYKVI
                     DSSDVVIQVLDARDPLGTRCEVIEKYIKKECAHKHLIFVLNKCDLVPTWVAAAWVKHL
                     SKFHPTLAFHASITNSFGKGSLIQLLRQFSVLHQDRKQISVGFIGYPNTGKSSIINTL
                     RRKKVCQVAPIPGETKVWQYITLMKRIFLIDCPGIVPPSTKDTETDILLRGVVRVENV
                     SNPEQFIPSVLKRCKRQHIERTYEISGWEDTTDFLEILARKYGRLLKGGEPDETSIAK
                     QVLNDFNRGKIPWFVPPPEDTETREGEDKKAHHKRAREEREAAKNAETTEQLRLREDE
                     KDLEDTEVKLD"
     gene            <833792..>834403
                     /locus_tag="PAS_chr4_0424"
                     /db_xref="GeneID:8200707"
     mRNA            <833792..>834403
                     /locus_tag="PAS_chr4_0424"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493809.1"
                     /db_xref="GeneID:8200707"
     CDS             833792..834403
                     /locus_tag="PAS_chr4_0424"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493854.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0424"
                     /db_xref="EnsemblGenomes-Tr:CAY71675"
                     /db_xref="GeneID:8200707"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:C4R7V0"
                     /translation="MSCEHEHHQHEAPPIETSSAQSLNTQIDFTKLTALNCTTPNSKL
                     YEIFIHEGEESKITLSSDCDNQLILNIPFVSSVKLYSLILKTSPDNDHCPKKISLFKN
                     ADVDFETTAPKNTHHFEQPLVGEFVEHHLPRRLFTNVHKLTIFFEGNWSNDEFESLEI
                     LGIELRGEWAPLTKDPIITLYEAAANPADHKSLAQETQDSATC"
     gene            complement(<834487..>835389)
                     /locus_tag="PAS_chr4_0425"
                     /db_xref="GeneID:8200708"
     mRNA            complement(<834487..>835389)
                     /locus_tag="PAS_chr4_0425"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493810.1"
                     /db_xref="GeneID:8200708"
     CDS             complement(834487..835389)
                     /locus_tag="PAS_chr4_0425"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493855.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0425"
                     /db_xref="EnsemblGenomes-Tr:CAY71676"
                     /db_xref="GeneID:8200708"
                     /db_xref="GOA:C4R7V1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4R7V1"
                     /translation="MPHVTEDSINSAIIINMSFNQAAYSNYMNPQPLKILYMCNVVNW
                     CIFSLYLASLVWLMSMLINFFAFEGEFKQKTTHFFKTWSKNLFKQSSMREASKQKHEH
                     DIEGLTGSHNGANCKPEYISSHIPGSLFLKTAELKYSTINKDNNDNQSVVTTIYPTPS
                     TLYNLYAQNSGVKQQFLGKQPVNISMVHPTIVDRINQISSNEDRCPVCIEEFQCDDLV
                     QTLPCSHYYHTKCISEWITQHEESKCPLCQFDIEDKISVATSSPEQGYGMYTPVVHCS
                     ENLESGGLSSENELANVVNEFGSA"
     gene            <835556..>836278
                     /locus_tag="PAS_chr4_0426"
                     /db_xref="GeneID:8200709"
     mRNA            <835556..>836278
                     /locus_tag="PAS_chr4_0426"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493811.1"
                     /db_xref="GeneID:8200709"
     CDS             835556..836278
                     /locus_tag="PAS_chr4_0426"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493856.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0426"
                     /db_xref="EnsemblGenomes-Tr:CAY71677"
                     /db_xref="GeneID:8200709"
                     /db_xref="UniProtKB/TrEMBL:C4R7V2"
                     /translation="MVSSNGVSATPMDSDTDALVNGQVLSDSSVYGPTYMDTSLLRLI
                     KQIGTVLGDNDEDTIDRTLCNGTTKLKNGSKVNFKQETPSTEYNGNANEVWPSKVSEE
                     ITTELLLELVQECRQTILQLNLNKNLNELQAKMTTEQLHMENQILKKSLETFTESNGR
                     LKTEIKNLLNKKEKLVNYVRKLKTDKKHLKVELLRQSQQMNQIEEHVNVSRGDMLNTL
                     GILASHVLEDEQRRDLDETIEV"
     gene            <836588..>837307
                     /locus_tag="PAS_chr4_0960"
                     /db_xref="GeneID:8200710"
     mRNA            <836588..>837307
                     /locus_tag="PAS_chr4_0960"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493812.1"
                     /db_xref="GeneID:8200710"
     CDS             836588..837307
                     /locus_tag="PAS_chr4_0960"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493857.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0960"
                     /db_xref="EnsemblGenomes-Tr:CAY71678"
                     /db_xref="GeneID:8200710"
                     /db_xref="InterPro:IPR019329"
                     /db_xref="UniProtKB/TrEMBL:C4R7V3"
                     /translation="MYPVIQSAARRLGVRCFSGTTSVRAFNLQLEKEIRSKIDSLPKL
                     NNIFQNANGSVRQPSDTELQTIAELNSLVTNRKLSLTDYLFQNAANQALYVDNEADLK
                     ELDISSRQVVDKVPFKDAKTGEIKWKVVRENENEGWEKIMYVGFVPTMILIFAIVLFK
                     DDKSIDEWAMDELLLRLKEKNLSDVELIDELDKLSKSHVGKIGASEINKRDAVIIERI
                     LNGEYDQLSGLKKKELPIIDL"
     gene            <837595..>838197
                     /locus_tag="PAS_chr4_0427"
                     /db_xref="GeneID:8200993"
     mRNA            <837595..>838197
                     /locus_tag="PAS_chr4_0427"
                     /product="Evolutionarily conserved protein with similarity
                     to Orm2p"
                     /transcript_id="XM_002493813.1"
                     /db_xref="GeneID:8200993"
     CDS             837595..838197
                     /locus_tag="PAS_chr4_0427"
                     /codon_start=1
                     /product="Evolutionarily conserved protein with similarity
                     to Orm2p"
                     /protein_id="XP_002493858.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0427"
                     /db_xref="EnsemblGenomes-Tr:CAY71679"
                     /db_xref="GeneID:8200993"
                     /db_xref="GOA:C4R7V4"
                     /db_xref="InterPro:IPR007203"
                     /db_xref="UniProtKB/TrEMBL:C4R7V4"
                     /translation="MTKSPTIPKNSIPFPSSPEKLTVPPDLATDHRRRRSSSIISHVE
                     PETIDVKNDQDINPNLNANWVHFKGAWLVHIVIIVLLKIFYDLFPIFSRELSWTLTNI
                     TYVIGSYIMFHQVKGTPFDFNGGAYDNLTMWEQIDDGAQYTPAKKFLVGVPIALFLIS
                     THYSNYDLNLFILNFISCMIVVIPKLPSSHRLRVTLPFFS"
     gene            complement(<841200..>841916)
                     /locus_tag="PAS_chr4_0429"
                     /db_xref="GeneID:8200711"
     mRNA            complement(<841200..>841916)
                     /locus_tag="PAS_chr4_0429"
                     /product="Ubiquitin-conjugating enzyme that mediates
                     selective degradation of short-lived and abnormal protein"
                     /transcript_id="XM_002493814.1"
                     /db_xref="GeneID:8200711"
     CDS             complement(841200..841916)
                     /locus_tag="PAS_chr4_0429"
                     /codon_start=1
                     /product="Ubiquitin-conjugating enzyme that mediates
                     selective degradation of short-lived and abnormal protein"
                     /protein_id="XP_002493859.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0429"
                     /db_xref="EnsemblGenomes-Tr:CAY71680"
                     /db_xref="GeneID:8200711"
                     /db_xref="GOA:C4R7V5"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015368"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C4R7V5"
                     /translation="MTSIKRISRELEDVKKDPLSGVTLEVIDENDLSHLKGTFVGPPG
                     TPYEGGLFKVDIQIPSNYPFKPPKVQFDSKIYHPNISSVTGAICLDILKNAWTPILTL
                     KSTLISLQSLLQSPEPSDPQDAQVASVFLKDKREFDRTAKEWTFKYAPNPDYKGNPDD
                     GKSHSSNEASEQDENNRKKTKVEKVTHIDGIEIASIEMFENMGFSRPKILDVLKKLGL
                     TRVEDNDGDTKQEILEELLR"
     gene            complement(<842113..>843348)
                     /locus_tag="PAS_chr4_0430"
                     /db_xref="GeneID:8200712"
     mRNA            complement(<842113..>843348)
                     /locus_tag="PAS_chr4_0430"
                     /product="Endosomal protein that regulates cell polarity,
                     controls polarized growth"
                     /transcript_id="XM_002493815.1"
                     /db_xref="GeneID:8200712"
     CDS             complement(842113..843348)
                     /locus_tag="PAS_chr4_0430"
                     /codon_start=1
                     /product="Endosomal protein that regulates cell polarity,
                     controls polarized growth"
                     /protein_id="XP_002493860.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0430"
                     /db_xref="EnsemblGenomes-Tr:CAY71681"
                     /db_xref="GeneID:8200712"
                     /db_xref="GOA:C4R7V6"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:C4R7V6"
                     /translation="MNFFRRRRGNSVDSDELDISGPKKGSDRTKSRKPPNTAFRQQRL
                     KAWQPIYSPKTILPLLFVVFLVMCPIGIALIFRTYRVQNLVINYSRCDELEDSDEYAE
                     IPRNRVNFHFDKSTSSYSNYQNPRWRTSTSTDSLGNSVRTCHIEFDIPNDIHSPLYFY
                     YKLTNFFQNHRRYVESYDLEQLKGEAVPYDDIDSDCKPFAHSGDKIVYPCGLVANSYF
                     NDTLSSPVLLNPAGGSENVTYELTTKDIAWKTDRTTYKKTSYNWDEIVPPPNWEKMYP
                     NGYTEDNIFDITENEFFQNWMRTAALPSFMKLAAKNTTTAMESGTYQIDIGLNYPVSI
                     FGGSKSLVITSNNILGGRHFGLGVCYLIVAGASFLFGFLFLLKVLIKPRKIGDHSLLN
                     FEDERASQELFTSERRDYL"
     gene            complement(<843539..>849475)
                     /locus_tag="PAS_chr4_0431"
                     /db_xref="GeneID:8200713"
     mRNA            complement(<843539..>849475)
                     /locus_tag="PAS_chr4_0431"
                     /product="Component of the CCR4-NOT complex, which has
                     multiple roles in regulating mRNA levels"
                     /transcript_id="XM_002493816.1"
                     /db_xref="GeneID:8200713"
     CDS             complement(843539..849475)
                     /locus_tag="PAS_chr4_0431"
                     /codon_start=1
                     /product="Component of the CCR4-NOT complex, which has
                     multiple roles in regulating mRNA levels"
                     /protein_id="XP_002493861.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0431"
                     /db_xref="EnsemblGenomes-Tr:CAY71682"
                     /db_xref="GeneID:8200713"
                     /db_xref="InterPro:IPR007196"
                     /db_xref="InterPro:IPR024557"
                     /db_xref="UniProtKB/TrEMBL:C4R7V7"
                     /translation="MSFKQSLLSQTPSSITPSQFLADLISQHSNEQKNVLALLFAEIL
                     VPGSQHISSSTSTKTTALTPSTLPEATARGSQFRSLLKGLNIEQSTWDQIIELIFETD
                     DYFSDATSISQVTVASISQFLASLEPENIDKFLRYVAHHKLKDHPFLFQKNLLVSLYS
                     LNPQHGAIDLLSCPLQPVLANEPNSRRTIIWFKYIAELEVSLLVELKSRPATADENQI
                     NEIIEDSYKTAPEYLGLAALHLWKENKDNNADPGTTLAYLNLCHHFIVQLLDINSPYL
                     IILLTEFKEISEDELSSLLANYVSLRPNGAITVATYALRDGVLSSVLNKLSKFNDCLS
                     VAIEASNLGWNGLEKFVQNLLSNNPKQVQSQLVDFLEEQSSFEYQSSNNESNAQIKSH
                     RSLSIPVVYTLLKAIEGQKLSGDLVDKFKNVQVSVIQAYPRLINFGRGHDEAILANGN
                     SHSFPPSVEQEMKSYYQKMYLKQLEIKSVINSLKAFKDSDNPHEQDIFACMIHSLLDE
                     YRFFPEYPIDALATTSVLFGSTIYFQLIEGTTLTIALRYILESCRQPPEDNMFKFAVQ
                     ALYTFREKLGDYKSYCALLSEVPSLKQQPQIYEILQQVMNGTFRAPPSIPSQGIGSGE
                     RQPSQGKQPSNDSLVVSKFKSLNLAVELQRRDQETPDENVSDHVLFLVNNITEENLSA
                     KVEEMNKVLEPQYFEWFSNYLVTQRVKTEPNYHSLYCSLISRLDNLLLDAYILNLTFK
                     EIILILNKCYDVNDEISGPERTHLKNLGSWLGLITLTRNRPLKHRNLALKMLVLEAYD
                     KNKLEVVLPLVCKILDQAKNSKVFLPPNPWTVGNLKLLKELYDVGNLPLKLKFEIEVL
                     YNSLNTKLGDIEAANIIRTHQPADIDQFAVATNMMKELTLSNVNQMKQQQQQQQQQQQ
                     QQQHQQQQQQQQQQQQQFFLQQQAALQAQQVQQPQIPFDPQANPGVSTATPADESNQL
                     KVFSNLLGTTSFVTIPTLKYLFQAALARAVKEILPLVVDRTNLIALVTTKALVSKDFA
                     LESDEAKFRTAYINQVSYLTESLSLASCRDPLRESIQMNALQIANTMPNIDSTLFEEL
                     PQAITDNIDLASTIIQKAAVERAIQDIDELMAPQLAIRRQHRELKPNQQFIDPTMRSR
                     YPMLLPVPLGLKSDGVIPKQFMIYENFGKNRIVSPMQQPEHLQNINSQLNPSLRQGAQ
                     QPLVPPGVAEQMKQQMPPALPGQGGAVSLEQTFMFLQQLVDSVINLTRDAPEKLISEV
                     NTDSVVVTVLGEILQTCIGATVTDSLILKISQYVMNMLFVRTNSSLTQNTLVFLLDKL
                     CELSPFTAKDISWWLVHAEDERKYNKNVMRDLILLGLVPLAELDRSLAIQIEKKNVKA
                     VLFTIYLIHDSILSEDPIALRADLINSIEALQVLAHEPSEIGRKAYMSISRLKAIVKS
                     NSIQIFKMFGTSTISKKQYMSYVFAEWVKLVQYSRVNRVLEDFIWQLVDDGIVNNSEN
                     LSLLITTATEMSVAAFSKEADPSKKLHIETYAPADALALLLVKLLLMQEDSTGVERKT
                     FFNSMLAVIVLAFASDHNNNSTSFNERPYFRIFSSLFSYWLSARHEFEDGDDESLKTF
                     NSELYLILAQNLMVMQPSSFPGFTFAWISLISHRMFMPMILEVPENKGWGRFVNLLQC
                     LLSFQLHYVDSEKISDVVNVVYKGTLRIIALLSHDFPDLLVQYHYQLISSTPESYVQL
                     KNIISSAYPKGITVPNPFQQGLKVDRLEEIKQEPPIGYHPESDLTAKGLKKPVESYLR
                     IPSQSLLKTISTGLSVAEPRNGKSKYDAGLVNAVVFFVGIAAVEEQKSFRDGSSFDST
                     SNHVMLLSSLIKDGDVELQNLILTAIANQLRYPNSHTHWFSCILLHFVGSATLWGDQR
                     EAIKFNISCVLTKRAMSYNPIPWGILVTFLELVSNSEYEIFSSPFIKGDATLERLFGT
                     LQHHVRNQKPIDEQPEPLKL"
     gene            <850836..>852275
                     /locus_tag="PAS_chr4_0432"
                     /db_xref="GeneID:8200714"
     mRNA            <850836..>852275
                     /locus_tag="PAS_chr4_0432"
                     /product="Integral membrane component of endoplasmic
                     reticulum-derived COPII-coated vesicles"
                     /transcript_id="XM_002493817.1"
                     /db_xref="GeneID:8200714"
     CDS             850836..852275
                     /locus_tag="PAS_chr4_0432"
                     /codon_start=1
                     /product="Integral membrane component of endoplasmic
                     reticulum-derived COPII-coated vesicles"
                     /protein_id="XP_002493862.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0432"
                     /db_xref="EnsemblGenomes-Tr:CAY71683"
                     /db_xref="GeneID:8200714"
                     /db_xref="GOA:C4R7V8"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C4R7V8"
                     /translation="MKGIKFIFMALAAAVAQGISDNSQWSNEHVVTSLSLPDLDLKTS
                     MKSLKDWKLNGDVKLDEGRIILTPKPEIVSLNDKKKQIKGSIWTEYGFGLNQFTIEVT
                     MRSLGSIGRTSSGLSLWLVDDQAGTISQDPGNNFGGPEKYKGLQVLMDSNDAKLNSVT
                     RSYLMDGDFDISKAFSVCNFPYQNSNVPVILRLSYKKGNFKLTIDNKLCFQTDKISIP
                     LGRFWTFGISAVTRNDLKVHEQFEILKLKTFNDVVDTDDEVDLLLDQPYATTTIMEQA
                     SKETAAPESKPIVSEFGNSQAFREKELELKNQLAQQKSAEALPYIIAKLDTLESLVDE
                     TNLLITSSNEQPHGDILLQQINRQFHEVFKHIRYVNDKVELLSRSPDSSSSSSSVTSS
                     NVDGLKRDILALTETVRGLSEEQKMVMQALLRINDLVKTPLNHANVVTLDEVASKMKM
                     YLAPLLLIFIVIIVMNYRLGKQIRHAKIL"
     gene            complement(<853218..>854117)
                     /locus_tag="PAS_chr4_0433"
                     /db_xref="GeneID:8200715"
     mRNA            complement(<853218..>854117)
                     /locus_tag="PAS_chr4_0433"
                     /product="NADPH-dependent alpha-keto amide reductase"
                     /transcript_id="XM_002493818.1"
                     /db_xref="GeneID:8200715"
     CDS             complement(853218..854117)
                     /locus_tag="PAS_chr4_0433"
                     /codon_start=1
                     /product="NADPH-dependent alpha-keto amide reductase"
                     /protein_id="XP_002493863.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0433"
