GenomeNet

Database: RefSeq
Entry: NC_012990
LinkDB: NC_012990
Original site: NC_012990 
LOCUS       NC_012990            1114666 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Zygosaccharomyces rouxii strain CBS732 chromosome A complete
            sequence.
ACCESSION   NC_012990
VERSION     NC_012990.1
DBLINK      BioProject: PRJNA39573
            BioSample: SAMEA3138235
            Assembly: GCF_000026365.1
KEYWORDS    RefSeq; genomic DNA.
SOURCE      Zygosaccharomyces rouxii
  ORGANISM  Zygosaccharomyces rouxii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygosaccharomyces.
REFERENCE   1  (bases 1 to 1114666)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1114666)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1114666)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928173.
            The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A
            to G). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1114666
                     /organism="Zygosaccharomyces rouxii"
                     /mol_type="genomic DNA"
                     /strain="CBS 732"
                     /db_xref="taxon:4956"
                     /chromosome="A"
     gene            complement(<3142..>4002)
                     /locus_tag="ZYRO0A00132g"
                     /db_xref="GeneID:8201993"
     mRNA            complement(<3142..>4002)
                     /locus_tag="ZYRO0A00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494338.1"
                     /db_xref="GeneID:8201993"
     CDS             complement(3142..4002)
                     /locus_tag="ZYRO0A00132g"
                     /note="some similarities with uniprot|P36034 Saccharomyces
                     cerevisiae YKL219W COS9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494383.1"
                     /db_xref="GeneID:8201993"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DP39"
                     /translation="MSIISDESEMDLEKCVQTFEEEEIELPEDSSGGKLTYFLAPYFF
                     EKKWISDIIFPLFGALLVLLIRLAYFSLRDYFDTQLEMKPSDIFSPLWMIIHYLLCFT
                     TCFVNFIYHRKNFNIETKALQKLLKEVAEMDLTGDPAAWQRIASRVNHFSEEGGHHYP
                     LFYSGEHCMRFFVREIVKPIERQTYDIRCYQEGSTVVNFWKNPPNKALTERALANYNK
                     CVESFGKLSHTAEKDEFRDGIFEKFHSIFNTSLFYLVIIEYVSFVIMALALIVLLISR
                     AIFDLFATPH"
     gene            <4324..>5022
                     /locus_tag="ZYRO0A00154g"
                     /db_xref="GeneID:8202059"
     mRNA            <4324..>5022
                     /locus_tag="ZYRO0A00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494339.1"
                     /db_xref="GeneID:8202059"
     CDS             4324..5022
                     /locus_tag="ZYRO0A00154g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494384.1"
                     /db_xref="GeneID:8202059"
                     /db_xref="UniProtKB/TrEMBL:C5DP40"
                     /translation="MSNKKKSKSKASESHKRGGRENSPRGQHNSPSLQRDNSISDQQG
                     SENSGTGSGTNGIKLAARLLRNPLFSKRGFEHAKEGLKSERTGDSISTLKCIGSGLLF
                     LYPIVFIIYSIFGLASGDKNNSIHVFVYGGPLFTAVPYFIRYLDDVDTLLLSIFEIGE
                     KSLLGYFADPGIREFLLTVFEIAGLIYQCVKGRQTFKVFFWGIVGFIFYLVGNIILIL
                     ERKKRPESVVGNST"
     gene            complement(<7771..>8634)
                     /locus_tag="ZYRO0A00198g"
                     /db_xref="GeneID:8202073"
     mRNA            complement(<7771..>8634)
                     /locus_tag="ZYRO0A00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494340.1"
                     /db_xref="GeneID:8202073"
     CDS             complement(7771..8634)
                     /locus_tag="ZYRO0A00198g"
                     /note="some similarities with uniprot|P47187 Saccharomyces
                     cerevisiae YJR161C COS5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494385.1"
                     /db_xref="GeneID:8202073"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DP41"
                     /translation="MSVISDESEMDLEKCVQTFEEEKIELPEDSSGGKLTYFLAPYFF
                     EKTWLDDIIASLSAAFLSPSLVRLPYFIMRDLYDDPFETKLSDIFSPLLMIIHYFLCF
                     TFSFWNFIDNRKKVNIEKKVLQQLLKEVAEMDLTGDPVAWQRIASRVNHFSRETGYRY
                     SLFCSGEHCMRFFVREIVKPIECQTYDIRCYLEGRMCVNFWKNPPDKVLVERAVANYN
                     KSVENFGELSHTAEKDKFRDGIFEKFLNIFSTSILYLGAIHSASFVVMYLTYIISMIS
                     CAIFDSFTAPH"
     gene            <9173..>10243
                     /locus_tag="ZYRO0A00220g"
                     /db_xref="GeneID:8202084"
     mRNA            <9173..>10243
                     /locus_tag="ZYRO0A00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494341.1"
                     /db_xref="GeneID:8202084"
     CDS             9173..10243
                     /locus_tag="ZYRO0A00220g"
                     /note="weakly similar to uniprot|P47187 Saccharomyces
                     cerevisiae YJR161C COS5 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494386.1"
                     /db_xref="GeneID:8202084"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DP42"
                     /translation="MESDKESQRPVLPQDLFRNELTWMFYEMCKHRFPWVVSCLCLVA
                     GWVVAQMNFTYKNMLVSDMTAGALFGCALVWPFVRVRYLKFYPNTTELVQQVLESNPE
                     VDIEKWAEIANRLNIYFYQEHLWSTPHFFFNNQHVQLVFKDNVLRPYLEGKLDDITDM
                     DKIQSANCYLQSLNEKFELLLKVNLPEPVLNSELPRGTHRNKFSFYAAYLFVGFMVCY
                     YQALTLLMIVMAFILNFFLLLINAILFQYLTLRIYQDSYCTLYPQMDIIRAMNFLAII
                     IKVSPGKEPVKWDQIARYMNQYLAEENNGHSTNIFLDGKHCLNCYKTCFEPLSTNNGP
                     SKYCDLKEIVEGTQPSVNGETN"
     gene            complement(<11435..>12292)
                     /locus_tag="ZYRO0A00242g"
                     /db_xref="GeneID:8201477"
     mRNA            complement(<11435..>12292)
                     /locus_tag="ZYRO0A00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494342.1"
                     /db_xref="GeneID:8201477"
     CDS             complement(11435..12292)
                     /locus_tag="ZYRO0A00242g"
                     /note="some similarities with uniprot|Q70DG7 Saccharomyces
                     cerevisiae YHL044W Putative integral membrane protein
                     member of DUP240 gene family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494387.1"
                     /db_xref="GeneID:8201477"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DP43"
                     /translation="MSMISYEGERDLEKCEQTFEEEEIELPEDSTGGKLTYFLAPYFF
                     EKTWLYDIITSLSAALLSSVTPLVYFSLCDFYHDPLESELSDFLSPLWMIIHCFLCFM
                     MLFVNFIDHRKKVNIETKALQKLLKEVGEMDLTGDPVAWRRIASRVNHFSEETGYRYS
                     LFCSGEHCMRFFVREIVKPIECQTYDIRCYYERERYRNFWKNPSNKALTERALANYNN
                     SVENFGELLHTTEKDKFRHGIFEKFLNIFSTSILYLGAIEFASFMIMMLTFIISMIAW
                     IIFHPFATA"
     gene            <12613..>13308
                     /locus_tag="ZYRO0A00264g"
                     /db_xref="GeneID:8202061"
     mRNA            <12613..>13308
                     /locus_tag="ZYRO0A00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494343.1"
                     /db_xref="GeneID:8202061"
     CDS             12613..13308
                     /locus_tag="ZYRO0A00264g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494388.1"
                     /db_xref="GeneID:8202061"
                     /db_xref="UniProtKB/TrEMBL:C5DP44"
                     /translation="MSNKKKSKSKASESHKRGGRENSPRGQHNSLSPQRGNSISDQQG
                     SENSGTGSGTNGIKLAARLFRNPLFSKRGFKHAKEGLKSERTGDSISGVRCFGSFFLF
                     VYPFLLIGYCIHGFLAGDINSKSAFLYGIPLCIAVPYCIRYLDDVDTLLSSIFEIGEK
                     SLLGYFADPVIREFLLTVFEIAGLIYKCIESSQKSRIYVWRIVGFVLYLVGHTLLILE
                     RKKRPGSVADASA"
     gene            <15089..>16114
                     /locus_tag="ZYRO0A00286g"
                     /db_xref="GeneID:8202060"
     mRNA            <15089..>16114
                     /locus_tag="ZYRO0A00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494344.1"
                     /db_xref="GeneID:8202060"
     CDS             15089..16114
                     /locus_tag="ZYRO0A00286g"
                     /note="highly similar to uniprot|Q02895 Saccharomyces
                     cerevisiae YPL088W Putative aryl alcohol dehydrogenase
                     transcription is activated by paralogous transcription
                     factors Yrm1p and Yrr1p along with genes involved in
                     multidrug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494389.1"
                     /db_xref="GeneID:8202060"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DP45"
                     /translation="MGSIKPVKLGNSGLKISPILVGCMSYGSKKWQEWVIEDKQEVFK
                     ILKHCYDSGLRTFDTADFYSNGISERLLGEFLKTYNINRETVVILSKVFYPVDDTMEL
                     NPSFDSVENELNLSNQRGLSRKHILAGVSNSVRRLGTYIDVLQIHRLDHDTPMKEIMR
                     ALNDVVERGDARYIGASSMLATEFAELQFIAEKYDWFQFISSQSCYNLLYREDERELI
                     PFAKKHNIGLIPWSPNARGLLTRPLRQTTERSKKDWGFKVVKLDKLEDSDREIISRVE
                     AIGKEKGVSMAAVSMAWVLHKGCYPIVGLNSVERVDEAKEALSIKLTDDEILHLEEPY
                     KTKASLF"
     gene            complement(<16982..>18676)
                     /locus_tag="ZYRO0A00308g"
                     /db_xref="GeneID:8202058"
     mRNA            complement(<16982..>18676)
                     /locus_tag="ZYRO0A00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494345.1"
                     /db_xref="GeneID:8202058"
     CDS             complement(16982..18676)
                     /locus_tag="ZYRO0A00308g"
                     /note="similar to uniprot|P43548 Saccharomyces cerevisiae
                     YFL055W AGP3 Low-affinity amino acid permease may act to
                     supply the cell with amino acids as nitrogen source in
                     nitrogen-poor conditions transcription is induced under
                     conditions of sulfur limitation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494390.1"
                     /db_xref="GeneID:8202058"
                     /db_xref="GOA:C5DP46"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DP46"
                     /translation="MGWTDINILTKGKGDDASCESYTSSGITPDQIETGEGKNHNASL
                     YDPKTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFT
                     IMESIGEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQ
                     FWGPQVPLYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISG
                     GIKDRPAFGFHYWNNPGALSHGFKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIP
                     LAIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALKSPISIAITRAGWEGGTHL
                     VNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGL
                     VSLMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKAL
                     FYPYTQIIGIAANIFLALIQGWTSFVPFKAGDFVDAYVLLPAAAVLYIGISLLKTHSF
                     KTVDLLTIDLDEGRRVDLDATFVDEDEDELDGEQDTNGEKFSKGKSYREKITRFFA"
     gene            <19597..>21327
                     /locus_tag="ZYRO0A00330g"
                     /db_xref="GeneID:8201480"
     mRNA            <19597..>21327
                     /locus_tag="ZYRO0A00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494346.1"
                     /db_xref="GeneID:8201480"
     CDS             19597..21327
                     /locus_tag="ZYRO0A00330g"
                     /note="similar to uniprot|P38358 Saccharomyces cerevisiae
                     YBR293W VBA2 Permease of basic amino acids in the vacuolar
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494391.1"
                     /db_xref="GeneID:8201480"
                     /db_xref="GOA:C5DP47"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DP47"
                     /translation="MDGEIAQPLLTRTVSSSNKQTNADKINQHYLSISHSDVGEYREE
                     PNDDEQGDLDDETTPLSRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMD
                     LSSWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSF
                     MRAFTGIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSI
                     GWRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIII
                     GLTLQLVYLSLGSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKL
                     VRSLFSFLVLTISVLVGFASYAYLFTLPLFFQVILGDSTAKAGLRLAIPSVFTPVGGL
                     IAGICMSKFNCLQTLLYVGIAFMCLGNFLFLYIGADATDSLIGFFLIPANLGQGITFP
                     SSLFTFIFAFSKIDQATATSTLYLFRSIGSVWGVTGSAGIVQFCFSHHLEKALEGLLD
                     ERKIRKLIKKITSNTSYIKELEGPVKVAVIESFDTATKKVHLISTSFCLVALILCVIK
                     DVFKPKTTKS"
     gene            complement(<23054..>24706)
                     /locus_tag="ZYRO0A00374g"
                     /db_xref="GeneID:8202062"
     mRNA            complement(<23054..>24706)
                     /locus_tag="ZYRO0A00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494347.1"
                     /db_xref="GeneID:8202062"
     CDS             complement(23054..24706)
                     /locus_tag="ZYRO0A00374g"
                     /note="similar to uniprot|P40445 Saccharomyces cerevisiae
                     YIL166C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494392.1"
                     /db_xref="GeneID:8202062"
                     /db_xref="GOA:C5DP48"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DP48"
                     /translation="MGIRQLISQQEVEQKSDEDKQYITEDIEQLSTDSSIDASSNVFA
                     DPEIANYYSSIYENSQYECRHLFDPDFTWTRKEEKRVIKKNDWYVTFWTFLMFTALDF
                     DRSNISQALSDNMLENLNLTTNDYNTANTINLVCFLAAELPSQLISKKIGADVWIPTQ
                     MCLWSIVSVCQASMTTKSGFYATRALLGALQGGFICDVCLWMSYFFTSKELPFRLSLF
                     YIANPMTSVWSSLLSFGLLKIKTGGLMNQSWRWLFLVEGLFTLLIGIMSFLKMPPSPA
                     QTKAWYRKKGWYTDREEKIVVNRVLRDDPTKGDMHNRQPVSPKELLKTLLDYDLLPIY
                     IVRFLGDIGSSPVSTYMTLTLRKLGFSTYKTNALSIPYNVLSVITMLLAGYFSEIVNQ
                     RSLIIMGTPIWILACLFPLRFWPGSQVNTWGTYALLTVLLGHAPIWPLSISWCSANSN
                     SVRTRAVSAAMVNIYSQAAGIVSANIYRTPDKPLYHKGNDALIGIAFGTIAACLFTKF
                     YYIYRNKQKDKIWNAFTEEEKLRYTIETTDDGNKRLDFRFVH"
     gene            complement(<25837..>26589)
                     /locus_tag="ZYRO0A00396g"
                     /db_xref="GeneID:8201722"
     mRNA            complement(<25837..>26589)
                     /locus_tag="ZYRO0A00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494348.1"
                     /db_xref="GeneID:8201722"
     CDS             complement(25837..26589)
                     /locus_tag="ZYRO0A00396g"
                     /note="similar to uniprot|P40579 and to YIR036C
                     uniprot|P40580 Saccharomyces cerevisiae, Hypothetical
                     ORFs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494393.1"
                     /db_xref="GeneID:8201722"
                     /db_xref="GOA:C5DP49"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5DP49"
                     /translation="MVKSVIVTGVSRGIGRSIVEQIIGAGENAVVTGIARSESSLKSL
                     KEQFGDKFFYVVGDVTDKNAASALVQEALNKTGKIDAVVANAGVLEPVQTVQKADVDG
                     WKQLFDVNFFSVLSLATLAMPHLIKSQGNLVLVSSDACNMWFSGWGAYGASKAALNHL
                     ALTISKECDGVKAIAVAPGVVDTSMQDSIRENYGPSGMTPEAQKLFNDFKANGVLLDV
                     KIPARVYANLALQGIPNELNGEYVSYDDKRLG"
     gene            27262..27333
                     /locus_tag="ZYRO0A00418r"
                     /db_xref="GeneID:8201481"
     tRNA            27262..27333
                     /locus_tag="ZYRO0A00418r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=60.45"
                     /db_xref="GeneID:8201481"
     gene            complement(<27895..>30447)
                     /locus_tag="ZYRO0A00440g"
                     /db_xref="GeneID:8201994"
     mRNA            complement(<27895..>30447)
                     /locus_tag="ZYRO0A00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494349.1"
                     /db_xref="GeneID:8201994"
     CDS             complement(27895..30447)
                     /locus_tag="ZYRO0A00440g"
                     /note="similar to uniprot|P05085 Saccharomyces cerevisiae
                     YML099C ARG81 Zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type involved in the
                     regulation of arginine-responsive genes acts with Arg80p
                     and Arg82p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494394.1"
                     /db_xref="GeneID:8201994"
                     /db_xref="GOA:C5DP50"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DP50"
                     /translation="MERRTRTSTTGVSDLVVNPHHGNRLKNGTKSKRGKTFTGCWTCR
                     SRKVKCDLRRPHCQRCEKSGLVCGGYDIKLRWSKPLQFDEFGVPISAAQGNAQDNTSG
                     ASNDEPQYQRRNIDFVRYDEEYEFYEDMDDELSTLHNPPLEKIADNRTWIIKKFGVFK
                     GTDDALLNYGKNKGKRRKMEKPVERQEPAIESSNSQTAPASVPSTAPVMDEQEILDMT
                     YATPNNHEWISKELRDDALLSASALQGFPIMDLQFEDNTAPLDEGIGSAIQEPNDFFS
                     TSGDDAALSRALRLLFHRHPSLDVEKVATPSHKDSSMEPIVPLGNQIDIDCTLLDSKM
                     PKPAMEVVDSQLPDPRIFNVPGSQNPFLQLPTTGVQIHGLTRFLLNYYYKNVADLMTV
                     VALNQNPWKKLYFPRALKAVGDLAGMGYTANSRNSLLNALLAVSCFNLQSKFVKNSPE
                     MQFYLNLGIEFRKQASSFLKICLSNTVKQERYKDVLTAILSMNSIDVVWGTMADCQQH
                     LTICENFVKARMKARPKISEKAKTLHRIFSFLKLIQDSTALDQVTDQEINDDENKDRD
                     TNDDGQQGFDFNTLRDPSPVSGSEEGSFREFVKYDGKIQIGFVKDSNMAQSSSVSTPI
                     FKNIASESYAYSDERMVTVEDIMSTDALYGLPQSLILLFSDCVKLARHKEYYRLKNMT
                     TPRHFASLCQRFEKRLFKWRSEWKCLKEGSEEFINDTIEGLHHHTSSFYYGLFIYYHT
                     MVKDLNHSSLQMYVEKVLTHLKLMSNLILFKKVRIVPLIWQGFVAGCASTKLETQEEF
                     RKWAATLASSGMGSYWGARQIMFEVWRRKRNGESGDSWYSVYRDWEMNLMLS"
     gene            <30948..>31589
                     /locus_tag="ZYRO0A00462g"
                     /db_xref="GeneID:8201995"
     mRNA            <30948..>31589
                     /locus_tag="ZYRO0A00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494350.1"
                     /db_xref="GeneID:8201995"
     CDS             30948..31589
                     /locus_tag="ZYRO0A00462g"
                     /note="similar to uniprot|P11747 Saccharomyces cerevisiae
                     YML098W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494395.1"
                     /db_xref="GeneID:8201995"
                     /db_xref="GOA:C5DP51"
                     /db_xref="InterPro:IPR003195"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DP51"
                     /translation="MSRKLKRTNLFAKDVSSLLYAYGDVSQPLPETVQCLDELVSGYL
                     VDVCSSAFRAAQNCQRNKLKLEDFRFAVRRDPIKLGRAEDLVATNKLITEAKKQFNGS
                     DSSSLKRFKDGEGNDLEGEGEDEDYEDYDDEADEDAAGGGNTHLDDDDKHMDSEIHHK
                     SKGNIDNSFEDDNELHQVKSEKKSKSSTRGGKQGSRGGSKTRGKRQKRGTSGT"
     gene            complement(<31637..>33382)
                     /locus_tag="ZYRO0A00484g"
                     /db_xref="GeneID:8202046"
     mRNA            complement(<31637..>33382)
                     /locus_tag="ZYRO0A00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494351.1"
                     /db_xref="GeneID:8202046"
     CDS             complement(31637..33382)
                     /locus_tag="ZYRO0A00484g"
                     /note="similar to uniprot|Q03103 Saccharomyces cerevisiae
                     YML130C ERO1 Glycoprotein required for oxidative protein
                     folding in the endoplasmic reticulum"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494396.1"
                     /db_xref="GeneID:8202046"
                     /db_xref="GOA:C5DP52"
                     /db_xref="InterPro:IPR007266"
                     /db_xref="UniProtKB/TrEMBL:C5DP52"
                     /translation="MKAGSSLLSLVSLLAVGSRAQNVTENNLEPRSISFGGNTSVVPS
                     AVPPPVPPPLNSTYFCTIDKGEVINPTCDVTFDEINEINGKIRKDLVSLVHTDFFKYF
                     RLHLYKQCPFWNQNNGFCVNRACAVDVVEDWDSLPEYWQPEVLGGLQENETISDEESV
                     KEDCKFLDDLCANNKKQRMIEPDIEYCDINDLHGEGSVLVDLTANPERFTGYGGQESS
                     QIWSSIYGENCFSQGETGQSLAKDAFYRLVSGLHASIGTHLSNDHLNTETGKWGPDLD
                     LFMARVGNFPDRVSNMYFNYAVVSKALWKIKPYLDHLKFCDSYDPSVKATIMNILSQL
                     DSKVFNENLIFEGELSSKLKDDFRIRFKNVTQIMDCVHCDRCRMWGKVQTTGYATSLK
                     ILFELDESNENSKQHVVDKLTKYELIALFNTFDRLSKSIESVNNFEKMYNVRLEGGKI
                     ASFFKQNNFFKLLGRASRSISESVQSISKSIDQVSESQKPSGPVFADLKLPETNSKGS
                     DEPKTNVWVKAWHTEIHNVCEAFKFIFRSYLDLPRNLYTLVLSVVNSMWNSFVGARYW
                     NWEEENPVVYNLNTW"
     gene            complement(<33846..>35222)
                     /locus_tag="ZYRO0A00506g"
                     /db_xref="GeneID:8202047"
     mRNA            complement(<33846..>35222)
                     /locus_tag="ZYRO0A00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494352.1"
                     /db_xref="GeneID:8202047"
     CDS             complement(33846..35222)
                     /locus_tag="ZYRO0A00506g"
                     /note="similar to uniprot|P54787 Saccharomyces cerevisiae
                     YML097C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494397.1"
                     /db_xref="GeneID:8202047"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:C5DP53"
                     /translation="MSNIKQDLSEFDPLTQAETSPKDQNTAGEERTVEESTNRSATVG
                     EKDDGDEDEEPFYDFQLFIQQLRDPHAEPIVRFIKSFLHDFQTVRVLWTAKEQSKLIN
                     DFKIFIYDKFGLYKPFCELEGSKLRNAQEGLEKLIMGKLYARCFSPCLEPLEQSLDKE
                     HLQDLKDDRQLKLKSREYRFISPQELDIPNLLSDKLNKLVELSGKELNKVNHFKAPRD
                     KMICVLNSCKIIMAMLTNNKLENGADSFIPLLIYTILKSNLSSLASNTRYIERFRFES
                     FFRGEALYYLNSLQAAVSFIISINESTFTIENRNQFKQRYDDNQKQLIKEDEISERER
                     ENNSIVNPRLSKSPNPSQFILQPLDEAANTIKGKVNEFFTSAKPQLKPEDEARRTDTS
                     PPSVALYDEDNQDIDRLAQKLQDREQRNTLSTLKSMFPEMDPEIVEDVCIAKKYRVGA
                     TVDILLSL"
     gene            <35425..>36963
                     /locus_tag="ZYRO0A00528g"
                     /db_xref="GeneID:8201478"
     mRNA            <35425..>36963
                     /locus_tag="ZYRO0A00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494353.1"
                     /db_xref="GeneID:8201478"
     CDS             35425..36963
                     /locus_tag="ZYRO0A00528g"
                     /note="similar to uniprot|Q04489 Saccharomyces cerevisiae
                     YML096W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494398.1"
                     /db_xref="GeneID:8201478"
                     /db_xref="GOA:C5DP54"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DP54"
                     /translation="MCGILLHYATNQNFCNELLEFEEGFQGSKSGSSNSSQIFNAIVP
                     YVAARGPNFSSLRVSKEHCISWFSSVLSLREPFIRQSVEVGDRYILQFNGELYNEEIL
                     DNDTSFVASLLENDKMSVFEVISFLEGEFAYTIYDMHEHKLYFGRDDIGKRSLSYRLD
                     QAIGDIYVASVTGQQEGFTDCLAGIVYIYDVEDKSLNQQMLPILNREVSSEIIEDEDE
                     FQRITHALYEQLKSAIVKRVESIHPMHLENSPIAVLFSGGLDCSVIAAMICQQLENQP
                     SRRTVELLNVSFENYRTGLSPHDTPDRKLAVKSANALKQLFPSVDIKLVEIDVPYETY
                     EEHRPKVIDLMYPKNTEMDLSISIAFYFASKGSGYIDCGNGQRKKYQRQGIVLFSGLG
                     ADELYGGYYKFARKSTDELVEELTRQINNIYNRNLNRDDKVIAANGVEVRYPFLDRHV
                     IEFSMQSIPINWKINKLILRKLALEKLNLNSISEEPKRAIQFGSKSAKMTKDGNRHGT
                     DVLK"
     gene            complement(<36968..>37588)
                     /locus_tag="ZYRO0A00550g"
                     /db_xref="GeneID:8201479"
     mRNA            complement(<36968..>37588)
                     /locus_tag="ZYRO0A00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494354.1"
                     /db_xref="GeneID:8201479"
     CDS             complement(36968..37588)
                     /locus_tag="ZYRO0A00550g"
                     /note="similar to uniprot|P06838 Saccharomyces cerevisiae
                     YML095C RAD10 Single-stranded DNA endonuclease (with
                     Rad1p) cleaves single-stranded DNA during nucleotide
                     excision repair and double-strand break repair subunit of
                     Nucleotide Excision Repair Factor 1 (NEF1) homolog of
                     human XPF protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494399.1"
                     /db_xref="GeneID:8201479"
                     /db_xref="GOA:C5DP55"
                     /db_xref="InterPro:IPR004579"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="UniProtKB/TrEMBL:C5DP55"
                     /translation="MNNTDTTSFQSILAGVKRLRDQNGSGDENSSKKHQQQRTTEQVE
                     PSKDVRSNEVISSFNQQRSATGDSNTNEETSGAAPIRVSNTGKSVLVNTTQKANPLLN
                     HLKNTNWRYVSSTGGNKIYYDYLIKNRSVLFLTLTYHKLYTEYISRRMLPLQRSDDNI
                     LIFVVDDKNSEDILTEITKLCMFKGFTLLVAFNFEQAAKYIGYLNC"
     gene            <37726..>38292
                     /locus_tag="ZYRO0A00572g"
                     /db_xref="GeneID:8201989"
     mRNA            join(<37726..37741,37823..>38292)
                     /locus_tag="ZYRO0A00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494355.1"
                     /db_xref="GeneID:8201989"
     CDS             join(37726..37741,37823..38292)
                     /locus_tag="ZYRO0A00572g"
                     /note="highly similar to uniprot|Q04493 Saccharomyces
                     cerevisiae YML094W GIM5 Subunit of the heterohexameric
                     cochaperone prefoldin complex which binds specifically to
                     cytosolic chaperonin and transfers target proteins to it"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494400.1"
                     /db_xref="GeneID:8201989"
                     /db_xref="GOA:C5DP56"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR011599"
                     /db_xref="UniProtKB/TrEMBL:C5DP56"
                     /translation="MSSQRIDLTKLGPEQLAAVKQQIDQEFQHFNQSLQALTLARNRF
                     QDCIEDIKSISSPENKDQKIMVPASASLYIPGKIVENDKFMVDVGTGYYVEKTDTEAM
                     SFYEHKIQKLNKESVQIQNIIKEKTSASLAIEAHIRQAAMSQHQEALKQQQAQQPTNA
                     N"
     gene            <38479..>41073
                     /locus_tag="ZYRO0A00594g"
                     /db_xref="GeneID:8201990"
     mRNA            <38479..>41073
                     /locus_tag="ZYRO0A00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494356.1"
                     /db_xref="GeneID:8201990"
     CDS             38479..41073
                     /locus_tag="ZYRO0A00594g"
                     /note="similar to gnl|GLV|CAGL0H06985g Candida glabrata
                     CAGL0H06985g and weakly similar to YML093W uniprot|Q04500
                     Saccharomyces cerevisiae YML093W UTP14 Nucleolar protein
                     component of the small subunit (SSU) processome containing
                     the U3 snoRNA that is involved in processing of pre-18S
                     rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494401.1"
                     /db_xref="GeneID:8201990"
                     /db_xref="GOA:C5DP57"
                     /db_xref="InterPro:IPR006709"
                     /db_xref="UniProtKB/TrEMBL:C5DP57"
                     /translation="MAKKKNQPSSKLRKRAQNALELAQNELGESDYSDDESAYNSGRR
                     GVLNISRRGQDEDEFEGSENGEESFEDEDLDSDEALGSDDEYDVMNSKFSQTIRDKQK
                     NKNRNQEPEGDSDEEYTSIDEADLLPLSAVWDKAGNDDDDGDSSSGAEENSNGKLELQ
                     NENEIDGDDDDDDDEGDESESSQESGSEENPFDEVPQDDDDEVELNNVTSGLMKEGDK
                     QEYKRLNNYGTGKENEYALPSATSVSGSNKLNLADMIGVVDDKEAAAKATLVQDNSST
                     LSVPLPQRIQQRHERKAAYEISKDEMDKWKDVVQQNRRAEHLDFASGRSVPDNTSSTF
                     TRSAGQPQTELEEKVDKVLQNSNLVDPVKNSTFEELATAKMSPEDMKKKTREMRLMRE
                     LMFREERKAKRLKKIKSKTYRRIKKKEMLKNRELAGVDEESDEDADVARAKERMTLKH
                     RANSKWAKEMVKHGMTNDAETREEMEEMLRQGERLNTKVLDHDSEEDDPNLSDIEREE
                     EKEQSQGTSGEKLGKSGIMDMAFMKTAEAREKDENRKTMEALRAAEVSGNVDEESDDE
                     KAANVELNQGRRIYNSVASVNSKQERAKKSGDKPNGKKQVKDGEVEVRYEEPEQQEAR
                     NGKESEDKKTESVNPWLATGDEEDESTVKHSSKVSVVDKDSTKAAKNLYKIEKKGKRN
                     SKAADADEDLLLDADDQHHMTFQTEDLTPNFMFKQQDVVAEAFAGDDVVTSFDDDKKR
                     VAESEDDKEEDVTLPGWGQWAGAGSNPKKKRKFVKKIKGTVEKNKRKDKNLQNVIINE
                     KLNKKNLKYQSSAVPFPFESKEQYERSLRMPLGSEWTSSSAHQKMIKPRILTKPSEVI
                     DPLKAPFK"
     gene            complement(<41163..>41915)
                     /locus_tag="ZYRO0A00616g"
                     /db_xref="GeneID:8201991"
     mRNA            complement(<41163..>41915)
                     /locus_tag="ZYRO0A00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494357.1"
                     /db_xref="GeneID:8201991"
     CDS             complement(41163..41915)
                     /locus_tag="ZYRO0A00616g"
                     /note="highly similar to uniprot|P23639 Saccharomyces
                     cerevisiae YML092C PRE8 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494402.1"
                     /db_xref="GeneID:8201991"
                     /db_xref="GOA:C5DP58"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DP58"
                     /translation="MADRYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVV
                     IATEKKSSSPLALTETLNKISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYG
                     EYPPTKLLVSEIAKIMQEATQSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWK
                     ATAIGKGSTAAKTFLEKRWNEELELEDAIHTVLLTLKESVEGEFNGDTIEIAVIGDEN
                     KDLLGYKGVPGDKGPRFRKLTAQEINDRLDAL"
     gene            complement(<42373..>42786)
                     /locus_tag="ZYRO0A00638g"
                     /db_xref="GeneID:8201992"
     mRNA            complement(<42373..>42786)
                     /locus_tag="ZYRO0A00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494358.1"
                     /db_xref="GeneID:8201992"
     CDS             complement(42373..42786)
                     /locus_tag="ZYRO0A00638g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494403.1"
                     /db_xref="GeneID:8201992"
                     /db_xref="GOA:C5DP59"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR009145"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DP59"
                     /translation="MVNFSPEGIDPQDFDALYEDIYMEACRFGPVRSMVICENRNDHL
                     KGNVYLYYEREQDAEDAKNNFNTRWFDERPLYCDLTHVADFREAVCRKHDLGTCERGG
                     DCNFMHVRRPSTKIRIDLEKSQAKHWQFETKRSKS"
     gene            complement(<43886..>44092)
                     /locus_tag="ZYRO0A00682g"
                     /db_xref="GeneID:8201804"
     mRNA            complement(<43886..>44092)
                     /locus_tag="ZYRO0A00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494359.1"
                     /db_xref="GeneID:8201804"
     CDS             complement(43886..44092)
                     /locus_tag="ZYRO0A00682g"
                     /note="similar to uniprot|P39103 Saccharomyces cerevisiae
                     YML129C COX14 Mitochondrial membrane protein required for
                     assembly of cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494404.1"
                     /db_xref="GeneID:8201804"
                     /db_xref="InterPro:IPR029208"
                     /db_xref="UniProtKB/TrEMBL:C5DP60"
                     /translation="MARYPWYTKVTDAVHRLTVLTLIGGSAWMMGSLGYTMYQNGKKY
                     EQKVTQQLEADEKRDLEGAASSAE"
     gene            complement(<44383..>45885)
                     /locus_tag="ZYRO0A00704g"
                     /db_xref="GeneID:8201805"
     mRNA            complement(<44383..>45885)
                     /locus_tag="ZYRO0A00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494360.1"
                     /db_xref="GeneID:8201805"
     CDS             complement(44383..45885)
                     /locus_tag="ZYRO0A00704g"
                     /note="similar to uniprot|Q03104 Saccharomyces cerevisiae
                     YML128C MSC1 Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the endoplasmic
                     reticulum msc1 mutants are defective in directing meiotic
                     recombination events to homologous chromatids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494405.1"
                     /db_xref="GeneID:8201805"
                     /db_xref="InterPro:IPR018803"
                     /db_xref="UniProtKB/TrEMBL:C5DP61"
                     /translation="MKPSISILYSLAVSANVANVIADGSIFDSWTHSDLKSYIKDQQR
                     SLEKLSSKTYEELKETLSEAWPGQTGSKKPWWQFWPSQSSVTGSSQPVTDWLFETWPM
                     ERLHAFLKKNGIHPHPGATKDQLIKYIKDHFYSISEKLDTSGFYPSSSYFEHWTADDF
                     KSWLQDFEVPFEENNDELLDKVRENIYHVSKAAEEKRLNALKSLDLANRELLDSAGDI
                     KKDVFEHWSAEDLRKWLNSHKIPYNDDIEEKRDALAALASDQKELLKDDIQWFLEAAQ
                     RHSSPFLSKSPDYVCSVWDKTLLNLGSAFNSVQNKVGDVINDTFLIDLDSWPRGKITE
                     FLDARGVSYSKIATNEQLRALVREVRNKPLKKAQEKYDQLTDGAWYHSLKNWAQRKSG
                     EVQGNDYYKSVSTNAKTLSKNTQSWASGLGKKVKDDFNSWSVEDLKNYLKKMSGGAST
                     ATMSKDELVKLVREKTNLMLGVQEQPWYERWTNNVKNLFSRVPAALAVRQ"
     gene            <46819..>48573
                     /locus_tag="ZYRO0A00726g"
                     /db_xref="GeneID:8201806"
     mRNA            <46819..>48573
                     /locus_tag="ZYRO0A00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494361.1"
                     /db_xref="GeneID:8201806"
     CDS             46819..48573
                     /locus_tag="ZYRO0A00726g"
                     /note="similar to uniprot|Q03124 Saccharomyces cerevisiae
                     YML127W RSC9 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex DNA-binding protein
                     involved in the synthesis of rRNA and in transcriptional
                     repression and activation of genes regulated by the Target
                     of Rapamycin (TOR) pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494406.1"
                     /db_xref="GeneID:8201806"
                     /db_xref="GOA:C5DP62"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="UniProtKB/TrEMBL:C5DP62"
                     /translation="MSAYAANHSPTPHSVTDTSIPGVPSGGGEDEVDMNNMFMQLVPQ
                     PIRVTRNQSNGVAASKSLQFSLANLNVFQNLPKETSRGVDDLTRMKMAILSGIPEEVK
                     WALKKYLAYSNKAPYMISLKDLPNLLPLFTNFIQDMEPLVEKFNTPVLGDVKCMEKLQ
                     TGLNSLLIVRNLAQDTDSVQVLVSDTTIKNFILFVLQKFELVADGDSSWQIYDSNVSF
                     FSELCHYALDLMEAISSYIAPAKKDDLYFQTLVSVLNYTKDRYMVISILRSLSRLLVR
                     SKADEESAADNLDERTLSLIVSFLIVECDSELIIASLDFLYQYILPGAQRISILLDDP
                     HRFATLGAVLPRLLTYNIKEPEYDVLENFEVKLVKRLRPPAPSSAPDLPPSLFEQLLA
                     LNEPMRSTAWLRCCFQPVVDAEFTQISLWRAYESKFAQPVRESGRKLLPAVEFIKNVS
                     NAFSEASAMVITDSTTGKKRFVMKGIQPRPKALSINEGEYAAKNSLPPLQSKFLDDSS
                     NITPARQEELPDIKFPTKLSEVSKATSTFLCLLSNESSGPGVDFCRVIKPVVLHKLAD
                     IPPLSYALSEYMENTPGV"
     gene            complement(<48973..>52695)
                     /locus_tag="ZYRO0A00748g"
                     /db_xref="GeneID:8201807"
     mRNA            complement(<48973..>52695)
                     /locus_tag="ZYRO0A00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494362.1"
                     /db_xref="GeneID:8201807"
     CDS             complement(48973..52695)
                     /locus_tag="ZYRO0A00748g"
                     /note="similar to uniprot|Q02773 Saccharomyces cerevisiae
                     YML091C RPM2 Protein component of mitochondrial RNase P
                     along with the mitochondrially-encoded RNA subunit RPM1
                     Rnase P removes 5' extensions from tRNA precursors Rpm2p
                     is also involved in maturation of RPM1 and in translation
                     of mitochondrial mRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494407.1"
                     /db_xref="GeneID:8201807"
                     /db_xref="InterPro:IPR013888"
                     /db_xref="UniProtKB/TrEMBL:C5DP63"
                     /translation="MAFKSFKYKFYTKGYHSASQKPATAFFDSSYQYLRQNQGLVAVD
                     SAVPPSHLPHLGPHPVIGANVNFNIVDDVLQDYETADERREEQLREQYENNGNVNQHS
                     HQRESKGSNTDTYNGRRQRSASISSHHQTRSPAALRRRSMGENTATLSLRTGAKDAFI
                     DHTLSQRYYSTTNTSRKESDIHSHYRIPPESQPVVPAGKDAKVAADNVAKEDNVVDNG
                     RPAQLDQQFLSKQRDSMSPWEEDKEPCLNKDTFLRTHTDQINKCYENGDLNSINSLYQ
                     ALKRNDIIPPLKVYEQILDSVARRQFDNDDLDYKIAELLTCYQDLIMNRLKPSDRIYN
                     TVLECLFKASIAAYVTHNSNGVDFYKIAAELFHTIGGGSHLLSKSVLDHALLAMNLFP
                     GHMSLVQAQRILDKNSNAKSDSFYYVALLSYAKTMNDPGAIESLYEEYRLALSSDPLL
                     KEGEFEVYSMTVSGLVETGELELAIKLLDRLMQDLRNVSGSSENVSLLLSNFLLSVSK
                     LNCHKAYNLWAQFHKLKWVPEFSYEFYLVLMANSFEDWKLTKKIYSCLYPMKCQFRGN
                     HRNKLSEYLLYPMGVESVLSSLMDYSLQLKDSEIIMKLIEESIIKKFRFDTALYPFIF
                     AYLKEIRCPDEYLLRFVKAQGNVIKDAESISNVEKYDFLNGIVQHFPSQVILKKVTEM
                     EFFVDLCRNLNLSDSRVVNYGGLIGCMTSLWGSPQTIDKYAFNMEIHAILITKLYDFD
                     TYCSELDNDSLAEFREKTMERFSKLATNYKRLNLDPAKVPGVVVQAIKLTNVAEDVMA
                     FYNHPGDWDKSYHLSLGSVIRNSVRTGIKEYQKLLLEGYCFDYDTYKELISAKFVDSH
                     IIKSSLELCPDKEEQKYLTNLTVIRAPHDKLQDLVLLNPQFSSQILPFLKDESLLRLA
                     KNADIYKWIEVTDFPKAFMSIAVQAEYKASIEYIYSQLYQLKDYETILQFNKSCPVLD
                     MEILLKSCIRCGEYTQYNQLFEKFKDHLGSSSIDIQSEYLINNGQVDEAVHLINSANA
                     KTPHKTLDLYTFGLFLQSFTREIGYYDAPENTLQLANLLSTQSTFSGMLALYDIVSHT
                     EPFNVGESAKSAVKAELLEQMLNNIQDAINFVDVENEDIRDEFLLKLQNFFRFKVFLK
                     QPFVTLNDMKKLLDIWQNVNPYAIDTLFNNMVESIYLNPSAQSLYLENDLMFHYNSDS
                     LLELTNEIENFYANKEDSEAVDKIRRFKSVMNENKL"
     gene            complement(<53612..>54997)
                     /locus_tag="ZYRO0A00770g"
                     /db_xref="GeneID:8201808"
     mRNA            complement(<53612..>54997)
                     /locus_tag="ZYRO0A00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494363.1"
                     /db_xref="GeneID:8201808"
     CDS             complement(53612..54997)
                     /locus_tag="ZYRO0A00770g"
                     /note="highly similar to gnl|GLV|KLLA0D10505g
                     Kluyveromyces lactis KLLA0D10505g and highly similar to
                     YML126C uniprot|P54839 Saccharomyces cerevisiae YML126C
                     ERG13 3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase
                     catalyzes the formation of HMG-CoA from acetyl-CoA and
                     acetoacetyl-CoA involved in the second step in mevalonate
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494408.1"
                     /db_xref="GeneID:8201808"
                     /db_xref="GOA:C5DP64"
                     /db_xref="InterPro:IPR010122"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="UniProtKB/TrEMBL:C5DP64"
                     /translation="MTETKKQKTVQHPGKPQNVGIKGIEIYIPSQCVSQEELEKKDGV
                     SAGKYTIGLGQTKMSYVNDREDIYSMSLTVCSRLLKNYGIDPHSVGRLEVGTETLLDK
                     AKAVKTVLTQLFEGNNDLEGIDTYNACYGGTNALFNSINWIESNAWDGRDAIVVCGDI
                     AIYDKGAARPTGGAGTVALWIGPDAPLVFDNVRASYMEHAYDFYKPDFTSEYPYVDGH
                     FSLTCYVKAVDQVYRSYSKKAIARGLAKDPLSPESIGVKNHFDYNIFHVPTCKLVTKS
                     YARLLYDDFRAKPELYPEVDSNLAKVDYEKSLTDKSIEKTFVGATKQLCQERVQPSLI
                     VPTNTGNMYTGSLYASLASLLYYVGSEKLQGKRVGLFSYGSGLAASLFSLKVVGDVSH
                     INKLLDLDNKLNSRAVETPEQYEAAIHLREEAHLKKSFEPKGSIDLVAPGAYYLTSID
                     DKFRRNYSVKQ"
     gene            <55544..>57589
                     /locus_tag="ZYRO0A00792g"
                     /db_xref="GeneID:8201809"
     mRNA            <55544..>57589
                     /locus_tag="ZYRO0A00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494364.1"
                     /db_xref="GeneID:8201809"
     CDS             55544..57589
                     /locus_tag="ZYRO0A00792g"
                     /note="similar to uniprot|Q04511 Saccharomyces cerevisiae
                     YML088W UFO1 F-box receptor protein subunit of the
                     Skp1-Cdc53-F-box receptor (SCF) E3 ubiquitin ligase
                     complex binds to phosphorylated Ho endonuclease allowing
                     its ubiquitylation by SCF and subsequent degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494409.1"
                     /db_xref="GeneID:8201809"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DP65"
                     /translation="MCIYYKLHLSKKSHLLGRNLVLLRKISAMDGDESPHSALLALPA
                     EILINILSHLDEKDLYVLQEVCSRLRRLVNDEELWKNLFISQIHTNYFPSFAQTPKYS
                     IEYVDRQQGLRQWGHNRAIKTKYVIAPSPRFEVQIESMIFDYPRCACYNDGVITVVQL
                     HQRRKKDRLVYIPCTTPQGCSTMHFNINSAVFGRFDGRVFGKLLSNKSYLTPVTEFNA
                     RHTHCVTAIAASSSQDFSEDWCASGSANGELMWWCETKLVKDIRVSNRPIQRLALYKN
                     WTIALDDDRIYVIHAMDQVHSLALPRVQNEAGAEVPLNVQFLKVDFGAKWLVMADLKG
                     LYVIAFDPEQNFGHTRCLQIQEGISNVVADESTCRREQNSNFAGGDGCFIAVITADNS
                     VKVINIRAPGNVLKVNTHLHFDKEVHTCQVTNLVVVCALAGSLQIFDAASGELVKVVQ
                     KTDKDPQFLGLSQGRMVVASRNVIQYLQYVPEERINKNRTGSSSRGQNIKWEKEVSLG
                     MDIYDEEEQIRQETAERNRKLLEDYGGDMSEEELHLRIALMESESVAERPVQQGQEEN
                     DDADEELRRALEESRRQHEHEELLNSFADDDDDDFRDALGQSLAAERRRNPRARLRHN
                     TPESRTHEDTSTHTNNDTQQQLDQHQQQQQQQQQQQQQTDDEEALQLAIALSLSEMS"
     gene            complement(<57722..>58657)
                     /locus_tag="ZYRO0A00814g"
                     /db_xref="GeneID:8201810"
     mRNA            complement(<57722..>58657)
                     /locus_tag="ZYRO0A00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494365.1"
                     /db_xref="GeneID:8201810"
     CDS             complement(57722..58657)
                     /locus_tag="ZYRO0A00814g"
                     /note="similar to uniprot|Q12746 Saccharomyces cerevisiae
                     YML125C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494410.1"
                     /db_xref="GeneID:8201810"
                     /db_xref="GOA:C5DP66"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C5DP66"
                     /translation="MADVLVGKNILDEPVHGIYIPTGLFLAGISITVYMSGENRLLYT
                     LPVLFSFLAYRAYAAYSRKRSIYSDRWSPLELEDKTIVSKNTAIYRFKLNTSVETLNL
                     PPGYHLMARAFINGTEEIRPYHPISPRYAPGYFDLMVKSYVDGKVSKFFAGLEPGKTV
                     DFMGPVGKLNYYCNSSTAIGLVAGGSGITPILQVLNEIITTPEDVTKISLLYANETEN
                     DILLKDELDELVDKYPHFEVNYVVNRPSSNWKGLRGYVTKEMMQRCLPSPSVDHRLLI
                     CGPPDMNSLVLELANNIGWRFSGEESEGNDQVFVF"
     gene            complement(<58896..>60503)
                     /locus_tag="ZYRO0A00836g"
                     /db_xref="GeneID:8201811"
     mRNA            complement(<58896..>60503)
                     /locus_tag="ZYRO0A00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494366.1"
                     /db_xref="GeneID:8201811"
     CDS             complement(58896..60503)
                     /locus_tag="ZYRO0A00836g"
                     /note="highly similar to uniprot|P54783 Saccharomyces
                     cerevisiae YML086C ALO1 D-Arabinono-1 4-lactone oxidase
                     catalyzes the final step in biosynthesis of
                     D-erythroascorbic acid which is protective against
                     oxidative stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494411.1"
                     /db_xref="GeneID:8201811"
                     /db_xref="GOA:C5DP67"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR007173"
                     /db_xref="InterPro:IPR010031"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR023595"
                     /db_xref="UniProtKB/TrEMBL:C5DP67"
                     /translation="MVMLFDFLSVAPRRGFVFKNWAGIYSCRSQLYFQPTSVDEIVKV
                     VKAARQERKTLVTVGSGHSPSDMCMTNEWLMNLDRFNKVLELKEHPRKKYADVTVEAG
                     MRVYQLSEYLEQKGYAIQNLGSISEQSVGGIISTGTHGSSPYHGLVSSQYVNLTIVNG
                     KGDVVFLDSEHQPDVFKAALLSLGKIGVIVKATIRAVPKFNLRSTEELIKFDTLLDKW
                     DTIWTSSEYIRIWWYPYARKCILWRGIKTQEPVTIPRKSWWGTLVGRYFYETLLWVAT
                     QIYSPLTPYIERFVFHRQYGQVETFGQGEVEVSKSVDGLNMDCLFSQFVDEWGCPLEN
                     GPEVLRSLDHSIMQAAQNKEFYVHVPIEVRCSNTTTPDKPLNVEDRTSTSPGPIHGNT
                     LRPYLDNTPSHCRYAPLSDVTNNQLTLYINATMYRPFHWNSAVGRWYALFEDTMAAAE
                     GKPHWAKNFIGSTSLLEKQNKPETEYDDYEMRGMAKSVRKWYGQDLKNWQRIRREQDP
                     DGVFLANKDWCIRNGIVDEQDIEQADH"
     gene            <60861..>61805
                     /locus_tag="ZYRO0A00858g"
                     /db_xref="GeneID:8201896"
     mRNA            <60861..>61805
                     /locus_tag="ZYRO0A00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494367.1"
                     /db_xref="GeneID:8201896"
     CDS             60861..61805
                     /locus_tag="ZYRO0A00858g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494412.1"
                     /db_xref="GeneID:8201896"
                     /db_xref="UniProtKB/TrEMBL:C5DP68"
                     /translation="MGKLAEICCRVVAQELSWLSFAEARYIIENLPSAQCVELVWQHL
                     CQNMKDSKTLYLLMQNHPLIAGELDSTGWYGHKISYRRQSVPNLDLVESIRFFNTLEG