                     /db_xref="EnsemblGenomes-Tr:CAY71684"
                     /db_xref="GeneID:8200715"
                     /db_xref="GOA:C4R7V9"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C4R7V9"
                     /translation="MALAIPQIGFGTGTTWYKYGRESEIDQTLVDALVSALQVGITHL
                     DGAECYGTALETRDAIKKANIPREKLWITEKYYAGDSSHKSKSKAANPLAALKEILRL
                     EELEYVDLYLLHSPYITKETHGFTLEEAWGYLEEAQSLGLAKNIGVSNFTVADLEKIL
                     KVAKVKPQVNQIEYNAFLQDQTPGVVEFSQKNGILIEAYSPLAPLYKGDKSIKEVKEF
                     LDYVYELGKKYGKSDTQVLLKWVLQKGIIPITTSTKTERVKEFLKIDDFQLEPSEVEK
                     ITTLGAKAPVVRQYWVPEYSKFD"
     gene            <855536..>856402
                     /locus_tag="PAS_chr4_0434"
                     /db_xref="GeneID:8200716"
     mRNA            <855536..>856402
                     /locus_tag="PAS_chr4_0434"
                     /product="Subunit of the core complex of translation
                     initiation factor 3(eIF3)"
                     /transcript_id="XM_002493819.1"
                     /db_xref="GeneID:8200716"
     CDS             855536..856402
                     /locus_tag="PAS_chr4_0434"
                     /codon_start=1
                     /product="Subunit of the core complex of translation
                     initiation factor 3(eIF3)"
                     /protein_id="XP_002493864.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0434"
                     /db_xref="EnsemblGenomes-Tr:CAY71685"
                     /db_xref="GeneID:8200716"
                     /db_xref="GOA:C4R7W0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR017334"
                     /db_xref="InterPro:IPR024675"
                     /db_xref="UniProtKB/TrEMBL:C4R7W0"
                     /translation="MATAVAQNWADELPQTQVTDNGDGTKTVVSFTRNQQGKKVKITK
                     RIRETIVKEEVVPAVAQRRKWSRFGEEKDNTAVGPDTRTTMLDDPIDVQFGEEARKRK
                     EEEVKKRKQTEVTKSLVVCRLCQGDHFTTKCPFIGTLGVDPESNPNMSGNNGEAEGST
                     ADVSGDSVGSGLGGSGSSYVPPHLRGRGGAMPRPGPGERIHDDSTTIRITQLNEVVDE
                     QRLRMELCAPFGNITKATVVRNRETGRSKGVAFVAFETEQEAQLAIDRLNNRGYLSLI
                     LKVDWSKPKPKV"
     gene            complement(<856753..>857484)
                     /locus_tag="PAS_chr4_0435"
                     /db_xref="GeneID:8200717"
     mRNA            complement(<856753..>857484)
                     /locus_tag="PAS_chr4_0435"
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /transcript_id="XM_002493820.1"
                     /db_xref="GeneID:8200717"
     CDS             complement(856753..857484)
                     /locus_tag="PAS_chr4_0435"
                     /codon_start=1
                     /product="Subunit of the RNA polymerase II mediator
                     complex"
                     /protein_id="XP_002493865.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0435"
                     /db_xref="EnsemblGenomes-Tr:CAY71686"
                     /db_xref="GeneID:8200717"
                     /db_xref="GOA:C4R7W1"
                     /db_xref="InterPro:IPR009244"
                     /db_xref="UniProtKB/TrEMBL:C4R7W1"
                     /translation="MEDEQHGLISALYPPPPPYLKFFTSKNVEKLKELRETKSDEEIH
                     QQVKGTELQFLIPPTKPEGESYRSFGSVWSFKDKFIDLKASGIQQLYPNFISEENDQD
                     EVFSHERLTEMKKMTKSLLLNFLELLGIVAKNPSYANQKIEHIRIILINLHYLLNSYR
                     LHQSREILILEMESKIQQDKAEIENIETVCARIEEKVRTLVKKNVIIVPEKNGMMEVD
                     DEKETDIEAKRQEVIDSLLEEEYIE"
     gene            <857861..>858320
                     /locus_tag="PAS_chr4_0436"
                     /db_xref="GeneID:8200718"
     mRNA            join(<857861..857996,858047..858168,858222..>858320)
                     /locus_tag="PAS_chr4_0436"
                     /product="RING finger containing subunit of
                     Skp1-Cullin-F-box ubiquitin protein ligases (SCF)"
                     /transcript_id="XM_002493821.1"
                     /db_xref="GeneID:8200718"
     CDS             join(857861..857996,858047..858168,858222..858320)
                     /locus_tag="PAS_chr4_0436"
                     /codon_start=1
                     /product="RING finger containing subunit of
                     Skp1-Cullin-F-box ubiquitin protein ligases (SCF)"
                     /protein_id="XP_002493866.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0436"
                     /db_xref="EnsemblGenomes-Tr:CAY71687"
                     /db_xref="GeneID:8200718"
                     /db_xref="GOA:C4R7W2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:C4R7W2"
                     /translation="MKWRLMYQVSILLKVLFAPATNISDGQEKKRFEVKKWTAVAFWS
                     WNMVVETCAICRNHLMEPCIDCQPNSTSQSNIECATAWGTCNHAFHMHCITRWLKTRN
                     VCPLDNGEWVLQKYGN"
     gene            complement(<858367..>859317)
                     /locus_tag="PAS_chr4_0437"
                     /db_xref="GeneID:8200719"
     mRNA            complement(join(<858367..859218,859270..>859317))
                     /locus_tag="PAS_chr4_0437"
                     /product="Prephenate dehydratase, catalyzes the conversion
                     of prephanate to phenylpyruvate"
                     /transcript_id="XM_002493822.1"
                     /db_xref="GeneID:8200719"
     CDS             complement(join(858367..859218,859270..859317))
                     /locus_tag="PAS_chr4_0437"
                     /codon_start=1
                     /product="Prephenate dehydratase, catalyzes the conversion
                     of prephanate to phenylpyruvate"
                     /protein_id="XP_002493867.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0437"
                     /db_xref="EnsemblGenomes-Tr:CAY71688"
                     /db_xref="GeneID:8200719"
                     /db_xref="GOA:C4R7W3"
                     /db_xref="InterPro:IPR001086"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="UniProtKB/TrEMBL:C4R7W3"
                     /translation="MTNIAYLGPQGTYSHKAALQEFANGENFTYEPQTTIRSCINALS
                     DKTVSYAVIPFENSSNGQVVFSYDYLKDWFMNKEGNTPDFRVVGEQFVSIHHNLITNA
                     PSLDKITKIYSHPQVWSQCNRFFEANDKVFPKSLEKIDCSSTSRAVQIVKETVEKGDE
                     YVAAIASDIAAELHNVPVFQANIEDFDENTTRFLILGYDSLPLTTDKSSKTLTLMAFM
                     LKKDDNHGALCDALACFKEHGINLQTIASRPSKMKSWHYIFFIEFWDDQDENTVNALE
                     KLNDYVQEKFVLGTFPRSKKYWD"
     gene            complement(<859504..>861216)
                     /locus_tag="PAS_chr4_0961"
                     /db_xref="GeneID:8200720"
     mRNA            complement(<859504..>861216)
                     /locus_tag="PAS_chr4_0961"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493823.1"
                     /db_xref="GeneID:8200720"
     CDS             complement(859504..861216)
                     /locus_tag="PAS_chr4_0961"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493868.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0961"
                     /db_xref="EnsemblGenomes-Tr:CAY71689"
                     /db_xref="GeneID:8200720"
                     /db_xref="GOA:C4R7W4"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R7W4"
                     /translation="MFLNSSIRRTSINGLGVCSRWIHQSFQRDAVSESNVITSVKKQN
                     LKRNPKSNRSIRRNRYNDLRVQVERDVIESLEKNKKSSLKSPHDKYNRLKIKFDPRFE
                     GSFKDFGISSRLDRQLHEKLDISRPTDNQRRILSILCSGISVLAVASQRSGSSTCLLL
                     YALSIRGRSLLLAPTTLALLQLQKLCHSLEVQDVAFLYRSSEEDELNQEKQLDLKTPQ
                     VMVATPQRMLDLISKNNSDPLYMRLHELKFLGVDDADIQLLNDNKKVVHERPAQILIN
                     YIMKLKETISSTKNIQPLQFGFIETLDISNKLLNMIEENKWNVSRTLLPIGLLAKGDV
                     LARARINQSARLSIVIGDSRKVLDFKLPPLSTGMEVLSKIRSPIGKEFDENAKKHLTT
                     QLQKDKTLSQLISDEILDALPTVSAKLRKKKSLLICPDSITIRTIMEQLTKLGYSSKQ
                     LSSSTANFFNDENEQSQFLVSTPSQLPGLNLEGLASVICLGLHALKDAKTLVLIAGKS
                     QSPRVTLILSKSKTTLVERFMIERILLKSGVASLTPLIGETDNYDEKAYQVLFSDIHG
                     ETSS"
     gene            <861379..>861888
                     /locus_tag="PAS_chr4_0438"
                     /db_xref="GeneID:8200994"
     mRNA            <861379..>861888
                     /locus_tag="PAS_chr4_0438"
                     /product="Heat shock protein with a zinc finger motif"
                     /transcript_id="XM_002493824.1"
                     /db_xref="GeneID:8200994"
     CDS             861379..861888
                     /locus_tag="PAS_chr4_0438"
                     /codon_start=1
                     /product="Heat shock protein with a zinc finger motif"
                     /protein_id="XP_002493869.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0438"
                     /db_xref="EnsemblGenomes-Tr:CAY71690"
                     /db_xref="GeneID:8200994"
                     /db_xref="GOA:C4R7W5"
                     /db_xref="InterPro:IPR007853"
                     /db_xref="InterPro:IPR024158"
                     /db_xref="UniProtKB/TrEMBL:C4R7W5"
                     /translation="MLPRILASQVLRQSSRTLLRSSRSPLLRKASSQFFNGFARWNSS
                     QPLKVDKPQLMIAFTCKKCDTRSSHTFSKQAYTNGTVLIQCPGCKNRHLIADHLKIFS
                     DERVNIQDLLAAQNESVSSSVDDLVFEDIPEKLKKVIGHHAKDAPEEYKQKRQVEGGA
                     LPDGSDTDK"
     gene            complement(<861962..>864016)
                     /locus_tag="PAS_chr4_0439"
                     /db_xref="GeneID:8200721"
     mRNA            complement(<861962..>864016)
                     /locus_tag="PAS_chr4_0439"
                     /product="Plasma membrane transporter for both urea and
                     polyamines"
                     /transcript_id="XM_002493825.1"
                     /db_xref="GeneID:8200721"
     CDS             complement(861962..864016)
                     /locus_tag="PAS_chr4_0439"
                     /codon_start=1
                     /product="Plasma membrane transporter for both urea and
                     polyamines"
                     /protein_id="XP_002493870.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0439"
                     /db_xref="EnsemblGenomes-Tr:CAY71691"
                     /db_xref="GeneID:8200721"
                     /db_xref="GOA:C4R7W6"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="UniProtKB/TrEMBL:C4R7W6"
                     /translation="MAVKELLNQASGYGVLVGVGALFAIMVLISTRLMKKYLNENTGN
                     TEMFTVCNRSVGVGLASSAIMSSWMWATVSIWSVQMVFSYGVAAAYHYASTSSVQVVF
                     LMLAGIECKRKIPNAHTCLEIVNLRYGKATHILYIFLCLVNNLLSCSSMILGASGAIT
                     ALTGMHIVASTMLIPFGVLCYTFSGGLKGTFITEYVHTFIALIIFAYFTTASVAHNEI
                     GSLGNLYDLVKQWQADNEYYIEGNYQGSLLTFKSQGAIIFGLIHSIGDFGLAVMDSAF
                     WAKAFAAKTETMVPAYIIGSITIYACSWPLGTVMGLIGAYMSTKPSFPTYPNPMNADE
                     IANAFLLPYTLKALLGNGACGALLLALYMAVTSTVSSQMVSVSSILSFDVYRTYINPE
                     AQNKQMIKVTHFGVVFFGLFSAGFSVMLHYVGVSLTWMGYFYSMIICGGVIPLLLSIL
                     WSRQTTVAAFVAPIAGISTGIATWLSVAKTMYGDLSVASTGQQLPCLYGGLVTIFVPG
                     IVTVLVSLLYKPYKFDWARLQDATLVEGEEDSSESEFEKDNLSHSDEDREIKGVVPEY
                     TTEIGSIESPTDREKELVKIKFWLKVARIYLVINVLVTQVLWPMPLYRNWIWSRSFFE
                     GWAGASIGSTYLAIVLVCIYPLWDGRHALKKVACGVYRDYIKRENKQENKHLVEPVIE
                     SK"
     gene            <864925..>866952
                     /locus_tag="PAS_chr4_0962"
                     /db_xref="GeneID:8200722"
     mRNA            <864925..>866952
                     /locus_tag="PAS_chr4_0962"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493826.1"
                     /db_xref="GeneID:8200722"
     CDS             864925..866952
                     /locus_tag="PAS_chr4_0962"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493871.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0962"
                     /db_xref="EnsemblGenomes-Tr:CAY71692"
                     /db_xref="GeneID:8200722"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="InterPro:IPR021711"
                     /db_xref="UniProtKB/TrEMBL:C4R7W7"
                     /translation="MSNNSEGRPKLPFLEISYDSLRNLKDSDVDFQNLLRVWTTLTKS
                     SDSIRNGKRLENISWRVVNRKLLLNPLNREDSLDPMDFQALSRISLCRGSSQPFLAEY
                     KRKNNKKGKSEQARPTSDLNHDSIMSSLEKKKLQNGIDQSILEIPKQPSLFAKPLPRP
                     EPPSLFQKKEAKSSENKRHMFYLHSPSPVDENPMEKCPSQSLFSQTQQPLPDKPANST
                     SLFGNSKNKTTSLFGNEDRKEIVFTSDESLSDDSQWSSVSDSEESEEEEPRLDFHKKD
                     FPVETKPAMRRSLLSGLFLHELPHRNSEPNIHGQLSGTKMYQNPTNASSKTSIATEST
                     TIVNPKIKPPLLRTKTVPNVNHSAEREVLEVSSSQLAKSTLSCTNITAMASVSTAKDA
                     RPLLKRQSSHDVTKNDEVSSLSKLVSLSKLNLTSYFAGKNNKSGHHHKSEVSTANSNR
                     VPATARTLLPTALSTHMFLPTMANSRPSTLAQVVEAKEDDSSVDGSVRMSLNASRRNS
                     EQIEVGIPRPSTPAGSNVDVVRNSSIEIPGSSDSKSSNYRRDKTPDRDGLGGKGSQGA
                     TALSPRSTKKRMLASELSQSLREQILYELETAPENHAQTDNPYLAHKIRHGQEFLDDD
                     KLLDELIDKNDPGQMREQRLKNMSSTKLEVVPKTVLSDEDDDNMSYFAKGW"
     gene            <867165..>868412
                     /locus_tag="PAS_chr4_0440"
                     /db_xref="GeneID:8200995"
     mRNA            <867165..>868412
                     /locus_tag="PAS_chr4_0440"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493827.1"
                     /db_xref="GeneID:8200995"
     CDS             867165..868412
                     /locus_tag="PAS_chr4_0440"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493872.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0440"
                     /db_xref="EnsemblGenomes-Tr:CAY71693"
                     /db_xref="GeneID:8200995"
                     /db_xref="GOA:C4R7W8"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4R7W8"
                     /translation="MTGSTEGSITAPEFLEQQSLLEKEALELMPFDPQRCTFTDGALR
                     QQLYACLTCLKNQPKSEGEKPVFSGVCYSCSIQCHSTHELVELFTKRHFTCDCGTTRM
                     LYNGGCRLRNVDPKSPADDIPSSSNRYSNNFEGTFCSCEQPYNPLEETGNMFQCFFGE
                     VCNEDWFHEECLMGIPRGSVERKAKHTLTRNGKNILETLPEIEVDEDAATKTEENDSG
                     EEDAAPLPGFPSANDFDCLICWKCVDKFKALDLIPRSVRLPDIFHVESKSLDDRATQL
                     KNYKETQSNSKRLKTTTSKDFKFSIFLKDGFQSALKSIISTNEKHYDPLISLLRQFPF
                     LYEEDPVYEPPEESLHSETESSSMFDLGTKALESLPREQAIEGLQAYEKVKQKLSQFL
                     RPFAQEGRIVTKEEIKRFFEDTE"
     gene            complement(<868455..>871775)
                     /locus_tag="PAS_chr4_0441"
                     /db_xref="GeneID:8200723"
     mRNA            complement(<868455..>871775)
                     /locus_tag="PAS_chr4_0441"
                     /product="ATP-dependent Lon protease, involved in
                     degradation of misfolded proteins in mitochondria"
                     /transcript_id="XM_002493828.1"
                     /db_xref="GeneID:8200723"
     CDS             complement(868455..871775)
                     /locus_tag="PAS_chr4_0441"
                     /codon_start=1
                     /product="ATP-dependent Lon protease, involved in
                     degradation of misfolded proteins in mitochondria"
                     /protein_id="XP_002493873.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0441"
                     /db_xref="EnsemblGenomes-Tr:CAY71694"
                     /db_xref="GeneID:8200723"
                     /db_xref="GOA:C4R7W9"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /db_xref="UniProtKB/TrEMBL:C4R7W9"
                     /translation="MLRHYQGMRRCMVNTAHLAATGQSFKLVGPRLAHQLAFQNRNAL
                     QPLQPLEEFHHTLSTLRLKDDPKKDIVENEVDKDQNEDKEQPDIENNNEKDPSKERDP