                     HANYQFLTILELQNDMPGLESLVNLPSLVELSVAGISRPEQLVTSWHRALKVDSRRWS
                     QLKVLNVPQLTSPRLFFDSWQLIPSLLWMGVNLDGKTIGNIPKLNQLVIEAPIKAPME
                     ILCWLQEWQTMEIDGKVMIELDVNPNLVIPSIPSYFPLEARFSKLPGTYGYMRRLTNK
                     RTEIPEQDEVERPKTKRPKHRGIRRGASLQRFFGWGGL"
     gene            complement(<62129..>63574)
                     /locus_tag="ZYRO0A00880g"
                     /db_xref="GeneID:8201897"
     mRNA            complement(join(<62129..63444,63550..>63574))
                     /locus_tag="ZYRO0A00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494368.1"
                     /db_xref="GeneID:8201897"
     CDS             complement(join(62129..63444,63550..63574))
                     /locus_tag="ZYRO0A00880g"
                     /note="highly similar to uniprot|P09733 Saccharomyces
                     cerevisiae YML085C TUB1 Alpha-tubulin associates with
                     beta-tubulin (Tub2p) to form tubulin dimer which
                     polymerizes to form microtubules"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494413.1"
                     /db_xref="GeneID:8201897"
                     /db_xref="GOA:C5DP69"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002452"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:C5DP69"
                     /translation="MREVISINVGQAGCQIGNSCWELYSLEHGIRPDGYLQEGLSKPK
                     GGEEGFSTFFYETGSGKYVPRAVYVDLEPNVIDEVRTGPYKDLFHPEQLINGKEDAAN
                     NYARGHYTVGRELLDDILDRIRKISDQCDGLQGFLFTHSLGGGTGSGLGSLLLEQLSI
                     DYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKKNL
                     DIGRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPI
                     LSKSKAYHEANSVSEITNACFEPGNQMVKCDPRTGKYMATCLLYRGDVVTRDVQNAVS
                     QVKNKKTVQMVDWCPTGFKIGICYEPPTATPASQLSSVKRAVCMLSNTTAIADAWKRI
                     DRKFDLMYSKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYADEEF"
     gene            complement(<64264..>66078)
                     /locus_tag="ZYRO0A00902g"
                     /db_xref="GeneID:8201898"
     mRNA            complement(<64264..>66078)
                     /locus_tag="ZYRO0A00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494369.1"
                     /db_xref="GeneID:8201898"
     CDS             complement(64264..66078)
                     /locus_tag="ZYRO0A00902g"
                     /note="similar to uniprot|P25297 Saccharomyces cerevisiae
                     YML123C PHO84 High-affinity inorganic phosphate (Pi)
                     transporter and low-affinity manganese transporter
                     regulated by Pho4p and Spt7p mutation confers resistance
                     to arsenate exit from the ER during maturation requires
                     Pho86p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494414.1"
                     /db_xref="GeneID:8201898"
                     /db_xref="GOA:C5DP70"
                     /db_xref="InterPro:IPR004738"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DP70"
                     /translation="MSEKEDIHVEETAKNMTTGGNAAFHNYINDFAHIEDPLERRRLA
                     LQKIDEASFGWYHIRAIMVAGVGFLTDSYDIFAINLGVSMMTYVYWKDGNIPSSSETL
                     LKVSTSVGTVIGQFGFGILADVLGRKKIYGVELIIMIAACIMQCVIGASPAVNFTAIM
                     TFFRIIMGIGIGGDYPLSSIITSEFSTTKWRGAIMSAVFANQAFGQVAAGIVALILVE
                     GYKDDLKAAKSGSTCGPSCKRACDQMWRILIGMGCVPGCIALYFRLTIPESPRYTLDV
                     EFDAARGVADASKFVSGTQGEAAQNDIERLQRNPTAVVAAAQEHPYEGISDSSEAPVR
                     VDVPVENALPKASFKDFCHHFGQWKYGKILFGTAFSWFCLDVAVYGLNLNTAVILNAI
                     GYSGKGSIYQKLHDTAVGNLILICGGSLPGYWFTVFTVDIIGRKPIQLFGFFILTVIF
                     CIIGFDYHNLSGKELLGLYIICEFFQNFGPNTTTFLIPGEIFPTRYRSTAHGLSAAAG
                     KVGAIIAQTALGTLINHNCAKDNKPTNCWLNHVMEIFALFMLLGLLVSLLIPETKRMT
                     LEEVSEKYHDEIDPSKYRNVPSQSSTNSDTASSTMEQV"
     gene            complement(<66827..>68146)
                     /locus_tag="ZYRO0A00924g"
                     /db_xref="GeneID:8201899"
     mRNA            complement(<66827..>68146)
                     /locus_tag="ZYRO0A00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494370.1"
                     /db_xref="GeneID:8201899"
     CDS             complement(66827..68146)
                     /locus_tag="ZYRO0A00924g"
                     /note="similar to uniprot|P29704 Saccharomyces cerevisiae
                     YHR190W ERG9 Farnesyl-diphosphate farnesyl transferase
                     (squalene synthase) joins two farnesyl pyrophosphate
                     moieties to form squalene in the sterol biosynthesis
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494415.1"
                     /db_xref="GeneID:8201899"
                     /db_xref="GOA:C5DP71"
                     /db_xref="InterPro:IPR002060"
                     /db_xref="InterPro:IPR006449"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR019845"
                     /db_xref="UniProtKB/TrEMBL:C5DP71"
                     /translation="MVKALELLSHPVELKSALKLKFIRQPLYAPRDIASPELTRCYEL
                     LKATSRSFAAVIQELNPELRDAVMLFYLILRALDTVEDDMTIEPQLKVKVLRSFAEKL
                     DTRDWSFDGNSPEEKDRKVLVEFPCILHQYHELRPKYRQVIQDITVKMGNGMADYILD
                     EQFNLQGVQTVKDYDLYCHYVAGLVGEGLTHLIVEAGFGTPDLDANPQLYESMGLFLQ
                     KTNIIRDYAEDLGDGRSFWPREIWSKYAEKLPDLGDPRNAQNGLSCINELVLNALSHV
                     IDVFTYLSSINEQSTFQFCAIPQVMAIATLALVFNNEKVLTDRVKIRKGTTCELILKS
                     HTLHGCLSIFRHYVRDIKSRVPVQDPNYLKVNIQVARIEQHIEEMYQDKLPNGAKPKE
                     TIYYTKAQERFKQDEKILPIEQNEEYKFNMALTVLLTIVSAIYFYAK"
     gene            complement(<68502..>69077)
                     /locus_tag="ZYRO0A00946g"
                     /db_xref="GeneID:8201900"
     mRNA            complement(<68502..>69077)
                     /locus_tag="ZYRO0A00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494371.1"
                     /db_xref="GeneID:8201900"
     CDS             complement(68502..69077)
                     /locus_tag="ZYRO0A00946g"
                     /note="similar to uniprot|P38876 Saccharomyces cerevisiae
                     YHR189W PTH1 One of two (see also PTH2)
                     mitochondrially-localized peptidyl-tRNA hydrolases
                     dispensable for cell growth and for mitochondrial
                     respiration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494416.1"
                     /db_xref="GeneID:8201900"
                     /db_xref="GOA:C5DP72"
                     /db_xref="InterPro:IPR001328"
                     /db_xref="InterPro:IPR018171"
                     /db_xref="UniProtKB/TrEMBL:C5DP72"
                     /translation="MLRFRRRLTCFTGIGNPEPKYAGTRHNVGLIILDLLKNRFDAEQ
                     IHPYKVSSLSPAKYCQISSQLVMIRSDGDYMNLSGKTVVPMWNRLPHRDHVTHVVLHD
                     ELSLPLGKVQLRKPGTSLRGHNGLKSIQNCWRNDNFYRLSVGIGRPPQRDSTVVSDYV
                     LSKFDERELEILQTKSFKTAWERIGHLVNNK"
     gene            <69245..>70144
                     /locus_tag="ZYRO0A00968g"
                     /db_xref="GeneID:8201901"
     mRNA            <69245..>70144
                     /locus_tag="ZYRO0A00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494372.1"
                     /db_xref="GeneID:8201901"
     CDS             69245..70144
                     /locus_tag="ZYRO0A00968g"
                     /note="highly similar to uniprot|Q00582 Saccharomyces
                     cerevisiae YML121W GTR1 Cytoplasmic GTP binding protein
                     and negative regulator of the Ran/Tc4 GTPase cycle through
                     its homolog and binding partner Gtr2p involved in
                     phosphate transport and invasive growth human RagA and
                     RagB proteins are functional homologs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494417.1"
                     /db_xref="GeneID:8201901"
                     /db_xref="GOA:C5DP73"
                     /db_xref="InterPro:IPR006762"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DP73"
                     /translation="MSSNNRKKLLLMGRSGSGKSSMRSIIFSNYSAFDTRRLGATIDV
                     EHSNRRFLGNMTLNLWDCGGQDVFMENYFTRQKDHIFQMVQVLIHVFDVESQEVIKDI
                     EIFTKALKQLKKYSPDAKIFVLLHKMDLVQLDKREELFQLMMKKLQETSSEYGFPNLI
                     GFPTSIWDESLYKAWSQIVCSLIPNMAVHQSNLKKLKSVMNAWEIVLFERSTFLVVCS
                     SNAVNGETLDPKRFEKISNIMKNFKQSCTKLKSGFKTLVLNENIYVSEISQNMVCFIV
                     LNNSEEPQSMVLENIRMAKEFFQ"
     gene            complement(<70521..>71861)
                     /locus_tag="ZYRO0A00990g"
                     /db_xref="GeneID:8201902"
     mRNA            complement(<70521..>71861)
                     /locus_tag="ZYRO0A00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494373.1"
                     /db_xref="GeneID:8201902"
     CDS             complement(70521..71861)
                     /locus_tag="ZYRO0A00990g"
                     /note="some similarities with uniprot|P40463 Saccharomyces
                     cerevisiae YIL135C VHS2 Gene whose overexpression
                     suppresses the synthetic lethality of the hal3 sit4 double
                     mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494418.1"
                     /db_xref="GeneID:8201902"
                     /db_xref="UniProtKB/TrEMBL:C5DP74"
                     /translation="MNGTTTIPEYKFTSSPQSDNGNSSMIFERTVEDACSSRPFSRHG
                     SSVSLLSRKYSNQSTGGVGIPVTASSSRCGHRTPRTSQHSSPSQQGSPLDSPELVPGT
                     GTVNHRRHLENFVAPALDASCSIIADESANLNDLDIVYMRKPSTIGLDLALGRTRSNS
                     YATLREEHQQQQQQQQQQQQPVPPPLPRSNSASVGMDAKPRTLRFYSYADMLSDEMAT
                     SPTSGTRPPLPHSASSTFLRPAPQHQPMHFSNPFKTTTATTGNSNGCSSCGCGNGTRS
                     RKDSTASSGNLNPNVRRCSNNVLSRSTTSHLQAAAPPAPAPALGLARANKLAKPRRRS
                     AFQIESSDEFSSDEEDESPFPSSNHMGFSPLGSRVSRTSTQNSVNSQPSSHRAGGGSF
                     SNSSPSLMRRESFQNSINGVLMEDTLQTEKVGDILRKRMGNVKKQDIKVTTGED"
     gene            72860..72968
                     /gene="SNR68"
                     /locus_tag="ZYRO0A01012r"
                     /db_xref="GeneID:8201903"
     ncRNA           72860..72968
                     /ncRNA_class="snoRNA"
                     /gene="SNR68"
                     /locus_tag="ZYRO0A01012r"
                     /product="snR68"
                     /note="C/D snoRNA monocistronic SNR68"
                     /transcript_id="XR_002648378.1"
                     /db_xref="GeneID:8201903"
     gene            <72981..>74486
                     /locus_tag="ZYRO0A01034g"
                     /db_xref="GeneID:8201773"
     mRNA            <72981..>74486
                     /locus_tag="ZYRO0A01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494374.1"
                     /db_xref="GeneID:8201773"
     CDS             72981..74486
                     /locus_tag="ZYRO0A01034g"
                     /note="similar to uniprot|P32048 Saccharomyces cerevisiae
                     YNL073W MSK1 Mitochondrial lysine-tRNA synthetase required
                     for import of both aminoacylated and deacylated forms of
                     tRNA(Lys) into mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494419.1"
                     /db_xref="GeneID:8201773"
                     /db_xref="GOA:C5DP75"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5DP75"
                     /translation="MKKAIVDSSKLFASRNRLIEGNPSKYYPSIVRGSSSVKEFVERW
                     KGLDSSTRNVNESLHGRICGVRSAGKNMCFLDLGGLQVVMNSKEMAERNDGLNLAQRY
                     RAGDYVLVSGRPGLTERQRTLSIRAEKPPTVLAAAQQPLPPSLEDRAKLKQNRVLDYQ
                     LSGVEMLVTRHKVTRAVREFLDGRDFVEVETPILSNKANGASAEAFVTYSNALPENEK
                     RLELRVAPELWLKRLIIGGLERVYELGKVFRNEGIDATHNPEFTTLEFYQAYVTMEDL
                     IENVRDMLVHICSAVSGLPMAQRLLSELQTKGLQRLDFVDTLSKETGTDFHGIQDWSN
                     PELLWEATPIKDRSKLFPEGPQALSPSQMWNRLGGYYVEDRHCNGLCPTLVCNHPSII
                     SPLAKPNDNRLSKRFEMFIGGKEYINAYEEENCPQRQLQSFKDQAQSLLQYGDKESLS
                     VDEAYVEAMKWGMPPTGGVGLGIDRLVALLLGSTRIEEVLAFGCLDDVNRQ"
     gene            complement(<77175..>79022)
                     /locus_tag="ZYRO0A01078g"
                     /db_xref="GeneID:8201904"
     mRNA            complement(<77175..>79022)
                     /locus_tag="ZYRO0A01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494375.1"
                     /db_xref="GeneID:8201904"
     CDS             complement(77175..79022)
                     /locus_tag="ZYRO0A01078g"
                     /note="weakly similar to uniprot|Q75D69 Ashbya gossypii
                     ABR154C ABR154Cp"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494420.1"
                     /db_xref="GeneID:8201904"
                     /db_xref="GOA:C5DP76"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:C5DP76"
                     /translation="MDMSNNPEYVKETNEVWNRNFARARYWGAGLMGYWGLLVLIASI
                     NNWSTRFYPRATLVLRSQLDRFSPIRWLRGHVLIPTLLPRGKHLMHNRIGGLIPTRFE
                     SLILFIYFALVFIGESVNYETSKHNIYWPQKKDQLTRYVGDRSAIISMFIIIPTYLFA
                     GRNNFLLWLTGWRQSTFMTFHRWLARMAVVSSLVHTFTMLLNDYWLHTVHLRKYTQYW
                     RWGSVAIICGVIMVVQSLPFLRRSWYEIFLYGHIILALFFLIGVCIHLTVLGYGQYAY
                     AAASVWAFDRCIRLIRLGCFGIRYANVSITDEKHLLVIIDDSAQVWDKKPKPGAFGYL
                     YFLTGPFSWFQSHPFSVITIENSNSIAFQVTVKNGLTKRLYNDLISKADQTSRMKIML
                     EGFYGEYKPVRGYDQVMMFSSGAGAISPLEYLKEVVDHNSNTNSNQEHHNVKYVKFYW
                     MVPDLSYTRVLAPELIKLQKLEYVHPIIYVTQPQSKFQSIGSVPSGDENSSSSVNQAA
                     EDLEKSKGDKTKDTSITVNSTEEAIPISSKLESELVNSCEIHYGSRPDLNQLLIQDLQ
                     ETQPSDHVAVMTCAHPAVCDQIRSIVAEETSIKKGRSGTLDLIELLQSW"
     gene            <79473..>80402
                     /locus_tag="ZYRO0A01100g"
                     /db_xref="GeneID:8201905"
     mRNA            <79473..>80402
                     /locus_tag="ZYRO0A01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494376.1"
                     /db_xref="GeneID:8201905"
     CDS             79473..80402
                     /locus_tag="ZYRO0A01100g"
                     /note="similar to uniprot|P53942 Saccharomyces cerevisiae
                     YNL072W RNH201 Ribonuclease H2 catalytic subunit removes
                     RNA primers during Okazaki fragment synthesis cooperates
                     with Rad27p nuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494421.1"
                     /db_xref="GeneID:8201905"
                     /db_xref="GOA:C5DP77"
                     /db_xref="InterPro:IPR001352"
                     /db_xref="InterPro:IPR004649"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR023160"
                     /db_xref="InterPro:IPR024567"
                     /db_xref="UniProtKB/TrEMBL:C5DP77"
                     /translation="MLPPTVEFCKGSLHSKTFYSPVPEQIAQCKDNDDNDNENDQIIL
                     GVDEAGRGPVLGPMVYGISYCTKQFQDEILKPNYGFDDSKKLSDLERRRLFSKIYGEN
                     GEVAEIANVGYAVTAITPADISSGMLRYPANANYNLNEQAHDVTIALIEGVLQRGVKL
                     HHVYVDTVGPPASYQKKLEQKFPHIKFTVAKKADSLYCVVSVASIVAKVTRDILLEQW
                     AQQVSPPEAGPLGSGYPADAKTTAWLRNTMKPLMGWDPHLVRFSWQTSETLLDNKGIQ
                     IEWEEKSKSKPVWAGKSMLQAERKPLTLDSWYG"
     gene            <81173..>82201
                     /locus_tag="ZYRO0A01122g"
                     /db_xref="GeneID:8201702"
     mRNA            <81173..>82201
                     /locus_tag="ZYRO0A01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494377.1"
                     /db_xref="GeneID:8201702"
     CDS             81173..82201
                     /locus_tag="ZYRO0A01122g"
                     /note="similar to uniprot|Q08911 Saccharomyces cerevisiae
                     YOR388C FDH1 NAD()-dependent formate dehydrogenase may
                     protect cells from exogenous formate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494422.1"
                     /db_xref="GeneID:8201702"
                     /db_xref="GOA:C5DP78"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:C5DP78"
                     /translation="MCRHKVLLVLNAAGGKSEGHQKLLKCVEEKLGLKSFVESRGSEL
                     VPVVDETKSSNKNSATGEIIVLPHGSMPTVDAPRIKLSVTADDAVQVEVCDNGKLTVN
                     DNVNDNNAFDDDDTNDGGFRSPKRRKISVSDLTNSNHVSAAEHVITTILVLVRSYNEN
                     LQRQMHDVELDVHGSIRDNFDIENKVIGIIGAGKVGYRIMERLVAFNPRKILYYDPKE
                     LPVKNVKKLNVVGLLINQRGDIVQRVDKLEEMLSHSDVVTINCPLNKDSKGLFNKELI
                     SHMKDGSFLINASKGGICIARDIKEATKSGKLAGYSGDVQHSEYEAHDLKDILEGLLQ
                     RRHGQKTN"
     gene            <82681..>84063
                     /locus_tag="ZYRO0A01144g"
                     /db_xref="GeneID:8201703"
     mRNA            <82681..>84063
                     /locus_tag="ZYRO0A01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494378.1"
                     /db_xref="GeneID:8201703"
     CDS             82681..84063
                     /locus_tag="ZYRO0A01144g"
                     /note="similar to uniprot|P12695 Saccharomyces cerevisiae
                     YNL071W LAT1 Dihydrolipoamide acetyltransferase component
                     (E2) of pyruvate dehydrogenase complex which catalyzes the
                     oxidative decarboxylation of pyruvate to acetyl-CoA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494423.1"
                     /db_xref="GeneID:8201703"
                     /db_xref="GOA:C5DP79"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR006257"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:C5DP79"
                     /translation="MSALIRAAVPRVARISLASRLALRCYASYPAHTVIGMPALSPTM
                     AQGNLAQWSKKEGEQIGAGDVLAEIETDKATMDFEFQDEAYLAKILVPEGTKDIPIGK
                     PIAVTVEDGGDVDAFKDFKVEESAPKEEPKKEEPKKEESSADAKPTPAPSQSASKVAA
                     PPTDRIVASPLAKTIALDKGISLKSVNGTGPNGRITASDVEAFLSKAPAAGAGGAAGA
                     SSASGAATETYEDEPISNMRSIIGRRLLESTQSIPSYIVSSDISVSKLLKLRKSLNAS
                     AKDQYKLSINDILIKAITVAARRVPDANAYWLQDQGIIRSFKNVDVSVAVATPTGLLT
                     PIIKNAESKGLVSISGEVKEKVARAKINKLKPEEFQGGTICISNMGMNNAVSLFTSII
                     NPPQSTILAVSTVKRVAVEDAGAENGISFDDQMTITGTFDHRTIDGAKGGEFMRQLKN
                     VVENPLELLL"
     gene            <84426..>84608
                     /locus_tag="ZYRO0A01166g"
                     /db_xref="GeneID:8201704"
     mRNA            <84426..>84608
                     /locus_tag="ZYRO0A01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494379.1"
                     /db_xref="GeneID:8201704"
     CDS             84426..84608
                     /locus_tag="ZYRO0A01166g"
                     /note="similar to uniprot|P53507 Saccharomyces cerevisiae
                     YNL070W TOM7 Involved in mitochondrial protein import
                     translocase of the outer mito. membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494424.1"
                     /db_xref="GeneID:8201704"
                     /db_xref="GOA:C5DP80"
                     /db_xref="InterPro:IPR012621"
                     /db_xref="UniProtKB/TrEMBL:C5DP80"
                     /translation="MSFLPSFILSDESKERISKILSMSHTVVHYGWMPFILYLGWAHT
                     ANRPNILNLLSPLPSI"
     gene            <84781..>85716
                     /locus_tag="ZYRO0A01188g"
                     /db_xref="GeneID:8201705"
     mRNA            <84781..>85716
                     /locus_tag="ZYRO0A01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494380.1"
                     /db_xref="GeneID:8201705"
     CDS             84781..85716
                     /locus_tag="ZYRO0A01188g"
                     /note="similar to uniprot|P40464 Saccharomyces cerevisiae
                     YIL134W FLX1 Protein required for transport of flavin
                     adenine dinucleotide (FAD) from mitochondria where it is
                     synthesized from riboflavin to the cytosol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494425.1"
                     /db_xref="GeneID:8201705"
                     /db_xref="GOA:C5DP81"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DP81"
                     /translation="MGELTPLQKEVVAGLTAGTLTTITVHPLDLVKIRLQLLATSAHR
                     YGYREVAQSIVSSSQRSHILKEAYRGLGINLVGNALAWGVYFGLYREAKDLIYGWAIQ
                     DCDQVVKFTDRDGKMSSLMYLGAGASSGLLTAILTNPIWVLKTRIMSTSSYASGSYRS
                     TWDGVKRLLQDEGARAMWHGLLPSMFGVSQGAIYFMIYDTLKNRFSSVRYREGRTNDS
                     NNNPRLKNTETIAMTTLSKMISVSTVYPFQLLKSNLQSFQSATEKYTLYRLANRIYKL
                     EGIGGFYRGLSANLIRSIPSACITFCVYENCKRYL"
     gene            complement(<85958..>86560)
                     /locus_tag="ZYRO0A01210g"
                     /db_xref="GeneID:8201706"
     mRNA            complement(<85958..>86560)
                     /locus_tag="ZYRO0A01210g"
                     /product="60S ribosomal protein L16"
                     /transcript_id="XM_002494381.1"
                     /db_xref="GeneID:8201706"
     CDS             complement(85958..86560)
                     /locus_tag="ZYRO0A01210g"
                     /note="similar to uniprot|P26784 Saccharomyces cerevisiae
                     YIL133C RPL16A N-terminally acetylated protein component
                     of the large (60S) ribosomal subunit, binds to 5.8 S rRNA;
                     has similarity to Rpl16Bp, E. coli L13 and rat L13a
                     ribosomal proteins; transcriptionally regulated by Rap1p
                     and to YNL069C uniprot|P26785 Saccharomyces cerevisiae
                     YNL069C RPL16B N-terminally acetylated protein component
                     of the large (60S) ribosomal subunit, binds to 5.8 S rRNA;
                     has similarity to Rpl16Ap, E. coli L13 and rat L13a
                     ribosomal proteins; transcriptionally regulated by Rap1p"
                     /codon_start=1
                     /product="60S ribosomal protein L16"
                     /protein_id="XP_002494426.1"
                     /db_xref="GeneID:8201706"
                     /db_xref="GOA:C5DP82"
                     /db_xref="InterPro:IPR005755"
                     /db_xref="InterPro:IPR005822"
                     /db_xref="InterPro:IPR023564"
                     /db_xref="UniProtKB/TrEMBL:C5DP82"
                     /translation="MSTFEPVVVIDGKGHLVGRLASIVAKQLLEGQKIVVVRAEALNI
                     SGEFFRNMLKYHDYLRKATAFNKNRGPFHFKAPSRIFYKAVRGMVAHKTARGKAAMER
                     LKVFEGIPPPYDKKKRVVVPHALRVLRLKPGRKYTNLGQLATSVGWKYENIVSKLEEK
                     RKVRSAEYYAKKKAFTKKVATAKAATSETEAAKKLAALGY"
     gene            complement(<87135..>87833)
                     /locus_tag="ZYRO0A01232g"
                     /db_xref="GeneID:8201707"
     mRNA            complement(<87135..>87833)
                     /locus_tag="ZYRO0A01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494382.1"
                     /db_xref="GeneID:8201707"
     CDS             complement(87135..87833)
                     /locus_tag="ZYRO0A01232g"
                     /note="similar to uniprot|P40465 Saccharomyces cerevisiae
                     YIL132C CSM2 Protein required for accurate chromosome
                     segregation during meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494427.1"
                     /db_xref="GeneID:8201707"
                     /db_xref="UniProtKB/TrEMBL:C5DP83"
                     /translation="MGSEDNSNNTIGNDSSLDLNVSLDELDLVTAWAAPNPNSLAQYV
                     ANTIDKSNSDVIVFYIDASNTFPLYQFEKLVPKDERGAKIYESIRIQIALNLSELNLI
                     VRKILQFVSREKVARSLNKDTEQNGLKVLLILSGIEIMFKNSRMSSPQEPHHMILRDL
                     FLRLRVEANHSNDQFGLTLKTFLIVPLQECQRCQISPGTRMPNNKRQRMTPMNVGNSV
                     GDYIVKFYADTLIS"
     gene            complement(<88082..>90424)
                     /locus_tag="ZYRO0A01254g"
                     /db_xref="GeneID:8201708"
     mRNA            complement(<88082..>90424)
                     /locus_tag="ZYRO0A01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494383.1"
                     /db_xref="GeneID:8201708"
     CDS             complement(88082..90424)
                     /locus_tag="ZYRO0A01254g"
                     /note="some similarities with uniprot|P41813 Saccharomyces
                     cerevisiae YNL068C FKH2 Transcription factor of the
                     forkhead family that regulates the cell cycle and
                     pseudohyphal growth also involved in chromatin silencing
                     at HML and HMR potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494428.1"
                     /db_xref="GeneID:8201708"
                     /db_xref="GOA:C5DP84"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:C5DP84"
                     /translation="MTDRRYSPQQHQGLVNSVIGILQCPEQPTMVSKQFSNQRNVATE
                     VQAYAKISGRDWTYYVKELEVSIGRNTDSLNLPPGTPQQKEGRVSIDLGPAKVVSRRH
                     AVIKFNMQHGGWEFHVLGRNGAKVNFKRVQTGAQSTAVILSSGTILDVGGTQMMFILP
                     DQEPVVSQSSIDHLLPKLASTYGSPNAGAYSPLDQNALLYDILQNGGYQNGNPPHNSG
                     NISNSDEPGNSVTGNGPLQSQPPQLQQVRTFKMYGNPSSNNMQYGAGQPGVLMSPDLS
                     NSNGSGNTPNYHNPQLSITQIGFPNSLDFASDLSRDENRNVKPPHSYATMITQAILST
                     GEGVISLADIYKYISSNYAYYRFAKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKW
                     RISEDYQRDFLNKWNSGKIGKVRRGSSVARQLQLHLSKFNSLPAQNDYTPEPTIIKQQ
                     SMAHRRVNTAGSVDRMQLDTPLSASSDNASQPQHVPSLPQAQAQVQPPLPQPPLQQQQ
                     LQQPHQSSQHQPQQAQSINPSQQPPQLLQHQQQPQPHLQQLPQPQPQPQHHNNHNQQQ
                     QQQQQQPQAQRQLQQQSGPSLPLPHPSLQPPTVMPPPHQAVYSQNPLPSSTAASAAAR
                     SSITPLITTATGTGPTQISPTQGPNLLRSPTKAFHITAMEAYTPERGSANQNRSPSAN
                     QQQNDPENYLSKDQNATGKVDKGRSSPGVWNLLQFSSVNNTPAVPQRERNNTANSNPT
                     TNGGETKDVVSSPLKSQTTQSNGKDLMLDTEGTKISLVND"
     gene            complement(<91512..>99242)
                     /locus_tag="ZYRO0A01276g"
                     /db_xref="GeneID:8201709"
     mRNA            complement(<91512..>99242)
                     /locus_tag="ZYRO0A01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494384.1"
                     /db_xref="GeneID:8201709"
     CDS             complement(91512..99242)
                     /locus_tag="ZYRO0A01276g"
                     /note="similar to uniprot|P40468 Saccharomyces cerevisiae
                     YIL129C TAO3 Identified in a hunt for mutants that
                     activate OCH1 transcription Transcriptional Activator of
                     OCH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494429.1"
                     /db_xref="GeneID:8201709"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025481"
                     /db_xref="InterPro:IPR025614"
                     /db_xref="InterPro:IPR029473"
                     /db_xref="UniProtKB/TrEMBL:C5DP85"
                     /translation="MNTGFTFPPQQVNKDTGAQESFRFPKPSTSIPATTTAPNDITQV
                     NSSTANSETNLTNGFEDSAYNSNNGGGHNAVVAPIAETDELAPVIDIPPPLEISGKEI
                     RSFTPVPELAEKSGEDLYANNETNVDETGNFLINSVTPPDGLGSQLSQKPQELQQPQQ
                     PQQPQQPQQPQQPQQLQQQIPTETQRKSQVEDYVSNLRQQMATDWKSPSEYALHILFT
                     KFVRHAENKLNQCLHHPLTSEPPIVDILGEGVDPNFDKIVESLGHIAKNKPKPVIDAM
                     MFWRKTKSEIACVAAEEVENLLKEYENDQVKQYPIKHQPSSSISQPKTHSKSMSNGSR
                     FSHKRNSSSKSSTGSKGAIEDNKMRNLELSIITARDAAFQADRKSLISIYILCRVLIE
                     IVKQAPEGADEDLSDKLEEIVFTQLKTTDPMSISSSIIKSSNWNSFAELLGWMSERKF
                     ISVSDRFIADLEKIPTFVTRDLEPGVHLLILGMRYLRLKNYPLEKFEETADFMKSIAK
                     FFYQAENLSVSLAYAEVISQLLLPLAGSMTAEVNHPTWVEAMTALLSTTAKLQTESSS
                     SKYWASIFRLNVSILCVAPAELFSEYWITLIEKNARKIKNKSLPARVLFVVGLSRLVW
                     VYLYRCPETLNNTTRTLSRLFALFLSTKKKENWITTDLELINPLSDVLVTVGYAYPNF
                     LMENAILPLVRTSFNGFSLDGINYERMILVINTYRGLLMTNNKPEFPENDSRYYELSL
                     NDISIKQNEALTSNHEEVCTYFYKLFLLLDSNIGSEVWSPENQHNRPPTTPFEKFSLF
                     SNDNNNNNNRNLNIALFATLIETIPSCLNISGQIPFKSTIEIISRNAVHADLLIASSC
                     QNALKALASKKNPYTLITWFAKYSFDFDEKTQSSYNMSYLSSTEYRRLLILYVGLLEC
                     WLEEFHSSNLEEKKRETGLDGIELMPVDNNLEELNEVETLEWKNTVTVIEEVEGNGLF
                     FLCSQDAGIRHLGIQILRIISKFDEAMVEKTVRLSKCHSRSSSYFAAHRGTRLVDLLN
                     DTDFYSLLDSKRTLLSMVEKSRISKLTAKFKKGVLIKIAESEYGVDAALWQRIFPKLL
                     SVVCVACPITMALCRSIVCIRLVQVHGIILQIANNVEDRPREISPEVIINQWKLFLVV
                     ACTSLTSTNDQKLHIPTSGFRHGRKKSQQIFTVQHQKIKSATSVFKMVLPLLNADSTM
                     IRDAIISGLSSMNVNIYKAYIESIEGFLCTWSLQSSNNKIRVEMFHVLTILSRFLNET
                     MILEDKVLLKKISEILRHVKKFLEEESVQYSYEFQTLRSYFAELLRNYYSVVRLEPQF
                     DQLFPFQARASCFKYLKEWCGYGELAFIAEERYNTMIRNTDNSRDRTAITAGIEFQRS
                     RLEKVALETMVVLCSDTITKTIQDVPEMPIVISFDIAGLLSWIESLFNAEDESFKNMG
                     VSALENLLEMNTSNHQLFKEVAFQCAAHHKSPHVSVLYYITLCKTVLKMDNLVLEEDE
                     LVSLGLFGVVSDREDARSYAVDLLSAVEAKLHNSFYTKVFKERLASSSKTVYKSTAKE
                     VSSIFAELLSQELCLKIFSALVGTMDSFSFETKRDILILLTPWVNKFTLKSIEELDTF
                     MILNNLFYITIDLNNTLPIEVEQLWISLGKGNGFQNIHVSLEFIMTVSINHRNPNFVQ
                     HARDVVLYLGNVPGGIGLVDNLTSNLEPKSMIPLTKSEVKGPTENDKGYFIANVWDRL
                     NYHGKSITFSKAHLSIIFLVNLLTDPSEALKGNIANLLHVSVCLLDHYVPLIQESASK
                     IVCDLIFGLAPTHEKSEDTVELLRSKQKIWSYDNFMKDKNSARSPKAMDLLIRNLLSI
                     FPDIGTLQVDWQKIALKWATTCSVRHITCRSFQVFRSLLIFLDQGMLRDMLHRLSNTV
                     ADVNPDIQGFAMQILMTLNAITAELDPADLINFPQLFWSITACLNSIHEQEFIEVLSC
                     FMKFISKIDLNSPDTVRCLIATFPSNWEGRFDGLQQIVMTGLRSANSSDITWKVLDKL
                     NLLEDSRIIANSESRLLFALISNLPRFLQAMDRKDYSNIQTAVDAMVSLSNANNQPSI
                     SRLLDSLAKNKFRSKKDFLSQVISFISRNYFPKYSAQTIVFLSGLLLNKTDWVKLQSM
                     EILKYIFPLVDLRKPEFAGVGADLISPLLRLLLTDYEARALEVLDCVPQVSGSKMDKD
                     VLRVSMGNNDVKSSNRVTATLFGIPDESGWSVPMPTMTAATTRHNVHAVFMTCTANTT
                     GEDPAQEMPYMEDIVDFHADADYALGRSETNDSLSMIEEKEASLSHMWAELDNLDSFF
                     TRNNTASAAAAAAAAAAAAAGGKSKSAPPNDIGSLHDRSNSVETAQTEQTLQLESAPQ
                     LYDKKVSAILNHSLTKVPSNISFKTSLADSFAANTGSQGLINELGHRGNQPIYSEDGS
                     GTASGNVSAVCSANGNVGGNGSGLTRSRNSGNFKSPTNSLSLSGKARSTESPQDSLFR
                     FEGFLRSSQRGSRRKWQQHQQHQQLLSQTIHEQVIPSSSSYYDAESTSPKPPLRASSV
                     SPNAGNRGKSQKSQKHYHLPHFSSNKAQSWANHPSETE"
     gene            <100488..>103553
                     /locus_tag="ZYRO0A01298g"
                     /db_xref="GeneID:8201710"
     mRNA            <100488..>103553
                     /locus_tag="ZYRO0A01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494385.1"
                     /db_xref="GeneID:8201710"
     CDS             100488..103553
                     /locus_tag="ZYRO0A01298g"
                     /note="similar to uniprot|P40469 Saccharomyces cerevisiae
                     YIL128W MET18 DNA repair and TFIIH regulator required for
                     both nucleotide excision repair (NER) and RNA polymerase
                     II (RNAP II) transcription possible role in assembly of a
                     multiprotein complex(es) required for NER and RNAP II
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494430.1"
                     /db_xref="GeneID:8201710"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024687"
                     /db_xref="UniProtKB/TrEMBL:C5DP86"
                     /translation="MASEEASIFLETSIVSFVSNVDIDESSSDKTATQIAERISDKKF
                     KLLDLIVSLRDYLTSQDLNRRKKALCCLSTVLSKLPDDKLLKNEISVVLSFYASKFDD
                     TLMMQETLSGIYSLSGMKFLSMTEVGPILDLLSNKYNPSSHLAATRYFAFKILEKIYQ
                     RFSPKLIEDGELADLFVKTFLHVGNGEKDPRNLLLSFHLNELVSSNWNNVEKFKEDLF
                     DILFCYFPITFRPPKDDPYKISNADLKISLRSAISASPAFAEDAFGNLIDKLAASSPS
                     VKNDTLLTVKACIDKFGGEACLKHWLPLWSSLKFEIMHGNDAGYPDSPVSSPTQISEA
                     DNYQLSVNVMRSIASALLQFDEKAFDKFLSHIVEEVRPNFTYEKDLKQTCCLLGSIAS
                     ANQQIFNKVVALVLPLFFKNSPELSKLKLEIMNLSFFFDAYIRVFGEANSEQNEVPPN
                     SLSEQKDEILMVLSKALTASPKVEVTIRTLSIIQFTKLIKMKGFLMREEVALIVQYIY
                     EAILTDNNKNIYYAGLESLKAIGEIHEDIVFEISLKRMLELLPIDPNEGAQLNENEPV
                     DKETILKAILDFTNSRHKLVKESVLGLSKKLCQVAPYADSSEYCFLIISSIHTLLSNN
                     IEMIRENDAGFIKENIEMPLFAAMTNYPSLQKDDHNLTLLSNIIFFLNLKSPRNTHQD
                     ELTRYKKYFVDSLQLFVKPSRLVVPFEKLLCGIDKNCEFNEVEHYFAQTMDLLRSEEI
                     TEAQFERLGYLELLTIFTNKWMDEQSLSKFINLDDLSPVNLEMLVWIVKGLVMKNSHH
                     AVLFQEKFVNLLSSSEIGNYMAKLFEVFVVDVITFQKYKGISWNNNVKLTYKQKFFND
                     VFSRLVDAFKNTSEMDVKSNYLTALSLVSKHISSNLIEPYMNEMLPLLLQSLDMPNSE
                     VKVSALNTLLDTCEKFHQLITEHVQTLSRSLLKLVSPVSYNSVSVRVLALRMLETLTH
                     VVPLNHLLPFKEDIIDGLLPVLDDKKRIVRKQCVGTRQAYFELGQVPFE"
     gene            complement(<103593..>104231)
                     /locus_tag="ZYRO0A01320g"
                     /db_xref="GeneID:8201711"
     mRNA            complement(<103593..>104231)
                     /locus_tag="ZYRO0A01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494386.1"
                     /db_xref="GeneID:8201711"
     CDS             complement(103593..104231)
                     /locus_tag="ZYRO0A01320g"
                     /note="similar to uniprot|P40470 Saccharomyces cerevisiae
                     YIL127C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494431.1"
                     /db_xref="GeneID:8201711"
                     /db_xref="GOA:C5DP87"
                     /translation="MSSNVSQLHANDAVKGLLAKMLPGAVQSAENSAQKTKQKQKGSK
                     AQLIDRNLKRRVQLQELDVEKLKKKQSRIRRRDLQKQRRGQEEIKQLAELEVLERHRK
                     EGKLTKKETKHLNRLVNVNAERAKSWELDEDEKEDLLELQKYILEKTTSANRVAKSQK
                     RRQKKKTFNDNKKGVSASMARRYPGLTPGLAPVDMSDEEESSEEEEEVEMKE"
     gene            <104605..>108636
                     /locus_tag="ZYRO0A01342g"
                     /db_xref="GeneID:8201498"
     mRNA            <104605..>108636
                     /locus_tag="ZYRO0A01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494387.1"
                     /db_xref="GeneID:8201498"
     CDS             104605..108636
                     /locus_tag="ZYRO0A01342g"
                     /note="similar to uniprot|P32597 Saccharomyces cerevisiae
                     YIL126W STH1 helicase related protein snf2 homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494432.1"
                     /db_xref="GeneID:8201498"
                     /db_xref="GOA:C5DP88"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029295"
                     /db_xref="UniProtKB/TrEMBL:C5DP88"
                     /translation="MSATTKDPVVNNKVLPVDEPVKKEEDSHSQTQQQQQEEEVIIIP
                     KPVSAEQLEQLIYRYRAIQNRPKENKVEIQAIERTLGEISKDQDLYLYQLERLRNEKK
                     QDVEYDQNLLSRQLLALQFLDKDMDIPDDLLLDERQLDVNGLEDSSVQSLDPVKVSLD
                     FDENAKRLGLQDKFTHVFPTKLGVQSTEGMISSRIAKRISELERLPANLGAYSLEDAL
                     EFVTKDDIPSNIDSLKIKALVELKGLKLLTKQKSLRQKLISNVASQAHHNIPYLRDSP
                     VTMAAQRSVQVRNKVIVPQTVRLAEELERQQLLEKRKKERNMHLRKVHRIVEYVNSKQ
                     LNTWNYRDRCMQFGKHAQVMHNQIEKEEQKKVERNAKQRLAALKSNDEEAYLKLLDQT
                     KDTRITQLLRQTNSFLDSLAQAVRVQQNEVKIMRGEEVPPITDEEREKVDYYEVAHRV
                     KEKVDKQPSILVGGALKEYQIRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYL
                     FEMKKEPGPFLVIVPLSTITNWTLEFEKWAPTLRTVVYKGTPNQRRSLQNQVRSGNFD
                     VLLTTYEYIIKDRSVLAKPDWIHMIIDEGHRMKNSQSKLSYTITHYYHTKNRLILTGT
                     PLQNNLPELWALLNFVLPKIFNSAKTFEDWFNTPFANTGAQEKLELTEEETLLIIRRL
                     HKVLRPFLLRRLKKEVEKDLPDKVETVIKCGSSGLQQQLYQQMLKHNALFVGAGTEGA
                     TKGGIKGLNNKIMQLRKICNHPFVFDEVESVINPSRQNTPLLYRVAGKFELLDRVLPK
                     FKASGHRVLMFFQMTQVMDIMEDFLRLRDHKYMRLDGATKTEDRQEMLREFNAENSDY
                     FCFLLSTRAGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITT
                     DSVEEVILERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESESSRDQEDKAEL
                     DDEELNEILARGDHEKVLFDKLDQQRIQEEIDQAKAQGLEHPPPRLIEVDELPEIFTE
                     DITNHLETEPVTLGRVRERKQVFYDDGLTEEQFLQAVEDENNTLEEAIQKRREARSKR
                     QKQGKQQETVQEDDEGEPEEQQEQEEEAEIDTLGNTPTEAVDEPFQPEEDAGANEKKP
                     NGKRPSRSSSRKKRTSSAVAAADTVAEDDEMVNSVEEDGGEPQEPEKKKPKLKIKLNL
                     KKTPSTPESIESNEKKPEPKTNKKTKKQEINEFASQVQNLLNSMREQVEESDGHALTS
                     IFEKLPSKREYPDYYAVIEKPVALDTIMRNAKKGTYKSMEDVRRELQQMYDNARFYNE
                     EGSWVYNDAEALEQFTNKWFETA"
     gene            <108841..>109413
                     /locus_tag="ZYRO0A01364g"
                     /db_xref="GeneID:8201499"
     mRNA            <108841..>109413
                     /locus_tag="ZYRO0A01364g"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_002494388.1"
                     /db_xref="GeneID:8201499"
     CDS             108841..109413
                     /locus_tag="ZYRO0A01364g"
                     /note="highly similar to uniprot|P05738 Saccharomyces
                     cerevisiae uniprot|P05738 Saccharomyces cerevisiae YGL147C
                     RPL9A Protein component of the large (60S) ribosomal
                     subunit, nearly identical to Rpl9Bp and has similarity to
                     E. coli L6 and rat L9 ribosomal proteins and to YNL067W
                     uniprot|P51401 Saccharomyces cerevisiae YNL067W RPL9B
                     Protein component of the large (60S) ribosomal subunit,
                     nearly identical to Rpl9Ap and has similarity to E. coli
                     L6 and rat L9 ribosomal proteins"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_002494433.1"
                     /db_xref="GeneID:8201499"
                     /db_xref="GOA:C5DP89"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:C5DP89"
                     /translation="MKFIQTEQFVQIPEGVSVYIKARSIKVVGPRGTLFKDLKHIDVS
                     FSRVSAKLVKITVHNGDRKHVAALRTVKSLVDNLITGVTKGYRYKMRYVYAHFPINVN
                     VVEKDGKKLVEIRNYLGDKQVRHVPVREGVKIEFSKNQKDELILEGNSIENVSQNAAD
                     IQQICRARNKDIRKFLDGIYVSEKGVIEDY"
     gene            <110661..>113726
                     /locus_tag="ZYRO0A01386g"
                     /db_xref="GeneID:8201500"
     mRNA            <110661..>113726
                     /locus_tag="ZYRO0A01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494389.1"
                     /db_xref="GeneID:8201500"
     CDS             110661..113726
                     /locus_tag="ZYRO0A01386g"
                     /note="highly similar to uniprot|P20967 Saccharomyces
                     cerevisiae YIL125W KGD1 Component of the mitochondrial
                     alpha-ketoglutarate dehydrogenase complex which catalyzes
                     a key step in the tricarboxylic acid (TCA) cycle the
                     oxidative decarboxylation of alpha-ketoglutarate to form
                     succinyl-CoA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494434.1"
                     /db_xref="GeneID:8201500"
                     /db_xref="GOA:C5DP90"
                     /db_xref="InterPro:IPR001017"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR011603"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DP90"
                     /translation="MLRAISSASARQTVSRLAQRSKAASAVNKSLVGLSQHNRFYASG
                     ADQFMATSNANYIEEMYEAWQKDPSSVHVSWNAYFKNMGNLNIPSSQAFQAPPTLTGG
                     AQGAENIPIDSNFASAANIDQNVLLHLKVQLLCRAYQVRGHLKAHIDPLQISYGDDKS
                     KGVPRELTLEFYGFSERDLDREITLGPGILPRFARDGKTKMTLREIISSMEKLYCTSY
                     GVEYTHIPSKSKCEWLRERIEIPSPYQYSIDEKRQILDRLTWSTSFESFLSTKFPNEK
                     RFGLEGLEAVVPGIKTLVDRCVDMGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEFK
                     GTTTQDGVDGPGDVKYHLGMNYKRPTTSGKYVNLSLVANPSHLESQDPVVLGRTRSLL
                     ALRNNLDEQTKSIGVLLHGDAAFAGQGVVYETMGFQNLPEYSTGGTIHVITNNQIGFT
                     TDPRHARSTPYPSDLAKAFDAPIFHVNANDVEAVTFIFNLAAEWRQTFHTDAVIDIVG
                     WRKHGHNETDQPSFTQPMMYQKIAKQKSVFDVYAEKLMVEGSFTKADIEKHRQWVWSL
                     FEESFEKAKGYVPNPREWLTAPWENLKSPKEMATEILPHEPTKVDLDTLKKVGLAVSS
                     WPEGFEVHRNLRRILTNRAKSIESGEGIDWSTAEAMAFGTLALEGYNVRVSGEDVERG
                     TFSQRHSVLHDQKSERVFVPLKNLSEKQGDFTISNSSLSEYGVMGFEYGYSLTDPDNL
                     VMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGIVLSLPHGYDGQGPEHSSGRLERY
                     LQLANEDSRFFPSEEGLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQFRKPLALFFS
                     KQLLRHPLARSRMEEFSDGEFQWIIEDVELGKSIAPKEEIKRIVLLTGQVYTALFKKR
                     ESLGDKNTAFIKIEQPHPFPFAQLRDAIDSYPNLEDIVWCQEEPLNMGSWSYVSQRFP
                     TVLKETQNYKNSQVRYCGRDPSGTVAAGNKPAHTAEEEDFLNDVFGLKN"
     gene            <114071..>114958
                     /locus_tag="ZYRO0A01408g"
                     /db_xref="GeneID:8201501"
     mRNA            <114071..>114958
                     /locus_tag="ZYRO0A01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494390.1"
                     /db_xref="GeneID:8201501"
     CDS             114071..114958
                     /locus_tag="ZYRO0A01408g"
                     /note="similar to uniprot|P40471 Saccharomyces cerevisiae
                     YIL124W AYR1 NADPH-dependent 1-acyl dihydroxyacetone
                     phosphate reductase found in lipid particles and ER
                     involved in phosphatidic acid biosynthesis and required
                     for spore germination capable of metabolizing mammalian
                     steroid hormones"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494435.1"
                     /db_xref="GeneID:8201501"
                     /db_xref="GOA:C5DP91"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5DP91"
                     /translation="MSSSVIKTALVTGASSGIGYAVVKELAENGFTVYACARRLDLLE
                     QLSRGYEANKVIPYALDISNFEEIVQLKEYLSKHLPHQRLDVLYNNAGQSCTMPAVDV
                     TNERLNQLFQVNVIGHMNITSQLCQFLINAKGTIVFTGSLSGVSVFPFGAAYAATKAA
                     IHQYARVLHAEMKMFDVRVINAITGGVSTDIADKSPLPKSSPFYFPEGLKALEERKLM
                     SAKNFPMSAETYAQKLVKDILSPRDPVDVYRGTLASVVSWLMMFAPYWLVEWVTFKKF
                     KLDSVEKALGQKRETEKQE"
     gene            <116475..>118121
                     /locus_tag="ZYRO0A01430g"
                     /db_xref="GeneID:8201502"
     mRNA            <116475..>118121
                     /locus_tag="ZYRO0A01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494391.1"
                     /db_xref="GeneID:8201502"
     CDS             116475..118121
                     /locus_tag="ZYRO0A01430g"
                     /note="some similarities with gnl|GLV|CAGL0J09922g Candida
                     glabrata CAGL0J09922g and some similarities with
                     uniprot|P40472 Saccharomyces cerevisiae YIL123W SIM1
                     (putative) invovled in control of DNA replication or
                     uniprot|P53616 Saccharomyces cerevisiae YNL066W SUN4
                     Protein involved in the aging process"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494436.1"
                     /db_xref="GeneID:8201502"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:C5DP92"
                     /translation="MKLSANILTAALLGSQVFVNAMPHMPIKRDEEDCSETVPAHADS
                     HQHKRAVAVNYVYQTVTVDGNGNSYTPTASASGSAASSSAPSSSDAVAMVTQYVTPGV
                     SASSPSGGYGGGLSGFATSVIHNAQPSQSSSPSSSGSGSSSSSSSSPSGSGDNWTETN
                     SEASSSGDASSNSNASASAGNGDSTASSSADSTAESGTNSSAQASAEAQAHSNNGNSH
                     SDSDSSSSSSSSSNNNGGSSSSSSSSSSSSGSSSSSSGSSGSGGSSSSSSSSSSSGGI
                     FGDLSAYEGPNEKFQDGTIPCSQFPSGQGVIPIDWINEGGWSGVENSDTSTGGSCKEG
                     SYCSYACQAGMSKTQWPSTQPSDGRSIGGLYCKNGYLHRTNTDADYLCEWGQDVASIV
                     SKLDQDVAICRTDYPGTENMVIPTYVKSGNSQPLTVVNQDTYYQWEGKPTSGQFYVNN
                     AGVSLEDGCVWSTPGSGKGNWAPLNFGAGYTNGITYLSLIPNPNNNVPLNYNVKIVAA
                     DDSSIVTGDCKYENGEYNGSGSDGCTVAVTSGKAQFVLYN"
     gene            <119540..>120700
                     /locus_tag="ZYRO0A01452g"
                     /db_xref="GeneID:8201503"
     mRNA            <119540..>120700
                     /locus_tag="ZYRO0A01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494392.1"
                     /db_xref="GeneID:8201503"
     CDS             119540..120700
                     /locus_tag="ZYRO0A01452g"
                     /note="weakly similar to uniprot|P40473 Saccharomyces
                     cerevisiae YIL122W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494437.1"
                     /db_xref="GeneID:8201503"
                     /db_xref="UniProtKB/TrEMBL:C5DP93"
                     /translation="MQEGSKREEDIIKKINSSTFQQSRGDASSNPVKTRIRRQILKDL
                     GFLQEGEQEVEDELIANDKCLDLYLQIRLERERKQIESLRESNLDRLNTIIDKCLQSD
                     KFTKDSLWKILDLIYKPLPSGSSASSSQQQQEQQQEQRPAQPTVALSPDARKRKLASP
                     VVSPKGHKRFASDVPSLGTVAATQPPYYGAPIQSGPTPWVGQQYNQQAPPQHQQQYEF
                     KNTIPAGLGGPARHPHQETIQTTPISENQPPTAAMAQQQQYFAGHYSPAQFVANGARG
                     GYFLPAATATAAAQSGRPHPVVMMQSDSPTQRAPSGYLQPPQHIPSSYGSTIKQEYPM
                     TTRRLQGHRRSQSANVPTFGIGSTKSPSRELHATPQKPVNFLIHTPKHPPPG"