                     VDKSKKESSVKRTKLAPESSSGISTAAPPSGNDDGKPKKKSAADELPEVYPQIIALPI
                     SRRPLFPGFYKAVIITNVNVIKAIRESLDKGYPYIGCFLFKDENADSDIITNKDEVHE
                     IGVLAQITSNVFSKDSETGVESLTTVLYPHKRIRIDELFPPKEGEDLNKDVESAKVVP
                     SERPTKRSRKEIIQGITGEKEGDGPKRSIEDEEEDLVSDEAQEVTTEKDENPTEFLKN
                     YPITLVNVSNVNDLPYERDSPVINSLTASILEVLKEMSNMNKMFADHLATFSASLQKD
                     VFQCPEKLADFAAAVTAGNENDLQDILNCLDIEKRLEKSFTILKKELMNKELQRKIEK
                     DIEERMAKRHREYHLNEQLKWIKKELGIDDGRDKLIAKYNDRVKDLNMPADVMKVYED
                     EIAKLQTLEPLMSEFTVTRNYLDWLTQIPWGKQSKDEYNIKKAITVLDDDHYGLKDVK
                     DRILEFIAVGKLLNKINGKIICFVGPPGVGKTSIGKSIARALNRKFYRFSVGGLSDVS
                     EIKGHRRTYVGAIPGRVVQALKKTETENPLILIDEIDKISHTHSVNGGDPSSALLELL
                     DPEQNNSFLDNYMDVPIDLSKVLFVCTANQLNTIPGPLLDRMEVIEISGYIADEKIKI
                     AERYLAPEAKQSAGLQDVNVDLTEEVIQSLIKNYCRESGVRNLKKQIEKIYRKAALNV
                     VRELGEEETERTEVEPEEETASLANPKIADETEQSSQSQSSNDESKPDVKTAKEVKES
                     LPQIKVPESFKIEITPDNLKDYVGPPVYTSDRLYETTPPGVVMGLAWTSMGGSSLYIE
                     SVLEQPLSHDSTPRLEITGQLGDVMKESSRIAYSFARMFMTKNYPENKFFERAKIHLH
                     CPEGATPKDGPSAGVTMTSSLLSLALDKSLSPTIAMTGELTLTGRVLRIGGLKEKSIA
                     AKRSGVDTIIFPKDNLSDWKELPENIKEGLTPVPVEWYHEVFEKVLPGISVADASNVW
                     KAEFDKIKEKEAEKEKSA"
     gene            complement(<871989..>872894)
                     /locus_tag="PAS_chr4_0442"
                     /db_xref="GeneID:8200724"
     mRNA            complement(<871989..>872894)
                     /locus_tag="PAS_chr4_0442"
                     /product="Subunit of the heme-activated, glucose-repressed
                     Hap2p/3p/4p/5p CCAAT-binding complex"
                     /transcript_id="XM_002493829.1"
                     /db_xref="GeneID:8200724"
     CDS             complement(871989..872894)
                     /locus_tag="PAS_chr4_0442"
                     /codon_start=1
                     /product="Subunit of the heme-activated, glucose-repressed
                     Hap2p/3p/4p/5p CCAAT-binding complex"
                     /protein_id="XP_002493874.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0442"
                     /db_xref="EnsemblGenomes-Tr:CAY71695"
                     /db_xref="GeneID:8200724"
                     /db_xref="GOA:C4R7X0"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C4R7X0"
                     /translation="MSSIQEIELREQDRWLPIANVARLMKGTLPATAKVSKDAKECMQ
                     ECVSEFISFITSEASDKCLNEKRKTINGEDILYSMASLGFENYAEVLKIYLAKYREQQ
                     ALRQERGDLRRRPVPTIDSNGGSLKTPAQDFFDFAADKKNDTSINNTQDPDEDTVNYD
                     NEHHSKNTTDHLDQDGYPSHYENDDNERNQDHNDDNHHSNENSGHHDNNEVQFSVPTF
                     DGYDEQARAAPNSMVHTHAEDIEHLNERLVKQENVDPNVHHDAALGLNLNDNANAIAS
                     ESEDIALVANGHHGENVLYRYQNDF"
     gene            <873173..>874786
                     /locus_tag="PAS_chr4_0443"
                     /db_xref="GeneID:8200725"
     mRNA            <873173..>874786
                     /locus_tag="PAS_chr4_0443"
                     /product="Flippase, essential integral membrane protein
                     that is required for translocation of Man5GlcNac2-PP-D"
                     /transcript_id="XM_002493830.1"
                     /db_xref="GeneID:8200725"
     CDS             873173..874786
                     /locus_tag="PAS_chr4_0443"
                     /codon_start=1
                     /product="Flippase, essential integral membrane protein
                     that is required for translocation of Man5GlcNac2-PP-D"
                     /protein_id="XP_002493875.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0443"
                     /db_xref="EnsemblGenomes-Tr:CAY71696"
                     /db_xref="GeneID:8200725"
                     /db_xref="GOA:C4R7X1"
                     /db_xref="InterPro:IPR007594"
                     /db_xref="UniProtKB/TrEMBL:C4R7X1"
                     /translation="MSSQDELDTTATKESKDSFSKSASGASFLMLTQLSSKLCTFFIN
                     QLLMSYISARILGATSYIDFLVATSLFFSREAVRLSCQRIKLPKGKAYQAIFNLSLIP
                     LVIGVPFSSILIYTQFIRQQNAAVLQSPLFRYSVGFMWLSVIIELLSEPLYNINQYDL
                     DIKTRSKIESFANVFKCLSQLGMIVWFEHKFKGMSVDKANPDYFIFSYCVSLFIYGGS
                     ILSLYLHFFFKSSARSQIRFKLTKIDDWYFEPRSISYWKNIFVQIFFKHVLTEGDKFI
                     VNYLCSPEEQGIFALVNNYGSLITRMVFAPIEESLRLYFTKLISQDSSPKTYRQVCTV
                     LKNILVFYKYLSLFIVIFVPFNSKFVFSMLLGNDWASSTDAFKVYWIYIPFLAVNGVT
                     EATFYSTVEDAARLFSYSKYMVMCSIAFIASATLLIRGTGLSVVGLIIANCVNMLLRI
                     IYCSNLINTMDSSFKLHIDSSAIQTILVGISVASLHYFITGSNTENFVQFFYSASLAC
                     LTLLLVIFKERSLLSNLFHQVWKSKIKSS"
     gene            complement(<874873..>876019)
                     /locus_tag="PAS_chr4_0444"
                     /db_xref="GeneID:8200726"
     mRNA            complement(join(<874873..875928,875981..>876019))
                     /locus_tag="PAS_chr4_0444"
                     /product="Ubiquitin-protein ligase"
                     /transcript_id="XM_002493831.1"
                     /db_xref="GeneID:8200726"
     CDS             complement(join(874873..875928,875981..876019))
                     /locus_tag="PAS_chr4_0444"
                     /codon_start=1
                     /product="Ubiquitin-protein ligase"
                     /protein_id="XP_002493876.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0444"
                     /db_xref="EnsemblGenomes-Tr:CAY71697"
                     /db_xref="GeneID:8200726"
                     /db_xref="GOA:C4R7X2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C4R7X2"
                     /translation="MSTVRRRSLSVGVAGTVAYMSYQKMSVATYFKLLDYSRFGIINL
                     ILVSSYYSSKFVKWVVFGELRPTEIQNLKDSLFYTSYEFILGLIMVRVLNGDVFDWNQ
                     ALKYGGFFLSVLLLKSFHYLTMDRVRNIFPMYKHSGRNLTLLHLRFAMGIVLLHYVDV
                     VLMIQFFREIFFNSKQMDLLVLIFGFEVFNLHPLIVYTSITYLGNYLEFRRQSPSRYG
                     DDYRSDLKERIFHLVDVIVNIIRLGMFILFSSLFVTFFTIPALHVLPSLYICLRQLIG
                     RTRRLIWLQKNAIKLVHINNELEDTDLSLMTKVDNKCVICLDRLDSPNRTAKKLRCDH
                     TFHSICIQSWMLVSRNCPVCRYKGKDTVVR"
     gene            complement(<876244..>878379)
                     /locus_tag="PAS_chr4_0445"
                     /db_xref="GeneID:8201394"
     mRNA            complement(<876244..>878379)
                     /locus_tag="PAS_chr4_0445"
                     /product="S-adenosyl-L-methionine-dependent tRNA:
                     m5C-methyltransferase"
                     /transcript_id="XM_002493832.1"
                     /db_xref="GeneID:8201394"
     CDS             complement(876244..878379)
                     /locus_tag="PAS_chr4_0445"
                     /codon_start=1
                     /product="S-adenosyl-L-methionine-dependent tRNA:
                     m5C-methyltransferase"
                     /protein_id="XP_002493877.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0445"
                     /db_xref="EnsemblGenomes-Tr:CAY71698"
                     /db_xref="GeneID:8201394"
                     /db_xref="GOA:C4R7X3"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R7X3"
                     /translation="MIRFLITIMGRFRRNKKGGSNNGKFGKRDNNHRGFHESWKDIEK
                     ENPRWESYYKELGLLSEEEFEVFKKSCQQTLPLTFRITGTRKHASEIRDIFEQKHLPN
                     LTNLNIEGYEDYSPPKSLPWYPNHLGWQIDLPKGVIKKNPDYAKTQRFLVIETDVGNI
                     SRQEAVSMIPPLVLDVKPHHYVLDMCAAPGSKTSQLVEALHAEDKEPSGFVMANDSDY
                     KRSHMLVHQVKRLNSANFIVVNHDAQMFPKMKLTPESQEYIKFDRVLCDVPCTGDATM
                     RKNINVWTNWTPGNAIGLHPLQLNILNRGIQLLQRGGRLVYSTCSLNPIENEAVVAAA
                     LRQWGDQIRLVDCSDRLPGLKRVPGISNWKVFGKDMELREKGADDIHATVFPPTEEEA
                     KNFNLDRCIRVYPHLQNTGGFFITVFEKIDKNSIGEKRKEQPDEEAEKKQKVDNNTSV
                     NPVKKQRLPRDANEEPFNFLDPANEQLQKCWEFYGFDDKFDRTCTLVRNATGDPIRTI
                     YYVAPVVKNVIQTNETRLKLVHSGVKLFVAQKSEHTCPWRLQNESLSIIKKHISKERV
                     FECNLDVLLILLQEGFPNINGIKEKELDVEFIKQIENTDEGCCLINVVRKNPNEEALF
                     LPLWKGKSNFNLMVSKQETFELLYRIYGIETEKQSQAKVVQEEPESQGKETPIQEAAE
                     TAAENPSEPIENAEPAEPKKSTEPVQSAE"
     gene            complement(<878546..>879199)
                     /locus_tag="PAS_chr4_0446"
                     /db_xref="GeneID:8201395"
     mRNA            complement(<878546..>879199)
                     /locus_tag="PAS_chr4_0446"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493833.1"
                     /db_xref="GeneID:8201395"
     CDS             complement(878546..879199)
                     /locus_tag="PAS_chr4_0446"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493878.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0446"
                     /db_xref="EnsemblGenomes-Tr:CAY71699"
                     /db_xref="GeneID:8201395"
                     /db_xref="UniProtKB/TrEMBL:C4R7X4"
                     /translation="MSGRAKYQRANVYDAVDGKYTKRKYEKHDPGEPDTIAPDDPWKD
                     DVKTVRVRTAAPPDEVLAENVKFQVPIPIKDRDSFAPSSQLPDSDLLKALHYYTAHVV
                     STKKPIELLNMENDVYETLKLIRNQRLETGWNNLQQSMDCTALLSLGALIEGWVEEFI
                     DGNAFKMYMERKEEKKKKKKRKSAKESPKETHKKVTENELVDEIIDSNSDIEEVNDI"
     gene            <879347..>879808
                     /locus_tag="PAS_chr4_0447"
                     /db_xref="GeneID:8201396"
     mRNA            <879347..>879808
                     /locus_tag="PAS_chr4_0447"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493834.1"
                     /db_xref="GeneID:8201396"
     CDS             879347..879808
                     /locus_tag="PAS_chr4_0447"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493879.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0447"
                     /db_xref="EnsemblGenomes-Tr:CAY71700"
                     /db_xref="GeneID:8201396"
                     /db_xref="GOA:C4R7X5"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:C4R7X5"
                     /translation="MSQDMNYVARANQTVSELAAKVREKNLQLEQLEHSYKNKIRALD
                     EYFKELQKNYPLPINAQKDSLPSLEDLVPPKCNHCNEIIEMDNYFLIPKGYKAEEPDS
                     PIDTPSGVTSQPIHSTATRPHKKNKKVSCSFCKELGHSRRDCPIKLSQQIS"
     gene            complement(<879874..>880295)
                     /locus_tag="PAS_chr4_0448"
                     /db_xref="GeneID:8201397"
     mRNA            complement(join(<879874..880137,880254..>880295))
                     /locus_tag="PAS_chr4_0448"
                     /product="Lsm (Like Sm) protein"
                     /transcript_id="XM_002493835.1"
                     /db_xref="GeneID:8201397"
     CDS             complement(join(879874..880137,880254..880295))
                     /locus_tag="PAS_chr4_0448"
                     /codon_start=1
                     /product="Lsm (Like Sm) protein"
                     /protein_id="XP_002493880.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0448"
                     /db_xref="EnsemblGenomes-Tr:CAY71701"
                     /db_xref="GeneID:8201397"
                     /db_xref="GOA:C4R7X6"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016654"
                     /db_xref="UniProtKB/TrEMBL:C4R7X6"
                     /translation="MLFFSLFKTLTDQQFKNNVEITGTLKSVDQYLNLKLDNIQYISD
                     EDNEFPHLFGVKSLFIRGSGIRYIHIDPSSVDTNLLQDASRRGMSNFQFFMLMRSVY"
     gene            complement(<880483..>882006)
                     /locus_tag="PAS_chr4_0449"
                     /db_xref="GeneID:8201398"
     mRNA            complement(<880483..>882006)
                     /locus_tag="PAS_chr4_0449"
                     /product="Protein required for the hydroxylation of heme O
                     to form heme A"
                     /transcript_id="XM_002493836.1"
                     /db_xref="GeneID:8201398"
     CDS             complement(880483..882006)
                     /locus_tag="PAS_chr4_0449"
                     /codon_start=1
                     /product="Protein required for the hydroxylation of heme O
                     to form heme A"
                     /protein_id="XP_002493881.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0449"
                     /db_xref="EnsemblGenomes-Tr:CAY71702"
                     /db_xref="GeneID:8201398"
                     /db_xref="GOA:C4R7X7"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="UniProtKB/TrEMBL:C4R7X7"
                     /translation="MSLSKTRFFFLKNTSLLSTCKPYLSQISLNLGASKRSKILPTAS
                     TSKKPVDQFLFSQKKLLADHRGNRGVRRFHTLPSRFQSQSAALNQGFQVAKAQSAKTS
                     SKWPINSHKSVGYVCIGTSILVFAIVVVGGLTRLTESGLSITEWKPITGSVPPLTEED
                     WKLEFEKYKQSPEFQELNSHITLEEFKFIFSMEWGHRLLGRVIGLSFVLPTFYFIARR
                     KCSKDVALKLLAICSMIGFQGFIGWWMVYSGLDKQQLAERNSKPTVSPYRLTTHLGTA
                     FVIYCYMIYTGLQVLKNYKIMKQPEAYVQIFKQIASPKLKTFKRLSSVLLGLVFITAM
                     SGGLVAGLDAGLIYNTFPHMGDDIIPSSNELMSPVFARKADQSDLFWRNMLENPTTVQ
                     LNHRILAVTTFFSVFAVHMYSHRLRPIIPKNAYRTLNACMGLVTIQAALGITTLIYLV
                     PIELATAHQAGALGLLTGILVLFQQLRRPNVANIALLKRSLQQLSKTGAKGASKPLN"
     gene            complement(<882769..>884703)
                     /locus_tag="PAS_chr4_0450"
                     /db_xref="GeneID:8201399"
     mRNA            complement(<882769..>884703)
                     /locus_tag="PAS_chr4_0450"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493837.1"
                     /db_xref="GeneID:8201399"
     CDS             complement(882769..884703)
                     /locus_tag="PAS_chr4_0450"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493882.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0450"
                     /db_xref="EnsemblGenomes-Tr:CAY71703"
                     /db_xref="GeneID:8201399"
                     /db_xref="GOA:C4R7X8"
                     /db_xref="InterPro:IPR021988"
                     /translation="MRTRLNFLLLCIASVLSVIWIGVLLTWNDNNLGGISLNGGKDSA
                     YDDLLSLGSFNDMEVDSYVTNIYDNAPVLGCTDLSYHGLLKVTPKHDLACDLEFIRAQ
                     ILDIDVYSAIKDLEDKALTVKQKVEKHWFTFYGSSVFLPEHDVHYLVRRVIFSAEGKA
                     NSPVTSIIVAQIYDKNWNELNGHFLDILNPNTGKVQHNTFPQVLPIATNFVKGKKFRG
                     AEDPRVVLRKGRFGPDPLVMFNSLTQDNKRRRIFTISPFDQFKTVMYDIKDYEMPRYE
                     KNWVPFFLKDNQEAVHFVYSFNPLRVLKCSLDDGSCDIVFEIPKVDSMSSELRGATPM
                     INLPQAIPMAKDKEIWVSFPRTRIANCGCSRTTYRPMLMLFVREGSNFFVELLSTSLD
                     FGLEVLPYSGNGLPCSADHSVLIPNSIDNWEVVDSNGDDILTLSFSEADKSTSVIHIR
                     GLYNYLSELDGYQGPEAEDEHNFQRILSDLHFDNKTTVNNFIKVQSCALDAAKGYCKE
                     YGLTRGEAERRRRVAEERKKKEKEEEEKKKKKEKEEEEKKRIEEEKKKIEEKERKEKE
                     KEEAERKKLQEMKKKLEEITEKLEKGQRNKEIDPKEKQREEEERKERVRKIAEKQRKE
                     AEKKEAEKKANDKKDLKIRQ"
     gene            complement(<885282..>887240)
                     /locus_tag="PAS_chr4_0451"
                     /db_xref="GeneID:8201400"
     mRNA            complement(<885282..>887240)
                     /locus_tag="PAS_chr4_0451"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493838.1"
                     /db_xref="GeneID:8201400"
     CDS             complement(885282..887240)
                     /locus_tag="PAS_chr4_0451"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493883.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0451"
                     /db_xref="EnsemblGenomes-Tr:CAY71704"
                     /db_xref="GeneID:8201400"
                     /db_xref="GOA:C4R7X9"
                     /db_xref="InterPro:IPR021988"