     gene            <121026..>122642
                     /locus_tag="ZYRO0A01474g"
                     /db_xref="GeneID:8201504"
     mRNA            <121026..>122642
                     /locus_tag="ZYRO0A01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494393.1"
                     /db_xref="GeneID:8201504"
     CDS             121026..122642
                     /locus_tag="ZYRO0A01474g"
                     /note="similar to uniprot|P40474 Saccharomyces cerevisiae
                     YIL121W QDR2 Multidrug transporter required for resistance
                     to quinidine barban cisplatin and bleomycin member of the
                     major facilitator superfamily of transporters conferring
                     multiple drug resistance (MFS-MDR)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494438.1"
                     /db_xref="GeneID:8201504"
                     /db_xref="GOA:C5DP94"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DP94"
                     /translation="MCTDTDTKVVFDSSQKDSNSLKTSDQKSDGSLAGKDNESEIPYS
                     RFKRRDKLLLVAQCASTGLFSSIAASIYFPVLTTVERKFHITEEQANITVVVYYVFQG
                     LSPSFMGNMADTLGRRPVILVSVLIYFVACLGIASCNTYSQLIGLRCLQAAGISPVIA
                     INSGMMTDITTRAERGGYVGYTSGCQVLGSAFGALIGAGLSSRWGWRSVFWFLSIGSG
                     ICLVISTLLLPETKRTIVGNASITPRSILNRSPILAIPAVRRELHLDNPDLQTLEPSP
                     KMNILASYKILLTPEIDLLLFVAGLQFATWTTHQTALSLNLSKKYNLSVAKIGLCFLP
                     SGISTLLSVVFSGRFLNWNYKRRLALHNNWLQEQKKQLFEENDNDIDRVNHLLATDPR
                     YHFNIFRARLQLAFFTLVLSSGGFAAFGWCIQVKAPLAAVLVTSGFASLFSNCILTMS
                     TTLVVDLFPSKASTAAGLVNLFRCMLSVVFIASLHKMSSKMNYGGVFTFLAALTASSS
                     VLLLIPVSNGKTLSYRRREEERRLLEDVEN"
     gene            complement(<123559..>124797)
                     /locus_tag="ZYRO0A01496g"
                     /db_xref="GeneID:8201505"
     mRNA            complement(<123559..>124797)
                     /locus_tag="ZYRO0A01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494394.1"
                     /db_xref="GeneID:8201505"
     CDS             complement(123559..124797)
                     /locus_tag="ZYRO0A01496g"
                     /note="highly similar to gnl|GLV|CAGL0J09966g Candida
                     glabrata CAGL0J09966g and similar to YNL064C
                     uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1 yeast
                     dnaJ homolog (nuclear envelope protein) heat shock
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494439.1"
                     /db_xref="GeneID:8201505"
                     /db_xref="GOA:C5DP95"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DP95"
                     /translation="MVKETKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAA
                     EKFKEASSAYEVLMDAEKREAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFF
                     GGGASRPRGPQRGRDIKHEITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKK
                     CTSCNGQGVKFITRQMGPMIQRFQTECDACDGTGDIINPKDRCKACSGKKVANERKIL
                     EVHVDPGMKDGQKIVFKGEADQAPDIIPGDVIFVVSERPHKHFRRDSDDLVYEADIDL
                     LTAIAGGEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGGFGNLLVKFN
                     IVFPKDHFTSLENMKKLEEILPPRKKTSIPSKAHVDDCVLSEFDAAKYSSTRGGRSAN
                     SYDEDDEDQPGAEGVQCASQ"
     gene            <125522..>126433
                     /locus_tag="ZYRO0A01518g"
                     /db_xref="GeneID:8201506"
     mRNA            <125522..>126433
                     /locus_tag="ZYRO0A01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494395.1"
                     /db_xref="GeneID:8201506"
     CDS             125522..126433
                     /locus_tag="ZYRO0A01518g"
                     /note="similar to uniprot|P53944 Saccharomyces cerevisiae
                     YNL063W MTQ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494440.1"
                     /db_xref="GeneID:8201506"
                     /db_xref="GOA:C5DP96"
                     /db_xref="InterPro:IPR004556"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DP96"
                     /translation="MPRVAPRLLKKALKAHSLLPLLLPACRSIEQSAQEFRWIRNELP
                     NMKQVRQACLQRFKLVPLQYILGNQPFGELDIVCRPGVLIPRWETEEWVCELSERLLG
                     SMGPLNSPFPIWDLCCGTGCVGLLLQRRLGPGCSLTAVDVTDAALGLCVENAHRNDLE
                     RPRLIATDVLTKKIVPDSRISLLTCNPPYIPKNQFAADTSPSVKRHEPQLALIGDLEF
                     YSSLVNTWIHHTDSFVYEVGDRRQIEYVMHGIRDDPRLQLEWCVGYRLDSSGCPRVVY
                     GYKAESSLAGALSGYGDLLYIPPGAGK"
     gene            complement(<126496..>127860)
                     /locus_tag="ZYRO0A01540g"
                     /db_xref="GeneID:8201507"
     mRNA            complement(<126496..>127860)
                     /locus_tag="ZYRO0A01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494396.1"
                     /db_xref="GeneID:8201507"
     CDS             complement(126496..127860)
                     /locus_tag="ZYRO0A01540g"
                     /note="similar to uniprot|P41814 Saccharomyces cerevisiae
                     YNL062C GCD10 Subunit of tRNA (1-methyladenosine)
                     methyltransferase with Gcd14p required for the
                     modification of the adenine at position 58 in tRNAs
                     especially tRNAi-Met first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494441.1"
                     /db_xref="GeneID:8201507"
                     /db_xref="GOA:C5DP97"
                     /db_xref="InterPro:IPR007316"
                     /db_xref="InterPro:IPR017423"
                     /db_xref="UniProtKB/TrEMBL:C5DP97"
                     /translation="MDYLHHITADQHVILKLPSGNWKIVELKPHTSVSLGKFGAFQVD
                     DIIGYPLGTQFEIYYENQSQPNDDDPKNKNRTPVGKVRIMDEDVGGSTEGSELSNVNS
                     SANNMNLINIGNEIQAMTSEQIEELKRQSISGEEIVAKMIESHSAFHKKTLQSQEKYL
                     NRKKRKFAKYFTVEYLSASFLLQWLLEKGDTQKVLDMSEETVAMLLNVANIRSEGQYL
                     CMDETGGLLVYFMLERMFGGDNNSSHTGKIVVLHENEHANLDLLKYSNYSEKFINDHV
                     KTVSLLDFFEPPNESEIDSYFKPIPKEEARQLKAGKKNAYQRRLKWYYNQHEIVQLST
                     KSQYDALIIASTLQLSTLVPLLAEKVHGSRPVVCYSQFKEILLELTHTLYTDLRFLAP
                     SISETRVRPYQSVRGKLHPLMTMRGGGGYLMWAHRVIPAPEPPAHETEDEGNGPEEKK
                     QKTQ"
     gene            <128145..>129998
                     /locus_tag="ZYRO0A01562g"
                     /db_xref="GeneID:8201733"
     mRNA            <128145..>129998
                     /locus_tag="ZYRO0A01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494397.1"
                     /db_xref="GeneID:8201733"
     CDS             128145..129998
                     /locus_tag="ZYRO0A01562g"
                     /note="similar to uniprot|P40991 Saccharomyces cerevisiae
                     YNL061W NOP2 Probable RNA m(5)C methyltransferase
                     essential for processing and maturation of 27S pre-rRNA
                     and large ribosomal subunit biogenesis localized to the
                     nucleolus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494442.1"
                     /db_xref="GeneID:8201733"
                     /db_xref="GOA:C5DP98"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR011023"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023273"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DP98"
                     /translation="MGNRRLSKRQPDPPTFDEFKSRKDKKSSKKKEKVKRQLPTEDGV
                     EKKKSKKQKSSKPVAEKVEKEETEEDKLPEVDLEELSKAKKSLFDDEEEEVNGDSEDE
                     QLQDEFDLEQEYDDDDDEDEAHAQQMFSDDDDDEVDLEELNVDNMESLSKKLDEEQAL
                     DAEEAEMELVEGEREQPKANVLPTEEEEEMEAQQQPDLTTVRTRMIEIVKVLDDFKNL
                     AAEGRSRTEYVDRLIKDICQYFGYSPFLAEKLFQLFSPAEALEFFEANEISRPITIRT
                     NTLRTRRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNYILQAAS
                     SFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCVFANDANKSRTKSLVANIH
                     RLGCTNTIVCNYDAREFPRVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFMQIP
                     HLQKQLLLSAIDSVDSHSKTGGIIVYSTCSVAVEEDEQVVDYALRKRPNIKLIETGLA
                     IGKEGFASYRGKKFHPSLKLTRRYYPHTYNVDGFFVAKFQKLGPSPHDDNQNSAKEKE
                     AAAVKEAVEEGIIHSDFASFDNEEDDKYIQKSQKQNLLKRGVNPKSVKSNK"
     gene            complement(<130119..>132365)
                     /locus_tag="ZYRO0A01584g"
                     /db_xref="GeneID:8201734"
     mRNA            complement(<130119..>132365)
                     /locus_tag="ZYRO0A01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494398.1"
                     /db_xref="GeneID:8201734"
     CDS             complement(130119..132365)
                     /locus_tag="ZYRO0A01584g"
                     /note="highly similar to uniprot|P53946 Saccharomyces
                     cerevisiae YNL059C ARP5 Nuclear actin-related protein
                     involved in chromatin remodeling component of
                     chromatin-remodeling enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494443.1"
                     /db_xref="GeneID:8201734"
                     /db_xref="GOA:C5DP99"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027664"
                     /db_xref="UniProtKB/TrEMBL:C5DP99"
                     /translation="MSRDNSLPPLRVRVLEDPPLRDQPEPFQDQSSYNPNVPIAIDFG
                     SSKLRAGYVNDPNPSHIFPNRLTRYRDRKLAKTMTFIGNDTSLDQAVRVQAKSAFDGP
                     LVTNWDYVEDTLEYTFNHLGVAANGGISNPLVINERLATIQSQRANWYQILFECFDVP
                     GVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGVLTESKRINWGGNQAT
                     EYLTNLMSLKYPYFPTKLSPFQYKTMYEDYCYVSQSYDEELEKYLSLDNLETNNVVLE
                     APFTEVVQPQKTEEELRLQAEKRKESGKRLQEQAKQKRVERMIQKEEELQYYTQVREQ
                     LKDQPKKKVLSILQNSGFDDERDFKKYVYNLERSLKKSQSTELEDGEEDDQDTENKFE
                     LLNVPDEQLNEEQLKEKRKQKILKASQDARNKAKEEKERAAQIEEKKRLQDEQWREND
                     LTSWIKDKHQKLNKLISQRKERIKMRDEMKDRKSQMSQSRMKNLATLAEDSGRGGSKR
                     TRQQATIDNDPNDTFGANDEDWMVYSDISQSPEALEELIEDQYKEIVALERVLLEFDP
                     NFTEEDTLDAQYDWRNSVLHLFLRGPRPHDGESIHHQHQMHMNIERIRVPEVLFQPNM
                     GGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAKLPGLRERIVKEF
                     SEFLPSGSPFSIRKSQDPSLDAWRGMAKLAQNTEDFKHGYITKQEYLEYGPEYIKEHN
                     LGNVHYFE"
     gene            <133530..>134252
                     /locus_tag="ZYRO0A01606g"
                     /db_xref="GeneID:8201735"
     mRNA            <133530..>134252
                     /locus_tag="ZYRO0A01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494399.1"
                     /db_xref="GeneID:8201735"
     CDS             133530..134252
                     /locus_tag="ZYRO0A01606g"
                     /note="highly similar to uniprot|Q00245 Saccharomyces
                     cerevisiae YIL118W RHO3 Non-essential small GTPase of the
                     Rho/Rac subfamily of Ras-like proteins involved in the
                     establishment of cell polarity GTPase activity positively
                     regulated by the GTPase activating protein (GAP) Rgd1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494444.1"
                     /db_xref="GeneID:8201735"
                     /db_xref="GOA:C5DPA0"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPA0"
                     /translation="MGMLCGSSSSQSSKKPIERKIVILGDGACGKTSLLNVFTRGYFP
                     KVYEPTVFENYIHDIFVDNRHITLSLWDTAGQEEFDRLRSLSYSDTDVIMLCFSLDSR
                     DSLMNVQHKWVGEIADHCEGVKLVLVALKCDLRRAEPENTAITPNLIHQQRTEQSRSD
                     LEQNISGINSTQNGDVISYEEGVAMAKKIGALRYLECSAKFNKGVNEAFTEATRVVMN
                     SEPRNKETREQEESSGSRCTIM"
     gene            complement(<134352..>135293)
                     /locus_tag="ZYRO0A01628g"
                     /db_xref="GeneID:8201736"
     mRNA            complement(<134352..>135293)
                     /locus_tag="ZYRO0A01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494400.1"
                     /db_xref="GeneID:8201736"
     CDS             complement(134352..135293)
                     /locus_tag="ZYRO0A01628g"
                     /note="some similarities with uniprot|P53947 Saccharomyces
                     cerevisiae YNL058C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494445.1"
                     /db_xref="GeneID:8201736"
                     /db_xref="GOA:C5DPA1"
                     /translation="MAGHTVVQRALPNIASGSFAQSASKTSSHTSKTSYSAVVTPPSS
                     DGNPNVWRANHLPDGLIYIIVGGTAAAIFAFIILWYAVARYMSRRVAKKTMYETNIQW
                     RDTPSSGLYDHGDEKELYQSLVDHSDKNDARPKKSLIGLLGGGNGLGSSTSYDTVADA
                     DMDDDLIGGGYQERFNPVQDFVPSHFPRSSLFISPTLEVAQQNQQSKSVGRTNHFQNL
                     SVTSLPSASESSSNLLDRPERTASPERKPKAYGRYHQRNRSSVGVSDHSHSRSHSRSK
                     SASSFEMPNVNNNNKKHGTTPSRFLNNLLEGNDDGTT"
     gene            <135642..>136205
                     /locus_tag="ZYRO0A01650g"
                     /db_xref="GeneID:8201737"
     mRNA            <135642..>136205
                     /locus_tag="ZYRO0A01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494401.1"
                     /db_xref="GeneID:8201737"
     CDS             135642..136205
                     /locus_tag="ZYRO0A01650g"
                     /note="highly similar to uniprot|P53949 Saccharomyces
                     cerevisiae YNL056W Cytoplasmic protein required for
                     replication of Brome mosaic virus in S. cerevisiae which
                     is a model system for studying replication of positive-
                     strand RNA viruses in their natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494446.1"
                     /db_xref="GeneID:8201737"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DPA2"
                     /translation="MLYYKILLYYRIYLKPMMYIPPLNFSPVVSTDVSLYRSGYPMPL
                     NYPFIRDQLHLRTIIHVGDKQDLSPEYAEFLEQGNIQFHNIYMDSCRDDGFKDRMNQI
                     LEIVLNVDNYPMLIHSGKGKHRVGTVVGIIRKLLQGWSIAGIYQEYDIFSGGLKGEAD
                     LEFITMFETSLFIRKDKIPGFVTSVTT"
     gene            <136284..>137444
                     /locus_tag="ZYRO0A01672g"
                     /db_xref="GeneID:8201738"
     mRNA            <136284..>137444
                     /locus_tag="ZYRO0A01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494402.1"
                     /db_xref="GeneID:8201738"
     CDS             136284..137444
                     /locus_tag="ZYRO0A01672g"
                     /note="highly similar to uniprot|P07172 Saccharomyces
                     cerevisiae YIL116W HIS5 Histidinol-phosphate
                     aminotransferase catalyzes the seventh step in histidine
                     biosynthesis responsive to general control of amino acid
                     biosynthesis mutations cause histidine auxotrophy and
                     sensitivity to Cu Co and Ni salts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494447.1"
                     /db_xref="GeneID:8201738"
                     /db_xref="GOA:C5DPA3"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DPA3"
                     /translation="MTFDLTKIVRPKIYNLEPYRCARDDFKDGVLLDANENPHGPTQP
                     GLEGSGLNRYPDPHQLAFKTAMANFRNGENHQYKDLPQPLTAENLCLGVGSDESIDAI
                     IRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNSFQANTDEVIKTAQN
                     DPSIKLIFITSPGNPTGAKVETSRIEKILQNWDRGMVVVDEAYIDFCGGSTAPLVTKY
                     PNLCVLQTLSKSFGLAGIRLGITFASKEMARVLNSMKAPYNISSLASEYALRAVQPDN
                     LKVMKQLSLENKSQQHRLVKELTSLPNVHKEPIGGLDANFILLRIGNGDGDNDLAKKL
                     YYKLATESGVVVRYRGSELGCTGCLRITVGTKEENDKLVKEFAKLLTQLTSN"
     gene            complement(<137498..>141925)
                     /locus_tag="ZYRO0A01694g"
                     /db_xref="GeneID:8201739"
     mRNA            complement(<137498..>141925)
                     /locus_tag="ZYRO0A01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494403.1"
                     /db_xref="GeneID:8201739"
     CDS             complement(137498..141925)
                     /locus_tag="ZYRO0A01694g"
                     /note="similar to uniprot|P40477 Saccharomyces cerevisiae
                     YIL115C NUP159 Subunit of the nuclear pore complex that is
                     found exclusively on the cytoplasmic side forms a
                     subcomplex with Nup82p and Nsp1p required for mRNA export"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494448.1"
                     /db_xref="GeneID:8201739"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DPA4"
                     /translation="MTCIGSEIETLTSEDFGFKKLGQAAILPSYDERLPFASLQNLDI
                     SNHRSLYVACSGNKIVIGKLQQLRDYIQNDAKSEISFIWEREVDDVIAVKLIRDEKLV
                     YVNKQSQVFELDLNKLGEPSEVFNFDCDLVYVKFWRNSVLLALDSNGQLRGLHLVQRQ
                     LTSLLENVAAFDLFQDKLYAFFKSFSVQVFELQSWNQLSKNSEFTTPSELLDEIKEEY
                     LPISITVLASQEYQLVFGIPVSADEEDVSYDHRIFVVRKDDDKMTFQESFDITPAFGS
                     VLRYPMYYDEKLSQLLNDTPQINILASSCSSEITIWDSAKVVQPLQDSERAVLPISKV
                     TDNDTNPVGIALDVVTEGVVAQPCPGVDSVDKLPLIYVLNNEGNLQIIGFYHATAIKE
                     GKFNVDALKQSIVAQETVEEVPFKESEAKDEPKKLEDPVNSLGGLSLGGETNKTESKP
                     LFGGLGQADSGTTISQDSSTSNQPSFGKPSFGQSSFGQSSFGKPAFGQSSSDQSPFGQ
                     SSFGTPAFGQSSSGQSPFGQSAFGKPAFGQSSSESSAPAFGKTSFGTSIESSAPAFGK
                     PSFGAATNTSAPATESSVPAFGKPSFGVATDTSAPATESSVPAFGKPSFGAAANTSSP
                     AFGQHIFGKSGFGASSGNESALDKPSEPAFGKAAFGQPSFGQPSFGQSSFGQPSFGST
                     TNGPTSSSSTFGKPSFGSNSNTGFGAFAFPKEKSPFESSSLNTSGSSFGNFAKGQSKS
                     ESPFANLVKKENDDNKSLFGAEKKDGDTSDKPKLEISEQPKSESSTSSSPPAETKPSF
                     SRLSTGVNAKSITTPEKPTFGHSTLGSISSNKKQSPFAALAKDENLPVFTSPSYGAST
                     SRPSFGQASAAPSSPSKQKFSPLGQKEGKKEEEEDKNAKEGKKAEDSTEEEKTSTGKK
                     SSPDNDDDLSDSTVEQTPARSESSISSLTAKIKESATLSSNDLKSPSITQQPKSKEGQ
                     SPFAQYTNDLNKPSSTGFTFSQVPNLNKEKEDSNNEFKLQISTKDDKRTETQTPESSE
                     NEGTLPEDLENSIEGAPKDSVSSHPDEKGGYGGDDESQPKTSEVKKEGDRIKSSSPTA
                     LNAVSREESYDTLDDFTRGELENAGIGAKAAAEGRKDQLKTVESAVSVDAENSSDDHE
                     RSVQTQASPPVLVSSGTQVEKAASGDADCQTNPIELSDFKIQAFENDDAYLGEQYRPK
                     PMPEYFSGASVTNIKYSSQDPILKSIERTYHYVSAELSVLMENISGLDSFFQDQCFEH
                     PVKINESSITNMYQWRIPDASKLQTILAEKNKPMKELYGQVESTSGKVSELTEKGIES
                     LQNKLIVIRDEYSNLEKLSHEFQKAFGGLRYHQLDKQSELRNKMFKTSETIQHIEELL
                     QILKLYTVQGKQMESNTYVVKLAREAADRENLLQEIARLREDIRNLNLKDERALEPKE
                     SSAAVANGIQSIEVVQVGLKLNTKRQLGEMLKKRTNIET"
     gene            complement(<142173..>143018)
                     /locus_tag="ZYRO0A01716g"
                     /db_xref="GeneID:8201740"
     mRNA            complement(<142173..>143018)
                     /locus_tag="ZYRO0A01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494404.1"
                     /db_xref="GeneID:8201740"
     CDS             complement(142173..143018)
                     /locus_tag="ZYRO0A01716g"
                     /note="highly similar to uniprot|P04840 Saccharomyces
                     cerevisiae YNL055C POR1 Mitochondrial porin
                     (voltage-dependent anion channel) outer membrane protein
                     required for the maintenance of mitochondrial osmotic
                     stability and mitochondrial membrane permeability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494449.1"
                     /db_xref="GeneID:8201740"
                     /db_xref="GOA:C5DPA5"
                     /db_xref="InterPro:IPR001925"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:C5DPA5"
                     /translation="MAPPFFSDIGKDINGLLGKDFYHGTNAAVDVSTVAKNGVKFTLK
                     AKQAVKDGPLSANVETRVSDKATGLTLTQGWSNANNLNTKIELADLTPGLKSELVTSL
                     VPGVSKAAKLNVSFVQPFFTARGAFDLLKGPSFVGDLTLAHEGIVGGAEIGYDITGGS
                     LSRYAVALGYSAGDYSLGLSTNNAQLTTVSFFQNVSPILQVGAKATSVPKELTNVNIE
                     FATKYLPDATSQIKTKIADSGIVALAYKQELRTGVTLGVGASFNALNLAEPVHKLGGS
                     LSFSA"
     gene            <143935..>146781
                     /locus_tag="ZYRO0A01738g"
                     /db_xref="GeneID:8201741"
     mRNA            <143935..>146781
                     /locus_tag="ZYRO0A01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494405.1"
                     /db_xref="GeneID:8201741"
     CDS             143935..146781
                     /locus_tag="ZYRO0A01738g"
                     /note="weakly similar to uniprot|P53950 Saccharomyces
                     cerevisiae YNL054W VAC7 Integral vacuolar membrane protein
                     may function to regulate Fab1p kinase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494450.1"
                     /db_xref="GeneID:8201741"
                     /db_xref="InterPro:IPR024260"
                     /db_xref="UniProtKB/TrEMBL:C5DPA6"
                     /translation="MSDEDHKLTVETETVEAPGESLLPSTIQPQSITTNENSNENGNM
                     DYDNITTATTMTGMNNSNNNVNDNNNVSGISNNNVNSTNSNMNSNANNGSSNANTNMS
                     TNGSTAFRDISPAHFAAAHAAAHAATSTHQPSSATEANFNLIDHNPLSPHAIQSLKNK
                     KSSLLINNDGKKESLPNNGNLSTSELSRRSRNDDLEPSQMAAGGQQDQRVPQSSHSAK
                     AATAPPAPPKQNANLAGPPMIQRPSLPLMNSREILLENEKQKSGGCKPKESKEPERAP
                     TNPTNSHTDNVAASAHNEEDTDSLHKPTKADFFAARLASAVGENDISDSEETFIYESA
                     ANSTKNAVPSGVGNNSINDNSYNKYPDSAQHGVASKMSVPVLNNNAKLLNRLKSTRHT
                     SLSALPANPSMPFSAVAPTPSPIANTGTGITAHSSTDDLNSVKSFARQNQRGPVDLQS
                     VKSFSSEPRSPDKRMSLVSLAKGNSAVAPVPSSRTNTGPQQPQQPQLPQLPQLPQQPQ
                     QYPQQLPQPQQQLSRKPSISNSTLRHVSASHMGVPRAKPEPTGFKRKLRTTASKIFDA
                     NGAPLRRYSGVPDDVNLEDYIEQHPSQDTKRLGHDLGGIDDQQSTIQEEAEAAAAAAA
                     AAEYGGDVDGDDIQSMFFYNHHGNLEARPQISDYEEDGEDLENNNNPNNNNGSHNHQS
                     NGNTTYLNAPYGGNLPYANEYTPLKPKTHHARTTLGYSPHNFYTRKTSWAKFKSFIYF
                     SCVTCMLLTVGFVLGFLLASNKELQDFNIVLIDNVLSSADELIFDVTVSALNPGFLSI
                     DVQNVDLDIFAKSSHVQEDGIKYRAGSSTIGDDDDDDDPPNQKETVLLGTAYMLETPL
                     RFHGNVLLKRDYDVGISSIKLLDPGAKQQQESDTLALLRLKPKQLEDDVSKWKNIIKH
                     DYQLIVRGNMRYKVPYGGAKSVPVQSHTEVKASP"
     gene            <147401..>148399
                     /locus_tag="ZYRO0A01760g"
                     /db_xref="GeneID:8201742"
     mRNA            <147401..>148399
                     /locus_tag="ZYRO0A01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494406.1"
                     /db_xref="GeneID:8201742"
     CDS             147401..148399
                     /locus_tag="ZYRO0A01760g"
                     /note="weakly similar to uniprot|P38590 Saccharomyces
                     cerevisiae YNL053W MSG5 Dual-specificity protein
                     phosphatase required for maintenance of a low level of
                     signaling through the cell integrity pathway regulates and
                     is regulated by Slt2p also required for adaptive response
                     to pheromone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494451.1"
                     /db_xref="GeneID:8201742"
                     /db_xref="GOA:C5DPA7"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DPA7"
                     /translation="MSAQDPARSPRSFQAKNTKNLSLNISKPSTATAARTTTGLQDTP
                     IPRPVGLGDTKFRRPTPLMSRRSDAAIYTQRRNANSNGNNNSNNGNGPRLHRVHSLSL
                     SVKTTELEPPASSKQMWVLPRKKSFDEDVEKSGVGPSSAENAGNAYPDGPLCVVSPNV
                     YLYSEPTLEQALKFDLVINVAAEIADLGPLIHRGSGVEYVRVPWTHNTRIIDELPILT
                     ETIHLAQQRGLRVLIHCQCGVSRSASLIVAYIMRYEKLPLNDAYEKLKSVALDISPNM
                     GLIFQLMEWGETLDSESRLISSFSQETTPRTPGEYFKTNLSSASTCSSTTVVSERE"
     gene            complement(<148588..>149925)
                     /locus_tag="ZYRO0A01782g"
                     /db_xref="GeneID:8201610"
     mRNA            complement(<148588..>149925)
                     /locus_tag="ZYRO0A01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494407.1"
                     /db_xref="GeneID:8201610"
     CDS             complement(148588..149925)
                     /locus_tag="ZYRO0A01782g"
                     /note="similar to uniprot|P53960 Saccharomyces cerevisiae
                     YNL040W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494452.1"
                     /db_xref="GeneID:8201610"
                     /db_xref="GOA:C5DPA8"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="UniProtKB/TrEMBL:C5DPA8"
                     /translation="MVTESLTRPTTVGALACQRNSFLFNGFKTTVISCEPVKGKPKDP
                     VKYLVELHDTILFPEGGGQPSDSGYLKCSNDRIPVSYVSRVGLHAKHHVGQYIDPGTT
                     VEVEVDQSKRVDYMQQHTGQHLLSAILESEPYKLDTLSWSMGGVISAKKPTLEINDYF
                     NYIELPRKLTSQEIEQVSHKVNELISINPQQISVIERTPEAHGDVQTSKIPDDYDLEK
                     GVLRTIHIGEIDSNPCCGTHLQRTNQIGSILISPNQTNIRGSNSRLYFMCGNRVVNYG
                     MAVNKLVGTAKSSLSCLESEIPEKIDRQRDLIQKSSKREQFWIKELASYESDRLLAKV
                     KEAGKAFLLKDEYGTLEFLLQVFKEFTNKLGKTPNEYQLVLCGREKSTESGSVLIVSE
                     SGEKISTIAASLSGVVPTLKGGGGKKGGKWQGKIVKFTENDWKSVKNYLETEF"
     gene            complement(<150103..>151233)
                     /locus_tag="ZYRO0A01804g"
                     /db_xref="GeneID:8201611"
     mRNA            complement(<150103..>151233)
                     /locus_tag="ZYRO0A01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494408.1"
                     /db_xref="GeneID:8201611"
     CDS             complement(150103..151233)
                     /locus_tag="ZYRO0A01804g"
                     /note="similar to uniprot|P53962 Saccharomyces cerevisiae
                     YNL035C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494453.1"
                     /db_xref="GeneID:8201611"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DPA9"
                     /translation="MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQT
                     GKSIAHIKTGEVAVNKLKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNA
                     PFLSLDSRHNMLACGTELSGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDP
                     NVLMSGSTDGYTNIYDLRQAEEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIH
                     ELNDKSDEAKEPRPVEFNDVRESWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQ
                     VDTNNAIDINAAHGDEVVRDVFVPARNSKLLYSCGEDGSVKTWENKSGPLNVTDEFWD
                     YSQLLNVLDEQPVVVEEPKETKHSKKKHSKSKKSNKQRFKPY"
     gene            complement(151477..151550)
                     /locus_tag="ZYRO0A01826r"
                     /db_xref="GeneID:8201612"
     tRNA            complement(151477..151550)
                     /locus_tag="ZYRO0A01826r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.64"
                     /db_xref="GeneID:8201612"
     gene            <152134..>154248
                     /locus_tag="ZYRO0A01848g"
                     /db_xref="GeneID:8201613"
     mRNA            <152134..>154248
                     /locus_tag="ZYRO0A01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494409.1"
                     /db_xref="GeneID:8201613"
     CDS             152134..154248
                     /locus_tag="ZYRO0A01848g"
                     /note="similar to uniprot|P40494 Saccharomyces cerevisiae
                     YIL095W PRK1 Protein serine/threonine kinase regulates the
                     organization and function of the actin cytoskeleton
                     through the phosphorylation of the Pan1p-Sla1p-End3p
                     protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494454.1"
                     /db_xref="GeneID:8201613"
                     /db_xref="GOA:C5DPB0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DPB0"
                     /translation="MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPA
                     DTPTGTNKVCLKRVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGT
                     YEVFLLMEFCTAGGLIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDI
                     KIENVLISADGEYKVCDFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLY
                     RCQAIDEKSDIWALGIFLYKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLIS
                     WMLSQQPMQRPNICQVLEEVSRMQGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNT
                     NTFMAPPAQVAPLTPAQSLGANGMPVGVTPQPMPIMAKTRSGISTGGNIFPGAANPMV
                     VPTQLGPAQVAGPVPMGSQDMSSGILPPFNRASTLPTDGFSTGPGKDGGVITSAVNTG
                     PETIKDRPFNYVDSETQTSDAGSITTSKPYLHPSAVSSTRSLPAQNADHDSRPRSSSL
                     DFKSAARKKPADEEILENLIALSNRRDDPNKRNSFNSFNSSPIGQRSPTGGANVPTTP
                     DSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKSTSEIVNIRTTTSSFSENGLRKTT
                     SNVENGKSTTRSIKTPSSVNGKSESKSKPPPPPPKPEHLRPKKPPKPAFLSGKRKEPE
                     VLLNEVKDAVMDSNVDTIETDV"
     gene            complement(<154507..>156630)
                     /locus_tag="ZYRO0A01870g"
                     /db_xref="GeneID:8201614"
     mRNA            complement(<154507..>156630)
                     /locus_tag="ZYRO0A01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494410.1"
                     /db_xref="GeneID:8201614"
     CDS             complement(154507..156630)
                     /locus_tag="ZYRO0A01870g"
                     /note="highly similar to uniprot|P53973 Saccharomyces
                     cerevisiae YNL021W HDA1 Putative catalytic subunit of a
                     class II histone deacetylase complex that also contains
                     Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
                     subcomplex to form an active tetramer deletion increases
                     histone H2B H3 and H4 acetylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494455.1"
                     /db_xref="GeneID:8201614"
                     /db_xref="GOA:C5DPB1"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR017321"
                     /db_xref="InterPro:IPR019154"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:C5DPB1"
                     /translation="MNTDNPVKQEDEGSKRKLEESPNGPVEKKPNVASVSNGRQKRQI
                     IVPACEPKIHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAEN
                     GLINDPTLSGEDDIGELMLKIPVREATVEELLQVHTKEHLEFIEKTSQMNREELLKET
                     ETGDSVYFNSDSYSAAKLPCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFC
                     LFSNVAVAAQNILKNYPESVRRILILDWDIHHGNGTQKAFYNDDRVLYISLHRFELGK
                     YYPGTIHGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMLAFEQIVMPMAREYRPDLVI
                     ISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVALEGGYNLDAIATSALSV
                     AKILIGEPPEELPDPSKNPKLEAIEMIDKVIHVQSKYWKCFRRLGNSGCNFKEPVTES
                     LITKNFPLQKAIRQEQFHQLEKEYGFVTLPVPKLELPEDTVLCSPDVFQESTVIIFVH
                     DTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLARKYGVIDVNIPQSLFEQDNYSA
                     MITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVHLLGHRDTRSVVKAVINFVG
                     RKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKKPRRKFGRVLRCESDGIN
                     NNMEERFDEATDFILDSFEEWSDSE"
     gene            <156967..>158364
                     /locus_tag="ZYRO0A01892g"
                     /db_xref="GeneID:8201615"
     mRNA            <156967..>158364
                     /locus_tag="ZYRO0A01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494411.1"
                     /db_xref="GeneID:8201615"
     CDS             156967..158364
                     /locus_tag="ZYRO0A01892g"
                     /note="similar to uniprot|P53972 Saccharomyces cerevisiae
                     YNL022C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494456.1"
                     /db_xref="GeneID:8201615"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DPB2"
                     /translation="MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNP
                     KHIYAVVASCWKYRMYLERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKR
                     IQMGKHPIKDYVLKYKTRLHAELVKLKVKLKVKELSELVDQDDGDDATPVRWIRINPL
                     KCDIPVVVEQLNKKFPHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGK
                     VIIQDRASCLPAHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDSNGGQAQIHAF
                     EKEPARAKVLQKMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFG
                     RKSLESSNDSQDQKLQDRLSKLSSFQFQVVKHAMSMPNARKIVYSTCSVHAEENERVV
                     IDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDDKPKCQLLAESCIRALP
                     REDGGIGFFAVCFQR"
     gene            complement(<158403..>159509)
                     /locus_tag="ZYRO0A01914g"
                     /db_xref="GeneID:8201616"
     mRNA            complement(<158403..>159509)
                     /locus_tag="ZYRO0A01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494412.1"
                     /db_xref="GeneID:8201616"
     CDS             complement(158403..159509)
                     /locus_tag="ZYRO0A01914g"
                     /note="highly similar to uniprot|P40495 Saccharomyces
                     cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase an
                     NAD-linked mitochondrial enzyme required for the fourth
                     step in the biosynthesis of lysine in which
                     homo-isocitrate is oxidatively decarboxylated to
                     alpha-ketoadipate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494457.1"
                     /db_xref="GeneID:8201616"
                     /db_xref="GOA:C5DPB3"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C5DPB3"
                     /translation="MFRSSVAKVAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLE
                     ALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAG
                     YSSPIVALRKELGLYANVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATG
                     TRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREIC
                     KDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGS
                     LGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIY
                     KAVDANLIKGDVNTPDLGGKATTQQVVDDILSKI"
     gene            <159749..>162610
                     /locus_tag="ZYRO0A01936g"
                     /db_xref="GeneID:8201617"
     mRNA            <159749..>162610
                     /locus_tag="ZYRO0A01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494413.1"
                     /db_xref="GeneID:8201617"
     CDS             159749..162610
                     /locus_tag="ZYRO0A01936g"
                     /note="similar to uniprot|P53971 Saccharomyces cerevisiae
                     YNL023C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494458.1"
                     /db_xref="GeneID:8201617"
                     /db_xref="GOA:C5DPB4"
                     /db_xref="InterPro:IPR000967"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="UniProtKB/TrEMBL:C5DPB4"
                     /translation="MSGFERSEAEIGMAAQEYDGKDAPQVVDNSLILEFSDDSDETTD
                     EETTDEDEDDRMMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCI
                     REWALKSTGRTMDKTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTC
                     DAPICEHGCSKVCHLGPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQFTCEESCG
                     LLLPCGVHKCSKKCHSGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRVADR
                     DSVDDQGNGWIGVFRCKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCP
                     CGRTPLNKLGQARVKCTDHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTN
                     CLCEARSFLVPCQFREDPRCNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRE
                     LLDESLVEAEHVCLKSCNLTLTCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVE
                     APVRCGTKLPPCPYSCISVVRDGYPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKK
                     SDVRTLCFQQDVSCGQICNKPLGSCRHTCQKKCHDGGCQVKCRQICGKKRVNCDHKCP
                     KPCHGGEPCPDFPCPFSVVIKCACGRKESTEPCGTNSQTLSASVTRELSCDEECERVK
                     RCAQLKDALGLKENGDSSVENTVSNALVASNFEELGLPFRETVLAIYSRQQRYCDNIE
                     SVLNNFIDDEKKSSLHFKPMKPAQRHFVHELAKAYKLYSESQDPEPKRSVYVKKELNG
                     ESNKPSITLQEALPIYQAFKQREKETKIRRYEMQNVTNLVNFVPKFEPTVELAKYNGF
                     LIRNLTDGTNGEDLQRIYGEHLKPTLVRNPVYKALPDRNIALIFPESYSDVTVNTECD
                     MERLVGHFDFICKEMFIGDGVELCQVGEYLQPEAPTESS"
     gene            complement(<162742..>163533)
                     /locus_tag="ZYRO0A01958g"
                     /db_xref="GeneID:8201618"
     mRNA            complement(<162742..>163533)
                     /locus_tag="ZYRO0A01958g"
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /transcript_id="XM_002494414.1"
                     /db_xref="GeneID:8201618"
     CDS             complement(162742..163533)
                     /locus_tag="ZYRO0A01958g"
                     /note="similar to uniprot|P40496 Saccharomyces cerevisiae
                     YIL093C RSM25 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM25"
                     /protein_id="XP_002494459.1"
                     /db_xref="GeneID:8201618"
                     /db_xref="GOA:C5DPB5"
                     /db_xref="InterPro:IPR016939"
                     /db_xref="UniProtKB/TrEMBL:C5DPB5"
                     /translation="MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTR
                     EARFINPSTGKKTVQWKEFDEGINRKGFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQL
                     REVFYQQHPWEFSRPKMLVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPEL
                     GIIDAYDRTRFEFYRLRMQEEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWK
                     QKAIEETELLAARRASPAESWGQEKQEGEPNKSDEDGQETEELHL"
     gene            <164037..>164255
                     /locus_tag="ZYRO0A01980g"
                     /db_xref="GeneID:8201619"
     mRNA            <164037..>164255
                     /locus_tag="ZYRO0A01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494415.1"
                     /db_xref="GeneID:8201619"
     CDS             164037..164255
                     /locus_tag="ZYRO0A01980g"
                     /note="highly similar to uniprot|Q8TGJ3 Saccharomyces
                     cerevisiae YNL024C-A Identified by gene-trapping
                     microarray-based expression analysis and genome-wide
                     homology searching"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494460.1"
                     /db_xref="GeneID:8201619"
                     /db_xref="InterPro:IPR009653"
                     /db_xref="UniProtKB/TrEMBL:C5DPB6"
                     /translation="MSALFNFKSLLQVILLLLCSCTYVHAQWPSLLDRYKGHGVLSAF
                     WKMARVGERASPYVSLACILMALSQLNS"
     gene            complement(<164386..>166515)
                     /locus_tag="ZYRO0A02002g"
                     /db_xref="GeneID:8201590"
     mRNA            complement(<164386..>166515)
                     /locus_tag="ZYRO0A02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494416.1"
                     /db_xref="GeneID:8201590"
     CDS             complement(164386..166515)
                     /locus_tag="ZYRO0A02002g"
                     /note="similar to uniprot|P40498 Saccharomyces cerevisiae
                     YIL091C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494461.1"
                     /db_xref="GeneID:8201590"
                     /db_xref="GOA:C5DPB7"
                     /db_xref="InterPro:IPR010678"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVKRTGNGTDAIDGSRKRGRKDLRSIRRARNDKEPVEEPEIPVA
                     SEEDGELSEDSEEDATNEVQEQEDSKEKAYGALLTILKSEHPEDRQRERRKKKQDLQD
                     PSSSDDELSEDEKGEVEANLVDTPGEEEPQSEEELSEGDEDESEDERDPFESHFNMQS
                     ESIDSLDEAWKQKKIVNKSGKIRVDDDESLIYTKTLAGKGQEFELPSHKGHLSSYPLK
                     RKLKIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYRDLYVLHVLN
                     HIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKVIEKSGLD
                     QVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYSNFYQS
                     DLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAHMNK
                     IPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNHH
                     QITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDG
                     ILLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTER
                     LHHFRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLD
                     GLALERIVSSKRAAVLTHGQNEIYEFK"
     gene            <167059..>168519
                     /locus_tag="ZYRO0A02024g"
                     /db_xref="GeneID:8201591"
     mRNA            <167059..>168519
                     /locus_tag="ZYRO0A02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494417.1"
                     /db_xref="GeneID:8201591"
     CDS             167059..168519
                     /locus_tag="ZYRO0A02024g"
                     /note="similar to uniprot|P40499 Saccharomyces cerevisiae
                     YIL090W ICE2 Integral ER membrane protein with type-III
                     transmembrane domains mutations cause defects in cortical
                     ER morphology in both the mother and daughter cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494462.1"
                     /db_xref="GeneID:8201591"
                     /db_xref="InterPro:IPR013635"
                     /db_xref="UniProtKB/TrEMBL:C5DPB8"
                     /translation="MSFVVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLF
                     NLYFMSTTLSLFVRGYASRFYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILES
                     GSQPEQSLLEVLKSNPFSAHSNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTIL
                     AIQAVGESHRWLLYEINSNIWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASL
                     LGFTLSLVCGLGLYGIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKE
                     AWQKHQRNYSSTNNLLSYYHDVVLDSAEMMWESIVSKTVTTSDPFYHTSMFPPLRKFT
                     DIFKPVGIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKII
                     PALQGKGDRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWF
                     SLNQTKIVVDSWGFWNWCNIFWTILVYGSELIGGKK"
     gene            complement(168736..168849)
                     /gene="SNR66"
                     /locus_tag="ZYRO0A02046r"
                     /db_xref="GeneID:8201592"
     ncRNA           complement(168736..168849)
                     /ncRNA_class="snoRNA"
                     /gene="SNR66"
                     /locus_tag="ZYRO0A02046r"
                     /product="snR66"
                     /note="C/D snoRNA monocistronic SNR66"
                     /transcript_id="XR_002648379.1"
                     /db_xref="GeneID:8201592"
     gene            <169587..>170582
                     /locus_tag="ZYRO0A02068g"
                     /db_xref="GeneID:8201772"
     mRNA            <169587..>170582
                     /locus_tag="ZYRO0A02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494418.1"
                     /db_xref="GeneID:8201772"
     CDS             169587..170582
                     /locus_tag="ZYRO0A02068g"
                     /note="highly similar to uniprot|P47821 Saccharomyces
                     cerevisiae YNL025C SSN8 Component of RNA polymerase II
                     holoenzyme involved in RNA pol II carboxy-terminal domain
                     phosphorylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494463.1"
                     /db_xref="GeneID:8201772"
                     /db_xref="GOA:C5DPB9"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="InterPro:IPR023598"
                     /db_xref="InterPro:IPR028367"
                     /db_xref="UniProtKB/TrEMBL:C5DPB9"
                     /translation="MSGSYWPSTQRRKWQFTKESLAKERQKLWVMECQLFPQGLNIVM
                     DSKQNGTSRVTTKNIPITHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVY
                     LSRFLLRVSVREVNLYLLVTTCVYLACKVEECPQYIRTLVSESRSLWPEFVPPDPTKV
                     TEFEFYLLEELQSYLVVYHPYSTMEQIVNVLEQPPFHMQLSSEDLQNCWSLINDSYIN
                     DAHLTYPPHIIAISCLFITISMKAGAAKNAIQNSQTNMQAMSETEASLAQALKHQEIF
                     NRFLAESQVDLEEVTDTIQELISLYDHWDKYHEPWIKFLLHTLYLRSPNSTARSS"
     gene            170989..171060
                     /locus_tag="ZYRO0A02090r"
                     /db_xref="GeneID:8201593"
     tRNA            170989..171060
                     /locus_tag="ZYRO0A02090r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=60.23"
                     /db_xref="GeneID:8201593"
     gene            complement(<171184..>172587)
                     /locus_tag="ZYRO0A02112g"
                     /db_xref="GeneID:8201594"
     mRNA            complement(<171184..>172587)
                     /locus_tag="ZYRO0A02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494419.1"
                     /db_xref="GeneID:8201594"
     CDS             complement(171184..172587)
                     /locus_tag="ZYRO0A02112g"
                     /note="similar to uniprot|P40501 Saccharomyces cerevisiae
                     YIL088C AVT7 Putative transporter member of a family of
                     seven S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494464.1"
                     /db_xref="GeneID:8201594"
                     /db_xref="GOA:C5DPC0"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DPC0"
                     /translation="MQPTGTVRSSVINLVKTIVGAGLLAIPYAFKSDGVLVGVLLILL
                     AAITSGFGLFVLGKCSKTLIDPRDSSFFSLCMLTYPSLSPLFDLAMITQCFGVGLSYL
                     VLIGDVFPGLFGGQRDWWIVGSSLVVVPLCLLKKLDSLKYSSIIGLFALAYLSLLILS
                     TFVYEYSSGRYEEVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTM
                     TNITAVVNRSIAIATVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSM
                     VVLTFPLLFHPCRIAVNNLCVWAQLQREKRAESHQECEPLNPNTPSSVRPISLSVQDS
                     DSRSLVNSYGATQGNEEIEDLEVAGNGSPHVNIPDGRFYIITALLLIAMYALALNVNS
                     FATVLAFVGATGSTSISFTLPGLFGYKLIGTDYLAAGQVIPSLEVFYKRCSFLLTWFG
                     LGVMFLSLYVIYTNGAG"
     gene            <172722..>173234
                     /locus_tag="ZYRO0A02134g"
                     /db_xref="GeneID:8201595"
     mRNA            <172722..>173234
                     /locus_tag="ZYRO0A02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494420.1"
                     /db_xref="GeneID:8201595"
     CDS             172722..173234
                     /locus_tag="ZYRO0A02134g"
                     /note="some similarities with uniprot|P53965 Saccharomyces
                     cerevisiae YNL032W SIW14 Tyrosine phosphatase that plays a
                     role in actin filament organization and endocytosis
                     localized to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494465.1"
                     /db_xref="GeneID:8201595"
                     /db_xref="GOA:C5DPC1"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DPC1"
                     /translation="MTNEVVPPENFSHVVGEIYRSSFPRVENFYFLKHRLKLKSVLVL
                     IPEELPPENEEFLQEAGIQLFQVGMSGNKEPFVNIPGDELTRAMEIVLNPQHQPILIH
                     CNRGKHRTGCLIGCIRKLQNWSLTMIFDEYRRFAFPKARALDQQFIEMYNDSDIKRIA
                     SANNWLPIQW"
     gene            complement(<173407..>173880)
                     /locus_tag="ZYRO0A02156g"
                     /db_xref="GeneID:8201596"
     mRNA            complement(<173407..>173880)
                     /locus_tag="ZYRO0A02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494421.1"
                     /db_xref="GeneID:8201596"
     CDS             complement(173407..173880)
                     /locus_tag="ZYRO0A02156g"
                     /note="similar to uniprot|P40502 Saccharomyces cerevisiae
                     YIL087C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494466.1"
                     /db_xref="GeneID:8201596"
                     /db_xref="InterPro:IPR019419"
                     /db_xref="UniProtKB/TrEMBL:C5DPC2"
                     /translation="MENPSNSTGHLPKQSFLARLYSHTTTPAPGIANAALLLATPIVS
                     PGIQNPANAVERAGRVQLLNKFTRPQYLGPSKRVALLFGGANALGAWIIHDQDLESGA
                     GFLAAWSTLYLIVGGRGSIKAVRYGKVWPLVLTAASGLNALLYSRRFISGAGALV"
     gene            complement(<176135..>176545)
                     /locus_tag="ZYRO0A02178g"
                     /db_xref="GeneID:8201597"
     mRNA            complement(<176135..>176545)
                     /locus_tag="ZYRO0A02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494422.1"
                     /db_xref="GeneID:8201597"
     CDS             complement(176135..176545)
                     /locus_tag="ZYRO0A02178g"
                     /note="highly similar to uniprot|P61830 Saccharomyces
                     cerevisiae YNL031C one of two identical histone H3
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494467.1"
                     /db_xref="GeneID:8201597"
                     /db_xref="GOA:C5DPC3"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DPC3"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <176939..>177250
                     /locus_tag="ZYRO0A02200g"
                     /db_xref="GeneID:8201598"
     mRNA            <176939..>177250
                     /locus_tag="ZYRO0A02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494423.1"
                     /db_xref="GeneID:8201598"
     CDS             176939..177250
                     /locus_tag="ZYRO0A02200g"
                     /note="highly similar to uniprot|P02309 YBR009C and to
                     uniprot|P02309 YNL030W Saccharomyces cerevisiae, HHF1 and
                     HHF2, two identical histone H4 proteins; core histone
                     required for chromatin assembly and chromosome function;
                     contributes to telomeric silencing; N-terminal domain
                     involved in maintaining genomic integrity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494468.1"
                     /db_xref="GeneID:8201598"
                     /db_xref="GOA:C5DPC4"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:C5DPC4"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            complement(<177325..>178869)
                     /locus_tag="ZYRO0A02222g"
                     /db_xref="GeneID:8201599"
     mRNA            complement(<177325..>178869)
                     /locus_tag="ZYRO0A02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494424.1"
                     /db_xref="GeneID:8201599"
     CDS             complement(177325..178869)
                     /locus_tag="ZYRO0A02222g"
                     /note="similar to uniprot|P40504 Saccharomyces cerevisiae
                     YIL085C KTR7 Putative mannosyltransferase involved in
                     protein glycosylation member of the KRE2/MNT1
                     mannosyltransferase family or uniprot|P53966 Saccharomyces
                     cerevisiae YNL029C KTR5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494469.1"
                     /db_xref="GeneID:8201599"
                     /db_xref="GOA:C5DPC5"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DPC5"
                     /translation="MLRIRAKVRRACEEISDNREFFLTLAASIVFLFVLLTKVFVKGV
                     VFPIETSDKYIGSDRDKPFYEGCVDTMQYLKDPAYTKMNATFVMLTRNEEIDGVLHSV
                     NSLESRFNQWFHYPYVFLNDVPFSEEFKREIKNAVSGEVQFGLVDKYMWQIPEETSDP
                     RAFKNAIDTQGDRGFLYGGSASYHRMCRFYSGSFYRHPLVQRHEWYWRVEPEVDFYCD
                     ITYDPFFEMARHNKKYGFNILIEEIYATVPNLFRYTMAFIKKYRIKTKTLWKLFSMNH
                     YILKTSNQELQDWVNFYRDVEPKLVEKLIIEDFLKGEDPEDSIGLNFLIRRSKSSTPI
                     VEDKFENEEYNLIHFWSNFEIARVDTFDNPIYNAYFEYLDKMGGFWRERWGDAPVHSL
                     GLGLTMNVEDIHYFRDIGYQHSVMAHCPKNAPHKQLVYKEGDPRHKRGYFKNWYDSTS
                     ENGSGCRCSCPSQRDTEDKSSECMDRWKNLLTADDAELDGGRHSGYVDTNKVERKLKQ
                     KLFQSD"
     gene            complement(<179204..>180214)
                     /locus_tag="ZYRO0A02244g"
                     /db_xref="GeneID:8201848"
     mRNA            complement(<179204..>180214)
                     /locus_tag="ZYRO0A02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494425.1"
                     /db_xref="GeneID:8201848"
     CDS             complement(179204..180214)
                     /locus_tag="ZYRO0A02244g"
                     /note="similar to uniprot|P40505 Saccharomyces cerevisiae
                     YIL084C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494470.1"
                     /db_xref="GeneID:8201848"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:C5DPC6"
                     /translation="MSQRQTAQDVSRKDKRRHNIESKVGKIYQTFVLDKDSYYKDRLT
                     ALQTDLTTLHQGNNKSYLRTLRDYEEERDLELVRLRLFEEYRVSRSGVEFQEDIEKAK
                     VEHERLVKLCKEKLYENIQHKIKMLQEDRLLMDVANAHSYAIDYYRGKYQKHTRSHGA
                     NGWESSSNEVGGAGTGRGDSANESATDTGTERRSLRRRAATKGAPATSRLASHAEESD
                     FQTNYSSAQGGTNNQNAGGGGPISALKSQDARSTDVNSDSEFMQDISDHAELYALLFG
                     EKEQDNRTSERRKHRTSQRYTAKSAPPLPSLNQDEVSEDIAMIRQMTDQPPAPFKPKT
                     SE"
     gene            <180349..>181575
                     /locus_tag="ZYRO0A02266g"
                     /db_xref="GeneID:8201849"
     mRNA            <180349..>181575
                     /locus_tag="ZYRO0A02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494426.1"
                     /db_xref="GeneID:8201849"
     CDS             180349..181575
                     /locus_tag="ZYRO0A02266g"
                     /note="similar to uniprot|Q04235 Saccharomyces cerevisiae
                     YML005W TRM12 Putative tRNA methyltransferase has a role
                     in tRNA modification S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494471.1"
                     /db_xref="GeneID:8201849"
                     /db_xref="GOA:C5DPC7"
                     /db_xref="InterPro:IPR003402"
                     /db_xref="InterPro:IPR026274"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DPC7"
                     /translation="MAWEIVVNDSKLIKAIKNELESKSLFVKPIYREGSKSVIRTGID
                     DADDEVLGRYGSCKRWYELDRGDTDGGNQIVRYTRKYLIDHNCLSQELMEFVPLRYTI
                     YTPLLLFNNSEKSFNNDNWNRFFAAHDPQDFFAGLAQCFPQVTHIAINMPIVESDTMR
                     RPFQLHPLYGEFNGKLSANYWLHPTQQDFENTLWCHTVQNGIHQYWAPMFTMFSRGNI
                     KEKKRILDTFEGIEGNDVVDLYAGIGYFTLSYLKRGARNCFCFELNPWSTQALKRGVT
                     ANGFNSEKVHVYTENNINALERIKNFEPKDLRIRHINLGLLPSSKDGWSIAQSIIHYQ
                     DSLSDENHKVTLHIHENVHVDRLQDGTFIQSTIDHLSMDRNHNYSATHLERIKTFAPD
                     VWHVCLDVDVHGKSKN"
     gene            <181918..>183777
                     /locus_tag="ZYRO0A02288g"
                     /db_xref="GeneID:8201850"
     mRNA            <181918..>183777
                     /locus_tag="ZYRO0A02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494427.1"
                     /db_xref="GeneID:8201850"
     CDS             181918..183777
                     /locus_tag="ZYRO0A02288g"
                     /note="similar to uniprot|Q288C3 Torulaspora delbrueckii
                     CRZ1 Calcineurin-responsive zinc finger transcription
                     factor and some similarites with YNL027W uniprot|P53968
                     Saccharomyces cerevisiae YNL027W CRZ1 Transcription factor
                     that activates transcription of genes involved in stress
                     response nuclear localization is positively regulated by
                     calcineurin-mediated dephosphorylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494472.1"
                     /db_xref="GeneID:8201850"
                     /db_xref="GOA:C5DPC8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DPC8"
                     /translation="MSNPLEELSDGQNQEVLIGSSGDGNNAKRGEAHTEMSYLNARPF
                     IKPEVLEFSSPELEERNENAFVQNYALQQNNNQTHNDSSYNNSNNDNNYGKNGEPLPS
                     LNTNEMFFSPSSTSSQNWRTPTLKVEDHDGWQEMLEPSPMSHQDVQSSQPFESDRRFL
                     STSSWQPENDPYTSDLDSDFGGTSSVYHTPNLTAQDATIASPAMSYLTTGDDEVDDLL
                     SVKSGVSSNSNCMLPRNSDGYKHVTNINELDNLLTVINDHFDLELNDLGSSSVPSNNQ
                     ELRRDMDLEMPNQQQSQSIQPPPVISIQEFPEQPIMNRNEDQHLPEQDSSPSPEETVP
                     LQRQRDKQHDAYSNLKQQQTQQQQTQQQQTQQQQQQQQQQLQNILLCPTDSLSDASYE
                     EMRSGRIKKRRASHGSRRLSRASRSSSVSPDEKARSLGEDSDRLLELADLQLPSPIPS
                     RQNSNNSGGDTNNNANDSSNDFTKAGGKSMGALEEGETLQNLSGNTKKRLSQKNPAAF
                     ACELCGKRFTRPYNLKSHLRTHTNERPFECSICGKAFARQHDRKRHEDLHTGKKRYVC
                     GGTLKNGSSWGCGKKFARSDALGRHFKTESGRRCIVPLYEEASREKGFIPDLP"
     gene            <183977..>185455
                     /locus_tag="ZYRO0A02310g"
                     /db_xref="GeneID:8201851"
     mRNA            <183977..>185455
                     /locus_tag="ZYRO0A02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494428.1"
                     /db_xref="GeneID:8201851"
     CDS             183977..185455
                     /locus_tag="ZYRO0A02310g"
                     /note="similar to uniprot|P53969 Saccharomyces cerevisiae
                     YNL026W SAM50 Essential component of the Sorting and
                     Assembly Machinery (SAM complex) of the mitochondrial
                     outer membrane the authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494473.1"
                     /db_xref="GeneID:8201851"
                     /db_xref="GOA:C5DPC9"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:C5DPC9"
                     /translation="MDQFDTNLSERLIEQSRSNSTSQDEQLEKAVKLQNYYGQLLHEK
                     SSELVAVNGVIVNNSESIRPQVLQRYLDATILQAKTVGQLVESADILDMKLVQHGLVE
                     NAQQTLGSRGTLQLPLIKYHFASQIYDSANIPETVSVIDVISQLQLFPLRKFMARTGT
                     NIGNGEGDGYLQFQLRNMFGGGEQLRFDVTKGTKTFSSYLINYAQPLNPWWVWDSLFF
                     KNCKQMGNRNSIETLLRGFRTCLRSGFYGDSVLNHEFFCDVALRNNKMNSLDTCDTLL
                     YQAGDDVKKSLGHIMIWDRRDNPVSASRGSLFRWYNELSLGKFWKSQIELSKAQSWFR
                     DDWLTVNGTLKTGYIHNFHPTSQSLNICDKFQNGGGNDVRSFQYMGLGPKDIYDSIGG
                     DAFVSYGVSVFTRLPFHKISHSNFRLHWFLNGGKLINHNNSSLQDVIKNLSTQHSTSI
                     GFGLVLKHPVARFELNFALPVTCHTGDCIRKGFQYGIGLSFL"
     gene            complement(<185528..>186598)
                     /locus_tag="ZYRO0A02332g"
                     /db_xref="GeneID:8201852"
     mRNA            complement(<185528..>186598)
                     /locus_tag="ZYRO0A02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494429.1"
                     /db_xref="GeneID:8201852"
     CDS             complement(185528..186598)
                     /locus_tag="ZYRO0A02332g"
                     /note="highly similar to uniprot|P40506 Saccharomyces
                     cerevisiae YIL083C Homolog to human PPCS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494474.1"
                     /db_xref="GeneID:8201852"
                     /db_xref="InterPro:IPR007085"
                     /db_xref="UniProtKB/TrEMBL:C5DPD0"
                     /translation="MVPRSPSKSQIHTSITEVSHAIDRSINEAAFPIAQTSDEDRYFL
                     TNPKPPYLEDLIKDAKEFIGLQRSLNRDKIVLVTSGGTTVPLENNTVRFIDNFSAGTR
                     GASSAEQFLANGYSVIFLHREFSLAPFNRLFTHNMEAQFLDYIDTNGNIKPEFRDTVL
                     RNKRLYDKYMVEDKKLLLLPFTTVNQYLWSLKSVAKLLNFSGGLFYLAAAVSDFFVPY
                     SRLPEHKIQSRDKGGDSEAESNSTTTSDGKLIVNLDPVPKFLRRLVESWAKQAMIVSF
                     KLETDESILIHKSTQALDRYNHQLVIGNLLQTRNKQVVFVDQKNREGTWIKLDGSHKS
                     IEEMIIPEVVKHHDRWILTQEN"
     gene            186813..186886
                     /locus_tag="ZYRO0A02354r"
                     /db_xref="GeneID:8201853"
     tRNA            186813..186886
                     /locus_tag="ZYRO0A02354r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.64"
                     /db_xref="GeneID:8201853"
     gene            187946..188019
                     /locus_tag="ZYRO0A02376r"
                     /db_xref="GeneID:8201854"
     tRNA            187946..188019
                     /locus_tag="ZYRO0A02376r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.64"
                     /db_xref="GeneID:8201854"
     gene            <188639..>189871
                     /locus_tag="ZYRO0A02398g"
                     /db_xref="GeneID:8201855"
     mRNA            <188639..>189871
                     /locus_tag="ZYRO0A02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494430.1"
                     /db_xref="GeneID:8201855"
     CDS             188639..189871
                     /locus_tag="ZYRO0A02398g"
                     /note="similar to uniprot|P32588 Saccharomyces cerevisiae
                     YNL016W PUB1 Poly(A) RNA-binding protein abundant
                     mRNP-component protein hypothesized to bind a pool of
                     non-translatable mRNAs not reported to associate with
                     polyribosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494475.1"
                     /db_xref="GeneID:8201855"
                     /db_xref="GOA:C5DPD1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DPD1"
                     /translation="MMSEEQGPVIGVNASVPVQEEPTVSPSPERSDSEERETTPVVPA
                     NATKGGRETSDRVLYVGNLDKSITEEVLRQYFQVGGQISNVKVMIDKNNARANYAFVE
                     YFKSHDANIALQTLNGKQIENNVVRINWAFQSQQALPDENTYNLFVGDLSVDVDDETL
                     CNAFRSFPSFIQGHVMWDMQTGGSRGYGFVSFGDQEQAQLAMDSMQSQELNGRPLRIN
                     WASKRENHHNGNRRGGLAGNRNGGMRLFPNNNNGFGRGMPMPPPNSMGIPLGGTLPPN
                     AQPMGAPPSGPAPTVPPPVNPQAVEAMIRRAPPRVTTSYIGNIPHFATDSDLIPLLQN
                     FGFILDFKHYPEKGCCFVKYDTHEQAAVCIVALANFFFQGRNLRTGWGKERTTFVPMA
                     QPQQPMMMADQSQQPIEH"
     gene            <190417..>192654
                     /locus_tag="ZYRO0A02420g"
                     /db_xref="GeneID:8201856"
     mRNA            <190417..>192654
                     /locus_tag="ZYRO0A02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494431.1"
                     /db_xref="GeneID:8201856"
     CDS             190417..192654
                     /locus_tag="ZYRO0A02420g"
                     /note="similar to uniprot|P25037 Saccharomyces cerevisiae
                     YDL122W UBP1 Ubiquitin-specific protease that removes
                     ubiquitin from ubiquitinated proteins cleaves at the C
                     terminus of ubiquitin fusions irrespective of their size
                     capable of cleaving polyubiquitin chains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494476.1"
                     /db_xref="GeneID:8201856"
                     /db_xref="GOA:C5DPD2"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DPD2"
                     /translation="MSFVLGPIVQKISSFISNNNNKTSIPIALGIVILSTAFLFLKSK
                     KHNSNVGDIARGMTSKSGFRRWMPRSGQMENEVLKRGGNIGGLVNDGNTCFMNCVLQS
                     MASSKELLKFLDEEIACKAKLDEDQSNGDDVNNEKPHNTSKQQQKREEEAKSEGETVP
                     DVTFSAALKELLDKLNAKYYRDRPYFKANKLLKSMSKAPNKNILLGYDQEDAQEFFQT
                     MLSELEKNAKSLDNTTIDKHAILEKDLPETAVIGQARLDHVGAVYIPTEQVTPNLIPP
                     GSKEKYFTKFKLITPLDGILAERIGCLQCGETGGIRYSVSSGLSLNLPSDNMGSSLKL
                     SDLLKDYIKPEIIEGVECNRCALIAVRDHLKEQLQQYEDKKANAIPAKLCQAFQSRIQ
                     ELEKVLSKPVIDDEEYKKLHTENMVRKSSKSKQVLISRPPPLLAIHINRSVFDPRTFM
                     IRKNNARVLFKSRLNLSPWCCDIDEINMDARMPMSQKEEVIMDSSEDENVGGEFYTKL
                     HQKYEREFEDSDEDSDQPIGSSDDKLVSNYDPLGGDGNSLSSYSDEEESNESDYIEKT
                     DALGNTIREPRARANDKVEVAVRENASGASSSEEEEEPEDKNQEMDGDDEDERASAPQ
                     NTESEGEDEGEATNGPLPSKFSVPATPLTYSLRSVVVHYGTHNYGHYIAFRRYRGYWW
                     RISDETVYIVDETEVLSTPGVFMLFYEYDYDESTGQTKQEDWQLEEEYNPEKIEIAGE
                     PESLS"
     gene            complement(<192797..>193123)
                     /locus_tag="ZYRO0A02442g"
                     /db_xref="GeneID:8201857"
     mRNA            complement(<192797..>193123)
                     /locus_tag="ZYRO0A02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494432.1"
                     /db_xref="GeneID:8201857"
     CDS             complement(192797..193123)
                     /locus_tag="ZYRO0A02442g"
                     /note="weakly similar to uniprot|Q07541 Saccharomyces
                     cerevisiae YDL121C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494477.1"
                     /db_xref="GeneID:8201857"
                     /db_xref="UniProtKB/TrEMBL:C5DPD3"
                     /translation="MDFYFYLLFFIFVIIFALLLPTLSGVGGFKIGQKNSRTSNDHRL
                     KFKLSSEKDIGKSSSHGFEIDSKTGLKKRVIGNYSEDPNHYDYDLDELISADDDENDQ
                     RPKAHV"
     gene            <193301..>193831
                     /locus_tag="ZYRO0A02464g"
                     /db_xref="GeneID:8201626"
     mRNA            <193301..>193831
                     /locus_tag="ZYRO0A02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494433.1"
                     /db_xref="GeneID:8201626"
     CDS             193301..193831
                     /locus_tag="ZYRO0A02464g"
                     /note="similar to uniprot|Q07540 Saccharomyces cerevisiae
                     YDL120W YFH1 Yeast Frataxin Homologue mitochondrial
                     protein that regulates mitochondrial iron accumulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494478.1"
                     /db_xref="GeneID:8201626"
                     /db_xref="GOA:C5DPD4"
                     /db_xref="InterPro:IPR002908"
                     /db_xref="InterPro:IPR017789"
                     /db_xref="InterPro:IPR020895"
                     /db_xref="UniProtKB/TrEMBL:C5DPD4"
                     /translation="MIRSTFVRASRLGRTCTAASAIRRASLLPIRKWNYPHPQLHAQR
                     FYAESFTLGDEIPPEVTNLSFQTYHEQADTFLESLSDQLEALSQKYPESVPDVELTQG
                     VMQLELGGIGSYVINKQPPNKQIWLASPVSGPNRFDFYKNEWISLRDGSKLLDILNEE
                     INQAVTEENVTLTPSD"
     gene            <194777..>198022
                     /locus_tag="ZYRO0A02486g"
                     /db_xref="GeneID:8201627"
     mRNA            <194777..>198022
                     /locus_tag="ZYRO0A02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494434.1"
                     /db_xref="GeneID:8201627"
     CDS             194777..198022
                     /locus_tag="ZYRO0A02486g"
                     /note="similar to uniprot|P22855 Saccharomyces cerevisiae
                     YGL156W AMS1 vacuolar alpha mannosidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494479.1"
                     /db_xref="GeneID:8201627"
                     /db_xref="GOA:C5DPD5"
                     /db_xref="InterPro:IPR000602"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="InterPro:IPR011682"
                     /db_xref="InterPro:IPR015341"
                     /db_xref="InterPro:IPR027291"
                     /db_xref="InterPro:IPR028995"
                     /db_xref="UniProtKB/TrEMBL:C5DPD5"
                     /translation="MPLKQINHDPQFKPVKSIYENRLRQFIDTGGYKDLNLPKFYDKQ
                     RIHQDGEYVKIWYYQIPWEKGFDPTAPSVRPSWKSIIDADKNGEIKWKNTAENQPFGP
                     SWTTTWFKVNLSIPQDWLDSGDQLTFEFNCDNEGIVIDPETLVPYTAFSGNERKEYHL
                     PRNGDGKYFFYIECGNNGMFGVGSGGTNNAPDPNRYFHLKTADIVWPDWDARALYFDF
                     WELSDAARELPDDSWQRNRARQIGNEVMNLFDPNDRSSVVRCREFLKKEYYDKYNDSD
                     KVYGKGDSSLLPNVYAIGNCHIDTAWLWPWAETHRKIVRSWSSQTTLMDKYPEYQFVA
                     SQAQQFKWLKDEHPEFFYGSLVPKVEQGQFYAVGGSWVENDTNIPQGESLCRQFLLGQ
                     RFFMKHFGAKSTVFWLPDTFGYSSQIPQICRTSGIERFLTQKLAWNNIDNFPHSTFNW
                     VGIDGSQVLTHMPPGNTYTSDANFGDVLRTAKQNKTQEFYEPGLMLYGKGDGGGGPTK
                     EQLEKMRRIRSLYNRNGNVIPKLQLGLSIDQFYDNILERTHQGDDLPAWVGELYLEFH
                     RGTYTTQARMKQLMRSSEIKLHDLEWIATKTSLLYPGKYKYPASKINDLWENVLLCQF
                     HDVLPGSCIELVYKYEARPMLENVLKEADKLLQGAQTVLIDNAVKSKDQVSVGTLAWC
                     KEDLKADASDFIPATCTVEDDYFVLNNGELTVKISKHSGVITSIVNEKTKTEYIDNKH
                     GRNKLGANQFVLFDDEPTSFPAWDTELYSVNKYKYLTKVEKIEVVSSTASAVTVEVVV
                     PVRQDCKLKTQITLKGKEAGVTDESKVDIHTKVENWNAFYQFLKVEFPVNIINDFASY
                     ETQFGITKRPTHYNTSWDTAKFEVCHHKFADYSEYTKGVSILNDCKYGFSTHGNLMRL
                     SLLRSAKAPDANADMGNHEFSYAIYPHRGPLSHKTVKLGLEFNYHYKFDLSSEAAKAF
                     DQFITLGGDPNVVLSNIKRGEDDKSIDSQYALDPQDKTTVVVRLYESLGGESLATLTT
                     SLPIKEVHKIDSLETKSLEKLHFHTNKNDAKLQDIPITLRPFEIGTYKLVL"
     gene            <198372..>199457
                     /locus_tag="ZYRO0A02508g"
                     /db_xref="GeneID:8201628"
     mRNA            <198372..>199457
                     /locus_tag="ZYRO0A02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494435.1"
                     /db_xref="GeneID:8201628"
     CDS             198372..199457
                     /locus_tag="ZYRO0A02508g"
                     /note="similar to uniprot|P18898 Saccharomyces cerevisiae
                     YGL155W CDC43 Beta subunit of geranylgeranyltransferase
                     type I catalyzes geranylgeranylation to the cysteine
                     residue in proteins containing a C-terminal CaaX sequence
                     ending in Leu or Phe has substrates important for
                     morphogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494480.1"
                     /db_xref="GeneID:8201628"
                     /db_xref="GOA:C5DPD6"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="UniProtKB/TrEMBL:C5DPD6"
                     /translation="MSTSLESTKHVKFLKRHLLMLPSSQQSHDVNRIAIIFYSIVGLS
                     ALGVDCSREYASSIPYIYQHYVKLQIPGYEEVFSGFVGSLATNVSNTSCISLPNTLFA
                     LLTLRIMKCDEFFQKTVDRESLGNFIRKCQYPDGSFASVLDMNKPTPSPVDSTDLRFC
                     YIAAAILRLLGCETKEDFEEFIDVDRVIDYMMTKKCDFGGFGDYGETHAGYTSCALCA
                     FQLLHGLDKLDSEFKERTVDWLLHRQVSNSGTVLLQEGKNPYYDPEENGGFQGRENKF
                     ADTCYAFWCLNSLKILDENEFNNVCRAGLAQDYLLTKTQNNLIGGFSKNDEDDPDLYH
                     TCLGIAVLQLMNGTFDGIFCIPKQFAP"
     gene            complement(<199620..>200513)
                     /locus_tag="ZYRO0A02530g"
                     /db_xref="GeneID:8201629"
     mRNA            complement(<199620..>200513)
                     /locus_tag="ZYRO0A02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494436.1"
                     /db_xref="GeneID:8201629"
     CDS             complement(199620..200513)
                     /locus_tag="ZYRO0A02530g"
                     /note="similar to uniprot|Q07534 Saccharomyces cerevisiae
                     YDL119C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494481.1"
                     /db_xref="GeneID:8201629"
                     /db_xref="GOA:C5DPD7"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DPD7"
                     /translation="MSEKSATTSAHLLGGFFGGLSSAVTLQPLDLLKTRIQQNKNATL
                     FTVLKQIDNPLNLWRGTITSAVRTSTGSALYLSCLNLMRTALAKDRGSSAAGPSSSNL
                     PQLTTYENLIAGALARGIVGYLTMPFTVLKVRYESTLYNYSSISEATRDVYRTYGIKG
                     FFRGFGPTSLRDVPYSGLYVLLYEKAKLIVPLILPREVIAHEHNGKFTSTTSATVNAL
                     SAIFSASLATSITAPFDTIKTRMQLEPKKFTSFFTTLTIIVRQESPIKLFSGLSMRLT
                     RKALSAGIAWGIYEELIKRFM"
     gene            complement(<200774..>201583)
                     /locus_tag="ZYRO0A02552g"
                     /db_xref="GeneID:8201630"
     mRNA            complement(<200774..>201583)
                     /locus_tag="ZYRO0A02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494437.1"
                     /db_xref="GeneID:8201630"
     CDS             complement(200774..201583)
                     /locus_tag="ZYRO0A02552g"
                     /note="similar to uniprot|P50113 Saccharomyces cerevisiae
                     YGL154C LYS5 Phosphopantetheinyl transferase involved in
                     lysine biosynthesis converts inactive apo-form of Lys2p
                     (alpha-aminoadipate reductase) into catalytically active
                     holo-form by posttranslational addition of
                     phosphopantetheine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494482.1"
                     /db_xref="GeneID:8201630"
                     /db_xref="GOA:C5DPD8"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:C5DPD8"
                     /translation="MKNQIMSYGDMQESIRNLDRAGNWHSILLLDSCHEGLQDAFVFE
                     ESMRFLSLEQQARILRKKSYPDRCKALCNRLLQISGISMATGLPHTQLKYKNGTYGKP
                     QLKDIDGLAFSMSNGERYVAQYIVKGKHCEVGIDLASTADYSGDQDLNNFKEIFSSQE
                     FESLIQCNPTKRAPMFAYIWSLKECYTKYTGLGLNSELCNIDFGKLNLFDSDNTLRRR
                     IGGKEIWFYSHWITPNEVVTVCHESSYDLDQNPHLHHLTLQDVLKQLRKTR"
     gene            <201699..>202760
                     /locus_tag="ZYRO0A02574g"
                     /db_xref="GeneID:8201631"
     mRNA            <201699..>202760
                     /locus_tag="ZYRO0A02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494438.1"
                     /db_xref="GeneID:8201631"
     CDS             201699..202760
                     /locus_tag="ZYRO0A02574g"
                     /note="similar to uniprot|P53112 Saccharomyces cerevisiae
                     YGL153W PEX14 Peroxisomal membrane protein that is a
                     central component of the peroxisomal protein import
                     machinery interacts with PTS1 (Pex5p) and PTS2 (Pex7p)
                     peroxisomal matrix protein signal recognition factors and
                     membrane receptor Pex13p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494483.1"
                     /db_xref="GeneID:8201631"
                     /db_xref="GOA:C5DPD9"
                     /db_xref="InterPro:IPR006785"
                     /db_xref="InterPro:IPR025655"
                     /db_xref="UniProtKB/TrEMBL:C5DPD9"
                     /translation="MSTGVQDDRKPLFDSAVSFLSDPSVKDAPLTKKIEFLQSKGLTQ
                     QEVELALKKSQQDHEMLSQNVNNSSTATVAREPDRGSLMYEAVPPPLPRRDWKDYFIM
                     ATATAGLFYGVYEVTKRYVIPNILPEAQSKLEQDKKEIQDQFERVDKLLVTLENEQSE
                     FKKQEEQKLVELDKTVVDLQTCLEQTSYTRDKIEDEFKIMKLEMANLQSKLDTFVMAK
                     RGDQQLENISSELESLKNLIKTREMHPGNSTSSTNDAVNHKSPLNKNPVPGVEAIPSA
                     TEILSKMNFGNNNNNNKDQEQASVPAWKKAREESLNHSNSNPNSNSIPEWQKSAMNNT
                     TNPELHDSTSNNSESTAQE"
     gene            <202977..>206237
                     /locus_tag="ZYRO0A02596g"
                     /db_xref="GeneID:8201632"
     mRNA            <202977..>206237
                     /locus_tag="ZYRO0A02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494439.1"
                     /db_xref="GeneID:8201632"
     CDS             202977..206237
                     /locus_tag="ZYRO0A02596g"
                     /note="similar to uniprot|P53114 Saccharomyces cerevisiae
                     YGL151W NUT1 Component of the RNA polymerase II mediator
                     complex which is required for transcriptional activation
                     and also has a role in basal transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494484.1"
                     /db_xref="GeneID:8201632"
                     /db_xref="GOA:C5DPE0"
                     /db_xref="InterPro:IPR014801"
                     /db_xref="UniProtKB/TrEMBL:C5DPE0"
                     /translation="MENENFYKLALRCADRQIASGDFLNFYKEFYNEKFSAKMENEDT
                     PNESKVLEVSNLLASECIRLLSFEKSLILANYVVEMVFVNYNSDLVHAFLPQLYYITN
                     SNMLIHFFAQSSAFFSKLSDKLVMDQLNKDLSTYVIPSILNVDVTTIGNDLVVAICKF
                     LLLMMNFINGNVVLSSDRSRDNLNALLNRLSKVNKLLHKKVQQQADAKLIFKNAKNNV
                     FPLESAVQEFVSSPSITSPQFEPSPISNAKAQASGGATVSGAKYQDIKLVRYYKNIWL
                     NNKIINWGPIDSDFLSRYASIATSAFQGVTYSPQSTDSILQDLIETSFTCFAQFVNNK
                     QYHQLNSNFNLLERQWMVFICKHLPLLILENGSGNSHTVPQALESIDDKVVKAIRTYY
                     SEKDDMKGRNEDLFDDYPSNNLDIRHEFIKNLVSLGLQSPTLLNDYLREDQMIDTRTL
                     LTTDDLIVTNSQGVQELVKDFKHFLTNSLDSLEPEVLINDSNDNADGLQQIFHNFENI
                     PPTKQREISNILIDILQHALENLEFDRIAKICSVLSFNFSHSLTTILSFSSPTKICEM
                     LIKFVDVSWDKFVEPRCKELVESEYDTMNFFLSFSCSILLLIVIWQTYDFSLVDVVLQ
                     SSESNTENSFVISYISKLPEIPDVFLLDPKNSLDQEMRTKSHQVVQNWLRDLFVNGSI
                     SDDLLQSVDLKQLAVLVPFIFKQVLLTLEVGAIEDVSNLVGGLEYFLQPFMLIGLVKI
                     VYWLEQYLYSLKSENLDEGLLEKLLTLLNSIFNPQALNEDSKLFHSSLLRLNAVRLLR
                     VLRQFRSQSQSNYGIYSTESSGHPKLELLIERLLSALNVSPTYNLDPRVITTENIYSQ
                     KQVGYGRFLILNENPINKIMTNQINSFWNLHSSTYYNLDYLKEVINLVSPRVFLQDVL
                     ATLEYKLDTYGVAGTRNKIAAVESEHVMDYLFYFLVLYDVRSQVDAVSLLQVMDGNSE
                     SPIVKEEMQMKTTEVAPKAEVSQDDDFDMLFGEPETNVTGVDKENQSTNVESKPTESK
                     YNLTATLERHSFGLIIHEMKQECNEALSTGDISKDVCDKITKYHEKYVYLLKTCVF"
     gene            complement(<206448..>210764)
                     /locus_tag="ZYRO0A02618g"
                     /db_xref="GeneID:8201633"
     mRNA            complement(<206448..>210764)
                     /locus_tag="ZYRO0A02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494440.1"
                     /db_xref="GeneID:8201633"
     CDS             complement(206448..210764)
                     /locus_tag="ZYRO0A02618g"
                     /note="similar to uniprot|P53115 Saccharomyces cerevisiae
                     YGL150C INO80 ATPase that forms a large complex containing
                     actin and several actin-related proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494485.1"
                     /db_xref="GeneID:8201633"
                     /db_xref="GOA:C5DPE1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR020838"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPE1"
                     /translation="MSLAALLNKEEGEQIPTPTSTPPAPVVSPVTGDESSRNTAIVNG
                     NGIMDPVQKYLQGLNRDFSVVSQRDALEHEYQDWKFINYQEFELVSEWNNQSKDWKGA
                     ALDSLYKDMATTKAEWDTYAKYKENKLKLLGEMDDVVEDEKPKKPKRAPRKRKIQEVD
                     EDDQVVENGGDTVEHLQQPVEEKYEVKQEEPDGSQQPSPLVNGKTHEEVEEDGGNEED
                     GDQDQEQDQDQEPDSVGDDVGTDMPAAGGAEADEAEEETQEPEQEEDSHDVQFSLEDD
                     ENDKDFLLDDDRPRPSSRKDKTVTLDSDRSKIVKELVKMCNKNKVVKVKKRRFTNAIV
                     TDYNPLDSKLSVKVTLKQYHVRRLKRHINEAKRAAAVAEAAKAKEEAAKNKAKEPTGS
                     PSSKKRKITAKDGSQDVTPANEIDSATASPTKNGLPTYGLKMTVKEARAIQRHYDNTF
                     FTIWKDMARKDCAKMARLVQQIQSIRTANFKKTSSLCAREARKWQFRNFKQVKDFQTR
                     ARRGIREMSSFWKKNEREERDLKKKAEKEALESARKEDEARENKRQAKKLNFLLTQTE
                     LYSHFIGRKIKTNELEGAMADQQLQQQQQQQQQQQLHQHFQHGHVDLDATEANKTEFH
                     NIDFDNEDDEQLRIKAAQNASNALAETRAKTKEFDDSSSNGEELNFQNPTSLGEITIE
                     QPQMLACTLKEYQLKGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEKYNIW
                     GPFLVVTPASTLHNWVNEISKFVPEFNILPYWGNGNDRKVLRRFWDRKNFRYTRDSPF
                     HVMVTSYQMVVSDVTYLQKMKWQYMILDEAQAIKSSQSSRWRNLLSFHCRNRLLLTGT
                     PIQNSMQELWALLHFIMPSLFDSHDEFNEWFSRDIESHAEANTTLNQQQLRRLHMILK
                     PFMLRRVKKNVQSELGDKIEVDVMCDLTHRQAKLYQILKSQISTNYDAIENAAGSDDA
                     SSDQNLINTVMQFRKVCNHPDLFERADVSSPFGFVDFGKIASMAREGGISEVMYSTKN
                     PITYQMPRLIYEDVVLPSFQNDIAARKKLLNVTMNVLDPVKNRDLIEHLRLLTGLKPN
                     EFSEIASKDIVQRALEFNKEDSNKPLIQEIYDDGNCAPKNFKSGLHVYDKPERLLALS
                     RTTTDGVLSSLVDIQNKIYDDQYFNCMHPGYRPGAASTPISIDVLGCRHLYERRGQEL
                     FNPTISQALSEIPPETQYNLKVEKKIPVDHFPITGKFPAAFNKYFSSPISMPSMDRFI
                     TESAKLRKLDELLVDLKRNGHRVLIYFQMTKMMDLMEEYLTYRQYKHIRLDGSSKLED
                     RRDLVHDWQTVPDLFVFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRL
                     GQTRQVTVYRLLVRDTIEERMRDRAKQKEHVQQVVMEGKTQAKKVKRIEGEDNKETVT
                     FK"
     gene            <211596..>212726
                     /locus_tag="ZYRO0A02640g"
                     /db_xref="GeneID:8201634"
     mRNA            <211596..>212726
                     /locus_tag="ZYRO0A02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494441.1"
                     /db_xref="GeneID:8201634"
     CDS             211596..212726
                     /locus_tag="ZYRO0A02640g"
                     /note="highly similar to uniprot|P28777 Saccharomyces
                     cerevisiae YGL148W ARO2 Bifunctional chorismate synthase
                     and flavin reductase catalyzes the conversion of
                     5-enolpyruvylshikimate 3-phosphate (EPSP) to form
                     chorismate which is a precursor to aromatic amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494486.1"
                     /db_xref="GeneID:8201634"
                     /db_xref="GOA:C5DPE2"
                     /db_xref="InterPro:IPR000453"
                     /db_xref="InterPro:IPR020541"
                     /db_xref="UniProtKB/TrEMBL:C5DPE2"
                     /translation="MSTFGHIFRVTTYGESHCRSVGCIVDGVPPGMSLTDKDIQPQLS
                     RRRPGQSKLSTPRNEKDKVEIQAGIEFNKTLGTPIAMLIRNEDQRPHDYSDMDNYPRP
                     SHADYTYMEKYGLKASSGGGRASARETIGRVAAGAIAEKFLSQVSNVEIVGFVSQIGS
                     VKMNRDTFDPHFHHLLNTITREKVDSAGFIRCPDAAIAAEMVKEIEKYRGQKDSIGGV
                     VTCVIRNLPAGIGEPCFDKVEALLAHAMLSIPASKGFEIGSGFSGVSKPGSQHNDLFV
                     FDEETQKLRTKTNNSGGVQGGITNGENVYFSVAFKSVATIAQEQETATYDGKAGVLAA
                     KGRHDPAVTPRAIPIVESMAALVLADSLLIQKSRDFARSVTH"
     gene            <213322..>215982
                     /locus_tag="ZYRO0A02662g"
                     /db_xref="GeneID:8201635"
     mRNA            <213322..>215982
                     /locus_tag="ZYRO0A02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494442.1"
                     /db_xref="GeneID:8201635"
     CDS             213322..215982
                     /locus_tag="ZYRO0A02662g"
                     /note="similar to uniprot|Q07533 Saccharomyces cerevisiae
                     YDL117W CYK3 SH3-domain protein located in the mother-bud
                     neck and the cytokinetic actin ring mutant phenotype and
                     genetic interactions suggest a role in cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494487.1"
                     /db_xref="GeneID:8201635"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002931"
                     /db_xref="InterPro:IPR011511"
                     /db_xref="UniProtKB/TrEMBL:C5DPE3"
                     /translation="MSVSIQVPPLPFKVKARYGWSGQTKGDLGFLEGDVMEVTRITGD
                     WFYGRLLRNKKCSGYFPNNFVNILQERLNRNQEAKKKEVMSQPPPPPPQESSRKVGIP
                     PIPARSTEEGSPRSSRSSRSSKSSDGSLRAIAKRQQQQQEAANVRHLRSRGYHAYSSP
                     TLPTVSPSGHEALSAKMYRIPESTSRRYEGESDFLPELPPIPISPRTDLHRRPKLPPS
                     LKSKSAADLYAVGTSKDSFDYFQEHKNFYDGYHPSSSSSFTNDTTSMDLFSDAQYLEN
                     SALSSENSYAIMSDFSATSAGSFARHKFAQSFEDSLERSQNATGSGSLNDSGNGKMGG
                     VLRRMVKKGSGSPVSDVPGSPVSGEYPKLPDLKSLVVNSTRSDARDWLTVKTHLNRSR
                     SLTKHEKHPRYMRALEMHRDLVLHPQDAIYNGLNTNEVKAHGQPGIVDIELAGLNLEY
                     IDNMTRKRCIKDGSMRLDDWAQTTFSARYATPVEKLRGIYVFCTEMFGLVDDNGCTDF
                     SRQPSHLDRILYQKHCTPYQLTCLFKRLCNSLGITCEVVIGFLKTPISKTHEFKYNHC
                     WLRVLANKEWRFIDVILGNVSNPVHEFVNNKRITRAENRYFLVEPLEFIYTHVPAKES
                     EQHIVPSIDQLSALYLPLVFPSFFRNGLKLYKFSTALAYLEDSEIYECSIEIPSDIEV
                     FASVVIPAENSKLAKASRKMDLALTQVKRHRVDSSRRIAVVKAILPPGVKEGALYIHS
                     GLRGSQTTLANVHPLSMMVSLQHEGEEMKYEFVVRRPSENVQKVEMYVVEPQNKYLFV
                     NNEYSFEIIQQPFDGILYNPSGINKNCKQPLALKSPSGKIYELKKNDPHFAFGTWKFN
                     VVLKETGVWTGLVLADSGMGWCSFAEWLCI"
     gene            <216306..>218489
                     /locus_tag="ZYRO0A02684g"
                     /db_xref="GeneID:8201574"
     mRNA            <216306..>218489
                     /locus_tag="ZYRO0A02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494443.1"
                     /db_xref="GeneID:8201574"
     CDS             216306..218489
                     /locus_tag="ZYRO0A02684g"
                     /note="similar to uniprot|P52891 Saccharomyces cerevisiae
                     YDL116W NUP84 Subunit of the nuclear pore complex (NPC)
                     forms a subcomplex with Nup85p Nup120p Nup145p-C Sec13p
                     and Seh1p that plays a role in nuclear mRNA export and NPC
                     biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494488.1"
                     /db_xref="GeneID:8201574"
                     /db_xref="GOA:C5DPE4"
                     /db_xref="InterPro:IPR007252"
                     /db_xref="UniProtKB/TrEMBL:C5DPE4"
                     /translation="MGMEVDEDDLRECYIKFGEALKDFKSVELSSTNPPDPFNILRDF
                     RSIAGSAALKSLEKKDSNKEGSDWELEAKLWHLLELLGSYRTSDINPDEMTTYSYNSN
                     AVFEKKLLQEDRNLYQIWIIIVWIQNNMNPRLTESLPTSKWSNSIISGGLKSCDLDFP
                     LRDLEADINVKDKLEDHAFYKYVYHLLLAGKVDSAIEECRLTENLTLSMILCGMQEYL
                     DPVRDTQIQNEFETQQGVKKHALWRRTVYSLSMDSRLDQYERAIYSFLAGTIPQDDVI
                     NDSNWDSDLLLHLNQILQIEIENYLFAKGKLTTDELIIPLPSKPQGLQNVLDLVSSKH
                     VEESEHPIRILIGAVILDTLSLVLHSSVEMLLDFVKGGSTDNYLAEKPYLLRIVTHIS
                     LFLSILEPQDEVSSNDRSKLITAYISVLKFHGLYDIIPIYVKFLDEQAALEAYSFILS
                     TLEDHEVRRKQLEVANFLQLPTPNILRRTTQRIFNETEGDYTPQGEILVTFDVEAVDR
                     HLISGVEWLLEGKLYVEAVESIVALSRRFLINGRIKALEYFMDRNQLNDVLKSYEFAK
                     ISQRDSEHEKDYAVAEILEYQYLVEGLKKYQEWQKTVKLMDLESNVPTVIAKFQEFSK
                     FTYKLIKNFLVDLSEDGSNPDGDVFYEIRSLYTPYLIIELHKGLVEASKLLKISMFIK
                     EALEITNLVANETDKIYLLFQTSGKLEEYLQLVAYTAILSGSDYK"
     gene            <218642..>220858
                     /locus_tag="ZYRO0A02706g"
                     /db_xref="GeneID:8201575"
     mRNA            <218642..>220858
                     /locus_tag="ZYRO0A02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494444.1"
                     /db_xref="GeneID:8201575"
     CDS             218642..220858
                     /locus_tag="ZYRO0A02706g"
                     /note="similar to uniprot|P32580 Saccharomyces cerevisiae
                     YPL029W SUV3 ATP-dependent RNA helicase component of the
                     mitochondrial degradosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494489.1"
                     /db_xref="GeneID:8201575"
                     /db_xref="GOA:C5DPE5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR022192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPE5"
                     /translation="MRGRWGLLRFTCGGLLRNFRREYHGKRNSLRIFEDNRWLVQKPS
                     LTSIPPQERSQVDAIGFMFGRNAPENIYTSDENFKELLDKSMHHVYNQKLTASFAGQE
                     NYKDYAWLKLRDYIYGQLKDGSLQEKVKQYKPSLTQLIKPSCPAHVVPQLIKVDDYDS
                     NTWQTILKNKVDSKLNKYVHFLSQTYDYIYEQEVLPLMMKTKKTDGSDDVDISNPVEW
                     FAEARKMKRHIIMHIGPTNSGKTYRALQQLKHANRGYYAGPLRLLAREIYDRFQKDGV
                     RCNLLTGEEVIHDLDSAGNPAGLTSGTVEMVPLTQDFDVVVLDEIQMMADLDRGWAWS
                     NALLGAKAREVHVCGEKSTLPLIKNIIKMTGDKLTVNEYERLGKLKVEDWVLPKGYKS
                     LRKGDCVVAFSKKRILDLKLRIEKDTNLKVAVIYGSLPPETRIQQAHLFNSGEYDIMV
                     ASDAIGMGLNLSIDRVIFTTDVKFNGKELVELSSSNIKQIGGRAGRFKSGSQGQDIPQ
                     GFITTFDPSVLSTIRRGMDAPIDYLQSAVIWPTDEICGNIITKFPPGTPPSVLLKAIA
                     LRLEKSSHKLFTMSDLKNKLNVLAIFEHMDDIAFFDKLRLSNAPVKDLPLVRNAFAQF
                     CDTIAKRQTRGLLSYPFPFEVLDYKCITDEKFGLELYESLYNIIMLYFWLGNRYPSYF
                     IDYESATDLKYFCELIIFEKLDRLKKNPYNKGAPQSVGSIYKQRAHFVNQYTRKRN"
     gene            <221117..>222313
                     /locus_tag="ZYRO0A02728g"
                     /db_xref="GeneID:8201576"
     mRNA            <221117..>222313
                     /locus_tag="ZYRO0A02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494445.1"
                     /db_xref="GeneID:8201576"
     CDS             221117..222313
                     /locus_tag="ZYRO0A02728g"
                     /note="highly similar to uniprot|P41338 Saccharomyces
                     cerevisiae YPL028W ERG10 Acetyl-CoA C-acetyltransferase
                     (acetoacetyl-CoA thiolase) cytosolic enzyme that transfers
                     an acetyl group from one acetyl-CoA molecule to another
                     forming acetoacetyl-CoA involved in the first step in
                     mevalonate biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494490.1"
                     /db_xref="GeneID:8201576"
                     /db_xref="GOA:C5DPE6"
                     /db_xref="InterPro:IPR002155"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR020610"
                     /db_xref="InterPro:IPR020613"
                     /db_xref="InterPro:IPR020615"
                     /db_xref="InterPro:IPR020616"
                     /db_xref="InterPro:IPR020617"
                     /db_xref="UniProtKB/TrEMBL:C5DPE6"
                     /translation="MSDNVYVVASCRTPVGSFQGSLASKTAIELGTAAVKGAISKVPQ
                     LKPETDYDEIIFGNVLSANSGQAPARQVALGAGLHNHIVDTTVNKVCASALRSIILGA
                     QSIKCGTSDVVVAGGCESMTNTPYYMPAARSGARFGETKLVDGIQRDGLNDAYDGLAM
                     GVHAEKCARDWDCSRQDQDEFAISSYQKAQKAQNEGKFDKEIVPITIKGFRGKPDTQV
                     TKDEEPSKLNVEKLKSARTVFQKENGTVTAPNASPLNDGAAAVILVSEKKLKQLGLKP
                     IAVIRGWGEAAHEPADFTWAPSLAVPKALTHAGIKDIGQIDFFEFNEAFSVVGLANTK
                     ILKIDPSKVNVYGGAVALGHPLGCSGARIVVTLLSVLEQENGKLGAAAICNGGGGASS
                     IVLEKL"
     gene            <222495..>223037
                     /locus_tag="ZYRO0A02750g"
                     /db_xref="GeneID:8201577"
     mRNA            <222495..>223037
                     /locus_tag="ZYRO0A02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494446.1"
                     /db_xref="GeneID:8201577"
     CDS             222495..223037
                     /locus_tag="ZYRO0A02750g"
                     /note="similar to uniprot|Q03786 Saccharomyces cerevisiae
                     YDR248C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494491.1"
                     /db_xref="GeneID:8201577"
                     /db_xref="GOA:C5DPE7"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR006001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPE7"
                     /translation="MANKVIVLAGTAGTGKSTVADILIKNHSARYPDVRFIEGDTLHP
                     PSNVEKMSAGIPLVDEDRWGWLEKVANVSSETAKEHGLCIAACSSLKKKYRDFMREKR
                     PDTIFYFVFLYGTKQEVLGRLERRSQHFMKATMMESQFKDLELPLEGEPHCCIVHIDG