                     /translation="MVDLFQWLKFYSMRRLGQVAITLVLLNLFVFLGYKFTPSTVIGS
                     PSWEPAVVPTVFNESYLDSLQFTDINVDSFLSDTNGRISVTCDSLAYKGLVKTSKKKE
                     LDCDMAYIRRKIFSSEEYGVLADLEAQDITEEQRIKKHWFTFYGSSVYLPEHEVHYLV
                     RRVLFSKVGRADTPVISLLVAQLYDKDWNELTPHTLEIVNPATGNVTPQTFPQLIHVP
                     IEWSVDDKWKGTEDPRVFLKPSKTGVSEPIVLFNLQSSLCDGKRGMFVTSPFRSDKVN
                     LLDIEDKERPNSEKNWSPFFLDDVEVSKYSTGYVHFVYSFNPLKVIKCSLDTGACRMI
                     YESPEEGRFGSELRGATPMVKLPVHLSLPKGKEVWVAFPRTRLRDCGCSRTTYRPVLT
                     LFVKEGNKFYTELISSSIDFHIDVLSYDAKGESCSGSISVLIPNGIDSWDVSKKQGGK
                     SDILTLTLSEADRNTVVVHVKGLLDYLLVLNGEGPIHDSHSFKNVLSTNHFKSDTTLL
                     NSVKAAECAIFSSRDYCKKYGETRGEPARYAKQMENERKEKEKKEKEAKEKLEAEKAE
                     MEEAVRKAQEAIAQKEREKEEAEQEKKAQQEAKEKEAEEKAAKEKEAKENEAKKKIIV
                     EKLAKEQEEAEKLEAKKKLYQLQEEERS"
     gene            complement(<887814..>889379)
                     /locus_tag="PAS_chr4_0452"
                     /db_xref="GeneID:8201401"
     mRNA            complement(<887814..>889379)
                     /locus_tag="PAS_chr4_0452"
                     /product="Putative protein of unknown function"
                     /transcript_id="XM_002493839.1"
                     /db_xref="GeneID:8201401"
     CDS             complement(887814..889379)
                     /locus_tag="PAS_chr4_0452"
                     /codon_start=1
                     /product="Putative protein of unknown function"
                     /protein_id="XP_002493884.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0452"
                     /db_xref="EnsemblGenomes-Tr:CAY71705"
                     /db_xref="GeneID:8201401"
                     /db_xref="InterPro:IPR008010"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y0"
                     /translation="MPEQVKPTQRPRSKSSLSDKETHITFWKLFKNELRKNLDSKPER
                     TTPDLKYIQSLEHLTNLYTVPFYLEQFMSFGLVYCLNSFLTLLTIIPLRVLMVSILKL
                     RAAFTNSVPGRYRFKREDVTWILLLLSSSIAISSIDTSKIYHNIKAGTVIKLYVMVSV
                     LEVADKLLSSLGQDILRVSFNFPLERSLSCAGKCFLVALLSTTYISVHACVFVYQIMS
                     LNVAVNSYSNALLTLLLSVQFAEIKSAVFKRLEREGLFQMACADLYERFQLFLMLFII
                     SVRNLVQLLMSTEFSIRSRSLGENIAISPVVISWIGMLMGPSFAVIGSELLVDWLKHL
                     YIGKFNRIKPQIYRRYTRILSQDFLREYRQNDPDCTNPPATTESFATMNIRLGLPLLP
                     ITVAFCKMVISSVRKACSTQNFDQSVLLAVASAAVILILLRMSTYVMLIRWARHNTRA
                     KTSPSGGDYLKGSPNTSLAGIEDIHTRSLLYGSDEKMPQSKEEQRSHNANRDGDKSLA
                     QVSRFEMHDKRIW"
     gene            <889562..>890293
                     /locus_tag="PAS_chr4_0453"
                     /db_xref="GeneID:8201402"
     mRNA            <889562..>890293
                     /locus_tag="PAS_chr4_0453"
                     /product="Protein with a role in transcription"
                     /transcript_id="XM_002493840.1"
                     /db_xref="GeneID:8201402"
     CDS             889562..890293
                     /locus_tag="PAS_chr4_0453"
                     /codon_start=1
                     /product="Protein with a role in transcription"
                     /protein_id="XP_002493885.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0453"
                     /db_xref="EnsemblGenomes-Tr:CAY71706"
                     /db_xref="GeneID:8201402"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y1"
                     /translation="MFYGIQEIADLLSSFHSRSLLTPPEANKLTLTLLECLTENYTDI
                     TTLRFLSRFLTKDAYRELTKERIITHTCGYPTCSKHSAKIKDRHYTNHLELPNTFTNS
                     YCSRFHYQCSEFYLNQLSNEALFGRKDVMTLPYNDERSYESKMIMLEDIISNPNVVDS
                     DKMDDMIRSMGDINIKDDKKVSPEDWMEMFEDIKIVENQDPKKEGDFEQTEDNKDSIS
                     GEGKENPRNINNPLNIEGYTTTIKN"
     gene            complement(<890369..>891433)
                     /locus_tag="PAS_chr4_0454"
                     /db_xref="GeneID:8201403"
     mRNA            complement(<890369..>891433)
                     /locus_tag="PAS_chr4_0454"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493841.1"
                     /db_xref="GeneID:8201403"
     CDS             complement(890369..891433)
                     /locus_tag="PAS_chr4_0454"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493886.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0454"
                     /db_xref="EnsemblGenomes-Tr:CAY71707"
                     /db_xref="GeneID:8201403"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y2"
                     /translation="MVLHFSQVQAHKYGVLSLYRNLIRKARFVSQDESISDLLREIFH
                     RFKIDLRSHRIRSLLLRGEELNEKFSKTILNGAPSQEIAELISSIKLILAPAAEAKLE
                     TPILNPVRSDMEIQDIQARNSQKQKLNDWMQKEIKNKRKENLMSTKTPPDTVYLKEIT
                     QPEVLFKLRVQAIDKLKTTLQKGPYKAQIAYKSGLKYPAYMIRVPWGGLWRERRFLYQ
                     AMLETDRLNEATTQLANNKSLMKKYYDMENQWDRLTGHSDGDWLSVFRIAEKEIDAQS
                     SKLVSEIKEYNKRQIQISHLTQKQLDAYYEARKANFTQLVKELKNYELNPHHSDIDLG
                     ELLEIYNFKSPTKLPLLGIN"
     gene            <891858..>892217
                     /locus_tag="PAS_chr4_0455"
                     /db_xref="GeneID:8201404"
     mRNA            <891858..>892217
                     /locus_tag="PAS_chr4_0455"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493842.1"
                     /db_xref="GeneID:8201404"
     CDS             891858..892217
                     /locus_tag="PAS_chr4_0455"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493887.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0455"
                     /db_xref="EnsemblGenomes-Tr:CAY71708"
                     /db_xref="GeneID:8201404"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y3"
                     /translation="MLNSTGGLSNDADANIEGNEIQIPKSSFDLSDDEDDEVVFGDDN
                     EGRAEPSNESNETEKLNPNAIKIALIKELSPLRIELLENTTKIQDIIDQNDREVNLAV
                     ALDDEEFNVLVPSQEEQ"
     gene            complement(<892299..>892938)
                     /locus_tag="PAS_chr4_0456"
                     /db_xref="GeneID:8201405"
     mRNA            complement(join(<892299..892733,892918..>892938))
                     /locus_tag="PAS_chr4_0456"
                     /product="40S ribosomal protein S13"
                     /transcript_id="XM_002493843.1"
                     /db_xref="GeneID:8201405"
     CDS             complement(join(892299..892733,892918..892938))
                     /locus_tag="PAS_chr4_0456"
                     /codon_start=1
                     /product="40S ribosomal protein S13"
                     /protein_id="XP_002493888.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0456"
                     /db_xref="EnsemblGenomes-Tr:CAY71709"
                     /db_xref="GeneID:8201405"
                     /db_xref="GOA:C4R7Y4"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="InterPro:IPR012606"
                     /db_xref="InterPro:IPR023029"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y4"
                     /translation="MGRMHSSGKGISASALPYSRNPPSWFKLTPDDVVQQVIKYARKG
                     LTPSQIGVLLRDAHGVAQTRFITGNKILRILKSNGLAPAIPEDLYYLIKKAVSVRKHL
                     ERNRKDKDSKFRLILIESRIHRLARYYRTVSVLPPNWKYESATASTLVN"
     gene            <893527..>896079
                     /locus_tag="PAS_chr4_0457"
                     /db_xref="GeneID:8201406"
     mRNA            join(<893527..893565,893632..>896079)
                     /locus_tag="PAS_chr4_0457"
                     /product="Putative protein kinase of unknown cellular
                     role"
                     /transcript_id="XM_002493844.1"
                     /db_xref="GeneID:8201406"
     CDS             join(893527..893565,893632..896079)
                     /locus_tag="PAS_chr4_0457"
                     /codon_start=1
                     /product="Putative protein kinase of unknown cellular
                     role"
                     /protein_id="XP_002493889.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0457"
                     /db_xref="EnsemblGenomes-Tr:CAY71710"
                     /db_xref="GeneID:8201406"
                     /db_xref="GOA:C4R7Y5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y5"
                     /translation="MSRYINERAAYAQLVGDYECLIKEFQNPDVEEIGNYKVLRVLSE
                     GPFGVVYLAQHKMLHYKVVLKKGERDLSKNGDNIMRECYYLREFNHPHITKIFETIFT
                     ENYVYMSIEYCCQGDLFDYLSKRRQIPTEEAVKIFSQLCGSVHYIHKRGCCHRDLKLE
                     NILLDEDNNVKLSDLGFTREIPHFYPNGNSAPNPHSPLHTFCGTTVYMAPELIRREQY
                     SGIRTDLWALGIILFTMLYGEMPFDTEDEILEQEPVYKDFISPSIIDLLKTLLKKDAK
                     ERFDSLEVVLQAPALQPYGEQQLQLLQDLRKQKLPDFDSPLERHLLKKIDRIGIDRKL
                     LKKSYRNRQLDSLVGFWNILVEREKHQYHKKKRRKSKLATRSRSMLKLNSNRSMNGIG
                     SRDRSMLSIPELLQNLQIQGPRKAAAIENANGNAMTNGTSEGPVSESSPRESDDFAYP
                     HQNHLFRPASYNSILSNPSIKQKLSLKYWKQKLKQMKNGSKTSLNFDEKKRNPSLVDS
                     RLDVANPEDRSKIRDNTHFNSQLGSIPAGEPTSGYTRQRRASGSGSITKRPTSVFSAF
                     SQFSETSGGSDYNAGYSTDNTVQNTSNITDRNPNAQPVYNRSKSNDGLFSTKSKQPDN
                     LTLESPTSNTDLSRCNSLESSSISFSSKRGRRRHNSRLPSGSVIRTRRGFDFIHRGKS
                     PLGFYECAMFPDRNKTRVNQKPIIVEEDSSKFFEEDEEDEEGENEIPNGSQLEPPIQL
                     MKVDGMQNLVNGVDTVGDVYEDEHDEEDDHGLEIKTTPRIHLDTRPVLRSDSKVIYDS
                     ASDSATTGDEADEEDECELEDESTVLQKGP"
     gene            complement(<896112..>897578)
                     /locus_tag="PAS_chr4_0963"
                     /db_xref="GeneID:8201407"
     mRNA            complement(<896112..>897578)
                     /locus_tag="PAS_chr4_0963"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493845.1"
                     /db_xref="GeneID:8201407"
     CDS             complement(896112..897578)
                     /locus_tag="PAS_chr4_0963"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493890.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0963"
                     /db_xref="EnsemblGenomes-Tr:CAY71711"
                     /db_xref="GeneID:8201407"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y6"
                     /translation="MWYGHRYQVIKCTKFLTMDPDIAWEYAKPDFLFDDDTVCFTIFY
                     LHPYQTDISGKLSKLFDQLTIQLDPYIKYYPWLNALPKMVVDRKDNYHYIYGELNYQD
                     AFEDAWLLLQVLTKFTSRDDNLYLHAFDQNGEILLIELHDKIPKWLSSSNGGNRCWIN
                     NRQILVIPESCEPGSGLKLQDSLEFLLKYPFKCLKLELPSITSEFPKRALQLIHTQKA
                     LVDKSTRSLIISHLSPSQMAQAINEYSKLHPHPSFLPASNVVDTPKTIYIQLPYLLST
                     YLDLSTNSFDEDLALEKKGWILQQSVRSYLKEHDLNLEQTEISEVELAEHNETILRDP
                     LQSELKRLEIITHHVKPKHIELTQDGEDDAWIEEFREVFFNLNRQSDTTNTVNDEKEH
                     DNAEVPVSSGEREAEKDEDSITREYLKQENIDIDEDDFFEFFCKEALKMDDKTMETLI
                     NYEPDNDIEDEDFSDDEDEKIDSEQFKLIQNLLRSMKH"
     gene            <897654..>898568
                     /locus_tag="PAS_chr4_0459"
                     /db_xref="GeneID:8200996"
     mRNA            <897654..>898568
                     /locus_tag="PAS_chr4_0459"
                     /product="Conserved protein involved in autophagy and the
                     Cvt pathway"
                     /transcript_id="XM_002493846.1"
                     /db_xref="GeneID:8200996"
     CDS             897654..898568
                     /locus_tag="PAS_chr4_0459"
                     /codon_start=1
                     /product="Conserved protein involved in autophagy and the
                     Cvt pathway"
                     /protein_id="XP_002493891.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0459"
                     /db_xref="EnsemblGenomes-Tr:CAY71712"
                     /db_xref="GeneID:8200996"
                     /db_xref="GOA:C4R7Y7"
                     /db_xref="InterPro:IPR007239"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y7"
                     /translation="MGATIDEDIKERIWNGKINIKVSLAPIDHKVNASQISFYTRLPR
                     NSFLPIYLPQMLDFFASSIKDPEWANQGNWWFSFQDVPIRWNLPIGVNFDIMTGLNPD
                     EPTLEEWNIILNYSNYPNTIVPIFNSKKSNGANFHRHDDRIQFFHVYWLNQMKESCYC
                     INGNCNSIMSLSKTDSNLFWGSLLSHARDTFMSINQKHVPLDPLNIRIIPIRIHISIL
                     NKVIQPNVTPTKDDQKDLTTLGDILQETIPELFPSSLMYTIAFPITHGIKLPINLSLI
                     DLYSYFAFSDGFVHISVVFNQPKPLYII"
     gene            complement(<898733..>899677)
                     /locus_tag="PAS_chr4_0460"
                     /db_xref="GeneID:8201408"
     mRNA            complement(<898733..>899677)
                     /locus_tag="PAS_chr4_0460"
                     /product="Nonessential protein that binds actin filaments
                     and localizes to actin patches and cables"
                     /transcript_id="XM_002493847.1"
                     /db_xref="GeneID:8201408"
     CDS             complement(898733..899677)
                     /locus_tag="PAS_chr4_0460"
                     /codon_start=1
                     /product="Nonessential protein that binds actin filaments
                     and localizes to actin patches and cables"
                     /protein_id="XP_002493892.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0460"
                     /db_xref="EnsemblGenomes-Tr:CAY71713"
                     /db_xref="GeneID:8201408"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="InterPro:IPR026113"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y8"
                     /translation="MSKADPTAGVSETKPPLDSRIGRDDPFTFGQRYLNNEEDVFKHN
                     AWDHVEWGDEQVMEAQEKIKKQYEAPVREFDKNLYNSQPAKYWDIFYRNNKENFFKDR
                     KWLQIEFPSLYEATKEDYGPVKIVELGCGAGNTLFPILTQNKNKDLSIVGADYSKNAI
                     KLVKENEDFDPQYASACVWDLSNPDLELPEGVEPHSVDIIIMVFVFSALSPDQWDSAV
                     KNLEKMLKPGGHILFRDYGRYDLAQVRFKKNRLLDDNFYVRGDGTRVYFFTEEELREI
                     FGKVFKEKEIGTDRRLLVNRKKQLKMYRIWLQAVFESA"
     gene            <899945..>901393
                     /locus_tag="PAS_chr4_0461"
                     /db_xref="GeneID:8201409"
     mRNA            <899945..>901393
                     /locus_tag="PAS_chr4_0461"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493848.1"
                     /db_xref="GeneID:8201409"
     CDS             899945..901393
                     /locus_tag="PAS_chr4_0461"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493893.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0461"
                     /db_xref="EnsemblGenomes-Tr:CAY71714"
                     /db_xref="GeneID:8201409"
                     /db_xref="UniProtKB/TrEMBL:C4R7Y9"
                     /translation="MVNRINFEDDLAHEFSQFAPSLVSKYRHNLKDVKGVDNGVSLEE
                     IPRSMIYKMFVNKSSRDKSVSHLRGNRVTSCVPELQFYEDLEPPVLPFKSEYSEESYN
                     LKHKTVTREAPRVLGGFSDHAPRGKSLASSKNSSQNIKQRSVSMFEPLGNKKQDQMGL
                     IKKLKRNSKTLEGKSSSQSSQRSLSSEIFKLPIKSKATSTQQPPIPESLRCIPAPCML
                     EKKEQSLTSSRSRSTSTAPSSLRSNSTRNTMLKKSTKPLPLPPVIKEDSSTVSSTDSL
                     DKLFDLYCSTTNSSTESSIKQSPTLETRSFHAKIDSGCSAPSTEPGLSYCCSSALDSQ
                     FSFEEEDKLPIAITTIPGKSLPQLPVKTFSQSEVRDYENSFKPKVLGIGIPPPLPRHF
                     RRSTEIEARTDLGRKPSQVKQDGSDTKIFTRKPRTLKKELNEIIELPEHSGSVNSIIP
                     FILADYDEKSSLRVVNRTTPTQSRDITPRAVE"
     gene            complement(<901649..>902761)
                     /locus_tag="PAS_chr4_0462"
                     /db_xref="GeneID:8201410"
     mRNA            complement(<901649..>902761)
                     /locus_tag="PAS_chr4_0462"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493849.1"
                     /db_xref="GeneID:8201410"