                     KSFEQVEEDTKEKVSKMFAE"
     gene            complement(<223226..>224473)
                     /locus_tag="ZYRO0A02772g"
                     /db_xref="GeneID:8201578"
     mRNA            complement(<223226..>224473)
                     /locus_tag="ZYRO0A02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494447.1"
                     /db_xref="GeneID:8201578"
     CDS             complement(223226..224473)
                     /locus_tag="ZYRO0A02772g"
                     /note="similar to uniprot|Q12505 Saccharomyces cerevisiae
                     YPL026C SKS1 multicopy suppressor of snf3 and grr1 mutants
                     serine/threonine protein kinase homologous to Ran1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494492.1"
                     /db_xref="GeneID:8201578"
                     /db_xref="GOA:C5DPE8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DPE8"
                     /translation="MLTNCQINNFQITSQIGSGAYGLVFHALDIITENEYAIKAVVKS
                     NSLNDFGKPKTDDNIKKSTVLQTQLYHFFKSFQNKLFLPTVDLDSIQSLSNAELARAP
                     HYKEIALHLKVHSHENVCTIHQVLESPLATFIVMDYYHLDLFTAIVDREHFTSNGLLI
                     KKVFLQLCSALEHCHHNGVFHCDIKPENVLLDANNNVHLCDFGLSTTCQYLAPNVCIG
                     SSYYMAPERILYCSGENDTVTSFPTSTGDVWSLGVILINLCCIRNPWLKAHQTEDSTF
                     NYYAKNPSVLKQILPISEEVYEILIKVLQINPYARIDIKSLMNEVANLTSLTNEGPLK
                     SVPKLDDHLYDTFITGDRGMCLREMLKEEKEEEREIEIDDESLSESIPCESDEEWTKS
                     FGNSLFMQWAGNNLSTLTNFSYN"
     gene            complement(<225436..>226071)
                     /locus_tag="ZYRO0A02794g"
                     /db_xref="GeneID:8201579"
     mRNA            complement(<225436..>226071)
                     /locus_tag="ZYRO0A02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494448.1"
                     /db_xref="GeneID:8201579"
     CDS             complement(225436..226071)
                     /locus_tag="ZYRO0A02794g"
                     /note="similar to uniprot|Q03784 Saccharomyces cerevisiae
                     YDR246W TRS23 Component of the targeting complex (TRAPP)
                     involved in ER to Golgi membrane traffic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494493.1"
                     /db_xref="GeneID:8201579"
                     /db_xref="GOA:C5DPE9"
                     /db_xref="InterPro:IPR007233"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:C5DPE9"
                     /translation="MAVRMLLVINKSGGLIYHRSFEGDVDKGLNSNDYLILASILHGS
                     FAIATQLTPKALQLSQSSSKNIDYTVPYIPYVGMPRGRTSSERSKYGASAPQGKLGSF
                     KGDDFFKESFQSWNRSGVRQLCTDQFTMYIYQTMTGLKFVVACSQGTLSPANPSSSNN
                     IFNIHVADNFLRKIYCLYSDYVMKDPFYSLEMPIKSTLFDKKVKQMVDNLV"
     gene            <226168..>226920
                     /locus_tag="ZYRO0A02816g"
                     /db_xref="GeneID:8201580"
     mRNA            <226168..>226920
                     /locus_tag="ZYRO0A02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494449.1"
                     /db_xref="GeneID:8201580"
     CDS             226168..226920
                     /locus_tag="ZYRO0A02816g"
                     /note="similar to uniprot|Q02685 Saccharomyces cerevisiae
                     YPL024W RMI1 Protein of unknown function GFP tagged
                     protein localizes to the cytoplasm and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494494.1"
                     /db_xref="GeneID:8201580"
                     /db_xref="UniProtKB/TrEMBL:C5DPF0"
                     /translation="MSKAHTHSQTHTYNLSFILDESTMSTIIFQDISQVPSPLQINDR
                     STLTGRDLAILEAFENEPWNSGPPPLVDQKLSRLDRDLLFQILMVENTSKSKLNQVDD
                     IRAKLDPTLQRVDRLKTTRDRVVINQVDIDSDEPTSENASTNALNQSRAVFRLVLQDR
                     KGSLFYAINSSPLSWLQVCMLGSKVIIKKGSIFNRGVFILQEPNVLFLGGINRAWNEN
                     RDGKLCEYLEAKLQRDAEDMKLNGSKKRKNTR"
     gene            complement(<227004..>228956)
                     /locus_tag="ZYRO0A02838g"
                     /db_xref="GeneID:8201581"
     mRNA            complement(<227004..>228956)
                     /locus_tag="ZYRO0A02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494450.1"
                     /db_xref="GeneID:8201581"
     CDS             complement(227004..228956)
                     /locus_tag="ZYRO0A02838g"
                     /note="highly similar to uniprot|P46151 Saccharomyces
                     cerevisiae YPL023C MET12 Isozyme of
                     methylenetetrahydrofolate reductase catalyzes the
                     reduction of 5 10-methylenetetrahydrofolate to
                     5-methyltetrahydrofolate in the methionine biosynthesis
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494495.1"
                     /db_xref="GeneID:8201581"
                     /db_xref="GOA:C5DPF1"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:C5DPF1"
                     /translation="MSIRELYESKDGPTLSLEFFPPKTETGKQNLLERMERMTALGPL
                     FATVTWGAGGSTAEKTLELASLAQKNLNLPICMHLTCTNMDRNIIDDALTRCKAAGIH
                     NILALRGDPPIGQDWSDLEASQSEFKHAVDLVRYINYRFPNEFCIGVAAYPEGHCEGE
                     AEGNEQNPWKDLPFLKEKIDAGADFVITQLFYDVDKFLQFEQMFRQHISTDLPLIPGL
                     MPINSYLLFNRAAKLSHASIPSSVLQKFPPEIQADDDAVKSIGVDILIEIIETIYKAT
                     HGRIKCFHFYTLNLEKAVAKIVATSPTLSDTLDVVEDENDEAATSEPEEQDQEGDIVL
                     EDANVKNLIEDNRKRRRQSSTVSNVSSELTSNRVIIGKKNQHGVGAPTRKVVISISQG
                     SGTLGRDATWDEFPNGRFGDTRSPAFGEIDGYGPTLKVSNKKAYELWGQPKTIQDLQI
                     IFIKYLEGSIDALPWCDLGLSPETALIQEELIQLNERGFLTLASQPATNGSPSTNKIF
                     GWGPAYGVVYQKAFIEMFVPKNIWENGNMKKAIEQYGRAKLTYYANDSQGNFETNLES
                     NSSNVVTWGVFSDSQVIQSTIVSEESFKAWSDEAFSIWLEWAKLFPRNTSTNSLLRQI
                     HQEYCLISIVHHDYINPDELWEIILS"
     gene            <229176..>232337
                     /locus_tag="ZYRO0A02860g"
                     /db_xref="GeneID:8201582"
     mRNA            <229176..>232337
                     /locus_tag="ZYRO0A02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494451.1"
                     /db_xref="GeneID:8201582"
     CDS             229176..232337
                     /locus_tag="ZYRO0A02860g"
                     /note="similar to uniprot|P06777 Saccharomyces cerevisiae
                     YPL022W RAD1 Single-stranded DNA endonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494496.1"
                     /db_xref="GeneID:8201582"
                     /db_xref="GOA:C5DPF2"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR006167"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:C5DPF2"
                     /translation="MPQLFIHEDSDDEQLQLELSRQAEEAVELNKAPDQDQPEESPSL
                     EKTPSLEKTPAEPSQPLYPLIPEENLDDNGLKPNLDDIRQVDIQLNLPLTFQQQVVEN
                     TLVTDDPLVILGKGIGIISIVANLLFTLATPTRINGQPKRSFVIVMNASPGDNLRISE
                     ELQELSWLSSCSEDIQGEDNDIDEDSQRPFHVINAESQNADKRQKLYNSGGIFSVTSR
                     ILIVDLLSGLLHPSRITGIVVLNVEKLKSFSNESFILEIYRSKNKWGFIKAFSESPES
                     FVTQFSPLMRKLKELRLKNVTLWPRFRVEISQCLNNAVNPQINKVVEVKVSQTNSMSQ
                     IQFGLMECLKKCIAEMNRKNPELVLETWNIENALDPTFVKSIDAVMVPNWHRISYESK
                     QLIKDIRFLKNLLKLLVSGDAVDFYEELQLSLDANKPSISRKYSESPWLMADESQMVI
                     SYAKKRIYSDGEYVLEEMPKWEQLISIMEDISYQRAYKDVSGPTLIVCSSYTTASQLA
                     RVLSQADRKDGFRRSMLRKLQLYKERREESKTLVKEIREREPDAMPELNVSAAFAKEQ
                     VITRRRRTRGAAAMAAVERLKNAGTGEDIESVIDDYNIKEELEPEGLLEMADNEATAP
                     TTEYEDEDDFGEKLFHDMSHNAITKEIWDQRTQYFQFVHRGDQIIIEIFANITDDSYL
                     QEIMPSNIIMYEPDLTFIRRVEIHRAIHREMPPNVCFMYYSNSVEEQGHLVSIRKEKD
                     AFTKLIRENSMLSHHFEADEDLSHYKNLAERKVKLNKLRRITTRVAGGQAALADFTQD
                     IVIVDTREFNAALPGLLYRYGVRVVPCMLTVGDYVITPDICIERKSIADLIGSIQNRR
                     LVSQCKKMRSHYKYPTLLIEFEEGQSFSLEPFSERRNYKSKELSTVHPISNKLSQDEI
                     QSELAKLVMRFPGLKIIWSSSPLQTVNMILELKIGREQPDPSQSVALGTRRKQEKSEK
                     KAAAKESDQKKYARLLRIPGISKVEYFNIRKKVKSYEKLKSLSSQELHDLLGDEDLVD
                     KLCRFLQAEKDDEEDELADSDIE"
     gene            complement(<232488..>236063)
                     /locus_tag="ZYRO0A02882g"
                     /db_xref="GeneID:8201583"
     mRNA            complement(<232488..>236063)
                     /locus_tag="ZYRO0A02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494452.1"
                     /db_xref="GeneID:8201583"
     CDS             complement(232488..236063)
                     /locus_tag="ZYRO0A02882g"
                     /note="some similarities with uniprot|P09547 Saccharomyces
                     cerevisiae YPL016W SWI1 Global transcription activator
                     that acts in complex with Snf2p Snf5p Snf6p and Swi3p to
                     assist gene-specific activators involved in the regulation
                     of expression of many genes including ADH1 ADH2 GAL1 HO
                     INO1 and SUC2 Zinc-finger transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494497.1"
                     /db_xref="GeneID:8201583"
                     /db_xref="GOA:C5DPF3"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="UniProtKB/TrEMBL:C5DPF3"
                     /translation="MDFYPSAAASPGINNAALDGNENGDEDDFSSFFDSNGVSGNNNN
                     TNEHNGNSVSPQAILARNSISEISRPNSNPGASMSPQQVFTNQAGLPQQILMMNSGTN
                     GGNEGATPQQILSNRGSPIAGNDGRSLAGSPASAASEGVLHGNSSVFTDRAATFAALR
                     KKQQQAQAAQQAQAQAQVQAQARAQAQAQAQIQAQARAQAQAQAQAQAQAQAQAQAQA
                     QAQAQAQAQAQAQAQAQAQSPAQAPTPTPAQQQGFQGATAAAAAVAAQQQQQRNVLQN
                     LNPDLQRRISTELNNKQYELFMKSLIENCKRENMPLQTIPEIAGRKINLFILFMLVQR
                     FGGGEQISRNKQWGVLAQRLQIPDVQQLTAIYYKILIPYEMYLKSPEGIKESQTKKIF
                     FQQFFQELLKKVQVYSNITNNTNGNSSSNGTSNASPPQPQPQLQPQPQPQPQPQPQPQ
                     PQPQPMSMNAVNAIKLKQQQLHQQQQQQQQQQQFLQQQQQQQQLAAAALRAKKQKKPR
                     QKKKTKKELELERRQQEEMMKRQQQALLEQQRQRKILMEQQLQQQQELLKKKYAQEMA
                     KLPKVYKRAVTRNYKPITRPIQHAKGYDIGYVSQIGEKIDANKPIFLFPPEIGIINLH
                     ALTMSLQSTNLGEIKTALDTLLVTSADSVLKLPFERYPDLLDSLCTLGINLLANLAQG
                     NYNIFHTIYCEEYDVDSILSSPHTPFSTTEERFNKVFENYVKDLNVENDGNSEPLEAR
                     VKVDSLTGTDLEQVPITPAQTPLDWNEDDNETDSVPLKGPRVWEPLPEPLSRRPNQDL
                     TNLHTPSYLQALKSVKEEIDNPFTKMNTRGAEDPKVLLNDQISTISMILRNASFSERN
                     SKIMGKNPFVKRFITDLMWLVFIQSDKVSSNRKGLNFKKDTVITLTNISHVYEVESHL
                     DCFFVLMLALSFGEPKKFDSGSDHLSYPEYLLKLGKYYGFGVDVLSKLFSLAYPNRSF
                     FKDILLPQIVDNEIEEESKDWITALRLINAYNKGDKYRLFNNVFSLLVSVIPFMQLNT
                     LPTLIEEVGPIISQSLTSMLIIVNFLESEDSNKNIKNMPLVWLNSEENIGFNLRRLSE
                     VLCNISIHTDKNLIHLKRMFAFISCKCIELTRLLIQKSIDFTPGTEKLQTCRSLASIP
                     GLLPTDTQIFALLSNPLADAEISRQAELFGKLNNQILATLVEGAK"
     gene            complement(<236681..>237781)
                     /locus_tag="ZYRO0A02904g"
                     /db_xref="GeneID:8202006"
     mRNA            complement(<236681..>237781)
                     /locus_tag="ZYRO0A02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494453.1"
                     /db_xref="GeneID:8202006"
     CDS             complement(236681..237781)
                     /locus_tag="ZYRO0A02904g"
                     /note="similar to uniprot|P50108 Saccharomyces cerevisiae
                     YDR245W MNN10 Subunit of a Golgi mannosyltransferase
                     complex also containing Anp1p Mnn9p Mnn11p and Hoc1p that
                     mediates elongation of the polysaccharide mannan backbone
                     membrane protein of the mannosyltransferase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494498.1"
                     /db_xref="GeneID:8202006"
                     /db_xref="GOA:C5DPF4"
                     /db_xref="InterPro:IPR008630"
                     /db_xref="UniProtKB/TrEMBL:C5DPF4"
                     /translation="MGQFSRFKKPLLVFLTVTFLIFWIRDNGSKTSAADSRSDIAQAL
                     KNNQNVKYPPNLLNRYLYGNGEGDARVDPTQYMSWWNKLVYKLTNWRREPRIVIILAA
                     NEGGGVLKWKNEQDWAIERLSINNKKSYAKKHGYGLTIKDQTVAKRYSHEYREGWQKV
                     DILRQAMREFPNAEWFWWLDLDTLIMEPEFSLEEHIFDRLNNVTSRTLQDFNPLNIPL
                     DIPYVDYTEELNLLITQDCGGFNLGSFFIRNTEWAHMVLELWWDPALYEQKHMYWEHK
                     EQDALEALYANQGWIRSRVGFLPLRSINSFPPGACSEFQDDKRFFYDDKEKDFIVNMA
                     GCNFGRDCWDEMQHYTRLLEDKNRKWFSRLFH"
     gene            complement(<238036..>239769)
                     /locus_tag="ZYRO0A02926g"
                     /db_xref="GeneID:8202007"
     mRNA            complement(<238036..>239769)
                     /locus_tag="ZYRO0A02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494454.1"
                     /db_xref="GeneID:8202007"
     CDS             complement(238036..239769)
                     /locus_tag="ZYRO0A02926g"
                     /note="similar to uniprot|P35056 Saccharomyces cerevisiae
                     YDR244W PEX5 Essential for import of proteins with
                     SKL-like import signal into peroxisomal matrix 69-kDa
                     protein containing tetratricopeptide repeat (TPR)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494499.1"
                     /db_xref="GeneID:8202007"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR024111"
                     /db_xref="UniProtKB/TrEMBL:C5DPF5"
                     /translation="MNAAECSIGSNPLAQFNKHTQRDRSLQHGSSMSMTHEPSPQQFK
                     STQNGMSDAARFHMQNFMNDGSTSNPQMRLGQQPMALRNATGSSSSVNMTPSVRESPG
                     APLQQNAWSQEFQFKDGSSQQLQQPRQTQQQRNGPSYSYRGMGMQNMPMVTGPRMMMG
                     PSMMHPQQQQQQQQQQSHNVDQQKSWDEQFKALESEVAENLNLQDAQTEETPVQEATQ
                     ENDIVGDQYQSEFQQVWDSLQKDADDLLTEDLAGTQEWENDYQRFLNGRVSGNSEYKF
                     EGENQFLHNPNAYEIGCVLMENGAKLSEAALAFEAAVQEDPQHVDAWLKLGEVQTQNE
                     KELSGINALEQCLKLDQHNVEAMKSLAISYINEGYDVSAFTMLNRWVEAKYPDLIENT
                     DGSAIDNETERYKLNVSVRNRFLQIANRLPQVDPDVQLCLGLLFYVDDQFDKTIDCFK
                     AALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVRARYNLAVSSINIG
                     CYKEAAEHLLTALSMHEVSGGATNPSMTVDSNNILETLKRAFVAMDRRDLLERAKPGM
                     DLQSFRNEFNF"
     gene            <240353..>242026
                     /locus_tag="ZYRO0A02948g"
                     /db_xref="GeneID:8202008"
     mRNA            <240353..>242026
                     /locus_tag="ZYRO0A02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494455.1"
                     /db_xref="GeneID:8202008"
     CDS             240353..242026
                     /locus_tag="ZYRO0A02948g"
                     /note="similar to uniprot|P23394 Saccharomyces cerevisiae
                     YDR243C PRP28 RNA helicase in the DEAD-box family involved
                     in RNA isomerization at the 5' splice site"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494500.1"
                     /db_xref="GeneID:8202008"
                     /db_xref="GOA:C5DPF6"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPF6"
                     /translation="MARPPDISQLLSGTDKSANGLQELEKPKFLTKAQRQQLLLNKSQ
                     KREDIIPTVVKPRNKESEVIQKEDEEYSQTSRPKFNYDTNEQEDTLSNYEPIVSIRAK
                     DLMQRPRDSIEQFYMGKHWTEKTRQEMSDRDWRIFKEDFGITIRGGSVENPLRSWYEL
                     KNEQMADAIVKNLKYHEPTPIQRAAVPNVCNKKFRDLLGIASTGSGKTLAFLIPILMK
                     IDQLPSRPLVLKKMDGPLALILAPTRELAQQIEKEAEELIDAWGKNCEVASIVGGHSI
                     EEISLQVSQGTDILVATPGRLIDCLENHVLTLGKVETLVLDEADRMIDMGFEEQVTSI
                     LGNLTQKRQTMMFTASMTPGTEKIAAGYLKNPVRVTVSGSQGSTPMIRQLVEHIGSEE
                     QRFQRIVEFLPQYRAPIIIFINYKRAADWLVQKFYKETQYKVTVLYGSKSQEQREQSL
                     QLLRKGKVQIMIATNVAARGLDVPDVSLVINFQLSKTFEDYVHRIGRTGRAGHEGTAI
                     TFLDDEDPELVKELYKYLQENNPTGANNFAPRLKEKYRLGKRRIEEVLY"
     gene            complement(<242160..>243149)
                     /locus_tag="ZYRO0A02970g"
                     /db_xref="GeneID:8202009"
     mRNA            complement(<242160..>243149)
                     /locus_tag="ZYRO0A02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494456.1"
                     /db_xref="GeneID:8202009"
     CDS             complement(242160..243149)
                     /locus_tag="ZYRO0A02970g"
                     /note="similar to uniprot|Q12046 Saccharomyces cerevisiae
                     YDL209C CWC2 Protein involved in pre-mRNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494501.1"
                     /db_xref="GeneID:8202009"
                     /db_xref="GOA:C5DPF7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DPF7"
                     /translation="MSKTWRERSAKVQVKESDLPSSIPPQTGLVFNIWYNKWSQGQGG
                     QSRFVSPFRLDPKLHSGKTLGDKQETQFFCLYFAKGMCCLGKKCQYMHHVPENEDMLR
                     LAAKTDVLDCFGREKFAFYRDDMAGVGSFRKHNKTLYVGGISSALGNRPLKSNQIENR
                     IRFLFSELGEIDKLHYLESKNCAFIKFKRQCNAEFAKEVVANQSLLIPSDREWEERLQ
                     LTGLQVKWAHDDPNPRAKREEEEEKRQETLDLMVHLLDKSNETQAAEEVKKGENESAE
                     EKHGRIFSGEVLNKLRKRKTNFKSENAKEKRQKTEEPQKASLVDYPSSSSEDE"
     gene            complement(243266..243351)
                     /locus_tag="ZYRO0A02992r"
                     /db_xref="GeneID:8202010"
     tRNA            complement(join(243266..243301,243313..243351))
                     /locus_tag="ZYRO0A02992r"
                     /product="tRNA-Tyr"
                     /note="tRNA-Tyr (GTA) cove"
                     /db_xref="GeneID:8202010"
     gene            complement(244752..244835)
                     /locus_tag="ZYRO0A03014r"
                     /db_xref="GeneID:8202011"
     tRNA            complement(244752..244835)
                     /locus_tag="ZYRO0A03014r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAA) cove score=70.82"
                     /db_xref="GeneID:8202011"
     gene            <245136..>247739
                     /locus_tag="ZYRO0A03036g"
                     /db_xref="GeneID:8202012"
     mRNA            <245136..>247739
                     /locus_tag="ZYRO0A03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494457.1"
                     /db_xref="GeneID:8202012"
     CDS             245136..247739
                     /locus_tag="ZYRO0A03036g"
                     /note="similar to uniprot|P19735 Saccharomyces cerevisiae
                     YBR055C PRP6 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494502.1"
                     /db_xref="GeneID:8202012"
                     /db_xref="GOA:C5DPF8"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR010491"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR027108"
                     /db_xref="UniProtKB/TrEMBL:C5DPF8"
                     /translation="MELPSFLSQQPPPGYIPGIGRGATGFSTRGDKKGPAKVPKRLQN
                     QDTVKAVDGDSKEQDEDSEADKVFSDLDSKLSSRNRSKKREGDQQSIPHQFADLKRSL
                     ATVSEDQWLNIPDAGDYTRKRRRERLDEQLNRKTYAAPDTLLMPHVNLSKLTEEREKM
                     LSRQLDSNIFEKEDSNSVNEAQKYLNDLETFEAGPRGDEEDVKKMRTILQSYRNADPK
                     KPEGWVAAARLEEKARKLKTARNIIEQGCLECPRNEDVWLENIRLNSADTQRCKTLAA
                     QGIKFNPQSLQLWIKAVDLEREVLNKHRVVRSSLQELPLSEELWKLAVKYSADKFEAQ
                     RILQKAVELIPTSIELCSALVHLQNYQEAKHTLNAARKAMPRELKVWILAAEVEESKG
                     EAVTDERILKLLSKGIKQLKENGLEITLLQLLKEAQSLVKEGGLRTAHALTQAALSEF
                     QDEYEASRVVSELSDSIVKVVGFKILLKSNPTKYSFWQSLKKLCEKLNKMDELYNTFE
                     TLLFDESENFRILKQNPLLSLMYSKEIWKNGHDIPKSLEILDRAQNILPNSLEVWLAK
                     LKFLCLTDQVELAQKSFAMAMERLRDSQVPHLEKLYYKYISFLRFRRQNTAAIKMLNE
                     TCIPKFPNCPKFYLQLGQIHYDLGQTEESQMAFERGTKMLPQGIPLWISLARIEEIDL
                     KRPAKARSIFDLALLKNPANETLSLARAQMEARLGNYDQARFIIQQSLQKHSKSATLW
                     AENIRILPLKRANVKKTVFQDALKNTNNSCEILVEIGISFYKELQHETAIKWFERATR
                     SNPSYGDSWVWVARCYKKLNRNIQEIVNQVEIHEPTHGNLWISVSKKPDTQYYSCSKI
                     LLTLLESENVV"
     gene            <247954..>250164
                     /locus_tag="ZYRO0A03058g"
                     /db_xref="GeneID:8202013"
     mRNA            <247954..>250164
                     /locus_tag="ZYRO0A03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494458.1"
                     /db_xref="GeneID:8202013"
     CDS             247954..250164
                     /locus_tag="ZYRO0A03058g"
                     /note="similar to uniprot|P40971 Saccharomyces cerevisiae
                     YDR034C LYS14 Transcriptional activator involved in
                     regulation of genes of the lysine biosynthesis pathway
                     requires 2-aminoadipate semialdehyde as co-inducer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494503.1"
                     /db_xref="GeneID:8202013"
                     /db_xref="GOA:C5DPF9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DPF9"
                     /translation="MSSMLGTSDPGTNKSNSDEVKPLQSSTSANYLSPASLDNGFSLT
                     GPSRFTPDLFSKKGSAPPVIGSIELTPSDDKLMATPEALASANGDMGSQKTAGSVSST
                     VTDGEGKVVKRKYSRNGCTECKRRRMKCDETKPTCWQCARLNRECVYILNAKNKKRKP
                     REARIKSTDRNNKKGLAKTNGSIPPAAVAVAAAAAADANTNKLEKDMINNMQVLELPN
                     VISASNMDGYDANLLIQNLNDMVSMKLNDSFSLNEGLKDFHLPDLDIPELMPQSKASE
                     NSVPISFLVNNVITFNTRLSSFQLGGVHDKYLEVFFYDCLDSIAPFFQNQGNPLRDII
                     LSFARNESYLLSATLAVGASIAHRNSNKLEDERNYCAYLSHCLSLLGEQFQNESNVMH
                     KIEPITLTVIMLAWDCINAMNSQWRSHLKGVTDLFKKINSGNSSKVMNVAKCWFKVME
                     TFASISTVLGGSLTDEQDMDLIFNPQDFQYIDSLKFLNIMTPLNEFNLLRGHKEDFDL
                     VIKEVIKALNAIRDQEKEHFVGEEEIFPKNLDYLQWTPEADTKQTLSYFNTQKILVEI
                     DKQLEYEFIDKSGIIPPESQSHPDNSHIDDNAIDVVVLRSGERIAISWYDISHQTQVL
                     SVLLTVLLKLLGIPKESITIQQVVKKIMSFFKFLDSDEAPQNSRTCYSNFAVLIAGFN
                     ALDEPTRDLVRAYYKLNGGRFRKLTEHNLNRLRKVWYGNDGGNYRLVDEDVLTW"
     gene            complement(<250211..>251482)
                     /locus_tag="ZYRO0A03080g"
                     /db_xref="GeneID:8202014"
     mRNA            complement(<250211..>251482)
                     /locus_tag="ZYRO0A03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494459.1"
                     /db_xref="GeneID:8202014"
     CDS             complement(250211..251482)
                     /locus_tag="ZYRO0A03080g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494504.1"
                     /db_xref="GeneID:8202014"
                     /db_xref="GOA:C5DPG0"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:C5DPG0"
                     /translation="MRLIYTLTLSVATLGRFVSASVLPQHGFEAEVDNTSLVDQLYGD
                     LLISREGFEMQSLHSKITPSDEDDEEFRARCGFYNENPVQLPSDGLGSDLVIFAGIVS
                     FAHLPIARCFTPGAEDFDIAIVGAPYDTSTSFRPGARFGPNGIRQGSRRLGSGVSPVR
                     GFPGSKLRQLDPYNAGYKLVDCGDVPMSPFDNRVALNQLYRGQRTIHKNKSVKDPSQP
                     PKIITLGGDHTVTLMNLRSAYEQWGRLAVIHFDSHIDSWDPRVLGGNITKSTALNHGT
                     FLHYAHEKGYLAPNNSIHVGIRAPFLGPDDEKHDFECGFEKIVARDIDIVGIKGIVDR
                     IKQHVTGWPVYLTLDIDSIDMAVAPGTGTPEPGGFSAREILTILDGLEGLNIVGADVV
                     EVAPAYDTNGDITSTIAASVVDSILGLMTID"
     gene            <251832..>253292
                     /locus_tag="ZYRO0A03102g"
                     /db_xref="GeneID:8202015"
     mRNA            <251832..>253292
                     /locus_tag="ZYRO0A03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494460.1"
                     /db_xref="GeneID:8202015"
     CDS             251832..253292
                     /locus_tag="ZYRO0A03102g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494505.1"
                     /db_xref="GeneID:8202015"
                     /db_xref="GOA:C5DPG1"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:C5DPG1"
                     /translation="MVHQQAENETEDSRLIRAGGSYGACPCDELGENEEDFTKITTYF
                     DEFIQILRKSLPLALTLLLQNLISSVSLLFVGRLGSLVLGSVTLANVIFNATAVVFLG
                     LATCLDTLCPQAYGAGNYTLVGLYFQRCIIISTIVSIPISFVWIFSKPLLNLVAKDAE
                     LINISSQYLKCMVGCIPGYIVFECGKKYMQAQGDFHTAQMILLIGFPFSILANYIFIL
                     NSPLGYLGAPLASSLTFTLMGILMACAMLRDRKCWHEFHWKTVIHGWEPLIRLAVPGI
                     IMIEAEFLAFESLTVLAARFETTELASQAVATSVQSISFQIPFAVSIAASNRISTHVG
                     RGKIPDCQIATRSTLFYMGPAVSMLNLVGLLGGRYFVSSLFTSDPAVIQRAAKLISVI
                     AINQIWDAYNVLGAGCLRAQGRQNIGGYLNLVAYYVFGMPLAIYLGFYLDWQAFGFWI
                     GLGFGIFALAIGEMYCVYRSDWPLIMLQSELLHGAA"
     gene            complement(<253638..>254234)
                     /locus_tag="ZYRO0A03124g"
                     /db_xref="GeneID:8201774"
     mRNA            complement(<253638..>254234)
                     /locus_tag="ZYRO0A03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494461.1"
                     /db_xref="GeneID:8201774"
     CDS             complement(253638..254234)
                     /locus_tag="ZYRO0A03124g"
                     /note="similar to uniprot|Q12335 Saccharomyces cerevisiae
                     YDR032C PST2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494506.1"
                     /db_xref="GeneID:8201774"
                     /db_xref="GOA:C5DPG2"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C5DPG2"
                     /translation="MAIAIILYSLHEHIAALAEIEKEGVELNGIQCDIFQVPETFDAD
                     TVKELGGKPTNYPIANREVLEKYDAFLLGIPTRFGNMPAQWSAFWDATNTLWIKGSLH
                     GKLAGVFVCTGSGGGNENTIASAVTTLVHHGMIYVPLGYYNVMKKLSRMDKVKGGGPW
                     GAGTISGPEGEREPSLIEKKIAREQGRKFGKIYWKTTH"
     gene            complement(<254352..>255329)
                     /locus_tag="ZYRO0A03146g"
                     /db_xref="GeneID:8201775"
     mRNA            complement(<254352..>255329)
                     /locus_tag="ZYRO0A03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494462.1"
                     /db_xref="GeneID:8201775"
     CDS             complement(254352..255329)
                     /locus_tag="ZYRO0A03146g"
                     /note="similar to uniprot|P38235 Saccharomyces cerevisiae
                     YBR053C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494507.1"
                     /db_xref="GeneID:8201775"
                     /db_xref="InterPro:IPR011042"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="UniProtKB/TrEMBL:C5DPG3"
                     /translation="MQVSKQDYSKVEPFVAVPDAVLSEGIVYVSPARTLLWVDIYRAK
                     VYRRRMDTGVTDVFHADGSGSIGAVFPILKRSSSDGNDTQVEEFLFAAKEGIAHGQFG
                     GSWKYVVKYSESGLDSERLKRLRSNDGNVHGEDLYIGLINDFDQETTDEGVIFKINLV
                     SKKIDVFWPRISIPNSLYWVGEYMFVTDSMNSCIWRTKHGFQEREKFIDVTQYSTDPE
                     GNLPEPDGSCLSSNGELLFVSIWGHSKVQVFSTKDGALLQEILLPEETPRVSCCAVVG
                     SDLFVTTGSEHLGTSKVGQPSKGGCLYRLSDVIPESDEFSTRGIIYRDD"
     gene            <255864..>257000
                     /locus_tag="ZYRO0A03168g"
                     /db_xref="GeneID:8201776"
     mRNA            <255864..>257000
                     /locus_tag="ZYRO0A03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494463.1"
                     /db_xref="GeneID:8201776"
     CDS             255864..257000
                     /locus_tag="ZYRO0A03168g"
                     /note="similar to uniprot|P38079 Saccharomyces cerevisiae
                     YBR054W YRO2 Putative plasma membrane protein of unknown
                     function transcriptionally regulated by Haa1p green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery and bud"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494508.1"
                     /db_xref="GeneID:8201776"
                     /db_xref="GOA:C5DPG4"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR029730"
                     /db_xref="UniProtKB/TrEMBL:C5DPG4"
                     /translation="MNQFIDIHKRGGNQAVTINKPYNVDIHITKNGSSWFWAAFCIFT
                     ALAMLVIILMFRKPANERLFYYTGFAPVMFMALNYFTLASNLGWIPVKVKYKHATTAS
                     EHGHLGTRQVFYSRYIGWFMAFPWPIIQASLLGNTPLWQIAFNIGLTEIYVVVMLFGA
                     VVHTTYKWGYFVIAIAAGIITCISVMTTTRNLVRNISPIVLKCFRIYFYIVMLFWFLY
                     PISFALSEGGNVMQPDSEGAFYGILDVLFLGFLPVLFIPVASYIGFDKLGLNKTVNHY
                     GQDSSPAENAVSRPPAPLPKPPPSSGAKDSSKGPGVKQPGKKTKKVKRVKKVMRPVQK
                     PAERPPSEEHVGEKMSEPAEGTSEPTEKVSEPAEKGTPDKSEEY"
     gene            <257891..>258490
                     /locus_tag="ZYRO0A03190g"
                     /db_xref="GeneID:8201777"
     mRNA            <257891..>258490
                     /locus_tag="ZYRO0A03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494464.1"
                     /db_xref="GeneID:8201777"
     CDS             257891..258490
                     /locus_tag="ZYRO0A03190g"
                     /note="highly similar to uniprot|Q12335 Saccharomyces
                     cerevisiae YDR032C PST2 Protein of unknown function with
                     similarity to members of a family of flavodoxin-like
                     proteins; induced by oxidative stress in a Yap1p dependent
                     manner; GFP-fusion protein localizes to the cytoplasm in a
                     punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494509.1"
                     /db_xref="GeneID:8201777"
                     /db_xref="GOA:C5DPG5"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C5DPG5"
                     /translation="MAPNVAIIIYSLYGHTAILAEAEKRGVEAAGGKADIFQVPETLS
                     PEVVKAMGGAPKPDYPIATADTLVNYNAFLFGIPTRFGNFPAQWKAFWDHTGGLWVKG
                     ALQGKVAGVFISTGTGGGNEMTVVNSLSVLAHHGIIYVPLGYANAFKELTNLEEPHGG
                     SPWGAGTLAAADGSRKPSELELSIHEIQGKTFTETVRKF"
     gene            complement(<258599..>258940)
                     /locus_tag="ZYRO0A03212g"
                     /db_xref="GeneID:8201778"
     mRNA            complement(<258599..>258940)
                     /locus_tag="ZYRO0A03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494465.1"
                     /db_xref="GeneID:8201778"
     CDS             complement(258599..258940)
                     /locus_tag="ZYRO0A03212g"
                     /note="similar to uniprot|Q07789 Saccharomyces cerevisiae
                     YDR031W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494510.1"
                     /db_xref="GeneID:8201778"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:C5DPG6"
                     /translation="MSQLDQFIMEDVARYCPREFMEYHKCVSSNRDDLQQCAFRQKDL
                     SSCIQNKVPSVKRVMEKCGSLMQNYEKCVRDNMDTRSVNNCVPLLEQMRSCASEHALQ
                     GTRPINEMVKD"
     gene            <258942..>260183
                     /locus_tag="ZYRO0A03234g"
                     /db_xref="GeneID:8201779"
     mRNA            <258942..>260183
                     /locus_tag="ZYRO0A03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494466.1"
                     /db_xref="GeneID:8201779"
     CDS             258942..260183
                     /locus_tag="ZYRO0A03234g"
                     /note="similar to uniprot|Q12021 Saccharomyces cerevisiae
                     YDR030C RAD28 Protein involved in transcription-coupled
                     repair nucleotide excision repair of UV-induced DNA
                     lesions homolog of human CSA protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494511.1"
                     /db_xref="GeneID:8201779"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DPG7"
                     /translation="MNTCLLKYQLNSIGSNYLNHLSVQHEFEKMVESESPRKYQYSKS
                     KIGGTSCLQIDPNTGKFLLACGNDGSLGIWSLDDRCQDDELYCKRIKFSARTGSNDEP
                     IAIPTNKNAQMVHSFETRKNRFRLYRQSSSPLAPAQSQSRPGHRYGIRSCQWFKLDNG
                     MFFTGSNDLSVQLWDTNSLEAVHSVDVGHRVNQIDTTDHCIVVATEDGYPRLIDLRNP
                     TGITHLGSGTMPHEMLTVHCNPQKTHIVATGDSNGSIKLWDLRKRNQLLMEVYHDTPR
                     KRAHLSYCQDLAWNSNGSQLASVGADGRIYIWSPFNQSHRASQVGPHDLPRTRHLRRT
                     SQRLLWSENYILCNTDYGEIQLLDPVHKKLWTKIEDPEPTSSTSSTTQFSGMALQDKL
                     SNGMGLRLYLSTGNSIYEHTS"
     gene            <260758..>263997
                     /locus_tag="ZYRO0A03256g"
                     /db_xref="GeneID:8201780"
     mRNA            <260758..>263997
                     /locus_tag="ZYRO0A03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494467.1"
                     /db_xref="GeneID:8201780"
     CDS             260758..263997
                     /locus_tag="ZYRO0A03256g"
                     /note="weakly similar to uniprot|Q00816 Saccharomyces
                     cerevisiae YDR028C REG1 Regulatory subunit of type 1
                     protein phosphatase Glc7p involved in negative regulation
                     of glucose-repressible genes involved in RNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494512.1"
                     /db_xref="GeneID:8201780"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:C5DPG8"
                     /translation="MGDNLAAFFADRVSQSQTTPVKSYSAPTTPISGDPLDGGLKKLG
                     KTNGNGQDDMGPTVSMAVHANDDDSFHKSTFNLKRTRSMGLLDEYIDPTRKLLGRNDN
                     ENHRINHGSKNIPLNETTVRARQVGEDEDEDQADDEGAEDNDVEDEDIDEDEYFDDNR
                     NGRRVERTESEWDDANRSMSVSPPPADDASILLPQDDNDLMREPERHVDYLSHEWNES
                     DISNSWKYIILKKKKKSSIDQVNAARLENASWRTWAKARNHLRTVSPEIVNWSKDSDV
                     TWLYGPIVRESDNHDKDVEMGYGSDDETSKRMSTPRKKQKDSHAPKPILKKRTVQEIL
                     KDNSLWKLSEARKHKHEGRHSTSAADTSDIMYEPHDAYDDYDALAAKVNAQYYGPKKT
                     NSGAEFNSGDGHNKSVDGSSDKPTHTTTTGSSETVPQAEDPLASSVGGEGSNDKALKT
                     ILTSSNNDGTGSKSRPGRDRHIHFNDRVEQCMAIADPDFDSDFIDNESDQGDEDADSY
                     GSTSIIGDRSGETLAQAANFGRTSGDSATSSSDDGDADEDDEDNSGLFISPAMPRRTD
                     SATHSPITDNSSTGSMKNSKLSLNPIIKLLPATTLNHGSDDEASDDSDYNGYGSSVSH
                     NVNTYRGYDYMYDYNSVYTGDTSSFLPVENCDVVDVPEGIGLHSAIAGDNASTYEFNH
                     AALSDLDHEVQADEQQHKIHEQPQAATQQEPNTPSLLNNDFDNSGFDSDEQFIEDSQY
                     HSSDDDEDEEEDLGLKRAVSMGRSSSSSSLKDLSNPQPLNTINPQSRTCSFISGKPLN
                     YAPSLPEDNSNFIDVNDNYDNGNHKNFDTTSNSDDDNSKFDNKNSVISSDGDNQRQKS
                     SHMPLKRAPSSPFIFNSESEDEDEDDEADEEDDHNIISCSPKGPNLQHHQEIGDSPKF
                     SLQSHSKTAPPQSSVILPTSGKSATASGPQLSDLSKSIRIKNSLSPAEVGASDVAITG
                     SFSPVNESIKSVVTNEGIIGRGASSPFTNNQNTHNNNEIRDVNRNLQDCHIDENRSNG
                     VGEQRDSSESVQKMMQNAREIANKYLHSWRKGDGNSQGTKSDNKNSGTD"
     gene            <264444..>267179
                     /locus_tag="ZYRO0A03278g"
                     /db_xref="GeneID:8201781"
     mRNA            <264444..>267179
                     /locus_tag="ZYRO0A03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494468.1"
                     /db_xref="GeneID:8201781"
     CDS             264444..267179
                     /locus_tag="ZYRO0A03278g"
                     /note="similar to uniprot|Q12071 Saccharomyces cerevisiae
                     YDR027C VPS54 Component of the GARP (Golgi-associated
                     retrograde protein) complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494513.1"
                     /db_xref="GeneID:8201781"
                     /db_xref="UniProtKB/TrEMBL:C5DPG9"
                     /translation="MSKDVKKDERIGENDDLQQANSVESPLNTSTPKMTNSDSSPKLT
                     RTPSIDGSLNDDLVSVSGNVGKLLPSSRMSMDSFSVRSLDSSAIGGRISSRPFVFDHS
                     NHSGSMEYSPLGNNSIFEIVMNTRRKNWLGYPSVQDIPPVVLTKDIVDPEIQNTVMNY
                     VQSIGPECAVFESSNNLKIINRIEQIKQLEIHDNGNNNFGDESETALQNKENLKELEK
                     VPDFYFSKNFQLDNPRTFQKVLKNVDLQLGELSIESKPQRDHAYSELRDRLNDYLDAV
                     EGLLVGEISKSSHKFFHALGDVDLIQRKAESTVNELDLLVENADILDKEKIQRRIDLL
                     QKTFKRKNVQKLEQGLLQVKQVLLRTEECRKLYEKEQYDICLHMIKSIDLLIKGDGSQ
                     DKAVQQWVQGWPFKLADLKSVPALTETREFLTNMKIEIGGKYSLQLCSVLLGDVRNYC
                     KSVSSKATLNRLQNNTREKKFLDIDEGFRGKVANIVHQLRRCEELASALSLYQDKCIA
                     EIKSIIKSYLPQETLPSESSSEDKKIGTPGTQQYPQQQQQQPVNNGSKLSKLIKEQTP
                     MDFQDMLVHIFTHASEALRRFYRHQKLLLDLSLNEIVSANDPNENQQSMITQLDIRNG
                     INETIRILQLRTGKIIAVRRELTCNLRYDHFLELYSICVLFIQECEAVSGEFLTRYLS
                     DVLAAQIKNFIVNQSSKNIRTIQRKIESETWTPFVVDPSVQRDVNDIVSSMELDPIDW
                     IKKSDLVRASEEDEKNDDDKENEKKEAQAGHKKSVVVEDNTFVASDSLLTNIGLIKEV
                     FILAVNLPSAYLANFEKMCYDLLRYFNIFAVAALNDPAKSSLQSNKNYSIMGESLDCL
                     SRFVHIVQRFFQRLSNFNKDYSSLDQSHYNHLLHQYHMSSEKIYMANAPPPPAPV"
     gene            <267538..>269544
                     /locus_tag="ZYRO0A03300g"
                     /db_xref="GeneID:8201782"
     mRNA            <267538..>269544
                     /locus_tag="ZYRO0A03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494469.1"
                     /db_xref="GeneID:8201782"
     CDS             267538..269544
                     /locus_tag="ZYRO0A03300g"
                     /note="similar to gnl|GLV|KLLA0F04389g Kluyveromyces
                     lactis KLLA0F04389g and some similarites with YDR026C
                     uniprot|Q12457 Saccharomyces cerevisiae YDR026C
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494514.1"
                     /db_xref="GeneID:8201782"
                     /db_xref="GOA:C5DPH0"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C5DPH0"
                     /translation="MASNQEKHYRDQPHHLPHEGGSRHESVEEAVFKYVGVGLQNDDD
                     NPKDPKSYDKRDGSNVVDTSKPGDGNQGNDMDWLFRNAHNDEDIGGDNNENSPRFQSV
                     ALAAIAAAYGSGAGAGSGEHKRRRARDGGEASDGEDDANGNNDNSNNGGRRKSSKKSK
                     KNKEKRAKLQLAVDPELATLDDSDVTSHDQLVRKAIMDTDSIAQHPDFQQYLNTDEEP
                     QKSKDSMKHKDKNHRPVGDHEDEDEEEEDEEDEDEDEDSRDTRDVDPAVVEAAARDEA
                     EDDNLDDVTKQYSELQKDSVMDNPVTKSIQKKDYREVLPKVLSSSDIGVDTDVSHLIQ
                     SAASKASAIIGTTSQSSGKSFDQAEEAALEQFITEYQTIKNLDRQQICERIWSNERRK
                     DDFWSNICKVLPYRTRSSIYKHVRRKYHVFEQRGKWTPQEDAELARLCVEKEGQWSEI
                     GRALGRMPEDCRDRWRNYVKCGSNRASNKWSPQEEELLKRVITEMLEESQRHHTRGTD
                     HLVQESDEEEDVPASDDEKQDFDKKDGRKSNRKTSFKDVINWTIVSERMGGTRSRIQC
                     RYKWNKLVKKEAIAKIQSITETDKRWILEKLRDLGFTEDSQVDWEELAALKPGVKWTG
                     TELKLCYERMRSGVRYYKQKSINDISKELLEMLDGSVPLEAKSN"
     gene            complement(<269848..>270315)
                     /locus_tag="ZYRO0A03322g"
                     /db_xref="GeneID:8201783"
     mRNA            complement(<269848..>270315)
                     /locus_tag="ZYRO0A03322g"
                     /product="40S ribosomal protein S11"
                     /transcript_id="XM_002494470.1"
                     /db_xref="GeneID:8201783"
     CDS             complement(269848..270315)
                     /locus_tag="ZYRO0A03322g"
                     /note="highly similar to uniprot|P26781 Saccharomyces
                     cerevisiae YDR025W RPS11A Protein component of the small
                     (40S) ribosomal subunit or uniprot|P26781 Saccharomyces
                     cerevisiae YBR048W RPS11B"
                     /codon_start=1
                     /product="40S ribosomal protein S11"
                     /protein_id="XP_002494515.1"
                     /db_xref="GeneID:8201783"
                     /db_xref="GOA:C5DPH1"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019979"
                     /db_xref="UniProtKB/TrEMBL:C5DPH1"
                     /translation="MSTELTVQSERAFQKQPHIFNNPKIKTTKRAKRWYKNAGLGFKT
                     PKTAIEGSYIDKKCPFTGMVSIRGKILTGVVVSTKMHRTVIMRRDYLHYVPKYNRYEK
                     RHKNVPVHVSPAFRINVGDIITAGQCRPISKTVRFNVVKVAANASAKKQFTKF"
     gene            complement(<270791..>271339)
                     /locus_tag="ZYRO0A03344g"
                     /db_xref="GeneID:8201636"
     mRNA            complement(<270791..>271339)
                     /locus_tag="ZYRO0A03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494471.1"
                     /db_xref="GeneID:8201636"
     CDS             complement(270791..271339)
                     /locus_tag="ZYRO0A03344g"
                     /note="similar to uniprot|P38231 Saccharomyces cerevisiae
                     YBR047W FMP23 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494516.1"
                     /db_xref="GeneID:8201636"
                     /db_xref="UniProtKB/TrEMBL:C5DPH2"
                     /translation="MLFRQVFLRFLSTTRVPLSKTVSGRIIVPPATHFNNQGPKFNRI
                     PRHEYKQLPDDSNYIEKFYDELQAFSQEFLEKQLHKKYTDFEDCPEELVFQLEQFIEL
                     QVIPKHSEPANETGDTRPSFPLRSIQCRNIGDKIIIERYLDFSKGVKLTLMLNGGHTF
                     IFDVLLQGKSVFDNMQKNEKKD"
     gene            <271779..>272828
                     /locus_tag="ZYRO0A03366g"
                     /db_xref="GeneID:8201637"
     mRNA            <271779..>272828
                     /locus_tag="ZYRO0A03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494472.1"
                     /db_xref="GeneID:8201637"
     CDS             271779..272828
                     /locus_tag="ZYRO0A03366g"
                     /note="highly similar to uniprot|P38230 Saccharomyces
                     cerevisiae YBR046C ZTA1 Zeta-crystallin homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494517.1"
                     /db_xref="GeneID:8201637"
                     /db_xref="GOA:C5DPH3"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002364"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DPH3"
                     /translation="MLRSTISSVFNKRATMATTTIPKTQKVILINDTGSYDVLKYQDH
                     PVPSITDNELLVKNKYSGINFIESYFRKGIYPSEKPLILGRESSGTVVAKGNSVKDFD
                     IGDKVAYLSGSAFAQYTKVDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAY
                     NVKKGDFILNYAAAGGVGLILDQLLKERGAHTIAVVSTEEKLELAKKHGAEYGIISSK
                     EDIVTRVKEITNNQGVDAAFDSIGKDTFETTISALKRKGTFVSYGNASGPVSPFPLTK
                     LTGNIKILRPSLFSYIATSEEWKHYSREFVSLVSSGKLKINIGHVFPLSEYPKATQLL
                     EERKTTGKLVLEIPQ"
     gene            <273072..>274970
                     /locus_tag="ZYRO0A03388g"
                     /db_xref="GeneID:8201638"
     mRNA            <273072..>274970
                     /locus_tag="ZYRO0A03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494473.1"
                     /db_xref="GeneID:8201638"
     CDS             273072..274970
                     /locus_tag="ZYRO0A03388g"
                     /note="weakly similar to uniprot|P38229 Saccharomyces
                     cerevisiae YBR045C GIP1 Meiosis-specific protein proposed
                     to be a regulatory subunit of the protein phosphatase
                     Glc7p required for spore wall formation and proper septin
                     organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494518.1"
                     /db_xref="GeneID:8201638"
                     /db_xref="UniProtKB/TrEMBL:C5DPH4"
                     /translation="MEISLAQENWCSEDCSQNSMSNGDNDNETISSGSVGTGGGKRNS
                     LKKWLHKAVLGYDVDDSFDNEDTVVIEEDDDLVFIPTTSDLSNGLFSSNKELSPLLFE
                     QNPGRKNYRRQKIKDFKFHLKMRMRLARGDETDKNGEMLYRRQCLMGQDGGGDSGEYN
                     EEELDCYQMFKTQPEHLDALFDYAMKSSLEQTSPSDFADFNYASSPVKELQPFQNLNY
                     DDINLNVEHAAFVPLDVWDIDKESDSKRLDSAEDPRVCGSSNDSKGEEDCPTLSMDST
                     EMESFTTGESTERSLELTPSVYLANELTMKDGATGSDVANDSFNSTEGEVEETSCEDS
                     QDTQNTLCSSGSPSIDSVLDSGDSNTIIYTIPTFKQGRGQLNVSGIIQSFKDGTLTEK
                     NLTQMAKGSSLGLSFRSKEFYEQPPSSDEDEQAQGRKQEMPMAPSENDNIREAPENYG
                     VEFAGNGEGVKFDKYSHILVYRAVKRNVQDKGFSCPSLRTPNNGNSSITSGVSESPSA
                     SKPILKKTDNERESEEIVRATLCDKVDVKSFLAYFEYFEHQKHSDEVNLSKFREEQLS
                     HYYSKEFFPELLEDIKFKHAFNSEYRKSKMATELNIGRKIGDGDEQHVRRLVNVIEDP
                     TIGSANFK"
     gene            complement(<275129..>276508)
                     /locus_tag="ZYRO0A03410g"
                     /db_xref="GeneID:8201639"
     mRNA            complement(<275129..>276508)
                     /locus_tag="ZYRO0A03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494474.1"
                     /db_xref="GeneID:8201639"
     CDS             complement(275129..276508)
                     /locus_tag="ZYRO0A03410g"
                     /note="highly similar to uniprot|P07284 Saccharomyces
                     cerevisiae YDR023W SES1 seryl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494519.1"
                     /db_xref="GeneID:8201639"
                     /db_xref="GOA:C5DPH5"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002317"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR010978"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="UniProtKB/TrEMBL:C5DPH5"
                     /translation="MLDVNQFIEEKGGNPELIRKSQKARGASVEIVDEIIADYKNWVK
                     TRFELDELNKQLNKLQKDIGLKFKNKEDASGLLAEKDKLTNEKKELTEKEQKEDNDLK
                     VKVNVVGNIVHPSVVVSNDEENNELVRTWGPKDLKEVGPIAAATGKPAKLSHHEVLLR
                     LDGYDPERGVKISGHRGYFFRNNGVFLNQALINYGLSFLATKGYTPLQPPVMMNKEVM
                     GKTAQLSQFDEELYKVMDGDDEKYLIATSEQPISAYHSGEWFEKPQEQLPVRYAGYSS
                     CFRREAGAHGKDAWGIFRVHAFEKIEQFCLTEPEKSWEEFDRMISLSEEFYQGLNLPY
                     RVVGIVSGELNNAAAKKFDLEAWFPYQKEYKELVSCSNCTDYQSRNLEIRCGIKKMGD
                     REKKYVHCLNSTLAATQRALCCVLENYQTEDGLVVPEVLRKYIPGEPEFLPFIKELPK
                     NSTSNKGKK"
     gene            276731..276804
                     /locus_tag="ZYRO0A03432r"
                     /db_xref="GeneID:8201640"
     tRNA            276731..276804
                     /locus_tag="ZYRO0A03432r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (TAC) cove score=72.06"
                     /db_xref="GeneID:8201640"
     gene            <277117..>277560
                     /locus_tag="ZYRO0A03454g"
                     /db_xref="GeneID:8201641"
     mRNA            <277117..>277560
                     /locus_tag="ZYRO0A03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494475.1"
                     /db_xref="GeneID:8201641"
     CDS             277117..277560
                     /locus_tag="ZYRO0A03454g"
                     /note="similar to uniprot|Q03939 Saccharomyces cerevisiae
                     YDR022C CIS1 Protein involved in microtubule assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494520.1"
                     /db_xref="GeneID:8201641"
                     /db_xref="InterPro:IPR018621"
                     /db_xref="UniProtKB/TrEMBL:C5DPH6"
                     /translation="MHPLTITVYDRNVRHMLSDDNQSSSHHTPDGNSHAMFPTNIKYV
                     FEDDDTSLAPTESENDDGIENMIIVNLEESGTLSGVELISDQFEMLSYKGVTSGNDPM
                     VDDVELEVVSQFTDLSNLVHDLPLDELIRLYVIQNEQMQTISNSM"
     gene            complement(<277585..>278784)
                     /locus_tag="ZYRO0A03476g"
                     /db_xref="GeneID:8201642"
     mRNA            complement(<277585..>278784)
                     /locus_tag="ZYRO0A03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494476.1"
                     /db_xref="GeneID:8201642"
     CDS             complement(277585..278784)
                     /locus_tag="ZYRO0A03476g"
                     /note="highly similar to uniprot|Q12099 Saccharomyces
                     cerevisiae YDR021W FAL1 Nucleolar protein required for
                     maturation of 18S rRNA member of the eIF4A subfamily of
                     DEAD-box ATP-dependent RNA helicases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494521.1"
                     /db_xref="GeneID:8201642"
                     /db_xref="GOA:C5DPH7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPH7"
                     /translation="MSFNREDDSRLKFKTSKKLRVSPTFEAMNLKDDLLRGIYSYGFE
                     APSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQVLELKRKDLQALVLSPTRE
                     LASQSCQVVSNLGDYLNVKAFALTGGKALKDDLKRIQSSGCHVVSGTPGRVLDLIKRQ
                     VVQTRNVQVLVLDEADELLSETLGFKQQIYDIFARLPPGCQVVVVSATMSRDILEVTK
                     KFMSDPVKILVKRDEISLEGISQYYVDVSKEEWKFDTLCDLYDSLTITQCVIFCNTRK
                     KVDWLSKKLIQSNFAVVSMHGDMKQEDRDKVMNDFRTGHSRVLISTDVWARGIDVQQI
                     SLVINYDMPEIMENYIHRIGRSGRFGRKGVAVNFITREDSSKLKATEKMYGIKIKPMP
                     ANLSELS"
     gene            <278958..>279647
                     /locus_tag="ZYRO0A03498g"
                     /db_xref="GeneID:8201643"
     mRNA            <278958..>279647
                     /locus_tag="ZYRO0A03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494477.1"
                     /db_xref="GeneID:8201643"
     CDS             278958..279647
                     /locus_tag="ZYRO0A03498g"
                     /note="similar to uniprot|Q12084 Saccharomyces cerevisiae
                     YDR020C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494522.1"
                     /db_xref="GeneID:8201643"
                     /db_xref="GOA:C5DPH8"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPH8"
                     /translation="MSPSIQQIVVSIGGGHATGVVETGEEIERSLKNLFPSTNVKIIN
                     LDKLDPNKPRQYNYKDYDFDQVYNEICGAGQKRSSIVGNVEPHMQDPVEIVLLCGCYA
                     LYDNRINEIVQLKIFLDSDGDKRLINLIHQNHITTREQLAELLAEYLDHLRLEMQKYI
                     KPTRAQADLIIPSNFDTTARDIIVDGICKVVEAIKGNQSPPAISKISPLLLDFEAEAM
                     DVEKERYYDLS"
     gene            <280162..>281871
                     /locus_tag="ZYRO0A03520g"
                     /db_xref="GeneID:8201644"
     mRNA            <280162..>281871
                     /locus_tag="ZYRO0A03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494478.1"
                     /db_xref="GeneID:8201644"
     CDS             280162..281871
                     /locus_tag="ZYRO0A03520g"
                     /note="similar to uniprot|P38228 Saccharomyces cerevisiae
                     YBR044C TCM62 mitochondrial protein (putative) chaperone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494523.1"
                     /db_xref="GeneID:8201644"
                     /db_xref="GOA:C5DPH9"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="UniProtKB/TrEMBL:C5DPH9"
                     /translation="MFRRSIHKSVCQSIRTVKTLHTPIYETGQLSTKQSLMQGIKLLD
                     NVVNSTTYNKTLLQLSKYNTNPKFITSRDSIRLQNVVRELLDGLRMDEVMTGRERQDH
                     QSRLAKIGLQLFCEIHESNILPISTSLTLTLMAEYAKSPNVTTLRAMLDGLEKVRTFL
                     TENIIHISSTVDIDALVDKLTILREDSETVKQVLKALDYKLYSDDLVRIVKGRKTTDE
                     IDVSKGWKFPAGILDTNEAYLRSIELPQKKLVSVDDEMLVLIYDGTLRDANAVLPTLH
                     HASKSKKSLLLMVTGDCTGDALASIVISNNRNRRQGIKSQTFIIKYDTKANDGISLHE
                     NYDLVQFLRLPQGFASVYSPDYSTLVPSKMCANQYYGKLDSLKATTGEAFLYNPIEWS
                     GEEQENPFTKMTVTVNVGAQSEIEIDHRRNFLDNLINNTLCHGLSKGFIPGYNVALAK
                     AVPLLEKLAFTAQDVDTKMGYEAVIMALAQSLQRSLTNAFGYNKFTSTSLLAETIKDP
                     NFSTAAIEPMGDLQELSRSGILDPWDKVDRCLASIASFMRILSSSDKIVAQVFEPPKK
                     RQP"
     gene            <282056..>283297
                     /locus_tag="ZYRO0A03542g"
                     /db_xref="GeneID:8201645"
     mRNA            <282056..>283297
                     /locus_tag="ZYRO0A03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494479.1"
                     /db_xref="GeneID:8201645"
     CDS             282056..283297
                     /locus_tag="ZYRO0A03542g"
                     /note="similar to YDR019C, uniprot|P48015 Saccharomyces
                     cerevisiae YDR019C (GCV1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494524.1"
                     /db_xref="GeneID:8201645"
                     /db_xref="GOA:C5DPI0"
                     /db_xref="InterPro:IPR006222"
                     /db_xref="InterPro:IPR006223"
                     /db_xref="InterPro:IPR013977"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR028896"
                     /db_xref="InterPro:IPR029043"
                     /db_xref="UniProtKB/TrEMBL:C5DPI0"
                     /translation="MRWHHNIDCSIKRPSPPKDTAAMIRSVRFNSTQAGLKKTALHDL
                     HVELGGNMVPFAGYSMPVAYKGQSHIESHRWTRTHAGLFDVSHMLQSTLQGKDAVNFL
                     HKVTPTDFQQLHPGVGTLSVLLNPNGGIVDDTLITKQSAHDFYMVTNAACAERDSQFL
                     VDELKSVADAKWTPITDRSLLALQGPDAHRVLQHVLAWDQSLADLYFGQRRSYKLFNG
                     AYIDVARSGYTGEDGFEVSIPNEDALQFAQSLLDNEMTKPIGLAARDSLRLEAGLCLY
                     GHELDESITPVEAALSWVISKSRRNITEGVKFNGYDKIIDQINNKTHKSLRVGYRYQT
                     KGPAARTGSKIFLPDGKTEVGHVTSGSASPSLDNINIGQGYVLKPHNKRGTNLLVQVR
                     NKLLPIELVKMPFVPSNYYRG"
     gene            <283783..>285837
                     /locus_tag="ZYRO0A03564g"
                     /db_xref="GeneID:8201818"
     mRNA            <283783..>285837
                     /locus_tag="ZYRO0A03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494480.1"
                     /db_xref="GeneID:8201818"
     CDS             283783..285837
                     /locus_tag="ZYRO0A03564g"
                     /note="similar to YBR043C, uniprot|P38227 Saccharomyces
                     cerevisiae YBR043C (QDR3)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494525.1"
                     /db_xref="GeneID:8201818"
                     /db_xref="GOA:C5DPI1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DPI1"
                     /translation="MVDPTNTTAKDGGSVYSYNSYSDSDLSPGKKDEEGGFQDPQAYR
                     GPHGEPTASDGAESTGEGFHEGDVKAESEQDENKKVGVWKKLKDRSYWTPRKERRGIL
                     PHLSLIPEFKDARDYPPHIKKFIVFVIAFSSMMGPMATSIVYPAIDPIKEDYKTTSIM
                     VNVSVGVYQISLGVFPLWWSSISEMNGRRTVYVLSFLLLLAFNVGTGLSPNINDFIIL
                     RVLSGGAAASVQSVGAGTVADLYVPEERGTNIGIYYMGPLMAPLVSPIIGAALVSGFP
                     WKSTQWFMVILSGVNVILLVLFLPETLRKQDSGAAITAILQARRKGSPGVNANQTEDK
                     SGYQTQYNEDTHSISDPSIATHEHGNDADLERVLSRTSNSMTRFNSNNDLDPIAPQLS
                     KIHSYDPRQEQMLREYEAKRVENNLEEELSRMETAKSNHTARSDGDKIEQTRFQKYRH
                     LAYLYLIRPLKSLYFLEYPPVLLAITFSAISFAVLYFVNMTLEYGYSRPPYNFSPMLI
                     GLMYIPNSVTYLLASVFGGMWTDNLLLKYKAKHGEMVPEARISWNIVTAVIAFPISLL
                     IFGWCLDKGEHWETPLVGTALFGYANMMTIGATVSYLVDSLPGKGATGVALNNLVRQV
                     LAAAAVFVTDPMLDNMTIGWSFTMLAFIIIGATSVLVVLKKYGDHWRENFDLERLYNK
                     LE"
     gene            <286088..>287290
                     /locus_tag="ZYRO0A03586g"
                     /db_xref="GeneID:8201819"
     mRNA            <286088..>287290
                     /locus_tag="ZYRO0A03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494481.1"
                     /db_xref="GeneID:8201819"
     CDS             286088..287290
                     /locus_tag="ZYRO0A03586g"
                     /note="similar to uniprot|P38226 Saccharomyces cerevisiae
                     YBR042C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494526.1"
                     /db_xref="GeneID:8201819"
                     /db_xref="GOA:C5DPI2"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:C5DPI2"
                     /translation="MSLSSGLNNGLRKCKIMVRVIIALVIFVQASLCITSMQVIVRVV
                     YHNNVAKRHHGIDFTKKAFISMLISTLHLIAPSAVRVTTDNNSIPKGTFYKDLKNGRI
                     ASHLKRKSVIVANHQIYTDWVFLWWLTSTADLAGKVYIILKKSLEYIPILGFGMRNYK
                     FIFMCRKWEQDRLTLHNSLGVIDANSRGVGPISGRSPVREDADGEIFWDTTSTNARQE
                     SWPYCLILFPEGTNLSPITRQRSFNYANKIGKTPFENVLLPHATGARHSLLKLRPSLD
                     VVYDITIGYSGVKKGEYGEALYTLNNVVFKGESPKLVDMHIKAYHINEIPIDDEQQFS
                     DWLYDLWAEKDRLMNVYYEKGTFDLDPDPDHTITGEFKISAYPFFSCVVFINSLVCLP
                     FLIWYLLR"
     gene            complement(<287401..>289416)
                     /locus_tag="ZYRO0A03608g"
                     /db_xref="GeneID:8201820"
     mRNA            complement(<287401..>289416)
                     /locus_tag="ZYRO0A03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494482.1"
                     /db_xref="GeneID:8201820"
     CDS             complement(287401..289416)
                     /locus_tag="ZYRO0A03608g"
                     /note="similar to uniprot|P38225 Saccharomyces cerevisiae
                     YBR041W FAT1 Fatty acid transporter and very long-chain
                     fatty acyl-CoA synthetase may form a complex with Faa1p or
                     Faa4p that imports and activates exogenous fatty acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494527.1"
                     /db_xref="GeneID:8201820"
                     /db_xref="GOA:C5DPI3"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:C5DPI3"
                     /translation="MGTKNPVGHVLLNAWLIVFSIVKTALVPVFAILSLCLKGPIEYL
                     DRKHRVKEDFYIITFFIKSVAQYFLAVRNHRFQYWYLFSKQVEQNADRLAISYPRPLS
                     KKGEFEVESFTYRETYDIVLRLSHILSEQYGVRSGDNIAIDSTNKPLFLFLLLASWNI
                     GAIPALLNYNTLGNPLVHSLRISGITQVFVDPQASGPIKSSEKEIKEELPNVRLNYLD
                     ETELLKTLKDPETPKFLQEDDLRSPQGLTDYKPAMFIYTSGTTGLPKSAIMSWRKATV
                     GCTLFAHIEHMDNNSVVFTAMPLFHSTATLLGVCSVWSKGGCVAISNKFSASNFWKEA
                     YLTKATHCQYVGEICRYLLNTPVSKYENMHSVKVAYGNGLRPDIWQKFRHRFHIEVIG
                     EFYAATEAPLATTSYQKGEFGVGACRNYGTGIQWFLSLQQTLVRMDPDDDATIYRNSK
                     GLCEKPAVGESGEMLMRIFYPKKPETSFQGYVGNKKETESKVLRNVFREGDAWFRTGD
                     LLKSDEYGLWYFVDRMGDTFRWKSENVSTTEVEDQIMGSNHDDFAQVVVVGIKVPGYE
                     GRAGFATIKLKNPETPESGRIAVLNRMLTHLNRELPKYAHPVFVKLVDHIEMTDTNKI
                     SKKIYRNQVLPHGANGDETVYWLKDYKEYKQLTDEDWSAIKSQKAKL"
     gene            complement(<289607..>290521)
                     /locus_tag="ZYRO0A03630g"
                     /db_xref="GeneID:8201821"
     mRNA            complement(<289607..>290521)
                     /locus_tag="ZYRO0A03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494483.1"
                     /db_xref="GeneID:8201821"
     CDS             complement(289607..290521)
                     /locus_tag="ZYRO0A03630g"
                     /note="similar to uniprot|P38224 Saccharomyces cerevisiae
                     YBR040W FIG1 Integral membrane protein required for
                     efficient mating may participate in or regulate the low
                     affinity Ca2 influx system which affects intracellular
                     signaling and cell-cell fusion during mating"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494528.1"
                     /db_xref="GeneID:8201821"
                     /db_xref="InterPro:IPR016509"
                     /db_xref="UniProtKB/TrEMBL:C5DPI4"
                     /translation="MILYWKMAWFFLKRMPKVISLVLNLITIFLTVFLLMGCSNLSND
                     STFLVRYKFDRSSPFYNVIQKSFNQSNGTTQMSGLEQVSIASGYMGVCITNIPKDYDK
                     GVKSVCYPRKDLANNPLYNDLSIELFNVPSSDKKSTQKQLPINLNILELAETTSRYVV
                     HPYILMVTVILATLMFLMLIYSTIPALPFKYWVLRATLCVSAFLVLFWGIGAMWTHVG
                     IHACSKLVPSASMGILKIHRGIKAAAMSWVSFAFLLAQLGILWFLYLRDRKNLSEEID
                     KINNTNNNQPPFHNPGDLSDSSTLNYKV"
     gene            complement(<290829..>291734)
                     /locus_tag="ZYRO0A03652g"
                     /db_xref="GeneID:8201822"
     mRNA            complement(<290829..>291734)
                     /locus_tag="ZYRO0A03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494484.1"
                     /db_xref="GeneID:8201822"
     CDS             complement(290829..291734)
                     /locus_tag="ZYRO0A03652g"
                     /note="highly similar to uniprot|P38077 Saccharomyces
                     cerevisiae YBR039W ATP3 Gamma subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494529.1"
                     /db_xref="GeneID:8201822"
                     /db_xref="GOA:C5DPI5"
                     /db_xref="InterPro:IPR000131"
                     /db_xref="InterPro:IPR023632"
                     /db_xref="InterPro:IPR023633"
                     /db_xref="UniProtKB/TrEMBL:C5DPI5"
                     /translation="MLSRVGVNAVRCGAMVPRVPQARNYATLKEVETRLKSIKNIEKI
                     TKTMKIVASTRLSRAEKAKVTAKKFDEADSAFYNNAETKPIEDAETAAKDKELVVAVS
                     SDKGLCGSIHSALAKRVRQHLADSPNAAVAAVGDKMRTQLMRTHPDNVKIGINGIGKE
                     APTFQLSSAIADTLLGLGAQNYPKITIFFNNPVSSLSFEPSTKDVFNPETIESSPSFS
                     KFEIDNDGQVSQDLFEYTLSNKILAALAEGYAAEISARRNAMDNASKNAGDMINRYSI
                     LYNRTRQAVITNELVDIITGASSLD"
     gene            <292801..>295737
                     /locus_tag="ZYRO0A03674g"
                     /db_xref="GeneID:8201823"
     mRNA            <292801..>295737
                     /locus_tag="ZYRO0A03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494485.1"
                     /db_xref="GeneID:8201823"
     CDS             292801..295737
                     /locus_tag="ZYRO0A03674g"
                     /note="some similarities with uniprot|Q7LGR2 Saccharomyces
                     cerevisiae YDR017C KCS1 Inositol hexaphosphate kinase
                     phosphorylates inositol hexakisphosphate (InsP6) to
                     diphosphoinositol polyphosphates required for proper
                     vacuole morphology and involved in salt stress response
                     contains two leucine heptad repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494530.1"
                     /db_xref="GeneID:8201823"
                     /db_xref="GOA:C5DPI6"
                     /db_xref="InterPro:IPR005522"
                     /db_xref="UniProtKB/TrEMBL:C5DPI6"
                     /translation="MNIGDERTSGDCKFIKDEQEHRQEQEQEHEQEQEHEHDREGEQE
                     EDNEPVTSLKDLNISDKKKLSSNVIRGRKASTYLRIFRDDEGLTDNNIHRQIIKQQEL
                     NARQEPQPVPQKPQQEVVVHPQQDKKTKKPTSFYDTNYKFSIKPEGKSSRSQNPLASK
                     PYAVAKYLESAISEPNKQQQQQMQQTDLGLKPVSSATYYPHKSRGSTRSISDEEPGEG
                     TAIPVVPRFQYKGTSVAETEATTLASITHDHVAQSPDGRASGSISEAAVESDEDYYDD
                     NEEDEEEKDSVYPLAVELQPFTNNVGGHTAIFRFSKRAVCKALVNRENRWYENIEVNH
                     KELLQFMPRYIGVLNVRQHFHNKEDFLRELSSSQRHKQEHRAFPSSRCIKLYQQQRQQ
                     LENQDQQHQHQHYDQHQQQQQQQRGQYLPQFQQNNCSRSISCNSSSEMGGLPEVVLSD
                     NRHMVPDSMLSMYPSNLCNSSGTGSFLQSTGGSSGKESSGSTTVNTKLKELVLQEVFA
                     LSPGEHDIIEGHLKKVRRPSSIKKSRSSSQDSSSQSTSRRGSNYSLKNVPNQGSGSPL
                     LKKSIRETISHSLNSPSSMMDLRQFQKKELVREKSQLRRASLSSSKDENNPTISPLSL
                     PRDHPLVEEFAVENEDDTNFSLDGKENHTNTISTTNSDITNNTSSAGSTSNTSHLAKP
                     SQGKHNESITFEEHSDTVVSKFILLEDLTRKLNKPCALDLKMGTRQYGVDAKPSKQHS
                     QRKKCLKTTSKKLGVRICGLKIWNQTYYITRDKYFGRRVQAGWQFTRVLARFIYDGLH
                     ISSVVRQIPRLTKQLDTLGSEIAHLKGYRLYGSSLLLMFDGNDSGNKRCRVKVNLIDF
                     ARCVTKEDLKESYDLFRIPPKNPDVEDRGFLRGVRSLKFYLMLIWNYLTNDAPLCNDD
                     EELQTFLQENVEKFDKPWDWLDEFDEEDEEEFNSPTSPLRKKWRKYELIFNTEPRFTN
                     DGEMSD"
     gene            <296208..>296495
                     /locus_tag="ZYRO0A03696g"
                     /db_xref="GeneID:8201824"
     mRNA            <296208..>296495
                     /locus_tag="ZYRO0A03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494486.1"
                     /db_xref="GeneID:8201824"
     CDS             296208..296495
                     /locus_tag="ZYRO0A03696g"
                     /note="similar to gnl|GLV|CAGL0D04394g Candida glabrata
                     CAGL0D04394g and some similarities with uniprot|Q12248
                     Saccharomyces cerevisiae YDR016C DAD1 Essential protein
                     component of the DASH complex involved in spindle
                     integrity and kinetochore function interacts with Duo1p
                     and Dam1p localizes to intranuclear spindles and
                     kinetochore"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494531.1"
                     /db_xref="GeneID:8201824"
                     /db_xref="GOA:C5DPI7"
                     /db_xref="InterPro:IPR013958"
                     /db_xref="UniProtKB/TrEMBL:C5DPI7"
                     /translation="MNNDTSARDKEENVPVPTLSAADKYFIEQRDLVLQDINNTMDSI
                     LNNLNSLNISLENSIAVGKEFESVAELWKTFYNGLEGTETVSSSQDDELEK"
     gene            complement(<296496..>297086)
                     /locus_tag="ZYRO0A03718g"
                     /db_xref="GeneID:8201825"
     mRNA            complement(<296496..>297086)
                     /locus_tag="ZYRO0A03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494487.1"
                     /db_xref="GeneID:8201825"
     CDS             complement(296496..297086)
                     /locus_tag="ZYRO0A03718g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494532.1"
                     /db_xref="GeneID:8201825"
                     /db_xref="UniProtKB/TrEMBL:C5DPI8"
                     /translation="MRRSVTTYQPAAHTAGLKRASTTSAVSPLSHVEERLGGLELVEA
                     KSDVEEASYEPAQYFSNREDEEFAGIKYTALPGSSGTEQEEANNSSSQNTEVQANCES
                     SFHSNNSTLGDPPSSSSEYEGDLEDGSYTDTLSTSVNDSLPPENVHKPLKDLIFKANK
                     EAYDVDSNKVRIKVGLSKKVPSLHPRRKINGASSLQ"
     gene            <298141..>298905
                     /locus_tag="ZYRO0A03740g"
                     /db_xref="GeneID:8201826"
     mRNA            <298141..>298905
                     /locus_tag="ZYRO0A03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494488.1"
                     /db_xref="GeneID:8201826"
     CDS             298141..298905
                     /locus_tag="ZYRO0A03740g"
                     /note="highly similar to uniprot|P38075 Saccharomyces
                     cerevisiae YBR035C PDX3 Pyridoxine (pyridoxamine)
                     phosphate oxidase has homologs in E. coli and Myxococcus
                     xanthus transcription is under the general control of
                     nitrogen metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494533.1"
                     /db_xref="GeneID:8201826"
                     /db_xref="GOA:C5DPI9"
                     /db_xref="InterPro:IPR000659"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="InterPro:IPR019576"
                     /db_xref="InterPro:IPR019740"
                     /db_xref="UniProtKB/TrEMBL:C5DPI9"
                     /translation="MSIGLLRQFVSRISCSLPKYRPFIKTMADDIERTQTPIIFAPET
                     YQYDKSSLNESQLVKDPIEQFTRWFEEAKSDKSETLPEAITFSSAELPSGRVSSRVLL
                     FKELDHRGFVIYSNWGTSKKARDIQSNPHGAINFFWKDLQRQVRVEGFTEHVNRETSE
                     RYFKVRPRGSKIGAWSSPQSSTIKSRDELDQLTAANTKKFEGQEEIPCPDYWGGVRVV
                     PLEIEFWQGRPSRLHDRFTYRRKSEHEEWEIIRLAP"
     gene            complement(<298936..>300639)
                     /locus_tag="ZYRO0A03762g"
                     /db_xref="GeneID:8201827"
     mRNA            complement(<298936..>300639)
                     /locus_tag="ZYRO0A03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494489.1"
                     /db_xref="GeneID:8201827"
     CDS             complement(298936..300639)
                     /locus_tag="ZYRO0A03762g"
                     /note="weakly similar to uniprot|Q99359 Saccharomyces
                     cerevisiae YDR014W RAD61 Protein of unknown function
                     mutation confers radiation sensitivity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494534.1"
                     /db_xref="GeneID:8201827"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ0"
                     /translation="MKVYGKRSGSLGIYASQNNSSEVELSDYESEPEPILESNERETV
                     IDNSTDDIRPMTSDSKMNPSVDSSLVSSVGSNVSNLKAFDFLDKAQAPKKRRRIYHED
                     HSDDTQDKKDTNVDENPLNRTINDLNTFVSSLKSSDETLLQDTFKKELEKSVEDGTSK
                     NTSGKLTYDRSRTMLMSKDEEEGLEAEDEEPKPTEDGDTKDGDDSQTYHINELKNMGD
                     MLQYQDDLELLLEGTPSRMSRSQFVSHLLNIALAMNGDQEFCRYVNKRQARDMWRRTF
                     HQMDFHDDVLLLIQGFLATKFQLPPNELPKFFNEFIQALYKRNRLPINGLSGNKIAQL
                     NYNDFLHNTQDRTGQEYVLELCVQYPGVILSCAPLVNRIVQTLVASEALPRGIFPVVE
                     KLASSGNTAEDANLLSVVSNKLIDLLPNNCQDDHLIKSLILFTNEETLERNSEVFHTC
                     MKFVLDHLPPLGSTDILILHLGLCLNVISGESGISHLENALWLQAQTFFHKLESNDDD
                     SFLLNMFYLNFAYMTVLLNKRLPTKVKTGLISHLELFAQESQHYNGSISDKIKYVTDK
                     L"
     gene            <300789..>301415
                     /locus_tag="ZYRO0A03784g"
                     /db_xref="GeneID:8202085"
     mRNA            <300789..>301415
                     /locus_tag="ZYRO0A03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494490.1"
                     /db_xref="GeneID:8202085"
     CDS             300789..301415
                     /locus_tag="ZYRO0A03784g"
                     /note="highly similar to uniprot|Q12488 Saccharomyces
                     cerevisiae YDR013W PSF1 Subunit of the GINS complex (Sld5p
                     Psf1p Psf2p Psf3p) which binds to DNA replication origins
                     and facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494535.1"
                     /db_xref="GeneID:8202085"
                     /db_xref="GOA:C5DPJ1"
                     /db_xref="InterPro:IPR005339"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ1"
                     /translation="MYGDLANKLVLEAKRTKQLNGRNNQRYALPMYHEELVQGILREV
                     TQLKRNSEFLKDQQQLALVDDKISKCQYFVTLLCMERNKRCLLAYQKVRSDILNSLAW
                     ENNGLDIMNGLIGAEQDTSDLSHQEQDYLKEYTDLLTELKSGDLADIDLSGSLTPPSD
                     VFIDVRVLKDAGEIQTEYGAFNLIKDSQFFVRQSDVERLIQQGYLQKI"
     gene            <301709..>302737
                     /locus_tag="ZYRO0A03806g"
                     /db_xref="GeneID:8202086"
     mRNA            <301709..>302737
                     /locus_tag="ZYRO0A03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494491.1"
                     /db_xref="GeneID:8202086"
     CDS             301709..302737
                     /locus_tag="ZYRO0A03806g"
                     /note="highly similar to uniprot|P38074 Saccharomyces
                     cerevisiae YBR034C HMT1 Nuclear SAM-dependent mono- and
                     asymmetric arginine dimethylating methyltransferase that
                     modifies hnRNPs including Npl3p and Hrp1p thus
                     facilitating nuclear export of these proteins required for
                     viability of npl3 mutants"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494536.1"
                     /db_xref="GeneID:8202086"
                     /db_xref="GOA:C5DPJ2"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR025799"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ2"
                     /translation="MESATQKSALTQSEQHYFNSYDHYGIHEEMLQDSVRTLSYRNAI
                     AQNKDLFKDKVVLDVGCGTGILSMFAAKYGAKHVIGVDMSSIIEMAQQLVDLNGYGDK
                     ITLLRGKLEDVQLPFPKVDIIVSEWMGYFLLYESMLDTVLYARDHFLVEGGLILPDKC
                     SLHIAGLEDFQYKDEKLSYWQDVYGFDFSPFIPHVMKEPIVDTVESQVVNTTKCELIE
                     FDLNTVQLSDLSFTAKFEVQAKRRDWINGIITWFDVKFPAPPGEKPVTFSTGAHAPYT
                     HWKQSVFYTADDLECEEGDILKGQIICQPNKFHKRDLDIKLTYDFQAKGVDGDRRCKK
                     NTNYYIMH"
     gene            complement(<302873..>303961)
                     /locus_tag="ZYRO0A03828g"
                     /db_xref="GeneID:8202087"
     mRNA            complement(<302873..>303961)
                     /locus_tag="ZYRO0A03828g"
                     /product="60S ribosomal protein L4"
                     /transcript_id="XM_002494492.1"
                     /db_xref="GeneID:8202087"
     CDS             complement(302873..303961)
                     /locus_tag="ZYRO0A03828g"
                     /note="highly similar to uniprot|P49626 Saccharomyces
                     cerevisiae YDR012W RPL4B Protein component of the large
                     (60S) ribosomal subunit, nearly identical to Rpl4A"
                     /codon_start=1
                     /product="60S ribosomal protein L4"
                     /protein_id="XP_002494537.1"
                     /db_xref="GeneID:8202087"
                     /db_xref="GOA:C5DPJ3"
                     /db_xref="InterPro:IPR002136"
                     /db_xref="InterPro:IPR013000"
                     /db_xref="InterPro:IPR023574"
                     /db_xref="InterPro:IPR025755"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ3"
                     /translation="MARPQVSVQSLEGKATSSAVPLPAVFAAPIRADIVHSVFTSVNK
                     NKRQAYSVSPQAGMQHSAESWGTGRAVARIPRVAGGGTHAAGQGAFGNMCRGGRMFAP
                     TKTWRRWNVKVNQNEKRYATASAIAASGVASLVLARGHRVEKIPEIPLVVSNDLESIT
                     RTKEAVSALKSLGAGADLVKVVRSKKLRAGKGKYRNRRWTQRRGPLVVYAQDNGLVKA
                     FRNVPGVETCDVTALNLLQLAPGAHLGRFVIWTEGAFSKLDKVWGSEAVASAKSGYSL
                     PSNIISTTDVTRIINSSEIQSVVRPAGQANQKRTHVLKKNPLRNKQILMRLNPYAKVF
                     ANEKLGSKKAPKASVKPSQLFNETLKHD"
     gene            complement(<304218..>305774)
                     /locus_tag="ZYRO0A03850g"
                     /db_xref="GeneID:8202088"
     mRNA            complement(<304218..>305774)
                     /locus_tag="ZYRO0A03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494493.1"
                     /db_xref="GeneID:8202088"
     CDS             complement(304218..305774)
                     /locus_tag="ZYRO0A03850g"
                     /note="similar to uniprot|P38222 Saccharomyces cerevisiae
                     YBR030W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494538.1"
                     /db_xref="GeneID:8202088"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ4"
                     /translation="MASTISEDLPGVLGFVEDCKGFFPGSKCLVKRSPVGGLGVFAQC
                     DLNEGETLLQLPKSAVFSASNSSISNLLVDSELDGMLALTIAFVYETTVFQERSHWWP
                     YLKSVKIEEAGSLYLPPNYWPDRDMLKGFTLDTLYQGLDPEPDIQQGFQIALELAHRW
                     NKEVGIPIPWKYLDNLEKFVACAYAISSRVFEIDNYHESGLVPIADLFNHHVSTPDVR
                     FVSLYDVCSECGEPGMCRHLVAEALEEEQEQEQEREKKPPSKSGDGLIDMQLIKELES
                     QEEEEVTNPKEKGLVEGVQPDDCVDIVLTQSVPKGQEIFNSYGDYSNALLLARYGFCV
                     ENNPWDVAYLGRDLLKLLKDKRLALRARWWKHLGYPLYNKWCALNKEQDEQEEEDKEE
                     EEEDHDEEEEDDENDEEDDEPYWLTVMCIDCNGEPSSPMRALLNLLAFNDRDWNKLRS
                     IEQDVESTGDKIGLLDKPLSKGARKILLNLVHKRKRPVPQINNAAARIMLESERKILE
                     KAEHYLNSNL"
     gene            <306295..>307626
                     /locus_tag="ZYRO0A03872g"
                     /db_xref="GeneID:8202089"
     mRNA            <306295..>307626
                     /locus_tag="ZYRO0A03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494494.1"
                     /db_xref="GeneID:8202089"
     CDS             306295..307626
                     /locus_tag="ZYRO0A03872g"
                     /note="similar to uniprot|P38221 Saccharomyces cerevisiae
                     YBR029C CDS1 Phosphatidate cytidylyltransferase
                     (CDP-diglyceride synthetase) an enzyme that catalyzes that
                     conversion of CTP phosphate into diphosphate
                     CDP-diaclglyerol a critical step in the synthesis of all
                     major yeast phospholipids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494539.1"
                     /db_xref="GeneID:8202089"
                     /db_xref="GOA:C5DPJ5"
                     /db_xref="InterPro:IPR000374"
                     /db_xref="InterPro:IPR016720"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ5"
                     /translation="MSKKELKRPQSVDKKVNDTAETEPSPTKMPPSQNGVKDGDEKEK
                     KKYNFLVRTLWTFVMIAGFFATLAAGHFWCIILILVCQITTFKECIAVTSASGRKRNL
                     PLIKTLNWYFLFTTIYYLEGKSLFRFFQSYFLEYKFLATVAANHKFICYCLYLQGFVM
                     FVCSLRKGFLKWQFASLCVTHMTLLLVVFQAHLIIKNVINGLFWFLVPCGLVIINDIS
                     AYLCGITFGKTKLIEISPKKTLEGFLGAWFFTAVASLLLTRLLSPYMYLTCPVKDIRT
                     NFFTSVNCELNPVFIPQDYRLPPIIFEKFGISVVTLKPIYFHALNLASFASIFAPFGG
                     FFASGLKRTFQVKDFGHSIPGHGGITDRVDCQFLMGSFSNLYYETFISEHRITVETIL
                     STILMNLSEKQILELINTLNLIFFRKNLVSANNYDDLINIYKSAADAISEN"
     gene            <307915..>309273
                     /locus_tag="ZYRO0A03894g"
                     /db_xref="GeneID:8202090"
     mRNA            <307915..>309273
                     /locus_tag="ZYRO0A03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494495.1"
                     /db_xref="GeneID:8202090"
     CDS             307915..309273
                     /locus_tag="ZYRO0A03894g"
                     /note="similar to uniprot|P38070 Saccharomyces cerevisiae
                     YBR028C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494540.1"
                     /db_xref="GeneID:8202090"
                     /db_xref="GOA:C5DPJ6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ6"
                     /translation="MVFTLDEDIEELCISDDDCEEAPQQLLQPMGAEHVGKHRRKSSV
                     LEKFPVVAPLHSRRLSLSVGEGQGQGVDPRLLADFKPVRVLGKGAYGKVVLVKDERTS
                     KLYAMKQLQKAEIIIENDESQDVSKRVERIFAERTILSQLDHPNVVKLFYTFHDNSRL
                     YLLLQYIPGGELFYHLKERGTLDEDTAAFYAAEISCALKFLHEKGIVYRDLKPENCLL
                     DADGHLVLTDFGLSKKSVDDNNSLSAPEDVSVLHSIIGTPEYCAPEILKGEPYTRNCD
                     WYSLGCLVYDMLVGKPPYTGVNHKVILNKIQKEKQGPRLPYYLSDGMKDWLGALLKKD
                     CNKRWDVDRYWAAQPQAQQAQQQRRRKKKAGQERTSPYTSHFVFRKINWAKIQDGPLQ
                     KSEQGPIVPIITDLELAENFDEEFTSLPFEENPQGRDIPKSDIFKGFSYKASGSYLEK
                     YF"
     gene            <309456..>310571
                     /locus_tag="ZYRO0A03916g"
                     /db_xref="GeneID:8202091"
     mRNA            <309456..>310571
                     /locus_tag="ZYRO0A03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494496.1"
                     /db_xref="GeneID:8202091"
     CDS             309456..310571
                     /locus_tag="ZYRO0A03916g"
                     /note="similar to uniprot|P38071 Saccharomyces cerevisiae
                     YBR026C ETR1 2-enoyl thioester reductase member of the
                     medium chain dehydrogenase/reductase family localized to
                     in mitochondria where it has a probable role in fatty acid
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494541.1"
                     /db_xref="GeneID:8202091"
                     /db_xref="GOA:C5DPJ7"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ7"
                     /translation="MQAFKRFASSVPSQFRSVIYSSHSLEDVTSVLSVHRYTPKESLE
                     NSVVVRTLAFPINPSDVNQLQGVYPSKPEKTLDYGTKDPAAIAGNEGVFEVLSVPSNE
                     NSLKAGDWVIPLYANQGTWSDHRVFKNASDLIKVNGLDLHTAATIGVNGVTAYQLVHD
                     YIKWTPGGNEWLIQNAGTSGVSKIVTQVAKAAGINTLSVIRDRDNFDQVAKKLENQLG
                     ATKVISESQNNDKLFGKQVLPTILGSNARVRLALNSVGGKSSAAIARKLEKDALMLTY
                     GGMSKQPVTLPTSLHIFKGLTSKGFWVTENCRREPNKKLDAVNALVKLYKEGKLISPK
                     DEIVTTDVNANGSDQDLLEAVKKGISASGKQLVVFKW"
     gene            complement(<310593..>311747)
                     /locus_tag="ZYRO0A03938g"
                     /db_xref="GeneID:8202092"
     mRNA            complement(<310593..>311747)
                     /locus_tag="ZYRO0A03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494497.1"
                     /db_xref="GeneID:8202092"
     CDS             complement(310593..311747)
                     /locus_tag="ZYRO0A03938g"
                     /note="similar to gnl|GLV|CAGL0I04774g Candida glabrata
                     CAGL0I04774g and some similarites with YBR036C
                     uniprot|P35206 Saccharomyces cerevisiae YBR036C CSG2
                     Endoplasmic reticulum membrane protein required for
                     mannosylation of inositolphosphorylceramide and for growth
                     at high calcium concentrations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494542.1"
                     /db_xref="GeneID:8202092"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ8"
                     /translation="MDTRIYWFVAVFSYIIQTKCLSLLQSSARDSERPGIDHQGVAIF
                     LLFMYFVPWLLLVPSARLVSIASSMTVSRPGTPELRARGERNGIMDGENNNNSNNGRS
                     YDSYDNGVKNNDIIGKVSYVVKLVILSLLLLVPVLTYMNALSLTPAFDVGLIQNTSIF
                     EITSLLYGVCGLSRRKNVFRNFIVMMIALMGIVLVSYTKATCDLLAGKFSINQKTGEL
                     EDPFLFDRLKSCLLCGLGALTLGPFTVLWNRWFNFSDRITLSHQCQHLTYIASICMAV
                     LLPFLPRALSTLAKVPTNKVFWLEALAAFLFGTLPHVFSLSLIQRQTPPSYSTTINLG
                     AIIFMGISDWICEPTQTTIVRWEVIGYIMLSVACVVLSIAYYEKKHLSLH"
     gene            <312935..>314116
                     /locus_tag="ZYRO0A03960g"
                     /db_xref="GeneID:8202093"
     mRNA            <312935..>314116
                     /locus_tag="ZYRO0A03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494498.1"
                     /db_xref="GeneID:8202093"
     CDS             312935..314116
                     /locus_tag="ZYRO0A03960g"
                     /note="highly similar to uniprot|P38219 Saccharomyces
                     cerevisiae YBR025C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494543.1"
                     /db_xref="GeneID:8202093"
                     /db_xref="GOA:C5DPJ9"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPJ9"
                     /translation="MPPKKKVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQSITRSP
                     LGNPANYPFATIEPEEARVIVPSPRFDNLCEIYKPASQVPAHLTVYDIAGLTKGASAG
                     EGLGNAFLSHIRAVDSIYQVVRCFDDAEIVHIEGDVDPIRDLQIINEELRLKDIEFAQ
                     KALENAHKIARRGGQSLEVKQKKEETVLIERIIKLLEDGQRVANQEWTPKEVESINSM
                     FLLTAKPCIYLINLSEKDYIRKKNKHLLRIKEWVDKYSPGDMIIPFSVCMEEKLSTMS
                     PEEQEEELKKIGTQSALPKIITSMRQKLDLISFFTSGPDEVREWTIREGTKAPQAAGV
                     IHNDLMNTFILAQIMKYSDMVEYKDENAIKSAGKLLQKGKDYVVEDGDIIYFRSAAGK
                     N"
     gene            complement(<314234..>315136)
                     /locus_tag="ZYRO0A03982g"
                     /db_xref="GeneID:8202094"
     mRNA            complement(<314234..>315136)
                     /locus_tag="ZYRO0A03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494499.1"
                     /db_xref="GeneID:8202094"
     CDS             complement(314234..315136)
                     /locus_tag="ZYRO0A03982g"
                     /note="similar to uniprot|P23833 Saccharomyces cerevisiae
                     YBR037C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494544.1"
                     /db_xref="GeneID:8202094"
                     /db_xref="GOA:C5DPK0"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:C5DPK0"
                     /translation="MSLLKSSSLVPRLLKLAPKQAGLIRPNYRCFSQFTKLYNERVPP
                     SQSPPLKKKPLSRIPIGGSETAPQTTSDGSIEFSTWKAASLFLIVGGGLYYYFTKEKR
                     RLEIEKEAEANRGYGKPMVGGPFHLKDCEGNVFSDKDLLGKFSIIYFGFTHCPDICPD
                     ELDKLGVWLDKLKSKYGSKVQPIFVTCDPNRDTPEVLTQYLQDFHPDIIGLTGTYDQV
                     KNACKQYRVYFSTPPQVQPGQDYLVDHSIFFYLMDPEGNFIEAMGRNYDNETGAERIQ
                     EHIKTFIPKEEREKRKQKWYSFLF"
     gene            <316200..>319076
                     /locus_tag="ZYRO0A04004g"
                     /db_xref="GeneID:8202016"
     mRNA            <316200..>319076
                     /locus_tag="ZYRO0A04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494500.1"
                     /db_xref="GeneID:8202016"
     CDS             316200..319076
                     /locus_tag="ZYRO0A04004g"
                     /note="highly similar to uniprot|P14180 Saccharomyces
                     cerevisiae YBR038W CHS2 Chitin synthase II requires
                     activation from zymogenic form in order to catalyze the
                     transfer of N-acetylglucosamine (GlcNAc) to chitin
                     required for the synthesis of chitin in the primary septum
                     during cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494545.1"
                     /db_xref="GeneID:8202016"
                     /db_xref="GOA:C5DPK1"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DPK1"
                     /translation="MTRNPFMVEPSSGSPVRPLQPQLTRFHTNTSDRTDLYNYPSPTR
                     GGNDYYESEDDFDVSKKFQGLPPSPSRAAVRYSPDRRRRSQFYRDSTTSSPLVDRFTA
                     NMQASPKKPSHTVVPVSEYDGTTEDFTSSYYSHENRQASHLSAPRNNLFGSQLGRQYS
                     ASTTSTAAMSTATDEKLFRNSYESYDDDRSTITSSNFAETQFELNHPVRKDYVRRANS
                     ESKRRPIVEDMGKAKAILKLDNPIPRGLLDTLPRRDSPEFTEMRYTACTVDADEYCQE
                     GYSLRFAEMNRECQMVICVTMYNEDKFALARTIHSIMRNVAHLCSRQRSQVWGPDGWK
                     KISVILVSDGRTKVNQGALDYLAALGVYQEDMAKESVNGDAVKAHIFELTTQVSIDSN
                     LDYVSKDIVPVQMVFCLKEENKKKINSHRWLFSAFCPVLQPSVVTLIDVGTRLNDTAI
                     YHLWKVFDMDSNVAGAAGQIKTMKGKYGLKLFNPLVSSQNFEYKVSNILDKPLESVFG
                     YIAVLPGALSSYRYRALENHEDGTGPLNSYFLGETQEGRDQDVFTANMYLAEDRILCW
                     ELVAKRNSKWVLKYVKEAQGETDVPEEIPEFISQRRRWLNGAMFAALYSQLHFHQIWR
                     TKHSFLRKLFLHIEFFYQFVQMLFSWFAIANFVLTFYYLAGSMNNILKHGNALFIFFK
                     YLIYCDLASLFIISMGNRPHGAKHLFILSMIILTICALYALICGFVFAIRTLKEKDNS
                     NNVFVNVVVSLLSTYGLYVISAFLYLDPWHIFTSSLQYFVTLPAFTCTLQIFSFCNTH
                     DVSWGTKGSSSNNKPLSKAIVMQGPDGKQIVETDWPQEVDKKFIEIKSRLKEVEFEEP
                     VIDEAQKRNDYYRDIRTRIVMAWMLSNLIFVMTITQIYSAEHTNNGYLVFILWSVAAL
                     AAFRALGSFGFLFMKYLRMIVKYKHKAQSTGSWNVRKADVDNKS"
     gene            complement(<319151..>320569)
                     /locus_tag="ZYRO0A04026g"
                     /db_xref="GeneID:8202017"
     mRNA            complement(<319151..>320569)
                     /locus_tag="ZYRO0A04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494501.1"
                     /db_xref="GeneID:8202017"
     CDS             complement(319151..320569)
                     /locus_tag="ZYRO0A04026g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494546.1"
                     /db_xref="GeneID:8202017"
                     /db_xref="GOA:C5DPK2"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:C5DPK2"
                     /translation="MASLRSKFLLPCRALSLSMTSSTTTTTAARTTATLNIPAVAPLR
                     INSGRLNDTILETGNQFGAALRWAPEPHGFGLRRLAGTEVDGKVRDWFVNECKALGCT
                     IKVDKIGNIFALYKGQDQTGKPPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKEN
                     GYVPHYDVCVVVWFNEEGARFARSCTGSSVWSHDLSLQEAYQMMSIGEDKPESVFDSL
                     NKIGYLGGTPASYKENAIDAHFELHIEQGPILENESKKIGIVTSVQGYQWSKCTVKGV
                     GAHAGTTPWNLRKDALLASAKIITRASEISQSHQALFTCGVIDVKPYSVNILPGEASF
                     TLDVRHPDDAVVQNVVKEIRKEIERVLNDNVAGPLSYDWEILQLSPAVKFNETCIECV
                     SRSAYAQFKENEVRPISSGAGHDSCQTAPHVPTSMIFIPSKDGLSHNFYEHSSPEEVE
                     NGFKVLLQAIVNYDNYRFSRGH"
     gene            <321351..>324878
                     /locus_tag="ZYRO0A04048g"
                     /db_xref="GeneID:8202018"
     mRNA            <321351..>324878
                     /locus_tag="ZYRO0A04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494502.1"
                     /db_xref="GeneID:8202018"
     CDS             321351..324878
                     /locus_tag="ZYRO0A04048g"
                     /note="similar to uniprot|P29465 Saccharomyces cerevisiae
                     YBR023C CHS3 Chitin synthase III catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin required for
                     synthesis of the majority of cell wall chitin the chitin
                     ring during bud emergence and spore wall chitosan"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494547.1"
                     /db_xref="GeneID:8202018"
                     /db_xref="GOA:C5DPK3"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DPK3"
                     /translation="MNNYGAEDEYYVNFNQDQESLLRSRLGSHRSGSTKRAGSLVRPE
                     RNRFNNPDNPHYYYVQKAQEQKDHLDIQPSTTGVLPTPGLRRTAESSGSLNSSVNLPS
                     SRSRRNLSEVQEDFPMRDMSGKGTRDGNSNSGPNDLHNEDLMELEHEDYLSEENPVLK
                     APKPAAPDLRNKKSKPLSPWMIYCYVVTFWAPAPLLSLFGMPKKERQMAWREKMGLLS
                     VICYVGVFVAYLTFGFTKTVCSSSKLRLRNNYVDPGYMIMNGKAFSLDSSSHPAAAGI
                     DAGANVLYPPINGSGKDASFLFQNVNGNCHDLIKPRENCTIPHDDDNNLAWYFPCALF
                     SQDGSTKPNFTKPRYYDGWACHTSKAARDAYYSLESSADVYFTWDDIRNSSRNLVVYN
                     GHVLDLNLLDWLERDQVTYPPMFDDMRHSNLQGYDLSIILATSHEKKVARCLTEIIKV
                     GEVDSKTVGCLASDVVLYSSLVFILSVVILKFLVSCYFSWVVARKQGAYAVDNKTMNR
                     QLNNIEDWSENLYSQGPMKKVAPELRPGHRNNPSRQSKFDIFKKRGTRSFGVNEITNE
                     MDNDDDYLFADGSYKGMTTMTTQNANKLQNGNQSSSGSGASKFHVRNQSAMFSSNSMM
                     LGGPSAAPVPVPSSIESLDTSIIHPDCVQQPPLNHMPFGYPLIHTMCFVTCYSEDEQG
                     LRTTLDSLSTTDYPNSHKLIMVVCDGLIKGSGNDQTTPEIVLGMMDNFVVPPEDVQPH
                     SYVAVASGSKRHNMAKIYAGFYKYNDETVPPENQQQVPMITVVKCGTPDEQGSAKPGN
                     RGKRDSQIILMSFLQKMTFDDRMTELEFQLLKNIWQITGLMADYYETVIMVDADTKVF
                     PDCLTHMIAEMVKDPLVMGLCGETKIANKAQSWVTMIQVFEYYISHHQAKAFESVFGS
                     VTCLPGCFSIYRIKSPKGPDGYWVPILANPDIVERYCDNVTDTLHKKNLLLLGEDRFL
                     SSLMLRTFPKRKQIFVPKAACKTVAPDEFKVLLSQRRRWINSTVHNLFELVLIRDLCG
                     TFCFSMQFVIFIELIGTLVLPLAICFTIYVVIFACVSKPTPIITLVLLAIILGLPALI
                     VVVTATRWSYLGWMFIYLLALPIWNFVLPSYAYWKFDDFSWGDTRTIAGGNGKGGHDE
                     NEGEFDHSKIKMRTWREFEREERIARAEK"
     gene            complement(<325007..>325552)
                     /locus_tag="ZYRO0A04070g"
                     /db_xref="GeneID:8202019"
     mRNA            complement(<325007..>325552)
                     /locus_tag="ZYRO0A04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494503.1"
                     /db_xref="GeneID:8202019"
     CDS             complement(325007..325552)
                     /locus_tag="ZYRO0A04070g"
                     /note="similar to uniprot|P38218 Saccharomyces cerevisiae
                     YBR022W POA1 Phosphatase that is highly specific for
                     ADP-ribose 1''-phosphate a tRNA splicing metabolite may
                     have a role in regulation of tRNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494548.1"
                     /db_xref="GeneID:8202019"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="UniProtKB/TrEMBL:C5DPK4"
                     /translation="MSNITYTVGNILPVTGYPRILIHSCNCGGSWGGGIAYQLAARYP
                     KAEQVYVDACDKYGNELLGKCLFIPSYKDDDLIICCLFTSAFGGASHDYKRSILNYTE
                     QGLKNVRTWVYEGGNAIQDPIEKDINSVLHKLDKPLKDYKLEMPKINSGIFGVPWGET
                     ENVLKEFGSGNQILNFTVYSL"
     gene            complement(<325870..>327897)
                     /locus_tag="ZYRO0A04092g"
                     /db_xref="GeneID:8202020"
     mRNA            complement(<325870..>327897)
                     /locus_tag="ZYRO0A04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494504.1"
                     /db_xref="GeneID:8202020"
     CDS             complement(325870..327897)
                     /locus_tag="ZYRO0A04092g"