     CDS             complement(901649..902761)
                     /locus_tag="PAS_chr4_0462"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493894.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0462"
                     /db_xref="EnsemblGenomes-Tr:CAY71715"
                     /db_xref="GeneID:8201410"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z0"
                     /translation="MLSPRKAHRHKRSTAISGDFDLSEFAGGDLSHSHYRSPSNSNNQ
                     FNIGSPLRSGQALDLNPKFTFSNKTEGTPLYSPSKGSQTPITPHENYTSTFDEPSFRS
                     PRSNKSPRQRFFLSDDTKIENDIPAALIDLDDIGKNKRNVTLSLDQDTSSKLHKRTES
                     APEFFNFSPTKFHSHLIIEEEDDNSNSNMNSISSFHKAADVTENKTVANKHINNGPSL
                     QLLELQPAINVNRIPSTTPLKSPDLNGESKQKEKSPSSSIFQMDIEHSLNSHSSLSTG
                     QKSVSSRRKSMSPVKPMTLNYADIRLSVGEPGPKVLKEREKGKENVISPKKSETSKNH
                     RRSKSFNFSFLSSSVEDEKTSKGRGRFLHWMRRKRD"
     gene            complement(<903240..>904598)
                     /locus_tag="PAS_chr4_0463"
                     /db_xref="GeneID:8201411"
     mRNA            complement(<903240..>904598)
                     /locus_tag="PAS_chr4_0463"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493850.1"
                     /db_xref="GeneID:8201411"
     CDS             complement(903240..904598)
                     /locus_tag="PAS_chr4_0463"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493895.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0463"
                     /db_xref="EnsemblGenomes-Tr:CAY71716"
                     /db_xref="GeneID:8201411"
                     /db_xref="GOA:C4R7Z1"
                     /db_xref="InterPro:IPR013233"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z1"
                     /translation="MERRVTFYAKEQLKADSFYNLFSPEETEITISESKDVPISIQYR
                     LTFPKELYPPLESIVERVASLRITYRNEELAGESENMFCGHLASGFNAYFVPLTMDQN
                     EIWSIADKIGSQFGAQGDEFIVTPFSVNYHKKRIDNYDLLPLLDLLRKLKIEEVHGLD
                     IQLVDSKVFVDVSYPLKSTMNIKEEDGIQTEVAILHLDEKLSNIENYALKGVRFQYPA
                     VEGPPGKGLETLFQVIPRHRFLPDEISFKGTLEHVGMHPKLKLSGLENVKPPFIQEGE
                     SLCRLFYYTPLSKHSFIDRYMIQDQSENVNLVAGFGEMNLEKPEWAVKKWGSEYLMEI
                     LNYKEGEALIPLHLRYGDVAKDTQYSEIDFELGDLFYACDSIDIQEQAVLERNVFQKR
                     SLGYERYFDNKTLFYHAKGHWQNNSDVYEVPIGDSTYAKHIDIATLSLVGLGAIYLIS
                     CL"
     gene            complement(<904746..>907232)
                     /locus_tag="PAS_chr4_0464"
                     /db_xref="GeneID:8201412"
     mRNA            complement(<904746..>907232)
                     /locus_tag="PAS_chr4_0464"
                     /product="AdoMet-dependent methyltransferase involved in
                     rRNA processing and 60S ribosomal subunit maturation"
                     /transcript_id="XM_002493851.1"
                     /db_xref="GeneID:8201412"
     CDS             complement(904746..907232)
                     /locus_tag="PAS_chr4_0464"
                     /codon_start=1
                     /product="AdoMet-dependent methyltransferase involved in
                     rRNA processing and 60S ribosomal subunit maturation"
                     /protein_id="XP_002493896.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0464"
                     /db_xref="EnsemblGenomes-Tr:CAY71717"
                     /db_xref="GeneID:8201412"
                     /db_xref="GOA:C4R7Z2"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR012920"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR024576"
                     /db_xref="InterPro:IPR028589"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z2"
                     /translation="MGTKTQKKNSKGRLDRYYYLAKEKGYRARSSFKLLQINEKYGHF
                     LEKSRVVIDLCAAPGSWCQVASQVCPVNALIIGVDIVQIKPLPNCLTFQSDITTEDCR
                     SKLRGHMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLGVGGTFVTK
                     IFRSKDYNNLMWIFQQLFDKVEATKPPASRNVSAEIFVVCKGFKAPKRIDPRLLDPKE
                     VFQEVQSGAANNEAKVFNPHKKVRKREGYEEEDYLQFKTLPLMDWVKQEVDVVNILGT
                     LNQFTIDKEDPDWKQVKKMEQTTKEFLECCKDLKVLGKKDFKHLLKWRKKARLLLELD
                     KVEEKEDALVDVEPLDEEAQITKELDELVQNERQKQKREKRKKNEQKQDIIRRMQMNM
                     LTDMQIGVDAVKADSASLFNLKIAERTGKLDDLASGKRAMVFHSEKDKPKPMVIVEET
                     KEVDSETEIDLLENELNMGYAHELQKKIEKNPRLLAKDKTEGDDEEWEGIVSAEERKS
                     SDDDYSDDDSDFDSDTERVLDSLIANRKIEEHNNDTGLSTTAQSFFSDSVFQALDSDE
                     EEEQQAASKKLQHTQSLQRVEEESENDEELDEAEGSSESEFEIVPPKSQWNEDEMDIS
                     DEEEDTNLTKANQKNVDLATVEAMTLAHQVALGRMTKKDLIEEGINKYSFRQTNGLPA
                     WFIDDEKEHSKIVKPITKEASDAIKEKMRELNARPIKKVMEAKGRKKMRALRRFEKMR
                     KKSDLINDDSAKSENDKAEQINALMRRLSKKENKKPKVTLIRATGKNRGVSGRPKGVK
                     GKYKMVDGVLKNEQRALRRIEKKSKNKKKH"
     gene            <907470..>908939
                     /locus_tag="PAS_chr4_0465"
                     /db_xref="GeneID:8201413"
     mRNA            <907470..>908939
                     /locus_tag="PAS_chr4_0465"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493852.1"
                     /db_xref="GeneID:8201413"
     CDS             907470..908939
                     /locus_tag="PAS_chr4_0465"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493897.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0465"
                     /db_xref="EnsemblGenomes-Tr:CAY71718"
                     /db_xref="GeneID:8201413"
                     /db_xref="GOA:C4R7Z3"
                     /db_xref="InterPro:IPR003333"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z3"
                     /translation="MSQTESTKGVKITNYAAIKNAPLPADGPGAKNFSNWLLLGLLTG
                     VPLFVTRKFHGGLKTFIFFFILFAIPILMAYWTVLSSYSPRLNEKVQFPNRGVEHYLK
                     FHDDQLAARYQGQNKIPMETFHELYFEGKVSFKGDALDALEYRHDWASFRFTLSLFRF
                     FLLGMIPEVIMHSRSQDEEQVRDHYDRGDDFYSWFLGDRMVYTSGLISDVNKDESLEE
                     LQDNKLKTVCEKIQLKEGEYLLDLGCGWGTLAAFASSQYGAKVTGITLGKNQTKYGND
                     KIASFGVDEKQSRILCHDYRDTPLPKDENGNTTKYDKITCLEMAEHVGVRKFRSFLQQ
                     VYDMLDDDGVFFLQYAGLRKSWQYEDLIWGLFMNKYIFPGADASTPLDFVVSALEATG
                     FETVSIDNIGVHYSATLYRWYKNWLSNRDNVVNKYGIKWFKIWEYFLASSTIISRQGS
                     ATCYQIVLRKNLNSYDRAGYISTQEGLQGPISRKTDWVK"
     gene            complement(<911936..>913963)
                     /locus_tag="PAS_chr4_0467"
                     /db_xref="GeneID:8201414"
     mRNA            complement(<911936..>913963)
                     /locus_tag="PAS_chr4_0467"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493853.1"
                     /db_xref="GeneID:8201414"
     CDS             complement(911936..913963)
                     /locus_tag="PAS_chr4_0467"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493898.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0467"
                     /db_xref="EnsemblGenomes-Tr:CAY71719"
                     /db_xref="GeneID:8201414"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z4"
                     /translation="MFKNCEPTDTLSLEACKKIDREYYNAKNSLAYLLNQEVLHNVAK
                     LQLYRTPEEEEVTTEQLRLFQIVQTTYCYCEFTLCQSRTFKDPLFTESEKCLVSESLN
                     IFLVAISTNDSFGTVAIHRYLLSFLLQTSEFFQLFPNVPSHWMSLDRQNASLKDEKIW
                     PSSYFETKLFPLFEAIQRVSFAPTSHQFPDEFGIFYDCFQNIIKCANNSIQVENWVKQ
                     SGKLVRFIVKPFEDISVAMLIQAPKFEPILYKYQFPLLRMMDGTPISDIDVNIKVLFQ
                     HIKEEETTAVNPSLLFNIRLLERWLCKILKLMIDCQARDIRINIFKEIRRNILDLINA
                     FFIREDINCSICYYTVYLLSEFVKIFSIEHEMLQEEFLTPLINETSLEKMFLHCLNRD
                     PNKDMIEDINHWNKLTNSQVFVFKLVYQLFNFGLDQTLAVLFLKEPSQLCKEVCHPQL
                     EPAKENEILRSMCYAITGSKSCIVDTDQVARQIVQNLISQNKLAADNSKGNDVNKNQR
                     LEFDSSKSLSFYLLSTQVSYFYNDPITCFFSSGLLVLLNRLVDSFDTGCAIPPIKEVT
                     SKEGFENTIGIISRIIVENYNCFQLYREIISKKGGSFKYIKPSESIQQLLLQSNNKTL
                     SQTQECLIEFIESNEVVDISVLRQNMQLFETLVTSLYCIEKAKSIRTHDHK"
     gene            <914469..>915560
                     /locus_tag="PAS_chr4_0468"
                     /db_xref="GeneID:8201415"
     mRNA            <914469..>915560
                     /locus_tag="PAS_chr4_0468"
                     /product="Transcription factor required for gene
                     regulation in repsonse to pheromones"
                     /transcript_id="XM_002493854.1"
                     /db_xref="GeneID:8201415"
     CDS             914469..915560
                     /locus_tag="PAS_chr4_0468"
                     /codon_start=1
                     /product="Transcription factor required for gene
                     regulation in repsonse to pheromones"
                     /protein_id="XP_002493899.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0468"
                     /db_xref="EnsemblGenomes-Tr:CAY71720"
                     /db_xref="GeneID:8201415"
                     /db_xref="GOA:C4R7Z5"
                     /db_xref="InterPro:IPR007757"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z5"
                     /translation="MSKVEVAHPTEKRTTTNSNSNKVSILLRNKFKQKYLAMNSAFPN
                     HYSHPSKKSKQKFIVNKSSKDYFKNDHTNQFIHTGKRPIENIRNIENPVSGYPKLQRL
                     LSLKQDQINKYRSKPFGARVPTEKMVETIDRWVSKQKLTFDVIMIGGLSENQFIYPLL
                     LNLQLDKLCSKPGFLFFWASTQQVQQLTRLLESSSWGGKFRRSEELVFLPVGRDSKYI
                     PDKNDIPEESLLQQKQWHCWMCITGTVRRSTDSHLIHCNVNTDIIVENTLMTSSCNNI
                     VPISMYELVENFSSSTRRLHILPASVGLEHSLKLRPGWVIVGPDVLVDNFDPSVYKQE
                     ISSVGSNVPSTDEIDLLRPKSPNRRLSYC"
     gene            complement(<915820..>916905)
                     /locus_tag="PAS_chr4_0469"
                     /db_xref="GeneID:8201416"
     mRNA            complement(<915820..>916905)
                     /locus_tag="PAS_chr4_0469"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493855.1"
                     /db_xref="GeneID:8201416"
     CDS             complement(915820..916905)
                     /locus_tag="PAS_chr4_0469"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493900.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0469"
                     /db_xref="EnsemblGenomes-Tr:CAY71721"
                     /db_xref="GeneID:8201416"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z6"
                     /translation="MALSLKRSSTTSDSSIRKKLCPNTNYGRSASISLAQLSSPVCQS
                     KPMKKRLSSLPVESSSSEAEDEEDDDCPRPKAGVFRLGSMDLSLSPAFAKYSQEDDYD
                     EEDDDSNVMVSKPIGHRATNKHSFSLLTNERENPNSDISSLNRMKRASFNTSPPKLTD
                     LSFLSTSSGHSSRSRHCVPESDVTARSRCFDYLIGAIDEAWARYCDATSNTEDQVYGF
                     SKSSHHQQHQRTRSLSTNSAQQILPNTPNSIFSSDEEDVEAENNDEDNGDLTDITDYE
                     SDNNRISEKPSNLRLQDLKDKLIKSKYHLQDFVESNNIDDSLSFWKRWDLIKYSTIEL
                     VEDDDNDDVVGDTIIEELEAGRFEGSF"
     gene            complement(<917779..>919338)
                     /locus_tag="PAS_chr4_0470"
                     /db_xref="GeneID:8201417"
     mRNA            complement(<917779..>919338)
                     /locus_tag="PAS_chr4_0470"
                     /product="Mitochondrial aldehyde dehydrogenase"
                     /transcript_id="XM_002493856.1"
                     /db_xref="GeneID:8201417"
     CDS             complement(917779..919338)
                     /locus_tag="PAS_chr4_0470"
                     /codon_start=1
                     /product="Mitochondrial aldehyde dehydrogenase"
                     /protein_id="XP_002493901.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0470"
                     /db_xref="EnsemblGenomes-Tr:CAY71722"
                     /db_xref="GeneID:8201417"
                     /db_xref="GOA:C4R7Z7"
                     /db_xref="InterPro:IPR010061"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z7"
                     /translation="MAVQLSSTAIAYPTGHTKETDKPYPTFSFINNAFVESKSTEWFD
                     VHDPTTNFVVSKVPQSTEEELEEAIESSHIAFQSWKKVSIIKRQQFAFKLVELLRENF
                     DRIASVIVLEQGKVFADAQGDVLRGLQVAEQACSITSDLKGSFLEVSADMETSMAREP
                     LGVIASICPFNFPAMIPLWTLPLAIVTGNTTVIKPSERAPGAALIIAELVEKAGIPPG
                     VVNIVHGKVPTVNKLIRDPRVKAVTFVGSNKAGEYIYQEATKHGKRCQANLGAKNHLV
                     VLPDANRSQFVNAINGAAFGAAGQRCMAISVLICVGETKNWVQDVVDYAKGLKIGSGF
                     DPSSDLGPLVTPNAKERAEKIIEKSIKQGAKILLDGRGKHPEQYSKGNFLAPTILANV
                     KPDMDCYVEEIFAPVLSVINVQTLDEAIEIINKCPYGNGTSVFTTSGPAQQKFTKNVD
                     VGQIGVNVPIPVPLPMFSFTGSRGSFLGDLNFYGQAGLNFLTKPKTITRLWKTSDYED
                     SAKTTSMPTHT"
     gene            <919728..>921194
                     /locus_tag="PAS_chr4_0471"
                     /db_xref="GeneID:8201418"
     mRNA            <919728..>921194
                     /locus_tag="PAS_chr4_0471"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493857.1"
                     /db_xref="GeneID:8201418"
     CDS             919728..921194
                     /locus_tag="PAS_chr4_0471"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493902.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0471"
                     /db_xref="EnsemblGenomes-Tr:CAY71723"
                     /db_xref="GeneID:8201418"
                     /db_xref="GOA:C4R7Z8"
                     /db_xref="InterPro:IPR021988"
                     /translation="MYHLAPRKKLLIWGGSLGFVLLLLIVASSHQRIRSTILHRTPIS
                     TLPVISQEVITADYHPTLLTGFIPTDSDDSDCADFSPSGVIYSTDKLVLHDSLKDIRD
                     SLLKTQYKDLVTLEDEEKMNIDDILKRWYTLSGSSVWIPGMKAHLVVSRVMYLGTNGR
                     SDPLVSFVRVQLFDPDFNELKDIALKFSDKPDGTVIFPYILPVDIPREGSRWLGPEDA
                     KIAVNPETPDDPIVIFNMQNSVNRAMYGFYPFRPENKQVLFSIKDEEPRKKEKNWTPF
                     FVPGSPTTVNFVYDLQKLTILKCSIITGICEKEFVSGDDGQNHGIGIFRGGSNLVPFP
                     TSFTDKDVWVGFPKTHMESCGCSSHIYRPYLMVLVRKGDFYYKAFVSTPLDFGIDVRS
                     WESAESTSCQTAKNVLAVNSISNWDLLDDGLDKDYMTITLSEADVVNSVLRVRGIAKF
                     VDNLTMDDGSTTLSTSNKIDECATTGSKQYCQRYGELH"
     gene            <921370..>922719
                     /locus_tag="PAS_chr4_0472"
                     /db_xref="GeneID:8201419"
     mRNA            <921370..>922719
                     /locus_tag="PAS_chr4_0472"
                     /product="Conserved protein involved in exocytic transport
                     from the Golgi"
                     /transcript_id="XM_002493858.1"
                     /db_xref="GeneID:8201419"
     CDS             921370..922719
                     /locus_tag="PAS_chr4_0472"
                     /codon_start=1
                     /product="Conserved protein involved in exocytic transport
                     from the Golgi"
                     /protein_id="XP_002493903.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0472"
                     /db_xref="EnsemblGenomes-Tr:CAY71724"
                     /db_xref="GeneID:8201419"
                     /db_xref="GOA:C4R7Z9"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="InterPro:IPR027470"
                     /db_xref="UniProtKB/TrEMBL:C4R7Z9"
                     /translation="MSSYDSLEPESSRGELSHQPSFLKRLSSFVATGSALGNFRTLEI
                     DFDDQERELILERLSKVHGIRPAKLIGVTKPLCTWTLYYKSEDDLKYYKSRSVRGFYR
                     AQNEIINRYQQIDKLLESGIPFSLLKNYDNEDVRDGDPLNVDEETNLLLGYNRESESR
                     EVFVAIILNSIINVVLLVAKIFVVLFSSSLSLMASLVDSVMDFLSTLIIYVSNSFAGK
                     RDKNEYPVGRSRLEPLGVLVFSVIIIVSFIQVGNESLKKLISGDRDVVSLDKTTISVM
                     VFTVAAKLFAYFWCKSSKNSSVVALVEDAKTDIVFNLVSLVFPALGHWLGIWWLDPLG
                     ALLLCVYVIALWASIAFVHINNLTGSAATKIDMQTIIYLILRFSESITKITSLKAYHV
                     GDHINVEVDVICNSKLDFKEFHDLAESIQYTIELLPYVERAFVHLDYRLGNYVGHLH"
     gene            <922889..>924490
                     /locus_tag="PAS_chr4_0964"
                     /db_xref="GeneID:8201420"
     mRNA            <922889..>924490
                     /locus_tag="PAS_chr4_0964"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493859.1"
                     /db_xref="GeneID:8201420"
     CDS             922889..924490
                     /locus_tag="PAS_chr4_0964"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493904.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0964"
                     /db_xref="EnsemblGenomes-Tr:CAY71725"
                     /db_xref="GeneID:8201420"
                     /db_xref="InterPro:IPR018307"
                     /db_xref="UniProtKB/TrEMBL:C4R800"
                     /translation="MDPSQEQREWQEQSIANPQPQSGTIIEDFVFAVGIINFHHIRGP
                     EIEYWLDAEGKSPLDTEKIASINERWPYLSFEALPDGAHMFTECFSEFSLVFDQSSLF
                     GCACVRQVDRADLLNNEDKEYTRSTVQKAVVLITRYPITIQLREQLSIITMTFFEQMD
                     FRDREIVQMFYDNIRTRYKHVKILNDDPYETLTENSSNENGDGALKIIKESDFYVGLD
                     LKHLVLGLKRNLLILLKALLLEKRIMFYSKNLMKLFNSQMSFLSLIPNLLLNLQDCSD
                     PSLNSLSQNRKKLTSLKTSDRTSLLNFIGLPLKLFDKGGFFQPYLTLQQNEVLNKKTT
                     LWYLVGTSNDLFLNQKHKIADIVVHVDHLGESSIEILNEDLKPSLSLTNADKKFIDFI
                     VHQVKLAHLENEGSGSNTINNFNLSRSFNGGNEFIRNNLEDYLIGLLSTLKYEKFLEN
                     ATPTQLNSLIPIGNTNHNQLHSDVKHYNELFISEYRKSNNYQIFDDSTDDELFNFFEP
                     THAANLIASPNIWDKMAKPFQKLRR"
     gene            <924603..>925509
                     /locus_tag="PAS_chr4_0965"
                     /db_xref="GeneID:8200997"
     mRNA            join(<924603..924645,924869..>925509)
                     /locus_tag="PAS_chr4_0965"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493860.1"
                     /db_xref="GeneID:8200997"
     CDS             join(924603..924645,924869..925509)
                     /locus_tag="PAS_chr4_0965"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493905.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0965"
                     /db_xref="EnsemblGenomes-Tr:CAY71726"
                     /db_xref="GeneID:8200997"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R801"
                     /translation="MSKKLIVFGGNGFLVQWKKADVFKPESYKDILKDANAVVHSVGI
                     LLENAEYKKAINSNNDLLGEIMSFFQTSNPMTKNVSNSYDAVNRESAVLLAQTLIESK
                     GKLPKSISKAPAFVYISADQQPPFIPSGYLESKRKAEFELYQLQPGIRPVLMRPSFMF
                     DEHISGDVRSKLKDLIKLGDQFNQKILNNALKDIIRPTVSTNQVAKSVIEKINDPEYH
                     GPVLLEEIV"
     gene            complement(<925527..>927332)
                     /locus_tag="PAS_chr4_0966"
                     /db_xref="GeneID:8200998"
     mRNA            complement(<925527..>927332)
                     /locus_tag="PAS_chr4_0966"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493861.1"
                     /db_xref="GeneID:8200998"
     CDS             complement(925527..927332)
                     /locus_tag="PAS_chr4_0966"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493906.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0966"
                     /db_xref="EnsemblGenomes-Tr:CAY71727"
                     /db_xref="GeneID:8200998"
                     /db_xref="GOA:C4R802"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R802"
                     /translation="MARLEAAAEAYVDNSTTFDSFGLDPRILQAINELGYEHPTLVQA
                     KAIPLALQEKRDVIAKASTGTGKTAAYCIPILQSILSNNNRTPGIQAVILVPTRELSV
                     QVDKFLDSLTSFCSKKVKCLNLSNSVSEQIHLAQLSELPEIVISTPTKLLQLLKKSSK
                     VNLSQLKYFVIDEVDLIFSYGYDDDLKELTELYLNLQNKIQVFLMSATMNEDVEQLKA
                     LYCKAPAVLKLNDDAIKSSNLVQYYCKTGELEKFLLSYVIFKLNLIKGKTLIFVNNID
                     RGYRLKLFLEQFGIKSCLLNNELPLSSRMHTVDQFNKNVYRLLIATDESSVGEEREED
                     FLEEANETETNADEKVAEKKSTENNTEKTEENEDGEEEIEEEEKINSKSSKQRDSGFS
                     RGVDFKNVACVLNFDLPTTAKSYVHRVGRTARAGKSGMALSFVVEKRLWNKHIASNLK
                     SAKRDEKILARIMTAQGRIGSKLEPYHFNESQVEGFRYRMEDAFRAVTATAIRNARIK
                     EIKQEIMVNEKLQRHFEENPQDLLSLRHDKELHPNRVQPHLKRVPDYLLPKGARSHPT
                     VGFVPFKNTNPNKHEKRGPRGGVRKRVNPLKKFKR"
     gene            complement(<927503..>929569)
                     /locus_tag="PAS_chr4_0473"
                     /db_xref="GeneID:8200999"
     mRNA            complement(<927503..>929569)
                     /locus_tag="PAS_chr4_0473"
                     /product="Mitochondrial inner membrane ATP-binding
                     cassette (ABC) transporter"
                     /transcript_id="XM_002493862.1"
                     /db_xref="GeneID:8200999"
     CDS             complement(927503..929569)
                     /locus_tag="PAS_chr4_0473"
                     /codon_start=1
                     /product="Mitochondrial inner membrane ATP-binding
                     cassette (ABC) transporter"
                     /protein_id="XP_002493907.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0473"
                     /db_xref="EnsemblGenomes-Tr:CAY71728"
                     /db_xref="GeneID:8200999"
                     /db_xref="GOA:C4R803"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R803"
                     /translation="MRTRLSCNGLPSFSSIMRTPIRLPPSFKFRPAISFRYQSVFHSG
                     FRNASAITYKSALKPVYQPQLRFSSHKASKPDRKLPQLSQLKIIKDLMAYLWPKDNLA
                     AKVRVVIALSLLVAAKLLNVQVPFFFKSIVDNMNIDWEQNVGTVTSVIGALIIAYGGA
                     RFGAVLFGELRNAIFARVAQSAIMKVAHNTFVHLLHMDLNFHLTRQTGGLTRAIDRGT
                     KGIAYVLSAMVFHIIPITFEISVVCGILTYNYGMSFAAVTLATMIAYSIFTIRTTTWR
                     TGFRRQANNADNQAASVALDSLINFESIKYFNNESFQSMKYDAALTKYKDAQIKIATS
                     LAYLNSGQNLIFTSSLTAMMFMGCVGVSQGYLTVGDLVLINQLVFQLSVPLNFLGSVY
                     RELKQSLLDMESLFKLQKEEVEIKSLPGAPDLLVKGGEIRFENVSFGYHPDRPILKNC
                     SFTIPAGHKVAIVGPSGSGKSTILRLVFRFYDVTEGKIYIDGQNIKEVNVESLRKHIG
                     VVPQDTPLFNDTIWENVRFGRLSATDDEVRNVISQVKLDKLIQDLPNGSNTIVGERGM
                     MISGGEKQRLAISRLLLKNSKITFFDEATSALDTHTEQALLKTIKEVFKQNSNTNVSI
                     AHRLRTIADADKIIVLKEGHVIEEGTHQELLQQPGSLYSELWTIQEHMFEEEKEVEAT
                     SEKVDQ"
     gene            complement(<930242..>932371)
                     /locus_tag="PAS_chr4_0967"
                     /db_xref="GeneID:8201421"
     mRNA            complement(<930242..>932371)
                     /locus_tag="PAS_chr4_0967"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493863.1"
                     /db_xref="GeneID:8201421"
     CDS             complement(930242..932371)
                     /locus_tag="PAS_chr4_0967"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493908.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0967"
                     /db_xref="EnsemblGenomes-Tr:CAY71729"
                     /db_xref="GeneID:8201421"
                     /db_xref="GOA:C4R804"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:C4R804"
                     /translation="MNGKNFSILDLAPLYLALPTLAISFRLLGSIQKDPMLCFLQSVF
                     LSSLIPTALTFWNSWATREMTDEPQKKGNDFLVYLSLTILFFANGYLPVGRTISLVII
                     TLICTRIDAKYDSKLLKFQSLFFAGIYFIYDVARNHDKDVFPKLVISYLSLLIPYWIF
                     LHFNRNGLSLAGSEGKLRHVLISAVSFALLLWWGLDSINFQMLFIAVGSLVLLTVSQT
                     ESRLQSPFQAFDRSAFLTNPKAHLLILSLICMVVSFLSIPKHFLEYLFELSLNGFVMI
                     FLKPLSLEDAIDEANFNKSLHPKEPRSSAAKPSFISRLLKSQKSSSIFNFLLLNTSFM
                     LVQLLYSFRSKSLSLLSDSLHMLLDCTSLLLGLLANFFAAEDLERQKASKALREERER
                     KLKKRYGHLPRQEYEVKKAQLNSIQFYDSANLYPFGLARIETLAGFTNASLLLGIVFG
                     IFSEGIHRIFHPVDLQKTNELLIVSFLGLVVNLVGIYSFDHGHSHGHSHGHSHSHDHS
                     HSHENNNTHAHDHSHSKCEDDHDEHKTPDHPQHTVADNDNMRGIFLHILADTLGSVGV
                     VISTLLIKWLNIQILDPIMSLTIASLIFVSSLPLLKSSSKNLLLSVTGNHDQAIKDFL
                     SALSSIHAVKSYSTPRFWPLNGNGPKDTLTGYIHIQYYRTENSLSIKQKVQALLTNNP
                     AFDKVYIQYENEIDDCWCRRTGIVNSQ"
     gene            complement(<932530..>933726)
                     /locus_tag="PAS_chr4_0474"
                     /db_xref="GeneID:8201000"
     mRNA            complement(<932530..>933726)
                     /locus_tag="PAS_chr4_0474"
                     /product="Member of the Sir2 family of NAD(+)-dependent
                     protein deacetylases"
                     /transcript_id="XM_002493864.1"
                     /db_xref="GeneID:8201000"
     CDS             complement(932530..933726)
                     /locus_tag="PAS_chr4_0474"
                     /codon_start=1
                     /product="Member of the Sir2 family of NAD(+)-dependent
                     protein deacetylases"
                     /protein_id="XP_002493909.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0474"
                     /db_xref="EnsemblGenomes-Tr:CAY71730"
                     /db_xref="GeneID:8201000"
                     /db_xref="GOA:C4R805"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C4R805"
                     /translation="MGKTAEHESIAVGMKRERQDSVLISDSETYLPPTPQSIRKKFPE
                     TLPASTESTPTRRKRLKRVPLKYRPEKNTILEVHDVTQTLSDEPEKVGFLYHALINSQ
                     RIIVVNGAGVSVASGIPDFRSSKGIFSKYGGSSGKDLFDINLFRSSDKIQQFTSMIRD
                     LSSLVERSKPSKFHHFINELAKTSNLLRVYTQNIDCLELQCPYLETKSPLPSKAPFPN
                     VIQLHGNIKQVSCTKCHINYPLGPNFSAKMSCPECIELDNVRELVGKRTLGHGILKPK
                     IILYNEHHPDGEAIGAISEMDLKSRPDCLIVAGTSLKIPGVKRMVKEFAKAVKSCKGC
                     VIWLNKEPPPTSIINYIENMDLIVVADCDSIPDLVSGYKDKYIYKRVKTSTPQIKIDM
                     LNTCKI"
     gene            <933925..>935295
                     /locus_tag="PAS_chr4_0475"
                     /db_xref="GeneID:8201422"
     mRNA            <933925..>935295
                     /locus_tag="PAS_chr4_0475"
                     /product="Essential protein involved in transcription
                     regulation"
                     /transcript_id="XM_002493865.1"
                     /db_xref="GeneID:8201422"
     CDS             933925..935295
                     /locus_tag="PAS_chr4_0475"
                     /codon_start=1
                     /product="Essential protein involved in transcription
                     regulation"
                     /protein_id="XP_002493910.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0475"
                     /db_xref="EnsemblGenomes-Tr:CAY71731"
                     /db_xref="GeneID:8201422"
                     /db_xref="GOA:C4R806"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R806"
                     /translation="MVQISEVKESGSRESRTAAHTHINGLGLDEYGAAKKVDGGFVGQ
                     AEAREACGVIVDLIKYRKMSGKAILLAGGPGTGKTALALAVSQELGPKVPFCPIVGSE
                     LFSAEVKKTEALMENFRRAIGLRIKEIKEVYEGEVTELTPEESENPLGGYGKTISHVI
                     VGLKSAKGTKQLRLDPSIYEAIQKERVSVGDVIYIEANTGGIKRVGRSDAYATEFDLE
                     AEEYVPLPKGDVHKKKEIVQDVTLHDLDMANAKPQGGQDVLSMMGQLLKPRKTEITDK
                     LRQEVNKVVSKYISQGIAELVPGVLFIDEVNMLDIECFTYLNRALESKIAPIVILASN
                     RGKTTVRGTDDVKAPHGIPPDLVDRLLIVRTLPYNKEEIQTIIFKRAKIEGLNINEQA
                     LDRVATIGSEKSLRYGLQLLTPAGILATTSGRTEILPEDIDECLDLFLDGKRSTKILE
                     QSESYL"
     gene            <935400..>936440
                     /locus_tag="PAS_chr4_0968"
                     /db_xref="GeneID:8201423"
     mRNA            <935400..>936440
                     /locus_tag="PAS_chr4_0968"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493866.1"
                     /db_xref="GeneID:8201423"
     CDS             935400..936440
                     /locus_tag="PAS_chr4_0968"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493911.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0968"
                     /db_xref="EnsemblGenomes-Tr:CAY71732"
                     /db_xref="GeneID:8201423"
                     /db_xref="GOA:C4R807"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C4R807"
                     /translation="MAKLYFLGAGSIGGLVATQISNVTKLDIVLLLRNERRLNKYLNN
                     NSKFTYENLTNLRNPTKEEYHLRAISHIPKDHGGLPEHIDNLIITTKCHQTVEALEPY
                     ISCISEKTNILLIQNGFGVESKLKKIWPQNKVPNMFQGVISHGVFKDRFWNVKHVGNG
                     DLKIGRLANEDTEVPQFIQDLLVSPVLNAELLSFKDLLKIRLEKLIVNCCINPLTAIY
                     DCLNGELLQLSHRQFHRVINESVRCLTADKELNKIFVNDAAFAQLMDRERLLKTVLKV
                     CELTKRNSSSMREDVRQVHQTEVDFLNGYISDVGKKNKVFTPHNDILSEMVKNRVLLN
                     YKREESGARLVQ"
     gene            complement(<936453..>937766)
                     /locus_tag="PAS_chr4_0476"
                     /db_xref="GeneID:8201001"
     mRNA            complement(<936453..>937766)
                     /locus_tag="PAS_chr4_0476"
                     /product="Ribosomal protein lysine methyltransferase"
                     /transcript_id="XM_002493867.1"
                     /db_xref="GeneID:8201001"
     CDS             complement(936453..937766)
                     /locus_tag="PAS_chr4_0476"
                     /codon_start=1
                     /product="Ribosomal protein lysine methyltransferase"
                     /protein_id="XP_002493912.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0476"
                     /db_xref="EnsemblGenomes-Tr:CAY71733"
                     /db_xref="GeneID:8201001"
                     /db_xref="GOA:C4R808"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C4R808"
                     /translation="MLVDKYAQLMTWLQSSNKTFISEKLWIVDDSSTGKSIYTVQSLK
                     TNEHLVTIPREFMLNFITILLHIEKISNKTFDIPNEYRIANIPSPSPEDSDYNLIYQQ
                     FKGDELMDLSSYQLISMFLVIESHKKNSFWKPFIEVLALLSDFAYAPLIWLVENTNEI
                     FFRKLPPPTQAHALAQLERFNLDYSVIINLLSTKYINIEVERLISKREFLRMWMCCNS
                     RCLYMELPSFLNKSKEDNFTMVPYVDFLNHSSEDGCTVKINSFGFQVTSGLNYPENSQ
                     LYFKYGAHSNEFLLCEYGFMFERGMNSWNYIDINEQVIALMEPHHVEFLKDQGYYNDY
                     TVSLSDVSFRVQVALAVIQETPEGLSSKRITNFINGLTQGTSFEAKSKQMLKEILSGI
                     VEECQQVFNTNLQQFSNDEKYSRIITRLYEDRFDIAKTHLDLLEG"
     gene            <938170..>938895
                     /locus_tag="PAS_chr4_0477"
                     /db_xref="GeneID:8201424"
     mRNA            <938170..>938895
                     /locus_tag="PAS_chr4_0477"
                     /product="Putative dephospho-CoA kinase (DPCK) that
                     catalyzes the final step in Coenzyme A biosynthesis"
                     /transcript_id="XM_002493868.1"
                     /db_xref="GeneID:8201424"
     CDS             938170..938895
                     /locus_tag="PAS_chr4_0477"
                     /codon_start=1
                     /product="Putative dephospho-CoA kinase (DPCK) that
                     catalyzes the final step in Coenzyme A biosynthesis"
                     /protein_id="XP_002493913.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0477"
                     /db_xref="EnsemblGenomes-Tr:CAY71734"
                     /db_xref="GeneID:8201424"
                     /db_xref="GOA:C4R809"
                     /db_xref="InterPro:IPR001977"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C4R809"
                     /translation="MLVLGLTGGIASGKSTLSQHLANDKDISIVDADKIAREIVYPGK
                     PAYKKIVQYFGPKIPNLVSKDGSLDRHNLGNYVFQNKAELGVLNGITHPQVRWEMFKE
                     MIWAYLSFKRIVLLDVPLLFEAKMGNICGSIIVVTSDHDLKMERLRARNPELSLEECE
                     SRINAQMSDEEKSALADVTIANNGTKEEFGNKIDIVISTLKPSKWWTMLSLFPLIGGL
                     SAIYYLLQRRRHMNQIKNKAKET"
     gene            complement(<938906..>941809)