                     /note="similar to uniprot|P05316 YBR021W Saccharomyces
                     cerevisiae FUR4 Uracil permease localized to the plasma
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494549.1"
                     /db_xref="GeneID:8202020"
                     /db_xref="GOA:C5DPK5"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="UniProtKB/TrEMBL:C5DPK5"
                     /translation="MRLKFFGKRKQEANDYNEEDRQHGIQQVRSPPHDDLAIMFSRQS
                     HVPPVSSRQAEFENVNSSSDKNYVDGDGDGGSSSIDHKDKIAVKEDEAYEGTTGVVED
                     VWEPEIEPQGKWQKFYYNWLVVDKSTIGIPFSRSFLNNSDLKPVESKRRIWGWHNFFY
                     YWLADCFNINTWQVASSGMQIGLNWWQCWISIWIGYLCTGIFVVLASRFGAAYHVCFP
                     VSVRASFGVYFSAWPIVNRIVMAIVWYAVQAWLGGTLVSLLLRSIFGNDLNTKIPNHF
                     GSDNATTFEFMSFFIFWVVSIPFLLIPPHKLKYLFAVKAALVPFAAFGFLIWAVVKSH
                     GHLAMGNLSEYHPHGSAFSWVFIRSLINCLANFATLIVNAPDFARFSTTPNSSSLIQL
                     VSIPFLFSLTCLIGILVTAAGYKLYGINYWSPIDVLGKFLDSSYSSGTRAGVFLIVFV
                     FIIAQLGTNISANSLSCGTDMTSILPRFINIKRGSLFCAAIALCICPWNMMASSSKFT
                     MALSAYAIFLSSIAGVVCCDYFLVRRGYIKLMHLYSNQKGSFYMYGNRWGINWRALVA
                     YFLSIAPNLPGFIGTVGAPQVTVGVGALRIYYLNYWVGYVIAFLVYGVLCYIWPVPGT
                     PVKNFLREKGWYQYWADVEDFEHEWRLTMMKKDLLDDKVDLAEVDPEKIFY"
     gene            complement(<328582..>333138)
                     /locus_tag="ZYRO0A04114g"
                     /db_xref="GeneID:8202021"
     mRNA            complement(<328582..>333138)
                     /locus_tag="ZYRO0A04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494505.1"
                     /db_xref="GeneID:8202021"
     CDS             complement(328582..333138)
                     /locus_tag="ZYRO0A04114g"
                     /note="similar to uniprot|P32568 Saccharomyces cerevisiae
                     YDR011W SNQ2 ABC transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494550.1"
                     /db_xref="GeneID:8202021"
                     /db_xref="GOA:C5DPK6"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:C5DPK6"
                     /translation="MKKGNVLETGSSSPIDSNSPISYDGGSLVGVGHTEGNTGANTSG
                     FSRGDIERGANDDVELHEMLAKYKSNGQGSTFTPELASKVESLARTLSKRKSADGKFD
                     LSSVDDEDGFDAEKILRHFVKNASSQGIDFRKTGITMEDVSATGLDNSFLEGSTFADI
                     ALLPYTIFKFLKGVRHRRMRKIIRNVNAFALPGEMVLVLGRPGSGCSSFLKTAAGVTD
                     QFAGGVEGDIMYDGVPQDTMMKHYRSDVIYNGELDVHFPYLTVKQTLDFAIACKTPAI
                     RVNNVSRSEYIRETRDLYATIFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEALAARG
                     TFYCWDNATRGLDASTALEYAMAIRIMTNLLNSTAFVTIYQASENIYETFDKVTVLHS
                     GRQIYYGSARDAKAYFEKMGYLCPPRQATAEFLTSLTDPNGFHVVREGYENKVPRTAE
                     DLENYWLNSEECANLKKAIQEYKASVDPEATKQFFAETMKAEKSKYARDKSYYTVSFP
                     EQIRLCTVRGFQNVYGNKAYTVINIAAAVIQAFITGSAFYNSPASTAGAFSRGGVLYF
                     ALLYYSLMGLANISFDHRPILQKHKTYSLYHPAAEALGSTFSGAPFRMIGLTLFIIIL
                     YFLAGLNRTAASFFRVYWFLAMCSEAIYALFDLIASACDDISQANSIAGLVMFAISMY
                     STYMIQLPNMHPWFKWISYVLPIRYAFEGMLESEFHGRHMACGKGSLVPSGPGYENVP
                     DSERVCAFIGSKKGRSWVLGDDYLNVQYQYIYWHLWRNIGIMFAFLIGYNVFKAIITE
                     IKRPVKGGGDALIFKKGTRNATAKKNNRPDDLESMDQMNVQDVKDKYSSGSDITPNND
                     QEIEQSFKDFASKGIFIWKNICYVIPYKGGERTLLDNVTGYVAPGTMTALMGESGAGK
                     TTLLNTLAKRVNVGVVTGDMLINGKPVDSSFERRTGYVQQQDIHIAEMTVRESLIFSA
                     RLRRPQSIPDAEKVADAETVMKLLDMEEYADALVGGLGAGLNVEQRKKLSIGVELVSK
                     PDLLLFLDEPTSGLDSQSSWAIVQLLKRISRAGQSILCTIHQPSATLFEQFDRLLLLK
                     KGGQTVYFGDIGENSSIVLDYFERNGARHCEEKENPAEYILEAIGAGATATVKDDWHE
                     IWQKSDEYGATEQKASEWIEKLANQECTNEEIGSAPTKYATDYFYQFKYVWLRTNLMF
                     WRDVPYIFSKCMLQVTAGLFIGWTFFNPGKSYVGLQDTMFAAFISVIVAAPSMNQIQA
                     RAISSRELFEVRESKSNMFHWSLLLITQYMAEIPYHILFSTFFFCASYFPLRVWFEAS
                     RSAVFFLNYCIMFQLYYVGLGLTILYMSPNLPSANVIMGLILSMMIQFCGVTQPVSLM
                     PGFWTFMWKVSPFTYFIQNLVAIVLHKKPVVCKKKELNYFDPPQGKTCGEYMNGFMKQ
                     AQGYIANPDATSNCAYCQVSVGDDYMAQRGVYYGNLWRNFGFYWVYIVFNMFAMVGIY
                     YIFSVRGVSIFNPFAVIKRIIKRK"
     gene            complement(<333829..>335379)
                     /locus_tag="ZYRO0A04136g"
                     /db_xref="GeneID:8202022"
     mRNA            complement(<333829..>335379)
                     /locus_tag="ZYRO0A04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494506.1"
                     /db_xref="GeneID:8202022"
     CDS             complement(333829..335379)
                     /locus_tag="ZYRO0A04136g"
                     /note="similar to uniprot|P13045 Saccharomyces cerevisiae
                     YDR009W GAL3 Transcriptional regulator involved in
                     activation of the GAL genes in response to galactose forms
                     a complex with Gal80p and Gal4p to relieve inhibition by
                     Gal80p binds galactose and ATP but does not have
                     galactokinase activity and similar to YBR020W
                     uniprot|P04385 Saccharomyces cerevisiae YBR020W GAL1
                     Galactokinase phosphorylates alpha-D-galactose to
                     alpha-D-galactose-1- phosphate in the first step of
                     galactose catabolism expression regulated by Gal4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494551.1"
                     /db_xref="GeneID:8202022"
                     /db_xref="GOA:C5DPK7"
                     /db_xref="InterPro:IPR000705"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR019539"
                     /db_xref="InterPro:IPR019741"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DPK7"
                     /translation="MYLCNNLTSIPLAMSVPTYSLDRCNEITRRFFETFGEDADFVSR
                     SPGRVNIIGEHIDYCNFSVLPMAIDVEMLLAVRVVRGSTSITLANADPKFAPRCFDIP
                     LEESIGIDPALSDWSNYFKCGLLVAQNFCQETGQPMRDVGMQVFCQGSVPTGGGLSSS
                     AAFICATALATIRAVKGSQCEISKQDLTRITADAEHYLGVNNGGMDQCASVCGEKDHA
                     LYVEFKPVLKATPFPLPASVRFIIANTLVVSNKFETAPTNYNLRVVECTIAASVLAHT
                     HGVSLPGEKTPGNLRQVIYTLCERREGTESTAVEINESDKIDKEIQKLQYALRLVEET
                     LGPKSKGYTMSEASAALDMTPEEFTREYLTSFPVRFHLLQLYLRAKHVYLEALRVLQC
                     LRLMTSVHGTSTDTQQFLRDFGTLMNASQASCRDNYGCSCEGTEQICRIALNNGSLGS
                     RLTGAGWGGCTISLCPDEQSVTDIKRALIKQYYNERFPHMPPSELEAAIIVSKPVAGS
                     ALYEHLQM"
     gene            <335965..>337977
                     /locus_tag="ZYRO0A04158g"
                     /db_xref="GeneID:8202023"
     mRNA            <335965..>337977
                     /locus_tag="ZYRO0A04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494507.1"
                     /db_xref="GeneID:8202023"
     CDS             335965..337977
                     /locus_tag="ZYRO0A04158g"
                     /note="similar to uniprot|P04397 Saccharomyces cerevisiae
                     YBR019C GAL10 UDP-glucose-4-epimerase catalyzes the
                     interconversion of UDP-galactose and UDP-D-glucose in
                     galactose metabolism also catalyzes the conversion of
                     alpha-D-glucose or alpha-D-galactose to their
                     beta-anomers"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494552.1"
                     /db_xref="GeneID:8202023"
                     /db_xref="GOA:C5DPK8"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018052"
                     /db_xref="InterPro:IPR025308"
                     /db_xref="UniProtKB/TrEMBL:C5DPK8"
                     /translation="MVSKVLVTGGAGYIGSHAVVELLANGYECVVVDNLSNSSYESLA
                     RVQVLAKKYVPFYKVDLIDLEALTKVFEEHSDIESVIHFAGLKAVGESSQIPLQYYQN
                     NVSGTLVLLQLMQKYRVKEFVFSSSATVYGDYTRYPGIIQVPETCPLQPTNPYGHTKF
                     TIENILRDVSASGGWKFAILRYFNPIGAHPSGLIGEDPLGIPNNLLPYMAQVAVGRRE
                     KLSVFGNDYDTRDGTPIRDYIHVVDLAKGHVAALKYLQDQENDICEEWNLGSGKGSSV
                     LEMYDAFTRSCGIKISKEIVGRRNGDVPLLVAKPTKAELELNWKTELGVKESCEDLWR
                     WVTKNPFGYSQHGVIGTTVHKGDYDNRLVTLGHGSRFQLIISNRGASIIDLLVDGQSI
                     VLGPGDPGDYSGATIGRYANRIVGGKYDLDGKVHQLTTNDNGNTNHSSVGCYSEKHFL
                     GPLVKTPSKGVFIAEYVLLDEQPRDFQSDLQVSVIYTLDVQAKALDIQYQAVLTKGES
                     TPINLTNHTYFNLNKVNADTVQGTEIRLATNKAVGLDGTLHQVDVSTFNDKEEEVTIL
                     DSVEPRIDHCFVVAESTSLDSTKGKLRPVLRASHPESHISLEVLTTEPSFQLYTGDGL
                     TGFTPRSGFAVEPARYVNAINDERWKKTVTLSQGDAYRSRIVYRFT"
     gene            <338303..>339406
                     /locus_tag="ZYRO0A04180g"
                     /db_xref="GeneID:8202024"
     mRNA            <338303..>339406
                     /locus_tag="ZYRO0A04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494508.1"
                     /db_xref="GeneID:8202024"
     CDS             338303..339406
                     /locus_tag="ZYRO0A04180g"
                     /note="highly similar to uniprot|P08431 Saccharomyces
                     cerevisiae YBR018C GAL7 Galactose-1-phosphate uridyl
                     transferase synthesizes glucose-1-phosphate and
                     UDP-galactose from UDP-D-glucose and
                     alpha-D-galactose-1-phosphate in the second step of
                     galactose catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494553.1"
                     /db_xref="GeneID:8202024"
                     /db_xref="GOA:C5DPK9"
                     /db_xref="InterPro:IPR001937"
                     /db_xref="InterPro:IPR005849"
                     /db_xref="InterPro:IPR005850"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019779"
                     /db_xref="UniProtKB/TrEMBL:C5DPK9"
                     /translation="MTAAFILEDHSHRRYNPLKGTWVLVSPHRAKRPWLGQKEVASKP
                     DNPPYDPECYLCPGNSRATGATNPQYDSTFIFVNDFSAVKLDQPHDIGERAGEESLKQ
                     RLFKTESVRGVCFVICFSPQHNLTIPQMPLNEVVKIVEAWNELYQTVSFEAAQQGKPF
                     KYLQIFENKGTAMGCSNLHPHGQAWCLESVPTEVLEELKSIKNYREENHSHLLGDCVE
                     LELEEKARIVLENDSFIVIVPYWAVWPFETMVVSKSKVASIDKFNEMQRRDLSSILLE
                     LTKKYDNLFQTSFPYSMGIHQAPLNAQGDDLENSWFHMHFYPPLLRSATVRKFLVGFE
                     LLGEPQRDLTAEQAAQRLRDVDGTVHYLERNDV"
     gene            341110..341191
                     /locus_tag="ZYRO0A04202r"
                     /db_xref="GeneID:8202025"
     tRNA            341110..341191
                     /locus_tag="ZYRO0A04202r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=83.48"
                     /db_xref="GeneID:8202025"
     gene            <341547..>342860
                     /locus_tag="ZYRO0A04224g"
                     /db_xref="GeneID:8201934"
     mRNA            <341547..>342860
                     /locus_tag="ZYRO0A04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494509.1"
                     /db_xref="GeneID:8201934"
     CDS             341547..342860
                     /locus_tag="ZYRO0A04224g"
                     /note="highly similar to uniprot|P40327 Saccharomyces
                     cerevisiae YDL007W RPT2 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates required for
                     normal peptide hydrolysis by the core 20S particle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494554.1"
                     /db_xref="GeneID:8201934"
                     /db_xref="GOA:C5DPL0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPL0"
                     /translation="MGQGLSSGQDKKKKRSNKEKPKYEPPVQPRFGRKKRRGGPATAE
                     KLPNIYPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPFEKKQEEEKKQLEEIRGN
                     PLSVGTLEEIIDDDHAIVTSPTMPDYYVSILSFADKELLEPGCSVLLHHKTMSIVGVL
                     QDDADPMIAAMKIDKSPTENYSDIGGLESQIQEIKEAVELPLTHPELYEEMGIRPPKG
                     VILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAEHSP
                     SIVFIDEIDAIGTKRYESNSGGEREVQRTMLELLNQLDGFDDRGDIKVVMATNRIETL
                     DPALIRPGRIDRKILFENPDMNTKKRILGIHTAKMNLSEDVRLDELVTSKDDLSGADI
                     QAMCTEAGLLALRERRMQVTAEDFKQAKERVMKNKVEENLEGLYL"
     gene            <343452..>344297
                     /locus_tag="ZYRO0A04246g"
                     /db_xref="GeneID:8201935"
     mRNA            <343452..>344297
                     /locus_tag="ZYRO0A04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494510.1"
                     /db_xref="GeneID:8201935"
     CDS             343452..344297
                     /locus_tag="ZYRO0A04246g"
                     /note="highly similar to uniprot|P35182 Saccharomyces
                     cerevisiae YDL006W PTC1 Type 2C protein phosphatase (PP2C)
                     inactivates the osmosensing MAPK cascade by
                     dephosphorylating Hog1p mutation delays mitochondrial
                     inheritance deletion reveals defects in precursor tRNA
                     splicing sporulation and cell separation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494555.1"
                     /db_xref="GeneID:8201935"
                     /db_xref="GOA:C5DPL1"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:C5DPL1"
                     /translation="MGVSEEDISGTPTEYQLTYQVGVAENKNAKFRKTMEDVHTYVKN
                     FASRLDWGYFAVFDGHAGSQASKWCGSHLHHVVEQKLLEDETRDVREVLNESFVSVDR
                     QINTKLSGNSGCTAAVCILRWEVPDDVDNQTADFSQHTRKLYTANVGDSRIVLFRKGR
                     SVRLTYDHKASDILEMQRIEKSGGLIMKSRVNGMLAVTRSFGDKFFDGLVVGNPFTTS
                     VELTRDDEFLIVACDGLWDVIDDQDACELIRDIKEPNEAAKTLVRYALENGTTDNVTA
                     MVVYL"
     gene            complement(<344524..>345495)
                     /locus_tag="ZYRO0A04268g"
                     /db_xref="GeneID:8201936"
     mRNA            complement(<344524..>345495)
                     /locus_tag="ZYRO0A04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494511.1"
                     /db_xref="GeneID:8201936"
     CDS             complement(344524..345495)
                     /locus_tag="ZYRO0A04268g"
                     /note="weakly similar to uniprot|Q12124 Saccharomyces
                     cerevisiae YDL005C MED2 RNA Polymerase II transcriptional
                     regulation mediator Stoichiometric member of mediator
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494556.1"
                     /db_xref="GeneID:8201936"
                     /db_xref="InterPro:IPR021017"
                     /db_xref="UniProtKB/TrEMBL:C5DPL2"
                     /translation="MASKSPEIIPQSPPQNGRLHENKLTQCFDDIMRVAVEMMLHQQL
                     KTVQLDSSVVNGFSHNQQRMLSEKIHIFHAILDDMETTLGKSKDYVEAIYELGREKEL
                     QKEREREELRRRQEEEERKSKEQEELRRHQEMELKAQQEKEQQQQEQQEQQKQQKQDN
                     DVEPDLKMKFSMDTPSGLLADFPGASGDMNETGAIPKNSDDKPVSPRQYSTKIKQEQG
                     LPQGDLGDLGGMDISMFPNMDTGFDMGSMGGEPDPNKQGGSNDPTAGLPESENANDVA
                     GTLGDPGNNGVVDNSDDYLTLNDFNDLNIDWSATGDPGDLDLNGFNI"
     gene            complement(<345802..>346446)
                     /locus_tag="ZYRO0A04290g"
                     /db_xref="GeneID:8201937"
     mRNA            complement(<345802..>346446)
                     /locus_tag="ZYRO0A04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494512.1"
                     /db_xref="GeneID:8201937"
     CDS             complement(345802..346446)
                     /locus_tag="ZYRO0A04290g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494557.1"
                     /db_xref="GeneID:8201937"
                     /db_xref="UniProtKB/TrEMBL:C5DPL3"
                     /translation="MQEVLFKEHQYIQRGKSLKRYISKLRNVLKNNRLAGKAKKDLEV
                     RSQKKEKPKRNSLSSKRKRSLTSANNTNNITPTRKETQSAKKQDSPKWKRQKRTSRDR
                     GRTSSKKRRDPHGNCDLLASEQSENPHNHADSPLSRRSKNSKSYNRRKHSKEAKNLTL
                     DDIQEHPMLQQELVANINGSYIQFHLVSVDPKLLLQGPPVITTEPMPSLIWPYD"
     gene            <347213..>347692
                     /locus_tag="ZYRO0A04312g"
                     /db_xref="GeneID:8201938"
     mRNA            <347213..>347692
                     /locus_tag="ZYRO0A04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494513.1"
                     /db_xref="GeneID:8201938"
     CDS             347213..347692
                     /locus_tag="ZYRO0A04312g"
                     /note="highly similar to gnl|GLV|KLLA0F14773g
                     Kluyveromyces lactis KLLA0F14773g and similar to YDL004W
                     uniprot|Q12165 Saccharomyces cerevisiae YDL004W ATP16
                     Delta subunit of the central stalk of mitochondrial F1F0
                     ATP synthase which is a large evolutionarily conserved
                     enzyme complex required for ATP synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494558.1"
                     /db_xref="GeneID:8201938"
                     /db_xref="GOA:C5DPL4"
                     /db_xref="InterPro:IPR001469"
                     /db_xref="InterPro:IPR020546"
                     /db_xref="UniProtKB/TrEMBL:C5DPL4"
                     /translation="MFRLNAARTLTKSVNAVAKRTYAEAAANDFLKLKFALPHETLFA
                     GTKVTQVNLPAKSGGVGILANHVPTVEQLSPGVVEIFEGANTKKYFVSGGFASVQPDS
                     TLCVTSVEAFPLESFSQENVKSLISDANKNLSSSDEKVAATAAIQLEVLEALQAALK"
     gene            <348276..>350102
                     /locus_tag="ZYRO0A04334g"
                     /db_xref="GeneID:8201939"
     mRNA            <348276..>350102
                     /locus_tag="ZYRO0A04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494514.1"
                     /db_xref="GeneID:8201939"
     CDS             348276..350102
                     /locus_tag="ZYRO0A04334g"
                     /note="similar to uniprot|Q05325 Saccharomyces cerevisiae
                     YDL003W MCD1 Essential protein required for sister
                     chromatid cohesion in mitosis and meiosis subunit of the
                     cohesin complex expression is cell cycle regulated and
                     peaks in S phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494559.1"
                     /db_xref="GeneID:8201939"
                     /db_xref="GOA:C5DPL5"
                     /db_xref="InterPro:IPR006909"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="InterPro:IPR023093"
                     /db_xref="UniProtKB/TrEMBL:C5DPL5"
                     /translation="MSETHTISISAKNGPLAQIWLAANMSNLGRGQVLQTSISESANE
                     IAKASGCDENVTNIEHITLRTSGELLQGIVRVYSKQAAFLLSDIKDTLTKISTLFKSN
                     QRINITVNRANTIAAVDQLILEDAVTEKEVLAAPSLDFLDDNQIPEGLMGQETEESHQ
                     RRVQGAAPWDTSLEFGRRFDPDEDLEYNQSSGLDLDFDIDDGQLSKTAEEGTRQSHDV
                     VSQSQEPEHLLMGEDDFPLEDPNNVDWDLGISEEKDQERATSEAGSHDSVELGRRAEE
                     RSMTGEPIDFGFNLDIEKDAGDEEDQEEPESDEQQQKLQEEERERERKEEAKRERKAR
                     KDPALRNCKRIQQDVETELDDHSLKTASEEILNGRPETEVQDLPKLNQKRLWGEMIQS
                     LSYLPQETIERLTSLQTSKKPKTQVESENEESFEEPQMDISLGLNDDLLPESSISSSR
                     PPSELGEGDHESPMAADIGEHPLDQGQEEHGEPNIEQSTQQDSDEREPSSSQSELDDS
                     EKVKLTTGEFASREAVDFAELMRVEFIDNDSLEFENLLTTKKRAQGVEEDTRLTRQEA
                     TKGFFDMLSLATADCIDLNQQETFGEINISARPALYERFITA"
     gene            <350421..>357890
                     /locus_tag="ZYRO0A04356g"
                     /db_xref="GeneID:8201940"
     mRNA            <350421..>357890
                     /locus_tag="ZYRO0A04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494515.1"
                     /db_xref="GeneID:8201940"
     CDS             350421..357890
                     /locus_tag="ZYRO0A04356g"
                     /note="similar to uniprot|P35194 Saccharomyces cerevisiae
                     YBL004W UTP20 Possible snoRNA-binding protein based on
                     computational analysis of large-scale protein-protein
                     interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494560.1"
                     /db_xref="GeneID:8201940"
                     /db_xref="InterPro:IPR011430"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DPL6"
                     /translation="MAKQKNTPKATNKFRYASFKDKIDDLKIEPVRNLATRAHDYVET
                     SHFFASFEHWREINLSSSFTSFAGDVENIVQTLPQILYHEETILSTLLHYIDRHEPLS
                     LQPLLDLLAQFCHDLGPDFLKFYERSVNSMVSLLEAAVSFESSDVFEWTFNCLAYIFK
                     YLSRYLTEDLVPTFNLLFPLLSHSKTYLSRFSAEAMSFLIRKSNLKNLVGFVSFAFKK
                     LVEVEEANFYDGLLALFTEALVSTQEALHSKCRSILDIFIGEALATSSDRSGSLLCDL
                     WINLARHASFDNLQPVFESVVNKLQNVIDANNMNQATKIITTISFAESGKKVGNWTSV
                     VELVKVIISQKDRSKLSPQTLAFLFMVLLRNCDIKNLTHFHKKLYEFYLDEYPDYFTG
                     FFKASVDFTADRVYSFNGNRYLQQYLNKHWSTHQEQISLFLLQSSDDSDANRKLVVKT
                     PDEFARSILESLKVYGKHISDDGLFEVCQGSILLSRSQEKNEDVLIPVLENILNASSP
                     VTDFKKDVLGYVLDALQPSDQETHYQLLNDTLQQLESYRDSLVFIKSLNKYLLGLGKG
                     PKLGKYLSGLDDYIRILSENLTLPDKALRYETLKLITTLMEVQEKEVPQLLNDCKIIE
                     EIPLTLLNARDLSIRIRNMGSTFAKVESGSIITSLFFKFLFGLLTIRFSPVWEGVYEV
                     ISNAYGKDQQLVWDLIKRFLDAPDDHHCLTYYDDFMVGEADIDRWNVRAVRLHEILES
                     FSNTWSGYCFSKSTIVETMKARRANLDYPGQLRNQTLKLMLLVPQFVERHSRDIIPYL
                     FNQDESTEIFGLQEEKRGDLGSAARWTEADRNLLLKVIGKFKNMKSIYRFQEVHDRLM
                     LLLGSRNTEVQKLAFEALLGYHDSVLTKYRDNLRNLLDDTLFKDELLNLISTGDSKLI
                     EDQDEPQLMPYVVRIFFGRAQTPGTSGIKKGRKHAVISMLPNLRDEYIVEFLKLGSGK
                     FNYQYFFENGRIIEDSEVTATTLRRMLGFVNIVDYALGVLASGYPKVMATTVRPLIYT
                     IHMSYHVSNVEEKEPYMAKLAANLRQQSMKCLNNLFQYLGTSSVLNEFIEEICDIVVM
                     PRIEKFENENLQQPSSTLRMISSWSTVGELYPFLYFNDYASPSAMMRVLSNPNAKESV
                     VGVILEAANNIVTNPVNTDEYADLVTIVAANCLRVLPTLYKKITNPEIVSTSIDLLLN
                     LVYAGYLQDNETRKYLVDSFNHIIRDAFKGVSKKDVIKVLQVLAALLKDYDCDWDDVK
                     DLFEAVSGLHAKYSEKQLKEPLNDVFASFACRFPDLQKLSNLLSDLNSFSSKHMLEYD
                     FPRILSAFKQFHEVGYREYSEKQWLPILFTCMLYINDEEELAIRTNASHTFCKFFDYL
                     NEKPSPDAADEAVKILKRLILPHLRSGLRRTSEVIQAEHISVLSYIVSTGKYFTDLDD
                     LRVLLYNGDVEANFFVNVVHIQLHRRLRAVRRLREHGHELSGSSISNYLIPIVEHYVF
                     SKEEKFRNIGNEVLVTIGVLANFLSWSQYKGLLRRYIYFLKSRPDNLKESVNLITQLS
                     SALKNSLCYCRHKFNSEVVLKKFPIELEEPDNFVTEEIYPKLTSVLQVRDNETAVARI
                     PLSEALVNFVIGLDEVKLVSLLPGTLTSLCQILRSRSEELRDAVRKTLAEVSKILGAE
                     YLPFILKELISALRRGSQVHVLSFTVHHVLKTLEAALKPSDLDNSSQLLVNVIMEDIF
                     GFAGEEKESDNYHTTMKEIKVSRSYDTAEMLTSNISLPFFYTVLNPVKALLLERMNLK
                     SQNKLNELLRKYALGLNRNVQAASTEVLGLCYEIFEQSETVKKHTKSNRPLVSENEEF
                     FLINLNAKSGRVENETSLLNTTLQKFSLDLLRTVITRHRSLLEVKYLEGFMPLLKSCV
                     TSENEDVLTIALRVLLVMVKLEFPESSESIFANCARRVLNIIKDSPSTSSEVCQVGLK
                     FLSAVIRHKNIKLKDSALSYVLGRVLPDLNEPNKQGLAFNFVKALVYKHIQLPELYDV
                     IDTVRQIMVTNHSKEIRDVSRSVYYQFLMEYDQSKGRLEKQFKFMVDNLQYPSQDGRQ
                     SVMELINLIVNKANSVLLSKLSSSFFVALANVFFNDDAPRCREMASLLLSKLLSKLDP
                     ESLTTVEKYITAWLKQVQNVTFMNLGLRVYKVYLTSIGLEHNAALDELAMNRVKTIIS
                     NTDVGSESQWDLVYSALNLFIAYVERSEKSFGVAFRITWDKVIGCILYPHLWVRQSAS
                     RLVNLLVNNLDKFEKKFTDLEVQNVVSRTMRQLGAPTVPESLAAISVKTLMKVAMRWK
                     ENNVPFVLKESDNAQEVHYSSALDYMIVRAGAIIRSEENPADSFMSKKSCIQLLALLV
                     QILDENQLVEESEKIIMSLFNYLEQGAGDGLNEEQQELGNLAQECLQILESKISVSDF
                     TQAYANVKHNVLTRRQERKAKRAVLAVKAPDVAAQKKIKKHVRSREKRKHERDEHGFY
                     QRKNKKKRM"
     gene            complement(<358062..>358868)
                     /locus_tag="ZYRO0A04378g"
                     /db_xref="GeneID:8201941"
     mRNA            complement(<358062..>358868)
                     /locus_tag="ZYRO0A04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494516.1"
                     /db_xref="GeneID:8201941"
     CDS             complement(358062..358868)
                     /locus_tag="ZYRO0A04378g"
                     /note="similar to uniprot|Q03435 Saccharomyces cerevisiae
                     YDL002C NHP10 Protein related to mammalian high mobility
                     group proteins likely component of the INO80 complex which
                     is an ATP-dependent chromatin-remodeling complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494561.1"
                     /db_xref="GeneID:8201941"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:C5DPL7"
                     /translation="MSDDNDLKRKADELKENNEVLALGIQRTRLSVKRLKLEYSVLLE
                     RLESRVDLDPELRYENPLPTLESFKKELLTKPLKKTKSKRQKAKDRDPNMPKRPTNAY
                     LLFCEMNKEKVRQQGSQDVSKDLTEAWKNLNEQDRKPYYKLYTEDRERYQKEMEIYSM
                     KNDHDNENDPDHAKDHDEEYEGDEPENGREGPKHEDDDEEEEGEGEGEGEGEGEGEGE
                     GEGEGEAEEDEGEEDEEEEEDQREPESEITQLDEDGDNDEEMADIPTSEI"
     gene            <359271..>360647
                     /locus_tag="ZYRO0A04400g"
                     /db_xref="GeneID:8201942"
     mRNA            <359271..>360647
                     /locus_tag="ZYRO0A04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494517.1"
                     /db_xref="GeneID:8201942"
     CDS             359271..360647
                     /locus_tag="ZYRO0A04400g"
                     /note="similar to uniprot|Q05210 Saccharomyces cerevisiae
                     YDL001W RMD1 Cytoplasmic protein required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494562.1"
                     /db_xref="GeneID:8201942"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:C5DPL8"
                     /translation="MSKQEEEPLLKQTGSTATTGENSNSNNNTTSTSAKYKPKPKPRG
                     NGTKNVSSESGADTNLEVGVRHADDVNGGGIYNGEVTQGSLRAPNKQIRTGAQRTSRT
                     AQKLKLLPEEPFQRDEESLDLRDRDVYSQVNRITDKPARRDAEKLGKSHRHLLPRATA
                     YCTASGYSMRELVRWLKECKKIHHTHPKLFDECIYTPFMYNDWRGDKRFEHEDVIRLD
                     DEGGDINVSDKQPDLFVFEYGVVVLWGFTEREEKAFLNDIEGFEKEKLAEEDVQIEEF
                     NYYVTQSYQPRIYNDFITLRDASNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDI
                     PQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWSEPQLEPIYQATR
                     GYLEINQRVALLNQRLEVVSDLLQMLKEQLGHSHEEYLEFIVILLVGVEVIISVVNIA
                     ADILASKF"
     gene            complement(<360792..>361190)
                     /locus_tag="ZYRO0A04422g"
                     /db_xref="GeneID:8201943"
     mRNA            complement(<360792..>361190)
                     /locus_tag="ZYRO0A04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494518.1"
                     /db_xref="GeneID:8201943"
     CDS             complement(360792..361190)
                     /locus_tag="ZYRO0A04422g"
                     /note="similar to uniprot|P04911 Saccharomyces cerevisiae
                     YDR225W HTA1 One of two nearly identical (see also HTA2)
                     histone H2A subtypes core histone required for chromatin
                     assembly and chromosome function DNA damage-dependent
                     phosphorylation by Mec1p facilitates DNA repair acetylated
                     by Nat4p and similar to YBL003C uniprot|P04912
                     Saccharomyces cerevisiae YBL003C HTA2 One of two nearly
                     identical (see also HTA1) histone H2A subtypes; core
                     histone required for chromatin assembly and chromosome
                     function; DNA damage- dependent phosphorylation by Mec1p
                     facilitates DNA repair; acetylated by Nat4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494563.1"
                     /db_xref="GeneID:8201943"
                     /db_xref="GOA:C5DPL9"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DPL9"
                     /translation="MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQR
                     VGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKTAKPGKASQEL"
     gene            <361844..>362242
                     /locus_tag="ZYRO0A04444g"
                     /db_xref="GeneID:8201918"
     mRNA            <361844..>362242
                     /locus_tag="ZYRO0A04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494519.1"
                     /db_xref="GeneID:8201918"
     CDS             361844..362242
                     /locus_tag="ZYRO0A04444g"
                     /note="similar to uniprot|P02293 Saccharomyces cerevisiae
                     YDR224C HTB1 One of two nearly identical (see HTB2)
                     histone H2B subtypes required for chromatin assembly and
                     chromosome function Rad6p-Bre1p-Lge1p mediated
                     ubiquitination regulates transcriptional activation
                     meiotic DSB formation and H3 methylation and similar to
                     YBL002W uniprot|P02294 Saccharomyces cerevisiae YBL002W
                     HTB2 One of two nearly identical (see HTB2) histone H2B
                     subtypes required for chromatin assembly and chromosome
                     function; Rad6p-Bre1p-Lge1p mediated ubiquitination
                     regulates transcriptional activation, meiotic DSB
                     formation and H3 methylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494564.1"
                     /db_xref="GeneID:8201918"
                     /db_xref="GOA:C5DPM0"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DPM0"
                     /translation="MSAKAEKKPASKAPAEKKPAAKKTASAVESKGRKNKARKETYSS
                     YIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNRKSTISAREIQTA
                     VRLILPGELAKHAVSEGTRAVTKYSSSTQA"
     gene            complement(<362373..>362693)
                     /locus_tag="ZYRO0A04466g"
                     /db_xref="GeneID:8201919"
     mRNA            complement(<362373..>362693)
                     /locus_tag="ZYRO0A04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494520.1"
                     /db_xref="GeneID:8201919"
     CDS             complement(362373..362693)
                     /locus_tag="ZYRO0A04466g"
                     /note="highly similar to uniprot|P35195 Saccharomyces
                     cerevisiae YBL001C ECM15 Non-essential protein of unknown
                     function likely exists as tetramer may be regulated by the
                     binding of small-molecule ligands (possibly sulfate ions)
                     may have a role in yeast cell-wall biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494565.1"
                     /db_xref="GeneID:8201919"
                     /db_xref="InterPro:IPR002767"
                     /db_xref="InterPro:IPR029756"
                     /db_xref="UniProtKB/TrEMBL:C5DPM1"
                     /translation="MPKIPCLADLCMVPIGTGSASVSDFVTIVERRIRESHLKSTLHS
                     AGTTIEGPWDEVFTLIGELHELAHENGYVRIQSSLRVGTRTDKHQTAQEKVDTVLQKL
                     EKPH"
     gene            complement(<364152..>365624)
                     /locus_tag="ZYRO0A04488g"
                     /db_xref="GeneID:8201920"
     mRNA            complement(<364152..>365624)
                     /locus_tag="ZYRO0A04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494521.1"
                     /db_xref="GeneID:8201920"
     CDS             complement(364152..365624)
                     /locus_tag="ZYRO0A04488g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494566.1"
                     /db_xref="GeneID:8201920"
                     /db_xref="UniProtKB/TrEMBL:C5DPM2"
                     /translation="MDDLSSDGNMDSAPPDIHVSRSWFGDNQHDEFKEPSHEELEEIP
                     INGDDGNCRKCVNRQTHRTTLISECTSLYNIEDIGGDSLGLTALCKDMDSFNQMDGKA
                     TNSDFNYSMGRQNSSQNLLSFCNKGNREDYSDQIIEGVFHAAPSSEPPTGSLLCMQQG
                     HLSDRLSYPCSMSAMVANKQFDRCGEGHCFPSAQYEHTEPIFEEDRSSRMADLEYFAN
                     MDNDSWLDAKVDLNLGSSSWINALASRIQPSDPHEYFPTSSGKSNLFLEVGMYYADRL
                     GHDELTVSDQYGITLQDTVMRPPSTVGLNCNSLDESSKGLDAYSHISGSHSGTPWKIT
                     SGTTKQSSWDVFSRLDALNSRIQGLFFSVDSALSKSRCEESLAVNIEETGNLDGKLTF
                     SNFPPSEFSKDNRFDNESGSIVSSGITSNKEVIDIWTLGMASAESVLSDPEDFELGEL
                     YASNKSEVLQKANAKAIERLHEGDDHPQRKIKNFVGEKGL"
     gene            complement(<365695..>366972)
                     /locus_tag="ZYRO0A04510g"
                     /db_xref="GeneID:8201921"
     mRNA            complement(<365695..>366972)
                     /locus_tag="ZYRO0A04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494522.1"
                     /db_xref="GeneID:8201921"
     CDS             complement(365695..366972)
                     /locus_tag="ZYRO0A04510g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494567.1"
                     /db_xref="GeneID:8201921"
                     /db_xref="UniProtKB/TrEMBL:C5DPM3"
                     /translation="MSHTQLNHGFFYKDSGKVNDRDSLEDLSDSAQRYFRIGCTPPKT
                     SERIEIVHQSPQKSKITTSRTFNRKRVCVSRELPLEAKNTKGLTRVLKGAGNRYERNR
                     IQRFEETHASRNGSAYGAYEEFDEENFTSSVSFKSIVSAVFSNSIFQNPLGEHTSNTN
                     PFIENSFGGILDQLDGVNEDHLLICTKNESLNSCFLMRFIERRRRASAAVKEAARMAS
                     IRCKTRETARINAEEAVIQVHTRNLKLSFRDQEESKDCSQNEVNIIKDLDAPNTSLME
                     EANLSVGADLFFEGDIKQCGFEPTIDACWKLNDGLCPHVEALIYDSVDGDINDLKVKI
                     GDHQPCSWLTVLVSQIEIWGTDFQRTDCWDPLLKPDNLQKVTSNAEVSASIEETNCVS
                     KNNIDGGVSFSLQSAGGEGNFFFYSTSLKSIVC"
     misc_feature    complement(369077..369243)
                     /note="Centromere Zyro0A"
     gene            complement(<369397..>371859)
                     /locus_tag="ZYRO0A04554g"
                     /db_xref="GeneID:8201922"
     mRNA            complement(<369397..>371859)
                     /locus_tag="ZYRO0A04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494523.1"
                     /db_xref="GeneID:8201922"
     CDS             complement(369397..371859)
                     /locus_tag="ZYRO0A04554g"
                     /note="highly similar to uniprot|P32356 Saccharomyces
                     cerevisiae YDR001C NTH1 Neutral trehalase degrades
                     trehalose required for thermotolerance and may mediate
                     resistance to other cellular stresses may be
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494568.1"
                     /db_xref="GeneID:8201922"
                     /db_xref="GOA:C5DPM4"
                     /db_xref="InterPro:IPR001661"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011120"
                     /db_xref="InterPro:IPR018232"
                     /db_xref="UniProtKB/TrEMBL:C5DPM4"
                     /translation="MVDPKKSPLEEHARRHSSDGLNSSQTNTFSNAGDLDDLLKSKRE
                     SMASDESASQHHPSVHFNPKFLGTKSSSAKSESNPQRHRRLSSLNEFHDPFSTADVYY
                     GPETNPNKYSGIKPMNRPRTMSVVDNVSNFKTKSSLDRQLLKRRGSEDDTYLSSKGNR
                     RFFIENVDEMLGKLLACEDTDKNFQITIEDTGPKVIKVGTANSGGFKYVNIRGTYMLS
                     NLLQELTIAKSFGRNQIVLDEARINENPVDRLTRLIHTQFWDNLTRRVDLTNIAQIAL
                     DTKIDAPGAKNPRVYVPYNCPEQYEFYVQASQMNPSLSLEVEYLPRDITPEYVKSLNR
                     TPGMLALAMEEHINPSSGELSLVGYPYAVPGGRFNELYGWDSYMIALGLLEGGKTHVA
                     RGMVEHFIFEIEHYGKILNANRSYYLCRSQPPFLTDMALQVFKKMGGRNNPDAIDFLK
                     RACHAAIKEYRTVWVNSPRLDPETGLSCYHPLGLGIPPETEVDHFDSLLAPYHKKYNA
                     SREEFAKMYNDGKVNEPKLDDFFMHDRGVRESGHDTTYRFEGVCAYLATVDLNSLLFK
                     YERDIADIIEEFFENKYHDPWDNSVTDAQYWRDLAQKRRSVITKYMWDDETGFFFDYN
                     TKTKERHSYESATTLWALWAGLATEDQAAIMVEKAIPNLEVLGGIVACTERSRGPLSI
                     KRPSRQWDFPYGWAPHQILAWDGLSRYGFVGTATRLAYRWLYIMTKAFVDYNGIVVEK
                     YDVTKGTDPHRVNAEYGNQGADFKGVAKEGFGWVNASYVLGLQYMNDHAKRALATCVP
                     PIPFFNSLRPNERKNYGLQTHS"
     gene            <372682..>373308
                     /locus_tag="ZYRO0A04576g"
                     /db_xref="GeneID:8201923"
     mRNA            <372682..>373308
                     /locus_tag="ZYRO0A04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494524.1"
                     /db_xref="GeneID:8201923"
     CDS             372682..373308
                     /locus_tag="ZYRO0A04576g"
                     /note="similar to uniprot|P41920 Saccharomyces cerevisiae
                     YDR002W YRB1 Yeast Ran Binder #1 suppressor of FUS1
                     homolog of mouse HTF9a and human RanBP1 nuclear GTPase-
                     activating protein for Ran"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494569.1"
                     /db_xref="GeneID:8201923"
                     /db_xref="GOA:C5DPM5"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DPM5"
                     /translation="MSDDKSTTKPVEEKKPETESGPKPPTSAVFSMFGGKKENKPSGE
                     EESKKEENEEKKPKEDDDESPESPDVHFEPIVHLEKVDVKTLEEDEEVLYKVRAKLFR
                     FDGEAKEWKERGTGDCKFLKNKSTGKVRILMRRDKTLKVCANHIVAPEYVLKPNVGSD
                     RSWVYACTADVAEGETQALTFAIRFGSKENADKFKEEFEQAQKLNKKN"
     gene            complement(<373651..>374508)
                     /locus_tag="ZYRO0A04598g"
                     /db_xref="GeneID:8201924"
     mRNA            complement(<373651..>374508)
                     /locus_tag="ZYRO0A04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494525.1"
                     /db_xref="GeneID:8201924"
     CDS             complement(373651..374508)
                     /locus_tag="ZYRO0A04598g"
                     /note="similar to uniprot|P35196 Saccharomyces cerevisiae
                     YBR002C RER2 Cis-prenyltransferase involved in dolichol
                     synthesis participates in endoplasmic reticulum (ER)
                     protein sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494570.1"
                     /db_xref="GeneID:8201924"
                     /db_xref="GOA:C5DPM6"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:C5DPM6"
                     /translation="MSMEAETTLSWFSASEWIKNQFSNVIKVSNSAPKHVGFVMDGNR
                     RYAKKMDIEVKEGHEAGYMSMSKVLELCYQAGVDTATVFAFSIENFKRSSLEVDNLMQ
                     LARERIRQLADKGELAEKYGIRVKVIGDLTLLPKDIYKEVKRTTDLTKNNTRATLNIC
                     FPYTGREEIFHSVKELISEDVPIDSINEICLEKHLYTGDSPPLDLLVRTSGVSRLSDF
                     MLWQASNKGVVIELIDRLWPEFGPLNMAWILLKFAFRKSFSVKHELEDEVEDNDELME
                     TLPEDKKNL"
     gene            <374839..>376245
                     /locus_tag="ZYRO0A04620g"
                     /db_xref="GeneID:8201925"
     mRNA            <374839..>376245
                     /locus_tag="ZYRO0A04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494526.1"
                     /db_xref="GeneID:8201925"
     CDS             374839..376245
                     /locus_tag="ZYRO0A04620g"
                     /note="highly similar to uniprot|P18900 Saccharomyces
                     cerevisiae YBR003W COQ1 Hexaprenyl pyrophosphate
                     synthetase catalyzes the first step in ubiquinone
                     (coenzyme Q) biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494571.1"
                     /db_xref="GeneID:8201925"
                     /db_xref="GOA:C5DPM7"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:C5DPM7"
                     /translation="MIRRCIRFRICVLNARRGKSSFSAALAAVSRLVTPSIMLRNPVS
                     LVSNEMNTLAKNIMALIGSGHPVLNRVTSYYFEAEGKKVRPLLVLLLSRALAEIPLEQ
                     RTQSLIDSVDVPEDPVYSQPPKSLLFEPPANNLSPLDILHGIKPLNPLTKGPEPIPEA
                     NFDKERGILPKQRRLAEIVEMIHTASLLHDDVIDHSDTRRGRASGNVAFTNKMAVLAG
                     DFLLGRATVAISRLRNPEVVELMSNSIANLVEGEFMQLKNTAVEDISIINQGNKPLPA
                     ASKKLNNEVHDYRVPRAVGEGISHDQMIETAFDYYLHKTYLKTAALISKSSRAAAILS
                     GVDRTVVDQCYEFGKDIGICFQLVDDMLDFTVSAKDLGKPAGADLELGIATAPVLYAW
                     KADPSLGPLIQRNFSQPGDVEQTAEAVANSNGVFKTKKLAEKYRDQALQNLRKALPES
                     DARSALEFLTNSILTRGK"
     gene            complement(<376415..>377695)
                     /locus_tag="ZYRO0A04642g"
                     /db_xref="GeneID:8201926"
     mRNA            complement(<376415..>377695)
                     /locus_tag="ZYRO0A04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494527.1"
                     /db_xref="GeneID:8201926"
     CDS             complement(376415..377695)
                     /locus_tag="ZYRO0A04642g"
                     /note="similar to uniprot|P38211 Saccharomyces cerevisiae
                     YBR004C GPI18 Functional ortholog of human PIG-V which is
                     a mannosyltransferase that transfers the second mannose in
                     glycosylphosphatidylinositol biosynthesis the authentic
                     non-tagged protein was localized to mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494572.1"
                     /db_xref="GeneID:8201926"
                     /db_xref="GOA:C5DPM8"
                     /db_xref="InterPro:IPR007315"
                     /db_xref="UniProtKB/TrEMBL:C5DPM8"
                     /translation="MFCQLSSTFILCKLVQYGLILLTPRDQFDTSTELLLARFVSVAD
                     SSKFWNSHLWNKLLAWDSVYFMKAMASENGKPAFEHEFAFSQFWIHLVRFLAPNHEFY
                     NLLKTGVVLDNILHYLATFILYFLTVKIFSGNLKSSYAKSLAKKTSVLFIFSSAAGFL
                     TGIYSEPLSFTLSFLGIWARQSAVFTTLPKHIDCLYSRFPLYLFSAICFSLATLNRSN
                     CIVLGIYYVFDLWQLLKNRNYGKALLFPLLSGGILFLTCVLQQYVIPYSIFCPERGSW
                     CNTQILGPFTRQSFYGFLQSHYWNVGFLKYWTPNNIPNFLFALPNIIILLYSSVYFSK
                     IYPYYSLRPHIWVTTSLVIIVLLFAHVQIINRISTFIPLHLWYIADRLLKTSNSKDKS
                     TPRGDDRIAHYYIIWLIFWIPLQTILFAYFLPPA"
     gene            <378082..>378699
                     /locus_tag="ZYRO0A04664g"
                     /db_xref="GeneID:8201927"
     mRNA            <378082..>378699
                     /locus_tag="ZYRO0A04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494528.1"
                     /db_xref="GeneID:8201927"
     CDS             378082..378699
                     /locus_tag="ZYRO0A04664g"
                     /note="similar to uniprot|Q03446 Saccharomyces cerevisiae
                     YDR003W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494573.1"
                     /db_xref="GeneID:8201927"
                     /db_xref="InterPro:IPR020999"
                     /db_xref="UniProtKB/TrEMBL:C5DPM9"
                     /translation="MIIEKTGLIYARDFYDGDDDVSNESWKWARWTLFVIFILAIVMF
                     IVGVVGLNRRRKQVGRAPIRGTAWITPPSYRQSQRDHDRREDSEFVPQYTAKANENDL
                     GYYDENGEFHLNSKGEFYPPPSSPPPNETSEEPRSNSSMSLTRPENAVTRDRHNSSDV
                     EAEFDRDFGRGRPHTETLYTAATNNSSSVEKQHISTPERAKMAES"
     gene            <379317..>380801
                     /locus_tag="ZYRO0A04686g"
                     /db_xref="GeneID:8201828"
     mRNA            <379317..>380801
                     /locus_tag="ZYRO0A04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494529.1"
                     /db_xref="GeneID:8201828"
     CDS             379317..380801
                     /locus_tag="ZYRO0A04686g"
                     /note="highly similar to uniprot|P38067 Saccharomyces
                     cerevisiae YBR006W UGA2 Succinate semialdehyde
                     dehydrogenase involved in the utilization of
                     gamma-aminobutyrate (GABA) as a nitrogen source part of
                     the 4-aminobutyrate and glutamate degradation pathways
                     localized to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494574.1"
                     /db_xref="GeneID:8201828"
                     /db_xref="GOA:C5DPN0"
                     /db_xref="InterPro:IPR010102"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DPN0"
                     /translation="MSSPQPILQRKDLIRDSAYINGLWVKESEQHFDVTDPATNQVIA
                     QLPDQSVSAVNDAIDAAYEAFHTYKNTTPRQRAIWLRNFYNLMLENINDLGQILTWEN
                     GKALADSVGEIRYAASYFEWYAEEAPRVYGTVIQPGNAGNRAFTIKQPIGVCGLICPW
                     NFPSAMITRKAAAALAAGCTVVIKPDAQTPLSALALAALAEEAGFPKGAFNVVLADKN
                     TPQVGVTLCESPKVKKVSFTGSTRVGKLLMKQASTTMKKLSFELGGNAPFIVFENADL
                     DHAVDQAIASKFRGLGQTCVCANRLYVQESVVDKFAELMAAKVRQFVLGHGLHSDTTH
                     GCMINGQAIEKVEEHKKDAIEKGAKIVLEGGPLKELGPHFYNPAIVSHVPQSAKVSKE
                     ETFGPLCPIFTFKTTEEVVKYANDTDVGLASYVFSRDINTIYTVSEALEVGMVSCNTG
                     LFSDATIPFGGVKESGFGREGSLYGLDDYTVVKVVTIGGLPNKI"
     gene            <381043..>382434
                     /locus_tag="ZYRO0A04708g"
                     /db_xref="GeneID:8201829"
     mRNA            <381043..>382434
                     /locus_tag="ZYRO0A04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494530.1"
                     /db_xref="GeneID:8201829"
     CDS             381043..382434
                     /locus_tag="ZYRO0A04708g"
                     /note="similar to uniprot|P25301 Saccharomyces cerevisiae
                     YDR004W RAD57 Protein that stimulates strand exchange by
                     stabilizing the binding of Rad51p to single-stranded DNA
                     involved in the recombinational repair of double-strand
                     breaks in DNA during vegetative growth and meiosis forms
                     heterodimer with Rad55p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494575.1"
                     /db_xref="GeneID:8201829"
                     /db_xref="GOA:C5DPN1"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPN1"