                     /locus_tag="PAS_chr4_0478"
                     /db_xref="GeneID:8201425"
     mRNA            complement(<938906..>941809)
                     /locus_tag="PAS_chr4_0478"
                     /product="Phosphatidylinositol 3-kinase responsible for
                     the synthesis of phosphatidylinositol 3-phosphate"
                     /transcript_id="XM_002493869.1"
                     /db_xref="GeneID:8201425"
     CDS             complement(938906..941809)
                     /locus_tag="PAS_chr4_0478"
                     /codon_start=1
                     /product="Phosphatidylinositol 3-kinase responsible for
                     the synthesis of phosphatidylinositol 3-phosphate"
                     /protein_id="XP_002493914.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0478"
                     /db_xref="EnsemblGenomes-Tr:CAY71735"
                     /db_xref="GeneID:8201425"
                     /db_xref="GOA:C4R810"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR001263"
                     /db_xref="InterPro:IPR002420"
                     /db_xref="InterPro:IPR008290"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR015433"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:C4R810"
                     /translation="MEKENNSVSFCLSKDLKIPFQIKILSFEGYKATNEEYRHNHEIF
                     LTIQLVADNKLLLPSITKIVKYSHSVHHYLFKEKRNDSRSLWIKFPIHYSQLPLTCKL
                     RFILFDYHGQTGERIVVGFTELNIFNIENDDEFEYSCALKRGSQKIPVKLSSENGEVT
                     EASHTKHGLDDVNLQRKIKNFEINGKQNQSLSWLNELSNKKISQLNKLYSQKNCYLHV
                     EFKTFDIPVVYSDVKYSLINIPTITDKIGSAINENDLLSNNIESALQTPDRNVFDPEQ
                     YRDSRNDDPIELKFRKLERTHQSSFTNKDIKPTLKMRENIINVLRKQFFEKLTLQEKN
                     LIWKYRFFVLNNLILNKNYTSSQFNNFTVNFMKAINWDDDFEVKEFLTLIDKVPESTN
                     SDEQELTSQMDHRFVFITQLEIVDCLELLRGNYQNPIVRNMAIDRLRLAPDKDLEFYL
                     VQLVQCLRYETGNYDYEEMLDSSFSDDIVSSKYTFVDDDPIFRLLTDFRYLKQKHKKL
                     PDLNSPLARFLIQRSIENERLTNFFYWCLKVETDGELLQDVKQPVNPSGSYEEFIEED
                     TRSPDAGSPSTITINKKSSNIFKITLTHFIVEMSTHENGKMKVKSLKEQVLVMKAIQN
                     ISLRIRNEFKKETTPAKIEILKSLLSEKRQGKWSLSSFPPIHLPLNPAIEVSGTIPEQ
                     SSVFRSSLSPLKITFKTIDNSSYPVMYKIGDDLRQDQFVIQLITLMERILQNENLDMK
                     LTPYKILSMGAMEGLMEFIPNEALSSILKNNGSVLSFLKQNNPDPNSSLGVRAEVMDN
                     YVRSCAGYCVITYLLGVGDRHLDNLLLSKDGHFFHVDFGYILGEDPKPFPPLMKLPIQ
                     VIEGMGGLNDENYKLFCNYCFITYITLRKNSSLILNLVQLMIDSSIPLLRTKNSDEQE
                     KTEIILKIQEKFMLELNDEDAVLHFQNLINDSVNAFLPVVIDRLHNLAQYWRA"
     gene            <942175..>944268
                     /locus_tag="PAS_chr4_0479"
                     /db_xref="GeneID:8201426"
     mRNA            <942175..>944268
                     /locus_tag="PAS_chr4_0479"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493870.1"
                     /db_xref="GeneID:8201426"
     CDS             942175..944268
                     /locus_tag="PAS_chr4_0479"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493915.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0479"
                     /db_xref="EnsemblGenomes-Tr:CAY71736"
                     /db_xref="GeneID:8201426"
                     /db_xref="UniProtKB/TrEMBL:C4R811"
                     /translation="MNNDFPPDTMMGSFRFENPAQNQQQQQQQQQRQQGQGQQFTSLP
                     NQQFPQQQLQHLPPHGHPYYGLPPPGQAPLYNNGTTLQQSYGTPPTFNAGYADISGNN
                     FQPSVIQGNVPLLNHQGSFQASPMQTPIEIIERQRLEQQQQQQHQQQQHQLHQQKVQQ
                     PQQDQLHNHYQGQSVKGPESLRPLDFYYPKSQTTNVVNKRPIQSEVIDLVSKKPKQEN
                     KAPSSTTLYPPFNVWLDQYRAKQRVQYSENELKILLLKLGRDNEKSKTIQLLGGIFNE
                     MTAVDYKYKAILVDNIFSYFPWAKENKHDLVKVYMKVASWLINSFKAKEEDAVKTYLD
                     FFQKASLTPEMISLFKLDKVLAKIEKSKNFGEPLKVIARQISASLSVDKPKSTNGGLS
                     NSASSATVKANAFKGFSSLSKSAVAPASKTKKPTVFVRDNTTGNSNAESIKDSSSSAS
                     SSTSPPPAASNKTTTQPAKKASGGWSLSDYITKSKSTTESTNEPRSSSQPLEEKEKDD
                     KVTPDEKGLGLVSILKKPNHPKSKKKEGVRFNDANLVQIKHIVPEWILTGETYNHSEF
                     DLKEGSALKSLNHIQQEDELPPIDDTLPTSAPVRLELPTPTEYIVTVNDLNTYKLEVY
                     DVKQLENYEEELKINPTSRGGEASVPGQEVERQIYNDGKAPYDSVLQATPTEPDSVIN
                     ERPVACITKTISSFC"
     gene            <944382..>945056
                     /locus_tag="PAS_chr4_0480"
                     /db_xref="GeneID:8201427"
     mRNA            <944382..>945056
                     /locus_tag="PAS_chr4_0480"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493871.1"
                     /db_xref="GeneID:8201427"
     CDS             944382..945056
                     /locus_tag="PAS_chr4_0480"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493916.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0480"
                     /db_xref="EnsemblGenomes-Tr:CAY71737"
                     /db_xref="GeneID:8201427"
                     /db_xref="GOA:C4R812"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C4R812"
                     /translation="MDTSSSQSYFQPIIEPPGSRLFRFFPSQNPSDANWDYPAPQNPD
                     ISFPSQDYSEWSLSTNNRGANYTLGDTSSMKDEEEIWSLSQFSLENKKPVTDNSIEEI
                     GRNNVTPSIEPIMQSEKSNATSGRSMQKENLRRSSRIRKVVNCRDASRRKPKNSIRSK
                     HGCWTCRLRRKKCPEDGNQCSACLRLGIECDSSLQSKPEYLICKAAGREKMRQIKKIT
                     RSKKQS"
     gene            complement(<945051..>946760)
                     /locus_tag="PAS_chr4_0481"
                     /db_xref="GeneID:8201428"
     mRNA            complement(<945051..>946760)
                     /locus_tag="PAS_chr4_0481"
                     /product="Protein involved in inhibition of translation
                     and nonsense-mediated decay"
                     /transcript_id="XM_002493872.1"
                     /db_xref="GeneID:8201428"
     CDS             complement(945051..946760)
                     /locus_tag="PAS_chr4_0481"
                     /codon_start=1
                     /product="Protein involved in inhibition of translation
                     and nonsense-mediated decay"
                     /protein_id="XP_002493917.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0481"
                     /db_xref="EnsemblGenomes-Tr:CAY71738"
                     /db_xref="GeneID:8201428"
                     /db_xref="InterPro:IPR018834"
                     /db_xref="InterPro:IPR019458"
                     /db_xref="UniProtKB/TrEMBL:C4R813"
                     /translation="MNFGNVTKTLQQLKFQNDGLLQSGFVDSAALIDFVQLSSHQLKM
                     LIVKDIANVIATDNTIECFQAPVVFTELVDQYWLDFQRPTIKYFELQLKRLANDKIVR
                     TTLDSNGISKKFRGRKRVVEIRKLYSVYLKCNRIFCQFHIQLITELLSAYNLDAIGSI
                     DHICRLLRIENPNGSCKNIKGLAVCSQLIYVIHRSLLYFGNLSRYRTLLATNYLPPGS
                     LSRQDKKEYRKCLECLNLAILLLPSQGDPHNHIGLIERLRRNDFNIIYNFARSTMTRI
                     HSPNGFMNLILHLSSEMLLNTVSRAILEPEKCRSTVDSKLVKCNNYFIAIFGFHFLPQ
                     RWNDSQNMKFTDVSWKNIENDYRKSIATLDIHRPAHVKILWKQAIILISGYTILSNAK
                     FNHEWIDRSENLLEAYLQFVFHFIDEILTICTSGYSINTGLLPLVRLFLCWANQGGLP
                     LNYLLANSSTFDNLVHICEVASLLVNKDELCISKPQRQYYFYEDVDLKEFVPIGCRFK
                     DFNDSWILDKSQDSYKKLIGERPKEAPHNDVESDEDAFRIKAISYMVDQLLKSRSKLE
                     ICS"
     gene            <946986..>949544
                     /locus_tag="PAS_chr4_0482"
                     /db_xref="GeneID:8201429"
     mRNA            <946986..>949544
                     /locus_tag="PAS_chr4_0482"
                     /product="Putative protein of unknown function, may be
                     involved in detoxification"
                     /transcript_id="XM_002493873.1"
                     /db_xref="GeneID:8201429"
     CDS             946986..949544
                     /locus_tag="PAS_chr4_0482"
                     /codon_start=1
                     /product="Putative protein of unknown function, may be
                     involved in detoxification"
                     /protein_id="XP_002493918.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0482"
                     /db_xref="EnsemblGenomes-Tr:CAY71739"
                     /db_xref="GeneID:8201429"
                     /db_xref="GOA:C4R814"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:C4R814"
                     /translation="MESEAPYNFISSNGTIPDLRRPSARVAKVQLLIASLLGGITFLV
                     FCVLRCQFPNIYMARLNYVNKANRKFTPPPLSRTSLFGWIPTLVSIGDQDVLTNAGLD
                     AYVFLGFFKMAIKLLSTCLVFAVLVISPIRFHFTGRYDQGDDGDDGDANKQDDGFINP
                     ENYHTYLWLYVVFSYVFTLIVGYFLQKQTKHVVEIRQSYLGKQNSITDRTIRLSGIPP
                     ELRSERLLKEHIESLNIGSVSSVVICREWKPLIVLFKQREQIVDILESYWATVLEATD
                     LSNIRPYVSDSIRLLNTPVDEEAAFHDDVPPNDVSSLINSDDEQTDGPDDSINYSSSA
                     LSLITTQHPKRPKIRTRCFGLGGKRVDAIDYYTHQLKVIDEAIIEAREKHYPPTPAAF
                     ITMDTVATAQMMAQAVLDPNVHYLITRLAPAPHDIIWSNVCLPRKERLFKVYAITIII
                     GITSIALVFPVLYLTTLLNLKTISKFWPYLGKLLKKHHWAQTLVTGLLPTYLFTLLNF
                     VVPFFYVWLSSKQGFVSHGEEELSTVSKNFFYIFVNLFLVFTFGGTVSNYWGFLSDTT
                     KIAYQLAKALQELSLFYVDLIILQGLGMFPFKLLLVGQLFRFPYFKIKSKTPRHFRNL
                     YKPPFFNFGLQLPQPILILVITIIYSVMSTKILSAGLVYFIIGYYVYKYQLVYATVHP
                     QHSTGGVWALIFRRVVMGLLLFQVTMAGTLALQNAYLLATTLIPLPFFTVAFLWNYQK
                     NYYPLSSFIALRAIQNNDIVGRRHNHINRSRTSVDSEATNLQPNSSNTLDERRELNQT
                     YEYPFLVQSLDGPWLDIDGDEVIMASSEGPIRKRHQFHEWEYDDVNPNVLGQSW"
     gene            complement(<949552..>950439)
                     /locus_tag="PAS_chr4_0483"
                     /db_xref="GeneID:8201430"
     mRNA            complement(<949552..>950439)
                     /locus_tag="PAS_chr4_0483"
                     /product="Protein required for normal intracellular sterol
                     distribution and for sphingolipid metabolism"
                     /transcript_id="XM_002493874.1"
                     /db_xref="GeneID:8201430"
     CDS             complement(949552..950439)
                     /locus_tag="PAS_chr4_0483"
                     /codon_start=1
                     /product="Protein required for normal intracellular sterol
                     distribution and for sphingolipid metabolism"
                     /protein_id="XP_002493919.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0483"
                     /db_xref="EnsemblGenomes-Tr:CAY71740"
                     /db_xref="GeneID:8201430"
                     /db_xref="InterPro:IPR007290"
                     /db_xref="UniProtKB/TrEMBL:C4R815"
                     /translation="MICIECCQPVDNLYFQSKNGYIKLTICSKCNQVVDKYVEFDKVV
                     LFIDLLLLRPNAYRHLMYNSLIPTQNQDEKHFQPQIYTRVFRIWMLLLLFEVYVNWAY
                     EEKSYSSSQHSIVKELVLKDFSIASQYLFFFFKSVLDLVSSHIAMQLLIRYWLKFPDP
                     SYFQEYPKYFFPVVISFTICISSIIRLFPIAMLIWPYDIQALKLTKSAINFVNNFITI
                     DCLNTILINNNSKSHWKLLAIVTWSNYVKALTSRLLVCFFISRLYSYSFSSLIQNDYD
                     HSMGLLSSLRDALSELSLS"
     gene            complement(<950727..>953405)
                     /locus_tag="PAS_chr4_0484"
                     /db_xref="GeneID:8201431"
     mRNA            complement(<950727..>953405)
                     /locus_tag="PAS_chr4_0484"
                     /product="Member of the Sec24p family"
                     /transcript_id="XM_002493875.1"
                     /db_xref="GeneID:8201431"
     CDS             complement(950727..953405)
                     /locus_tag="PAS_chr4_0484"
                     /codon_start=1
                     /product="Member of the Sec24p family"
                     /protein_id="XP_002493920.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0484"
                     /db_xref="EnsemblGenomes-Tr:CAY71741"
                     /db_xref="GeneID:8201431"
                     /db_xref="GOA:C4R816"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C4R816"
                     /translation="METTHSMNAVYDGYSMSSLSDGMSELKVDQSKHKKRPVHILHQQ
                     PASQTTAQFHQPASSQPFLPPQVPFSQQPQSPNFVQGSPQIGTPQMGTPPLGVSQFGT
                     PQGQIQSPGQLHQTFSPPSNLDPTSVPDIRYETDVMFDSKSFLTFANVCPPLVGTQYT
                     VVDQGNASPRFMRMSMYNVPATEKLRKETGLSLGLVLNPFAPMQEQEKPIPEVDYREM
                     GGPPRCRRCRAYVNSTMQHTHDYRMICNICGFSSPIPSEYCSPLDPSGVRIDRNQRPE
                     LHLGMIDFLVPEAYNIDESIPPNPLHHVFLVDISNSSVRRELHKAFANAISMSVLKGY
                     PKGSKISIIAYDRKIHFFNLSLDSNQVSIATVSDLEDPFLPFFDGIFVDVKAGRIHID
                     RALQSLEMMGEYSEPEPAYGAALRYALLALEHVGGGKVTALLSALPSWGPGSLKGISP
                     SQRLTSELETEALTAKNQYYQKLSKDYISASVGLDLFVVSSGSVDLSDCSLVATSTGG
                     SVRSFFNYEVARDQKSLCISLLDSIQAVKGYQSQLKIRCSAGLQVTKYLGSFKTSNSD
                     ADPLIPIVTSNTSVGCLFKHDGKLSTKNDAHFQAALLYTSADGVRKVRVINSIISVTE
                     RIADVFAFADQDATLALELKEHLGRIPEVSLVGLRNRLTFDLVDINTDYKLKVVGKSS
                     ADQQLILPVGLRTLPMFTLAATKTRAIRSAPSNNTDLRVQSILDLKSFTLEKLAVYLY
                     PILINVLEIDEDACQYTSTGHFQLPPGTRLSRQNLMHGGAYILFNGLKVFFWIHSDVN
                     VLLLQDVFGQNVSSLDSIDPNLNELPELDTGISLQLRNLVSFLLRAISTLLLYQYKFV
                     GSDEMVRKLNSWKTCTKIVRLTSSKATMTSLTIFIH"
     gene            <955416..>956711
                     /locus_tag="PAS_chr4_0486"
                     /db_xref="GeneID:8201432"
     mRNA            <955416..>956711
                     /locus_tag="PAS_chr4_0486"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493876.1"
                     /db_xref="GeneID:8201432"
     CDS             955416..956711
                     /locus_tag="PAS_chr4_0486"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493921.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0486"
                     /db_xref="EnsemblGenomes-Tr:CAY71742"
                     /db_xref="GeneID:8201432"
                     /db_xref="GOA:C4R817"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:C4R817"
                     /translation="MIEYHPYMDTQTKLNLLKKNYPEVNEEVLLELLLSCRGSFKQTV
                     LLLNEQFDNEKASSVCHTPSYQSSLNDLWGSNKRQRIEGSGNVMLYTKESIETTIPYV
                     SYHKSFLPAELADRVLKYLLDLDICTFNEFYIAGKKCISTHKTCLMTSEDFIRESKDN
                     VNMNNFYIRGNPKKSIPYNSDLTVIQSLIQDLVNETLAQRDLSKTPFHNRRPWNGGSL
                     VCNRYDSIKSSLDWHSDRLTFMGPHPVIVSLSFGCTRYFRLRKIHPHKGSNLPPVYNI
                     PVPHNTLLIMYGGCQEEYKHCVAPLPSIIDSLHPISGETRINLTYRHYDSEWVSRIPR
                     CPECNEPMTLRRMFKKIENRGKYYWSCSAQTSKNSECKGFYWAKFDDYLEGKLKDYTL
                     FSKDEDECSQWIAEDDWEKLDYLKEYYKDLLLQRKKNPE"
     gene            complement(<956789..>960256)
                     /locus_tag="PAS_chr4_0487"
                     /db_xref="GeneID:8201433"
     mRNA            complement(<956789..>960256)
                     /locus_tag="PAS_chr4_0487"
                     /product="Carbon source-responsive zinc-finger
                     transcription factor"
                     /transcript_id="XM_002493877.1"
                     /db_xref="GeneID:8201433"
     CDS             complement(956789..960256)
                     /locus_tag="PAS_chr4_0487"
                     /codon_start=1
                     /product="Carbon source-responsive zinc-finger
                     transcription factor"
                     /protein_id="XP_002493922.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0487"
                     /db_xref="EnsemblGenomes-Tr:CAY71743"
                     /db_xref="GeneID:8201433"
                     /db_xref="GOA:C4R818"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C4R818"
                     /translation="MSNLPPTFGSTRQSPEDQSPPVPKELSFNGTTPSGKLRLFVCQT
                     CTRAFARQEHLKRHERSHTKEKPFSCGICSRKFSRRDLLLRHAQKLHSNCSDAAITRL
                     RRKATRRSSNAAGSISGSTPVTTPNTMGTPEDGEKRKVQKLAGRRDSNEQKLQLQQQH
                     LQQQPQLQYQQSLKQHENQVQQPDQDPLISPRMQLFNDSNHHVNNLFDLGLRRASFSA
                     VSGNNYAHYVNNFQQDASSTNPNQDSNNAEFENIEFSTPQMMPVEDAETWMNNMGPIP
                     NFSLDVNRNIGDSFTDIQHKNSEPIISEPPKDTAPNDKKLNGYSFYEAPIKPLESLFS
                     VRNTKRNKYKTNDDSPDTVDNNSAPAANTIQELESSLNASKNFCLPTGYSFYGNLDQQ
                     TFSNTLSCTSSNATISPILLDNSINNNSTSDVRPEFRTQSVTSEMSQAPPPPQKNNSK
                     YSTEVLFTSNMRSFIHYALSKYPFIGVPTPTLPENERLNEYADSFTNRFLNHYPFIHV
                     TILKEYSLFKAILDENESTKNWENNQFYLENQRISIVCLPLLVATIGAVLSNNKKDAS
                     NLYEASRRCIHVYLDSRKKIPTSLSANNNDSPLWLIQSLTLSVMYGLFADNDISLNVV
                     IRQVNALNSLVKTSGLNRTSIIDLFNINKPLDNELWNQFVKIESTVRTIHTIFQISSN
                     LSALYNIIPSLKIDDLMITLPVPTTLWQADSFVKFKSLSYGNQIPFQYTRVLQNLIDY
                     NQPLSDGKFLYENHVSEFGLICLQNGLHQYSYFQKLTAVNNREDALFTKVVNSLHSWD
                     RMISNSDLFPKKIYQQSCLILDSKLLNNFLIVKSSLKVSTGDVSSLNKLKENVWLKNW
                     NQVCAIYYNSFMNIPAPSIQKKYNDIEFVDDMINLSLIIIKIMKLIFYNNVKDNYEDE
                     NDFKLQELNLTFDNFDEKISLNLTILFDIFLMIYKIITNYEKFMKIKHKFNYYNSNSN
                     ISFLHHFELSSVINNTQMNQNDYMKTDIDEKLDQLFHIYQTFFRLYLDLEKFMKFKFN
                     YHDFETEFSSLSISNILNTHAASNNDTNAADAMNAKDEKISPTTLNSVLLADEGNENS
                     GRNNDSDRLFMLNELINFEVGLKFLKIGESFFDFLYENNYKFIHFKNLNDGMFHIRIY
                     LENRLDGGV"
     gene            complement(<960926..>961780)
                     /locus_tag="PAS_chr4_0488"
                     /db_xref="GeneID:8201434"
     mRNA            complement(<960926..>961780)
                     /locus_tag="PAS_chr4_0488"
                     /product="Mitochondrial phosphate carrier, imports
                     inorganic phosphate into mitochondria"
                     /transcript_id="XM_002493878.1"
                     /db_xref="GeneID:8201434"
     CDS             complement(960926..961780)
                     /locus_tag="PAS_chr4_0488"
                     /codon_start=1
                     /product="Mitochondrial phosphate carrier, imports
                     inorganic phosphate into mitochondria"
                     /protein_id="XP_002493923.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0488"
                     /db_xref="EnsemblGenomes-Tr:CAY71744"
                     /db_xref="GeneID:8201434"
                     /db_xref="GOA:C4R819"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C4R819"
                     /translation="MRNDKISLYSPDYYLACTVGGALACAPTHGGITPLDLVKCRRQV
                     NSSLYSSNWKGITSIIKNEGFPALYTGVLPTFIGYGLQGAAKYGGYEYFKKQYTDLNG
                     GKANTFTFLAASATAEFIADIFLCPLEAMKVKIQTTLPPDKPNLRELSLYKGLVPLWC
                     RQIPYTMVKFTSFEKIVDLIYSKAIKKPKDQLSNLQQTAVSFTGGYIAGIFCAAVSHP
                     ADVMVSLMNNNKEGLSVAQLYQKIGFSGLWNGLGIRIVMIGTLTGFQWLIYDSFKVYS
                     GLPTTGGH"
     gene            complement(<962370..>962744)
                     /locus_tag="PAS_chr4_0489"
                     /db_xref="GeneID:8201435"
     mRNA            complement(<962370..>962744)
                     /locus_tag="PAS_chr4_0489"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493879.1"
                     /db_xref="GeneID:8201435"
     CDS             complement(962370..962744)
                     /locus_tag="PAS_chr4_0489"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493924.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0489"
                     /db_xref="EnsemblGenomes-Tr:CAY71745"
                     /db_xref="GeneID:8201435"
                     /db_xref="UniProtKB/TrEMBL:C4R820"
                     /translation="MGCCVSKDSKGSSEGTNGLNEKRESEKHTRSNVKSSKPKNKTKP
                     VGKVKHKDQGKPLGGDVPTQNGLSPKEAAALAAEKRQEKNVNGALGKKLHQERVKSNK
                     KHLEELSQQKLQERKETPLVFD"
     gene            <962805..>965323
                     /locus_tag="PAS_chr4_0490"
                     /db_xref="GeneID:8201436"
     mRNA            join(<962805..962812,963025..>965323)
                     /locus_tag="PAS_chr4_0490"
                     /product="Component of the CCR4-NOT transcriptional
                     complex"
                     /transcript_id="XM_002493880.1"
                     /db_xref="GeneID:8201436"
     CDS             join(962805..962812,963025..965323)
                     /locus_tag="PAS_chr4_0490"
                     /codon_start=1
                     /product="Component of the CCR4-NOT transcriptional
                     complex"
                     /protein_id="XP_002493925.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0490"
                     /db_xref="EnsemblGenomes-Tr:CAY71746"
                     /db_xref="GeneID:8201436"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:C4R821"
                     /translation="MLSEKRIFVDKANKDKEGPTLKGPIMNTASQYKAQGNGQGIMRH
                     APQPQQTQIPSQYLLQQLQGSHATNQPQTDSSNPSLLVQALFQGPQSHQGQRIGNQQM
                     QPHVVLGSQTLQSSSVVPPGQNQPTSQSPHYDTIQVEDPTTFHWQHQVQLVQMSRKCN
                     QPHFYARHAAVSSRKLLGKNGNNNMPGVDGSQGNQPPNLLEATKTLLMSTDPTAEQAE
                     SGENKSATDPLLWFKKLSNDTQDEDEEIDASTLKDPTRQLWRALDLSGQQLLHLSEKL
                     FRYDFLTKLYLNGNGLTELPSSIRQLKSLTVLDVSQNLLSSFPPELGILFNLRYIYAF
                     DNRLTDIPFEFGNLYELEFLGIEGNVNMNPEYVNILAKRGSRGLTIHLRDNAPRPTPP
                     KSRQWIYFSNDGEIIEEQEYRQQQTEDDIVNTFTMMTYNTLCQHYATKKMYRYTPSWA
                     LDWDYRRERLKEQILDLQTDIICLQEVEHKTFDDFWQPIMLSHGYKGIFHVKSRAKTM
                     KESSAYKVDGCATFYRTSKFQAVERKHFEYGRIAMSQDKFKKTEDLFNRFLNKDNIAS
                     VLILEHIPSGNKLVVANTHLHWDPEFNDVKTMQVGVLLDELQAVIRKHLSPKDITKVP
                     LLICGDFNSKVHSAVYQLFSQGTVDKHEDIIGRDYGKFTEEGFRHPFHLQSSYDSIGE
                     LPYTNVSPTFTDVIDYIWYSTPSLSVKGVLGQVDPDYSKNIIGFPNADFPSDHIPLLS
                     TFMFKKSSAPRPDTRVDFRSDFRGSRKT"
     gene            <966842..>967921
                     /locus_tag="PAS_chr4_0492"
                     /db_xref="GeneID:8201437"
     mRNA            <966842..>967921
                     /locus_tag="PAS_chr4_0492"
                     /product="DNA N-glycosylase and apurinic/apyrimidinic (AP)
                     lyase involved in base excision repair"
                     /transcript_id="XM_002493881.1"
                     /db_xref="GeneID:8201437"
     CDS             966842..967921
                     /locus_tag="PAS_chr4_0492"
                     /codon_start=1
                     /product="DNA N-glycosylase and apurinic/apyrimidinic (AP)
                     lyase involved in base excision repair"
                     /protein_id="XP_002493926.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0492"
                     /db_xref="EnsemblGenomes-Tr:CAY71747"
                     /db_xref="GeneID:8201437"
                     /db_xref="GOA:C4R822"
                     /db_xref="InterPro:IPR000445"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR004036"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:C4R822"
                     /translation="MVKSEFFTQRTSKRLKLASQMAQSFGSTISDVALDGSRRKPAPA
                     VIQVKKESEPISLEVKSHGNDTKRARVKSEEDTHVKLEETPIPKNFFPIYNEVKLIRS
                     KITTPVDSMGCATIPIRIAEEKSGPLFRYRLLVSLMLSSQTKDEVNYEVMKSMNDYFK
                     SVGYENGLCLQAILDVEPTKLDELIHKIGFHNRKTVYLKSAAVIVKEQFNGDIPKNIK
                     QITALPGVGPKMGYLLLQDAWGINDGIGVDVHVDRLANMWKWVNTKTPEQTRLALEKW
                     VPRELWQEINPVLVGFGQVICTPRGRRCDVCSLASKKLCNNIDRGIISKSRREKESAA
                     LRGVAVKERKIRGDISQILDIEDLA"
     gene            <968069..>969046
                     /locus_tag="PAS_chr4_0493"
                     /db_xref="GeneID:8201438"
     mRNA            <968069..>969046
                     /locus_tag="PAS_chr4_0493"
                     /product="Putative phosphomutase, contains a region
                     homologous to the active site of phosphomutases"
                     /transcript_id="XM_002493882.1"
                     /db_xref="GeneID:8201438"
     CDS             968069..969046
                     /locus_tag="PAS_chr4_0493"
                     /codon_start=1
                     /product="Putative phosphomutase, contains a region
                     homologous to the active site of phosphomutases"
                     /protein_id="XP_002493927.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0493"
                     /db_xref="EnsemblGenomes-Tr:CAY71748"
                     /db_xref="GeneID:8201438"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C4R823"
                     /translation="MSLLIPSKVDYDDAHPATNHFQEYATLLGQQPREDFSWKFEVVP
                     GFFMQAEESTDDLKFRYTEQHFGLMLESWSELIKQVHALNEFAADNECYKVLFLARHG
                     QGFHNFAVGKYGLPEWNRKWRHLTTDGEIVWGPDPYLTERGVNQALENRDAWKNELSV
                     GCPLPQKFYSSPFTRSAMTLVNTWNEILDLKRVAPMIKENLRETIGVNRCDQRSDKKT
                     IEKRYANQYGFQFEPGFHEIDDYFTEEWRESIGEQTLRINRFLQFLFDLDWNSEEGKA
                     KNRRDSTFVSCTSHAGTIRSFLQVLGHREFTVGTGAMIPVVVKGIRHFN"
     gene            complement(<969039..>970943)
                     /locus_tag="PAS_chr4_0494"
                     /db_xref="GeneID:8201439"
     mRNA            complement(<969039..>970943)
                     /locus_tag="PAS_chr4_0494"
                     /product="Regulatory subunit A of the heterotrimeric
                     protein phosphatase 2A"
                     /transcript_id="XM_002493883.1"
                     /db_xref="GeneID:8201439"
     CDS             complement(969039..970943)
                     /locus_tag="PAS_chr4_0494"
                     /codon_start=1
                     /product="Regulatory subunit A of the heterotrimeric
                     protein phosphatase 2A"
                     /protein_id="XP_002493928.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0494"
                     /db_xref="EnsemblGenomes-Tr:CAY71749"
                     /db_xref="GeneID:8201439"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C4R824"
                     /translation="MEENHISFSTPKSNMAENNQDLYPIALLMDELRYDDVASRVQAM
                     KRLDTIAIALGPERTRSELLQYLDEVVTDDEDEVICIIAEELGKFVPLIGGPQYAVLL
                     LPILEKISSVEEPVVRDKAVESLNLIGETLSDAQIDSEFVPLVEKLAKDQWFSSCVAS
                     TGLFKGIVARVDSEKRKNLLNLYFSLIKHEIPLVRKSSATHLPEIVDQLSDKFANVDN
                     DEFNWNIIYEMFQVLIVDHQDSVKFLSVEVLICMLEFLHKIGNKTHHEALLQNVLNLI
                     NDPSWRVKYMIANRFEKLVEAFHDDQISLSLIGEFAGLMKDHEPEVRKAISEQLPGYV
                     RLVSETGNHGLQPDANKDIIIKEIIPCVNSLSEDESEVVRAALASQITGLAPYLGNEA
                     TIEHLLPIFLHMLNDVFSEVRLNIISNLQVVNEVIGIERLSNSLLPAITSLAQDKQWR
                     VRLAIIEQIPLLAEQLGVSFFDEGLGQLCMGWLDDPVYSIREAAVNNLQKLTQIFGEE
                     WARKDLILRILERQDDLINFIHRITSLFAFMKLIPVVRNEIIKTDIYPFFERLIKDEV
                     PNIRFNVAKAYQVIGETLLANDPKEAPVIESTIIPQLVQLTNDEDVDVRFFATKSLEG
                     VKKALSNYVN"
     gene            complement(<971725..>973155)
                     /locus_tag="PAS_chr4_0495"
                     /db_xref="GeneID:8201440"
     mRNA            complement(<971725..>973155)
                     /locus_tag="PAS_chr4_0495"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493884.1"
                     /db_xref="GeneID:8201440"
     CDS             complement(971725..973155)
                     /locus_tag="PAS_chr4_0495"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493929.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0495"
                     /db_xref="EnsemblGenomes-Tr:CAY71750"
                     /db_xref="GeneID:8201440"
                     /db_xref="UniProtKB/TrEMBL:C4R825"
                     /translation="MGSLRIRHPTSSPPHKPSFPNRPQIFARSPSFSLKANSTIILAM
                     SQVAYTGNQGVSNVSPSSRVSSYGPVKAQAFPQDLPSNSTVANNSSDLGPELLQNRLN
                     NNYQLAIRQYLNKNFAKSWTLVTSLISQLDLNDIHVIGSSEMSVEEASQDELVSNIYK
                     LYLSLIDLLLKEDQNSVGNGLYEEIHTIFQEGVIFRQIVQVYNHNYHLIDPELALMCF
                     IIELSNKFPLVNLDEQMETYLLKNDVFAQPFHINQLPGPMDASISVQDRRLLSLERVV
                     EFYLVHVLSQMNQIPRAKELIARIFSSDAQRVLRYSSLLDEHLHKVKEAELLREKELL
                     DRERNHKHFKKDFFSKKPGNDTAKQTRQVSRPMGPKSQDDKKLQRPSSTPRQVSLLDK
                     LKRLLFPPYSVSNTPQVHWILQMQRFIRPLVASCFIISLLLFVQKLSTSKSNLMAQLK
                     RLRVSLWVLLAKILDTFRMAFKISYI"
     gene            <973379..>973993
                     /locus_tag="PAS_chr4_0496"
                     /db_xref="GeneID:8201441"
     mRNA            <973379..>973993
                     /locus_tag="PAS_chr4_0496"
                     /product="Peroxisomal ubiquitin conjugating enzyme"
                     /transcript_id="XM_002493885.1"
                     /db_xref="GeneID:8201441"
     CDS             973379..973993
                     /locus_tag="PAS_chr4_0496"
                     /codon_start=1
                     /product="Peroxisomal ubiquitin conjugating enzyme"
                     /protein_id="XP_002493930.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0496"
                     /db_xref="EnsemblGenomes-Tr:CAY71751"
                     /db_xref="GeneID:8201441"
                     /db_xref="GOA:C4R826"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C4R826"
                     /translation="MSAEKRLLQEYRSILKEQRQKGSASTLSSNGILDLKPVSEDNFY
                     KWTAKLKGPTDTGYQDAFWELQIDIPSNYPTQPPKFTFIVSDDIPRNRRQRQTNQIQD
                     DDEFEGAEKEVLRHCYRMPHPNIAFNTGEICLDILQAKWTPAWTLSSALTAIVLLLND
                     PEPLSPLDIDMANLMKINDLKAYNSLIEYYVGRYSIEEEVYILN"
     gene            complement(<974000..>974875)
                     /locus_tag="PAS_chr4_0497"
                     /db_xref="GeneID:8201442"
     mRNA            complement(<974000..>974875)
                     /locus_tag="PAS_chr4_0497"
                     /product="Hypothetical protein"
                     /transcript_id="XM_002493886.1"
                     /db_xref="GeneID:8201442"
     CDS             complement(974000..974875)
                     /locus_tag="PAS_chr4_0497"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="XP_002493931.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0497"
                     /db_xref="EnsemblGenomes-Tr:CAY71752"
                     /db_xref="GeneID:8201442"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:C4R827"
                     /translation="MLRSRIMMGRPYPATRVKVSGIGARFSSSAAAAAAEATEPQDGD
                     NVETSSANFEQVSGFRSKDAAPAKNKKVVQRTTDLTPPKKTPKRYISLLPRVPSTSNI
                     NHNSLMLDSLMNGYRPLQMPVAKNLTASTHGTSSGSQTAPAALLTPKRKSSSILDSLK
                     EFKVSRNRLRNQVTSSRTDNYNPYFSKDQHFVPYTSIFTNSILNTQQHNTELFNLPLS
                     YLEKLKPYQCSNKPGDEFYRDDLIVVKKIELEESELEAKKKRLLSYTRVIGDAKNGTK
                     KQLEIDDIEEFFGFK"
     gene            <976339..>978207
                     /locus_tag="PAS_chr4_0969"
                     /db_xref="GeneID:8201443"
     mRNA            <976339..>978207
                     /locus_tag="PAS_chr4_0969"
                     /product="hypothetical protein"
                     /transcript_id="XM_002493887.1"
                     /db_xref="GeneID:8201443"
     CDS             976339..978207
                     /locus_tag="PAS_chr4_0969"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="XP_002493932.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_chr4_0969"
                     /db_xref="EnsemblGenomes-Tr:CAY71753"
                     /db_xref="GeneID:8201443"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:C4R828"
                     /