                     /translation="MDLYDELPQSSLLCDEEFTSLLDACKKYQVSVVDFLTLPSKELA
                     RQLQRSTNEVDKFQKSMIAEYDDQLMNFNEVKPISEVEGPVPFTTTDVGIDEALGGGI
                     YTHGITEVFGESSTGKSQLLMQLCLSVQLPTNMGGIKGKCVYISTEGDLPTQRLASMI
                     SAREELVKHGVSQENVYTVTCCDLINQDHILNVQLPILLENSRGAIKLIIIDSISHHM
                     RVELPTRDFKDHQDNRFYVDQVAERLLDLANKHALAVVVANQVSDRPLFESPEPYVAE
                     LTDYEYQLGWWVGWRNSSIIYHQKYNEPKNVNSDYQDNEDLLSDDEDGKLIHDEIARV
                     ENLSRTKAAKVTVANSEKALPPDKRPIERRSTFPSNKQRFHKKRSVDRRVPNLGLNWA
                     KHLSSRILLSKSYRASPMIRRGELHLYKGSDPTTFWQVKRLFKVVFSAYADSKEIPFM
                     ITKRGLESSLGDD"
     gene            complement(<382739..>383563)
                     /locus_tag="ZYRO0A04730g"
                     /db_xref="GeneID:8201830"
     mRNA            complement(<382739..>383563)
                     /locus_tag="ZYRO0A04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494531.1"
                     /db_xref="GeneID:8201830"
     CDS             complement(382739..383563)
                     /locus_tag="ZYRO0A04730g"
                     /note="similar to uniprot|P41910 Saccharomyces cerevisiae
                     YDR005C MAF1 Negative regulator of RNA polymerase III
                     component of several signaling pathways that repress
                     polymerase III transcription in response to changes in
                     cellular environment targets the initiation factor TFIIIB"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494576.1"
                     /db_xref="GeneID:8201830"
                     /db_xref="GOA:C5DPN2"
                     /db_xref="InterPro:IPR015257"
                     /db_xref="UniProtKB/TrEMBL:C5DPN2"
                     /translation="MSVNENGSPSASFSPNSGVKTNKLNDQNLKELVSNSESRYMSSP
                     SPGDSNSNSNPRSFYANRRTSSSTGLQPSKSAINRRRSSAVNDPANSINIGPFGPINE
                     TASRRTFAYLIAILNASFPDHDFSSLEPTDFLKISLKSMISKFENSLYSLGKNPEEWM
                     WEIINSHLDMPDCVIYQYSPPRSFLDDEPGYLWSLVFFLFNKKRKRVAYLYLISSRLE
                     SPTEGNVNEDEEREKLNQKRRTVIDDEAADYEGEYDLVYDENAIEDDADDAVEVTS"
     gene            complement(<384421..>386655)
                     /locus_tag="ZYRO0A04752g"
                     /db_xref="GeneID:8201831"
     mRNA            complement(<384421..>386655)
                     /locus_tag="ZYRO0A04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494532.1"
                     /db_xref="GeneID:8201831"
     CDS             complement(384421..386655)
                     /locus_tag="ZYRO0A04752g"
                     /note="weakly similar to uniprot|P38213 Saccharomyces
                     cerevisiae YBR007C DSF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494577.1"
                     /db_xref="GeneID:8201831"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DPN3"
                     /translation="MDTDPLEILSLYQYESGRHSSVVSFQSVQTAERLLDKLELSAED
                     ERLLQLALKEEREKNEAEEKERNRVLQREKDEEADAERQREREKEREQSPLLCLPASG
                     FPSLKNRSFVTPRRVLTVSVADPLGQGDKGLCTGAEQHLPTKSRYSYFVEEVDSEDED
                     NDTHDNQPSPRPKKPSLGTNPRKKTVRAEIYGAFNVGVAPIQRSNTTATETAPVSRST
                     SRKTVNFEKYRMDTSKLLSKSPSSKKAKLYENNSNNSSSTEFGQNSLLFRSQQSLSDE
                     SEGSIDGSSVKRNNSSATTKVSSGKDSTTASPLHIFNTATSYKSDGGDSLQNSNKETP
                     TKATLTRDTPTKNTPTKDGNGRSHSKKKTSFHLKNLFRSQKASGRKDSLNSKRSTDDL
                     AEMSAMNSANTSATTSVGTSAANSPPKGTPFLNNANKSPLFRKFAFPTNTTEPLEDIP
                     SSLSSSSSSAKQGSRMQTRDTQHYRSLSDHHAINKSSSIPTITNANTQPFTPGLRNRK
                     LSLDSRHNAGRVSRFDTPLTSDNNNNNSTNNNNNEDRIHDAAGSAIHSSPSLHSKRTN
                     IANLGESARKLHDACNDGNAEACFLYGMALRHGYGVIPDQEESFHYLFTATGLKSELH
                     DVFEVEINPFELERNQSIPEIAPEPSAPAIYECAISYLKGYGMDHEDEIKGLKFLEKV
                     ASMGHLDAMCLSGTIWSKKSSVRRKDLARAAAWFRIAEKRGAHLIGAEWIYKDKYIQM
                     AKNY"
     gene            complement(<387338..>390376)
                     /locus_tag="ZYRO0A04774g"
                     /db_xref="GeneID:8201832"
     mRNA            complement(<387338..>390376)
                     /locus_tag="ZYRO0A04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494533.1"
                     /db_xref="GeneID:8201832"
     CDS             complement(387338..390376)
                     /locus_tag="ZYRO0A04774g"
                     /note="weakly similar to YDR006C, uniprot|P40317
                     Saccharomyces cerevisiae YDR006C (SOK1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494578.1"
                     /db_xref="GeneID:8201832"
                     /db_xref="InterPro:IPR008862"
                     /db_xref="UniProtKB/TrEMBL:C5DPN4"
                     /translation="MEQARPHRSTIATASSEPQTTSTRNRSLSTTGTTTRTTTATIPQ
                     QTDIAKTTSSPKDQHGMNMNTNEEGGNTSSNNTEDRKRLSTCSQEHGPGDTTTQASFQ
                     PTGSLLVRKYTELVSSIGNHFPNEDDGGIDEGGVDIDVNDEEEQEDVGEEGKEVQSNS
                     ENDGDDGRAEGVNEEENEDSMGNGLFKQFDHRTGQFLRKDPFLAKEDLGVRRLFGKSD
                     NKFRSHSVPAICHSSLKRLTASYCQNHNHYHYRHHNNQQSAVGSVRKKRSGKPHHHHH
                     HRRHQHSPYCFVQAAFSNGSGATASTASSTDSGNSSGASSRESSRCVNGASSGNDTGA
                     TSFGNDPKQPAAAGAAATSTASSGVTTGSVTNEGNVGSNVGKSSTTPSLHRSHHQSKN
                     HSMSTNALRDAILLCHQAQQPLVTKYDELTLHERISAVRDHPGPLPLPPINLQCLKEI
                     DLQEIVKNPQLRHDIIFDPLLQFRPNLDGERGLKKKQLSDRYWRDVENEVYVYSQKPQ
                     VFQYDHTRLVPLFDTLREVLLTIVPQREAHVIHNVLDTELNVQELLRGSLIMTNLSEW
                     LAQLFKHHCAPMRDAWVDRMSAKFKEAEQESSLSKLIEGLRLVFQILEAMKLDIANHQ
                     IRILRPALLSNSVEFEKQYFQSLMNSDRVDLKSSLLWFNRKFNESVNQGTIQRDRAVP
                     RDVYKLCIRSIISLLSCRKMVREYPTSLSFDHARLILLRADIRQIVCLLICRLLFKQL
                     VANDTSLDKGAKNYIDSSGTQKKLKGEIVSIITDEHGNCRWTKNTMAIAIHLCKTITD
                     LRDEYLSRRVQTGVGISSSSNTTGTPPSSTPALAQAKVNFAKSWLSKQTQPLSEVYGV
                     LEDRVFRSLEELIFSKSDCTVDGRVRQDFVYLCSTLNKDSTITNTSATAAATTSAATS
                     NGLLVPTGENTSAASSSSSSSNTNDTNNNTNASTTSSNSHNTTASTFGTATTTTLQGL
                     DMEEFDSVLRHLYAVVNFHWSVFGAHYMDAISDQLGSRVF"
     gene            complement(<391929..>392240)
                     /locus_tag="ZYRO0A04796g"
                     /db_xref="GeneID:8201833"
     mRNA            complement(<391929..>392240)
                     /locus_tag="ZYRO0A04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494534.1"
                     /db_xref="GeneID:8201833"
     CDS             complement(391929..392240)
                     /locus_tag="ZYRO0A04796g"
                     /note="highly similar to uniprot|P02309 YBR009C and to
                     uniprot|P02309 YNL030W Saccharomyces cerevisiae, HHF1 and
                     HHF2, two identical histone H4 proteins; core histone
                     required for chromatin assembly and chromosome function;
                     contributes to telomeric silencing; N-terminal domain
                     involved in maintaining genomic integrity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494579.1"
                     /db_xref="GeneID:8201833"
                     /db_xref="GOA:C5DPC4"
                     /db_xref="InterPro:IPR001951"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR019809"
                     /db_xref="UniProtKB/TrEMBL:C5DPC4"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <392758..>393168
                     /locus_tag="ZYRO0A04818g"
                     /db_xref="GeneID:8201834"
     mRNA            <392758..>393168
                     /locus_tag="ZYRO0A04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494535.1"
                     /db_xref="GeneID:8201834"
     CDS             392758..393168
                     /locus_tag="ZYRO0A04818g"
                     /note="highly similar to uniprot|P61830 Saccharomyces
                     cerevisiae YBR010W One of two identical histone H3
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494580.1"
                     /db_xref="GeneID:8201834"
                     /db_xref="GOA:C5DPC3"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DPC3"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <393280..>393930
                     /locus_tag="ZYRO0A04840g"
                     /db_xref="GeneID:8201835"
     mRNA            <393280..>393930
                     /locus_tag="ZYRO0A04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494536.1"
                     /db_xref="GeneID:8201835"
     CDS             393280..393930
                     /locus_tag="ZYRO0A04840g"
                     /note="similar to uniprot|P00912 Saccharomyces cerevisiae
                     YDR007W TRP1 Phosphoribosylanthranilate isomerase that
                     catalyzes the third step in tryptophan biosynthesis in
                     2004 the sequence of TRP1 from strain S228C was updated by
                     changing the previously annotated internal STOP (TAA) to
                     serine (TCA)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494581.1"
                     /db_xref="GeneID:8201835"
                     /db_xref="GOA:C5DPN7"
                     /db_xref="InterPro:IPR001240"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DPN7"
                     /translation="MLVNVKKTKAMSKMVVKICGLQSVEAAQVAIDNGADLLGVICVP
                     NRKRTVDAEVAKSISNLCRSKNVKLVGVFRNQSKEDVAKIAQDYNLNVVQLHGDEDWK
                     EYDSFIPLPIIKRLVFPRDVEILSQLQNTDCQPLFDSEAGGTGEKLDWQSIGKWYSDA
                     NLSNGYILAGGLNPDNVRDALKIPGVIGVDVSGGVESDGMKDNEKIKTFLFNAHSL"
     gene            complement(<393985..>394848)
                     /locus_tag="ZYRO0A04862g"
                     /db_xref="GeneID:8201836"
     mRNA            complement(<393985..>394848)
                     /locus_tag="ZYRO0A04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494537.1"
                     /db_xref="GeneID:8201836"
     CDS             complement(393985..394848)
                     /locus_tag="ZYRO0A04862g"
                     /note="highly similar to uniprot|P00817 Saccharomyces
                     cerevisiae YBR011C IPP1 Cytoplasmic inorganic
                     pyrophosphatase (PPase) catalyzes the rapid exchange of
                     oxygens from Pi with water highly expressed and essential
                     for viability active-site residues show identity to those
                     from E. coli PPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494582.1"
                     /db_xref="GeneID:8201836"
                     /db_xref="GOA:C5DPN8"
                     /db_xref="InterPro:IPR008162"
                     /db_xref="UniProtKB/TrEMBL:C5DPN8"
                     /translation="MSYTPRQVGAKNTLDYKVFLEKNGKPVSPFHDIPLYADEEKQIF
                     NMVVEIPRWTNGKLEITKEEPLNPIIQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWE
                     DPNVVHPETKAVGDNDPVDVLEIGETIGYTGQVKQVKVLGIMALLDEGETDWKVIAID
                     VNDPLAPKLNDVEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALD
                     IVRETHESWKQLIHGKVSDNKGIALTNTTVTDSPTYSATAASEVPAASPQEDAPVDKS
                     IDKWFFISGSA"
     gene            395206..395278
                     /locus_tag="ZYRO0A04884r"
                     /db_xref="GeneID:8201837"
     tRNA            395206..395278
                     /locus_tag="ZYRO0A04884r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8201837"
     gene            complement(<395608..>396090)
                     /locus_tag="ZYRO0A04906g"
                     /db_xref="GeneID:8201538"
     mRNA            complement(<395608..>396090)
                     /locus_tag="ZYRO0A04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494538.1"
                     /db_xref="GeneID:8201538"
     CDS             complement(395608..396090)
                     /locus_tag="ZYRO0A04906g"
                     /note="similar to uniprot|Q12157 Saccharomyces cerevisiae
                     YDL008W APC11 Catalytic core subunit of the
                     Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
                     ubiquitin-protein ligase required for degradation of
                     anaphase inhibitors including mitotic cyclins during the
                     metaphase/anaphase transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494583.1"
                     /db_xref="GeneID:8201538"
                     /db_xref="GOA:C5DPN9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024766"
                     /db_xref="UniProtKB/TrEMBL:C5DPN9"
                     /translation="MKVDIEEVHSVFAWTWHIPKDNKDGSLEADDDDDVCGICRASYN
                     ATCPSCKYPGDECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAIN
                     DSQLEKFKELQLRKRTNTAGEFADEDDEEAIERAMAQQDQAEVDDQGDVIMDQGLVVR
                     "
     gene            complement(<396257..>397012)
                     /locus_tag="ZYRO0A04928g"
                     /db_xref="GeneID:8201539"
     mRNA            complement(<396257..>397012)
                     /locus_tag="ZYRO0A04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494539.1"
                     /db_xref="GeneID:8201539"
     CDS             complement(396257..397012)
                     /locus_tag="ZYRO0A04928g"
                     /note="weakly similar to Saccharomyces cerevisiae YDL010W
                     Hypothetical ORF or YBR014C uniprot|P38068 Saccharomyces
                     cerevisiae YBR014C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494584.1"
                     /db_xref="GeneID:8201539"
                     /db_xref="GOA:C5DPP0"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011899"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014025"
                     /db_xref="UniProtKB/TrEMBL:C5DPP0"
                     /translation="MGVTLNKRNLRVLSITSLLLLLVFFVVQNANSVSIGESSSLANA
                     NSNEDQTLTSAGTSINKESKEEVVTEKQKAKEKQPEGDSVVDAEIGKIKQEVGIGKTD
                     DLETGSSGSISGGGVVGKGGSASEHAQQTEFDPVKEYAMILDFSPIIVFSKSTCPYSK
                     KLKELLDKEYSFTPSYFVIELDRHHNGAELQKYVEQKTGRSTVPNVIINGKSRGGNDE
                     FRSLHNEGKLLSSFKDWSQGTFTVLQLDRPSNN"
     gene            complement(<397314..>399170)
                     /locus_tag="ZYRO0A04950g"
                     /db_xref="GeneID:8201540"
     mRNA            complement(<397314..>399170)
                     /locus_tag="ZYRO0A04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494540.1"
                     /db_xref="GeneID:8201540"
     CDS             complement(397314..399170)
                     /locus_tag="ZYRO0A04950g"
                     /note="similar to uniprot|P38069 Saccharomyces cerevisiae
                     YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible for
                     addition of the first alpha-1 2-linked mannose to form the
                     branches on the mannan backbone of oligosaccharides
                     localizes to an early Golgi compartment"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494585.1"
                     /db_xref="GeneID:8201540"
                     /db_xref="GOA:C5DPP1"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DPP1"
                     /translation="MPLVTRRYGKALRLALLGLLVCLVFLGTTRYNGDHAAAEEYLRK
                     YLSGGQLEHALNSVAAHGSDAAAALRQGVGSDQQAVDQQHTQDHASTQSSTLGPDSTA
                     KLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGFRPENYDEWPTLAHDSLENCL
                     EISPEEVTMLKKNHAAYVDVLGSLRLPKNVYKGKGIVTVGGGKFSLLALLVIRSMREL
                     GTTLPVEVFIPPSDLGENQFCDEILPQYNAKCVYLSDVLPPNVIANSQFTGYQFKSLS
                     LIASSFEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYYDIADIT
                     VNRRKRIRNCFDDLTPPEVYTKNTKSMDDIPFHDFEGTIPDVSTESGQLMISKSTHLP
                     TILLALYYNVNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATGVEGYHR
                     ANNEGFRGVAMLQHDLNQDYLRYQAAADAIEAKYGGKTAKSIKYDKLYSLDNFYKTFF
                     GSENSALKECDVMFAHSHAPKFDPYGLWTQNELVQDGKHFRSYTSLEKINNYDLELSA
                     IDSIHKFVCLDKVNFKYLSEKIQSKQEHQEMCDYISKRREFLLSTHQQAISK"
     gene            <400197..>400653
                     /locus_tag="ZYRO0A04972g"
                     /db_xref="GeneID:8201541"
     mRNA            join(<400197..400235,400324..>400653)
                     /locus_tag="ZYRO0A04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494541.1"
                     /db_xref="GeneID:8201541"
     CDS             join(400197..400235,400324..400653)
                     /locus_tag="ZYRO0A04972g"
                     /note="weakly similar to uniprot|P38216 Saccharomyces
                     cerevisiae YBR016W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494586.1"
                     /db_xref="GeneID:8201541"
                     /db_xref="InterPro:IPR028144"
                     /db_xref="UniProtKB/TrEMBL:C5DPP2"
                     /translation="MSAQEYYGDSKASYSRPQGPPPSSDYYGGASRGYPQGGGGGGGG
                     YYQQPPQQHYQQPPPQYTQPGYHGGGGYPQQGAPHQGGYGGGQQPIYVQQQPPQRGNE
                     DCLTACLAVLCVCCTLDMLF"
     gene            complement(<400896..>402722)
                     /locus_tag="ZYRO0A04994g"
                     /db_xref="GeneID:8201542"
     mRNA            complement(<400896..>402722)
                     /locus_tag="ZYRO0A04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494542.1"
                     /db_xref="GeneID:8201542"
     CDS             complement(400896..402722)
                     /locus_tag="ZYRO0A04994g"
                     /note="similar to uniprot|P32828 Saccharomyces cerevisiae
                     YDL013W HEX3 Ring finger protein involved in the DNA
                     damage response with possible recombination role
                     genetically identified by synthetic lethality with SGS1
                     (DNA helicase) and TOP3 (DNA topoisomerase) sporulation
                     role interacts with Slx8p and Lin1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494587.1"
                     /db_xref="GeneID:8201542"
                     /db_xref="UniProtKB/TrEMBL:C5DPP3"
                     /translation="MDLRGRESPEASQEVHINGRDEDPIIIESDQEEDQRIRDDARPI
                     RLHPDGRIHRPRDGLNRFVNSEGTNVATTRSQDNGGSDDEVAIVGEINNTRGNEEGPI
                     GSDAEYVDLDADNGPQVIEVNDNNRNNNENSDDDGLVIVQERTTAPRVTLNLPGGESL
                     QIDASPTDRPYRRSFEWQQQDRTRRQAMERSARRASRLLFHTSDDDDDDSGNGTVENG
                     RLPPSVLQLRRQEEERSRLRNITRRRDQMRSDAMQGNPVLMRLRERIDSFPPDVRSAF
                     VHAQSLYEFRSILQSVAPLTLQECDNELVPLFTEYRSRMVQNWATNRVQSNQQESRRL
                     NEENHERQRRLWHNRRHFRIHMGVGGGFGESLANYILMNANGMGSNDAAWLYNGYVGD
                     MDEEESTQSIVSMIQEREEREHDSRTKKYMEKTQDQQQSYVQRAMELPDGYSASFDTE
                     PKIKLDIVRDGKEETVVVKDDSVSDQWQEVPVCTLCGVELGVGIPDEFEGITKMDRGV
                     SFECLVYKYQFHCPYQTLARPSQLDRDLSRRTFVAPCGHTYCGRCFARIDNARGKSRM
                     AKRKLAQLKGSAHPDNYGPKICPAKGCKSPIRTRGKMREAFF"
     gene            complement(<403183..>404142)
                     /locus_tag="ZYRO0A05016g"
                     /db_xref="GeneID:8201543"
     mRNA            complement(<403183..>404142)
                     /locus_tag="ZYRO0A05016g"
                     /product="rRNA methyltransferase NOP1"
                     /transcript_id="XM_002494543.1"
                     /db_xref="GeneID:8201543"
     CDS             complement(403183..404142)
                     /locus_tag="ZYRO0A05016g"
                     /note="similar to uniprot|P15646 Saccharomyces cerevisiae
                     YDL014W"
                     /codon_start=1
                     /product="rRNA methyltransferase NOP1"
                     /protein_id="XP_002494588.1"
                     /db_xref="GeneID:8201543"
                     /db_xref="GOA:C5DPP4"
                     /db_xref="InterPro:IPR000692"
                     /db_xref="InterPro:IPR020813"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DPP4"
                     /translation="MSFRPGSRGGSRGGPRGGGRGGPRGGGRGGRGAPRGGGRGGPRG
                     GGRGAPRGGRGGPRGGRGGPRGGGQGGPRGGAKVVIEPHKHDGIYIARGKEDLLVTKN
                     VAPGESVYGEKRVSVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPGK
                     KVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELIAMAKKRPNVVPIIEDARH
                     PQKYRMLLGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAET
                     VFAREVQKLREERIKPLEQLTLEPYERDHCVVIGRYMRSGLKK"
     gene            <404459..>405370
                     /locus_tag="ZYRO0A05038g"
                     /db_xref="GeneID:8201544"
     mRNA            <404459..>405370
                     /locus_tag="ZYRO0A05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494544.1"
                     /db_xref="GeneID:8201544"
     CDS             404459..405370
                     /locus_tag="ZYRO0A05038g"
                     /note="similar to uniprot|Q99190 Saccharomyces cerevisiae
                     YDL015C TSC13 ER protein involved in very long chain fatty
                     acid synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494589.1"
                     /db_xref="GeneID:8201544"
                     /db_xref="GOA:C5DPP5"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:C5DPP5"
                     /translation="MVLVKSRSKSLRDTQVDVSPGSKFDDVLTAISKNNKDTSIYRLR
                     LTYLKENKQIPVVSDEFFAASDVETLYVKDLGPQISWRMVFICEYLGPIIIHSLFYYL
                     SQKPELRSSGSRYNPYMNRLAYLLILAHYLKREVETIFVHQFSQATMPFFNLFKNCFH
                     YWVLNGLIALGYFGKGFFFNDSDLFRAYSFLKINNLSALVAFFTIFELWNFYAHIKLR
                     IWGDYQKSLGNTKVRVPLDEGIFKIFVSPNYTLELLSWITFTLIFKLNFFALAFTIVS
                     GTQMYLWAQKKNKKYGTRRAFLIPYLF"
     gene            complement(<405402..>406886)
                     /locus_tag="ZYRO0A05060g"
                     /db_xref="GeneID:8201545"
     mRNA            complement(<405402..>406886)
                     /locus_tag="ZYRO0A05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494545.1"
                     /db_xref="GeneID:8201545"
     CDS             complement(405402..406886)
                     /locus_tag="ZYRO0A05060g"
                     /note="similar to uniprot|P06243 Saccharomyces cerevisiae
                     YDL017W CDC7 DDK (Dbf4-dependent kinase) catalytic subunit
                     required for firing origins and replication fork
                     progression in mitosis through phosphorylation of Mcm2-7p
                     complexes and Cdc45p kinase activity correlates with
                     cyclical DBF4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494590.1"
                     /db_xref="GeneID:8201545"
                     /db_xref="GOA:C5DPP6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DPP6"
                     /translation="MSHEDVPREIKDEMEQLYEDVEGLRDEYVLLDKIGEGTFSSVYK
                     AEDIKGKVCQRYSSHFWTPGSRYVALKKIYVTSSPQRIYNELNLLYMLTGCTRVAPLC
                     DATRVRDQVIAVLPYYPHEEFRNFYRDLPIKGIKMYLWEMLQALSFVHSKGIMHRDIK
                     PTNFLYNPEIGRGVLVDFGLAEMQPDYDRNEVEEDSLASIRDWRSHEQFCPCIVRDTN
                     KQNASSPMVTIQNGKVVHLNNVNGVDLSKGYPKNETRRIKRANRAGTRGFRAPEVLMK
                     CGSQTTKIDIWSVGVILLSLLSRRFPLFQSMDDTDSLLELCTIFGWKKIRKCAALHGL
                     GFEVSGLRHITENGFPNALKEFIYKLLDKECTVGTFPDYSVAFETYEYLSQELYDRRS
                     IEPKLPGSSNAETTITTEGPQAYELKKYQEEIWSDHYWCFQVLEQCLEFDPQKRSSAS
                     ELLQSAFFNELNEADIYTDVETTDEDQMSEEDQAVDDDLLLIPG"
     gene            <407307..>407969
                     /locus_tag="ZYRO0A05082g"
                     /db_xref="GeneID:8201546"
     mRNA            <407307..>407969
                     /locus_tag="ZYRO0A05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494546.1"
                     /db_xref="GeneID:8201546"
     CDS             407307..407969
                     /locus_tag="ZYRO0A05082g"
                     /note="similar to uniprot|Q12403 Saccharomyces cerevisiae
                     YDL018C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494591.1"
                     /db_xref="GeneID:8201546"
                     /db_xref="GOA:C5DPP7"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:C5DPP7"
                     /translation="MQHYLILLILLGIGLCSPVTFELPRGQTECFYTLTPKDHCTINY
                     YFAVQGGQSNDNTVNYKIYDPSDKESPMIERSNIRLGEWSFPGELRGEYAFCFQGGNE
                     HNKIVDLDIRHSCKNEADIWSERRKARREARHLRDLHNDPLQSSVENSVDKIEEQLYQ
                     LEINLMYYKARNKRNHHTVRSTDFRIMLFSIYGILLVIGMGLVEIIILKWFFRESRKY
                     AI"
     gene            complement(<408037..>409470)
                     /locus_tag="ZYRO0A05104g"
                     /db_xref="GeneID:8201547"
     mRNA            complement(<408037..>409470)
                     /locus_tag="ZYRO0A05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494547.1"
                     /db_xref="GeneID:8201547"
     CDS             complement(408037..409470)
                     /locus_tag="ZYRO0A05104g"
                     /note="similar to uniprot|P32375 Saccharomyces cerevisiae
                     YIR027C DAL1 Allantoinase converts allantoin to allantoate
                     in the first step of allantoin degradation expression
                     sensitive to nitrogen catabolite repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494592.1"
                     /db_xref="GeneID:8201547"
                     /db_xref="GOA:C5DPP8"
                     /db_xref="InterPro:IPR002195"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="InterPro:IPR017593"
                     /db_xref="InterPro:IPR018228"
                     /db_xref="UniProtKB/TrEMBL:C5DPP8"
                     /translation="MPIKAIGSQRCIIDSRETAATLLYSTDSGKIIEIYNELVPSVDD
                     PRLKLFDVEDFEDVTPKVILPGLVDSHVHLNEPGRTDWEGFATGTRAASSGGVTTVVD
                     MPLNAIPPTINVANFNTKLKAAEGQLWCDVGFWGGLVPGNLKDLIPLVKAGVRGFKGF
                     LMDSGVPEFPPIDKCYIENAMSELSNSKAMVMFHAELDTGSQETSHDNHHQETDSCQY
                     DSFLASRPDRFEFDAISLIIDCLKKSMAANSGKGPSVHIVHLASMEAIPLMRQAHKDG
                     LPITAETCFHYLSLAAEKIGKGATFCKCCPPIRNEKNRLALWEGLRDGSITSVVSDHS
                     PCTPELKQLEKGDFMSAWGGISSVGLGLPLLHTVGSTLNPSVSLMEIVKWCCENTAEQ
                     VGLQHRKGHLRIGYDADFVIFDPNAKQRVTNPTVYFKNKLTAYNGQELIGIVQRTILR
                     GLTIFDVSHGGPSKSPLGKPILEPREH"
     gene            complement(<409797..>412535)
                     /locus_tag="ZYRO0A05126g"
                     /db_xref="GeneID:8201676"
     mRNA            complement(<409797..>412535)
                     /locus_tag="ZYRO0A05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494548.1"
                     /db_xref="GeneID:8201676"
     CDS             complement(409797..412535)
                     /locus_tag="ZYRO0A05126g"
                     /note="highly similar to uniprot|P38217 Saccharomyces
                     cerevisiae YBR017C KAP104 Transportin cytosolic
                     karyopherin beta 2 involved in delivery of heterogeneous
                     nuclear ribonucleoproteins to the nucleoplasm binds rg-
                     nuclear localization signals on Nab2p and Hrp1p plays a
                     role in cell-cycle progression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494593.1"
                     /db_xref="GeneID:8201676"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DPP9"
                     /translation="MWAPNLESLLQLAVLLRSSMAPHQEERRGAMDALESFKIQPEFL
                     NYLCYILIEGESSEALVSHFSAQELQNNRATAGLLLKNTMLDGDNLTKGSQDIGYVKA
                     NIIHGLYNSNNSLVTNVTGIVITTLFSTYYRQHRDDPMGVQMISNLVELASNGSEASM
                     KTLSKIMEDSAQFFQLEWSGHIKPIDNLIACFLDITANGSTTATNRAEAIKCLNTVIP
                     LQPQSFSLRIDEFLNSIFQLAQTDENDDVRVQVCIAFSSLLKFRPDKLVDNLAGLIHF
                     MLHLISTVKEEKVSIEACEFIHSFCTDPNIPEHIIQPFVTDIVPVLLTKMVYNEESIM
                     VLESSNDDDASEEDKDEDIKPAAPRIVKKQRGDGEDSDDDDDDDDSGVDESDVDTQWN
                     LRKCAASTLDVMTNILPRDVMYVAFPFLKEHLDSDRWFIREATVLALGAMAEGGMKYF
                     DDQLPQLIPFLVDQLKDVWAPVRKITCWSLSRFAPWILKDHTEFLIPVLEPVIGRLMD
                     RKKDVQEAAISSVAVFIESCDAELVETVLYDELLNSFNRCFEFYKKKNLIILYDAVSR
                     FAEKVELDERAMKVLLPHLVNKWSLLPDNDKELWPLLECLSYVATSLGEKFMPMAPDV
                     YARAFRILCNCVELEATSQQNPAIVAPEKDFIITSIDMIDGLVQGLGSQCQPLLFPPG
                     SDNTLLQIMLQCLQDPFHEVRQSTFALLGDIVYFFDPQLLAATLSQFLKFIGTEIMHN
                     DDPDGIPALINAIWCLGLISERINLGEYIIDLSRVLLDLFTTQGQILDAAVLENLAIT
                     MGRISITLPEVFSNGLFASDAMWNRWCNALQDLDSLEEKSSAYMGFMNIVNLVGDHVA
                     ISNETLKNIIKGLSINVDPTPFAQSIYTFLMKHAERIQGLKLSQEEVTFLQQFNGN"
     gene            complement(<412875..>414935)
                     /locus_tag="ZYRO0A05148g"
                     /db_xref="GeneID:8201677"
     mRNA            complement(<412875..>414935)
                     /locus_tag="ZYRO0A05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494549.1"
                     /db_xref="GeneID:8201677"
     CDS             complement(412875..414935)
                     /locus_tag="ZYRO0A05148g"
                     /note="weakly similar to uniprot|P27637 Saccharomyces
                     cerevisiae YAR014C BUD14 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494594.1"
                     /db_xref="GeneID:8201677"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ0"
                     /translation="MNQGPSVNAFQGSVSPSLLPAEFGGKLSLEEPDTDLLNDPNLTE
                     NYSDLLKVKPHRRMEPEDESNSGSVVVTGGSPAKKMNDSHRNNQYSHNTNDDNSNDNN
                     SNSNSNSNSNNYDNNSNAGSEDPNNRDQEYDYSDSDFEENLEKRLQDMETEIPGERRA
                     TKNESSGGLGSMYDGLLMALSEDEDDLHLEDDEEDEENMELEDELFEEDELQPLPPPQ
                     ELDPDKLYALYAFSGPDPSHCQLKQDEACTLLNDQDAYWWLVRRYTDSKIGFAPAEIL
                     ETYPERLARLNCWKNENMSPRKNSDTEEQASQEQYTTTDEHSTDDDDDDDDTTAHENN
                     KLSDDDNDGDSNPRLALKGYGKSNKSVSFNDVVSYADRYIQDSDDESDYENDEPTQYD
                     EFSESKLRMGRIGEDNDGNVDLDDDMSEANSDASFNTASMVPLNIEKRRQPSPPQPAL
                     TPPPRHTEVQTGKTGSNEDIAKEINENRNSFIETQGTRDEPQEESQDGLHKIFEAPIL
                     PFGRKNSHLETSNSDSISIGEFSPSSSEWTNDSPQHQQLADHHSPRTLPPSRAIQDLT
                     RIVDTEDDSSTTIHGDSDPKTKSIEENPRQQQQNRRQQQNRNKETPASSSSSSEEIFM
                     EAERAGSSTSVNSASSVSRQLFHSSSVISTTTGKHHPIIDQLYDPIFHRMDDLLKQID
                     DASK"
     gene            <415946..>416869
                     /locus_tag="ZYRO0A05170g"
                     /db_xref="GeneID:8201678"
     mRNA            <415946..>416869
                     /locus_tag="ZYRO0A05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494550.1"
                     /db_xref="GeneID:8201678"
     CDS             415946..416869
                     /locus_tag="ZYRO0A05170g"
                     /note="highly similar to uniprot|P27616 Saccharomyces
                     cerevisiae YAR015W ADE1
                     N-succinyl-5-aminoimidazole-4-carboxamide ribotide
                     (SAICAR) synthetase required for 'de novo' purine
                     nucleotide biosynthesis red pigment accumulates in mutant
                     cells deprived of adenine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494595.1"
                     /db_xref="GeneID:8201678"
                     /db_xref="GOA:C5DPQ1"
                     /db_xref="InterPro:IPR001636"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR018236"
                     /db_xref="InterPro:IPR028923"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ1"
                     /translation="MVVSVAKTELDGIIPLVARGKVRDIYEVDPETILFVATDRISAY
                     DVIMENTVPDKGVLLTKLSEFWFQYLSKDVRNHLVPIPQGKTIFDFLPSELSQEKYKS
                     QLEGRSLLVHKFKLIPLEVIVRGYITGSAWKEYTKTGTVHSLPQPQDLRESQEFPRPI
                     FTPSTKAEQGEHDENISPEKAAELVGQDIADRVEKLAVTLYGKCKEYAKTKGIIIADT
                     KFEFGIDEKTNEIILVDEVLTPDSSRFWNGAHYTVGETQESYDKQFLRNWLTSNKLNG
                     VEGVKMPEDIVEQTRAKYIEAYETLTGTKYN"
     gene            complement(<416951..>418198)
                     /locus_tag="ZYRO0A05192g"
                     /db_xref="GeneID:8201679"
     mRNA            complement(<416951..>418198)
                     /locus_tag="ZYRO0A05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494551.1"
                     /db_xref="GeneID:8201679"
     CDS             complement(416951..418198)
                     /locus_tag="ZYRO0A05192g"
                     /note="highly similar to uniprot|P22209 Saccharomyces
                     cerevisiae YAR018C KIN3 Nonessential protein kinase with
                     unknown cellular role"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494596.1"
                     /db_xref="GeneID:8201679"
                     /db_xref="GOA:C5DPQ2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ2"
                     /translation="MYNRRDLLGDFVSPKQMRTPSPPSSSQYQVLEEIGRGSFGAVRK
                     VLHVPTKKLMVRKEIKYGHMSSKERQQLISECTILSHLKHENIVEFCNWDFEEQHEIL
                     YLYMEFCSSGDLSHMIKHYKQEKKYIPEKIIWGILAQILSALYKCHYGDELSPLTTIY
                     DRMKPPVKRKNIVIHRDLKPGNIFLSADDSGTSADEIHNVDYSQVVVKLGDFGLAKSL
                     GNSIQFATTYVGTPYYMSPEVLMDQPYSPLSDIWSLGCVVFEMCSLHPPFQAKNYLEL
                     QNRIKSGKFDRIPEYYSNGLNAIVHSMIDTNLKTRPSTFELLQDIQIRTARKSLQLER
                     FERNLLDYEKELANIEKILEKQATDYERETAHLREQFVQAVEERAREVLSGKKIGKVP
                     DTIYGYYDKRVPKPAYHWRTRYR"
     gene            complement(<418443..>421268)
                     /locus_tag="ZYRO0A05214g"
                     /db_xref="GeneID:8201680"
     mRNA            complement(<418443..>421268)
                     /locus_tag="ZYRO0A05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494552.1"
                     /db_xref="GeneID:8201680"
     CDS             complement(418443..421268)
                     /locus_tag="ZYRO0A05214g"
                     /note="similar to uniprot|P27636 Saccharomyces cerevisiae
                     YAR019C CDC15 Protein kinase of the Mitotic Exit Network
                     that is localized to the spindle pole bodies at late
                     anaphase promotes mitotic exit by directly switching on
                     the kinase activity of Dbf2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494597.1"
                     /db_xref="GeneID:8201680"
                     /db_xref="GOA:C5DPQ3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ3"
                     /translation="MTERINLTPAQQQQALNRSEQSVKQEPQKRNQIQYQLKQVIGKG
                     SYGVVYKAINRKTQKLVAIKEVHYENDDELTDIMSEIDLLKNLNHINIVKYHGFIQKS
                     HNLYIILEYCSHGSLKNYISRGNGLPESKAKVYVKQTLNGLNYLHEQGVIHRDIKAAN
                     LLLDSNNVVKLADFGVSTKVNTMTMAMTLAGSLNWMAPEIIGNRGASTLSDIWSLGAT
                     VLEVLTGNPPFYNLVDINIYYAIENDAFIPPSFISKEAQDFLSTCFQKNMYQRPTAAQ
                     LLRHKWVAGESPANKLELFKESNNEMDFQWDHDFKEPLHDPSLANPSSQHTSVPTSYL
                     PSLAKTRVNYSSASSVSSSSLVTTVTGSSESKTHGDPSTPHRSMHRTAANVEWAKGIL
                     DNLGKGTVRLTSDVLSILFENLDGEDISQSIIHLLRDSSNENMIISLFEYDKKFNFGN
                     LKKKFISMGGVPSVLEYNNIIEQFFLKDNYKVLIQCGILYRTHILKDSITLELAYKFL
                     DIVDSPQFWCQWCSKHVKVPNLIANLTNKSTQSIVLKLSSFPEASSWFPKQFIENILK
                     LPPTTEQPMYTIFKALTSILIQLHNSTAAEIVAATPSKVPTTTAPSMELPEAFLPWIL
                     GFFEDSKFCDEENSYVWKYYMSVIYHATHLNRLLLNQLLNNTNFINLILRLLTTRAKS
                     LQLLHVPLSIVMEISTELTEFHPVLVELSLHFLRSHEEFIVGGLEILLNSLQFALHDT
                     TKFISHPDSLAIEFPSGSSGKPSVLLTYRDLVEPFFRIKENNLEFGNFITKFMKICLL
                     TPLAFISFKIFSHSSFNERLTAFFMLYRNSLLIQIDLLKFVKLIIARSLEYLSTLKER
                     DLSAEVVIKKRLEVMMDFLDRNWNHQIEGQVGCDSILIHQLCNDIKSFATASPSSFAI
                     PSVRRQQSKSRFNLSLQNDAFDIPDRT"
     gene            <422152..>424197
                     /locus_tag="ZYRO0A05236g"
                     /db_xref="GeneID:8201681"
     mRNA            <422152..>424197
                     /locus_tag="ZYRO0A05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494553.1"
                     /db_xref="GeneID:8201681"
     CDS             422152..424197
                     /locus_tag="ZYRO0A05236g"
                     /note="similar to uniprot|P80235 YAR035W Saccharomyces
                     cerevisiae YAT1 Outer carnitine acetyltransferase
                     mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494598.1"
                     /db_xref="GeneID:8201681"
                     /db_xref="GOA:C5DPQ4"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ4"
                     /translation="MPDLPRLPIPPLRETLNRYLARVEPLQEDRQNNKTRECVLSDDN
                     LKMMQKLHEHLLEYDKQLAREKPQSSYIEDFWYDAYLMYEASVVLNVNPYFLLEDDRT
                     IKNVMGCYGEYTCQVKRAAKLIFSILKFIKEIRHENLRPDVVRGKTPLSMDQYAKLFG
                     CSRIPAGPGEKSCHLQVDPTSHHVMVTYKSQFYWFDVLDVNNIPIFSTPEPIEWNLYS
                     IIMDSEQSEASRPPFGVFITENRRVWSNVRDYIFHDSDPTNWKNLKIIDSALFVICLD
                     DASFTEDNELIKSMLCGTSQIRLGPNDLAKPLDAQHGTCLNRWYDKLQLIVTQNGKAG
                     INFEHTAVDGHTVLRLAADIYTDSILGFARGVTKNVPDVFTETSESDSENVNLNLITI
                     PRKLEWKVDPFILSSLHFAETRISDSVSQHEFAALDFTKYGSNHIKASFQCSPDALVQ
                     QVFQVAYYALYGKFETTYEPAMTKQFTNGRTEAIRSVTSESKKFVKSMFDRYAIDEHR
                     IRFLRRACNKHSQIIKECSEGLGQDRHLYALYCIWNEYYKDTMPLPPIFSDKSWSIHN
                     STVISTSNCGNPCLKSFGFGPVTPNGFGIGYIIRDNSISLVVSSRHRQTNRFASLIEH
                     SLLEIDHVFQRRSAADSEISAVTPSTRHGFGRLEQQRSDSLVHLLSGYNYFDVNVSG"
     gene            <424968..>429614
                     /locus_tag="ZYRO0A05258g"
                     /db_xref="GeneID:8201682"
     mRNA            <424968..>429614
                     /locus_tag="ZYRO0A05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494554.1"
                     /db_xref="GeneID:8201682"
     CDS             424968..429614
                     /locus_tag="ZYRO0A05258g"
                     /note="some similarities with uniprot|Q12451 Saccharomyces
                     cerevisiae YDL019C OSH2 Member of an oxysterol-binding
                     protein family with seven members in S. cerevisiae family
                     members have overlapping redundant functions in sterol
                     metabolism and collectively perform a function essential
                     for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494599.1"
                     /db_xref="GeneID:8201682"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ5"
                     /translation="MDRDSVAIISPGGQSYSSSSNLDPQLDRTRSQSTGNESGEHDVA
                     LASKPLLKLKLLDSLRQGNFKQLEALIKNEFQPVGDPNVEEVRNLVLHYAVQVAPAAL
                     IKDIVREWANNTRGGITIDINYRDENGDTPLHLSAFQSRGDVIEFLMDQPHVNDCILN
                     NSHLQPVEMCRNLSIAHMMQAKRATYVAEIAQEFRTAFNNRDFGHLDSILVNPRNAEL
                     LDINGMDPETGDTVLHEFVKKRDVIMCRWLLEHGADPFNRDRQGRLPVDLVGKVNEND
                     SATNTKVAIDIELKKLLGKAAKEQSVIDVTNNLHEPPTHKGYLRKWTNFAQGYKLRWF
                     ILSGDGKLSYYKDQADTRNACRGSLNMSTCYLHLDSSEKLKFEIIGGSNGAIRWHLKA
                     NHPIETNRWVWAIQGAIRFAKDRELLMKSGTVPPSLAMSRGLNAGGRYDSPLYSSQLQ
                     YNQGGGKNSQLLDEELGVSDGSAQQGRMPSSSDHRNKRVSTASITSNDLRLNNNLTES
                     GKEYVNRMVGNRLDSSSREGRSRTNSNLSHNHANERSGHNSLVGGVAGHPGNSQINNQ
                     KRQVNETQGEDRLPQQQSQQEEQQYYGHHQTNANVQPKKSTPLEASSTQLTSTARTPE
                     HAGGAFEPAPTDSIDSHVPSNEDELDNFSDEEEDNQDRNSNFDVDDEDVKTQYGPYSQ
                     RLSMLQRSLSMELSSLKELLDTGHPSEEAWGMLRKSLGSISNTFEKLYFLTSSRDKKL
                     GSLLAKQREVNNVWIQSVKDLELELIEKSNRLASLDKERRGLKKLLHKKLSEAGASTD
                     GSQFDSTTSRQVDDSNATLEGIAKFIEATREEDEESDAEVFFDAEDLVDASDEDEERY
                     PSESTNQTKPDSSEGSIPQHGDRSYGNKKEEEGKSQNRDTDYNGKDAEQKFSINEPPS
                     TAPPPVPSTHEDTTSQKVPEEVRPESQYSSSDQTRISSASHNRNPFRETEGQYAAEGA
                     SKNNEDIGKETENFERNEGQAGGAPSSNELKQLNTKVPDERSRKEPSSTGSPVEMARD
                     KVGTPQEPQVLRPQGKRPPKDVGSGAAVAGGVAAGAGGAAGVSKSDSTKNQKEDFGPR
                     HDSNQSSMKKPSANKPEQQDGTAQDNELMNLPMVGETEKQKQKYSVILKEGSFKGYED
                     GVRKRLRIDDDDRPAISLWSVLKSMVGKDMTRMSLPVTFNEPTSLLQRVAEDLEYSDL
                     LDTASTFEDSSLRMLYVAVFTASSYASTVKRVAKPFNPLLGETYEYCRPDKGYRFFTE
                     QVCHHPVVSATWTESAKWDFWGESNVDTGFNGRSFNIKHLGLWYIKMRPDSSEGEELY
                     TWKKPNNTVIGILVGNPQVDNNGEVEVVNHTTGDRCLINFRARGWRSQGAYEVTGEVF
                     DKNNNKKWILGGHWNDAIYAKMATPKNDSDIMKTKDTSSTGPKFDGSKFLVWKASPRP
                     EAPFNLTPFAITLNAPQPSLVPWVAPTDTRLRPDQREMEDGVYDKAGDEKHRLEQKQR
                     MVRRKRAETGEVHKPVWFHKEVHPVTKSEYWQFNGDYWKLRKDHKLKEVCPDIF"
     gene            <430218..>431873
                     /locus_tag="ZYRO0A05280g"
                     /db_xref="GeneID:8201683"
     mRNA            <430218..>431873
                     /locus_tag="ZYRO0A05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494555.1"
                     /db_xref="GeneID:8201683"
     CDS             430218..431873
                     /locus_tag="ZYRO0A05280g"
                     /note="similar to uniprot|Q6B2F0 Saccharomyces cerevisiae
                     YOL055C THI20 Hydroxymethylpyrimidine phosphate kinase
                     involved in the last steps in thiamine biosynthesis member
                     of a gene family with THI21 and THI22 functionally
                     redundant with Thi21p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494600.1"
                     /db_xref="GeneID:8201683"
                     /db_xref="GOA:C5DPQ6"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR004399"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR027574"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ6"
                     /translation="MTLSISINTPPPYLVLNKNEQLPVVMTVAGSDSSGGAGIEADIK
                     TITAHRCYAMTCMAALTAQTPAKVYSIHPLPKEFISQVLDANLKDMNCDVIKTGMLTA
                     NAVEALAAKLDSMGSKRPKLVIDPVLVATSGSALSSEELIELVKEKITPLADLLTPNI
                     YECFKLIGSEFELQNVSDLYELARRVSVATKSRNILVKGGHIPWGQDGKNFVTDVLYL
                     SQEDKFVVYNGPRILTTATHGTGCTLASAIASNLARGYPIAQAVYGGIEYVQSGVSIS
                     CQVASSHIKDNGPINHVYAVEVPLEGMVQDECFTARDVIPSTVNQTVSDIIKGDFFEY
                     LISHPKVKPHWESYIHHDFVRQVAQGTLPIHKFQFFIEQDYAYLLDYARVHCIAGSKA
                     PSLDDVEKELVIVGGVKNEMSQHEKRLKQEFGVSDNSYFDRIERSQALKAYSRYFNDV
                     AKRGNWQELVASLSPCLMGYGEALLHFRSDIVVEEGTVYREWCDTYLSPWYVDGMEQG
                     KSLLNQIARTYPADQLDNLVSIYANVCELETNFWGSALEHRVE"
     gene            <432548..>433843
                     /locus_tag="ZYRO0A05302g"
                     /db_xref="GeneID:8201684"
     mRNA            <432548..>433843
                     /locus_tag="ZYRO0A05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494556.1"
                     /db_xref="GeneID:8201684"
     CDS             432548..433843
                     /locus_tag="ZYRO0A05302g"
                     /note="some similarities with uniprot|Q03465 Saccharomyces
                     cerevisiae YDL020C RPN4 Transcription factor that
                     stimulates expression of proteasome genes Rpn4p levels are
                     in turn regulated by the 26S proteasome in a negative
                     feedback control mechanism RPN4 is transcriptionally
                     regulated by various stress responses"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494601.1"
                     /db_xref="GeneID:8201684"
                     /db_xref="GOA:C5DPQ7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ7"
                     /translation="MTSTELDLKRTLTDVLEDELYNINYHGQNSRRNVLGLSLPAEFD
                     ETMLNGEFWNQQQQPQQQPQQDQQIEWNQSQDENNIFNKYADPSLTTTSSHLKNDNNN
                     VATTPVQGTVNLNSVMKVNNPFLNMRYQLPYDVKITNDYHDEADSIYSPQADEDPIGF
                     DGSNNPKMQWPLQDNNMALSNEDARMIFDHEFAADDDDLSDEDDDEDGNEDENQKVFD
                     ACDFVDGTKGFGAQDSSDQAIMDDEDDDLIDEDELYEPSIRNGRKESVVTTPQAAIVE
                     PSPPITTSTSSSAFTPSDSRSSNNNSRSRRKLPITDTNSNNNNLTSTGSHHNSSSSNN
                     GEIYTCLILNNITRQPCSAQFSRSYDLTRHQNTIHAKKKTVFRCSECIRMLGHDGYQK
                     TFSRLDALTRHIKSKHENLSLEQRQEVTKYAKENIGYVV"
     gene            complement(<434078..>434983)
                     /locus_tag="ZYRO0A05324g"
                     /db_xref="GeneID:8201685"
     mRNA            complement(<434078..>434983)
                     /locus_tag="ZYRO0A05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494557.1"
                     /db_xref="GeneID:8201685"
     CDS             complement(434078..434983)
                     /locus_tag="ZYRO0A05324g"
                     /note="highly similar to uniprot|Q12326 Saccharomyces
                     cerevisiae YOL056W GPM3 Homolog of Gpm1p phosphoglycerate
                     mutase which converts 3-phosphoglycerate to
                     2-phosphoglycerate in glycolysis may be non-functional
                     derivative of a gene duplication event"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494602.1"
                     /db_xref="GeneID:8201685"
                     /db_xref="GOA:C5DPQ8"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR005952"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ8"
                     /translation="MTIESNTFKLILLRHGQSELNHENIFCGWIDAGLTQKGKDQAKN
                     AANLIIDYCQTHSIPLPQVGYISRLVRTRQTMEVILAEMNLKGSYEVVSGSNYEPKGQ
                     LKQGYTSVLETWRLNERHYGSWQGKRKPDVLKEYGEDQYMYIRRDYEGKPPHVDLNRE
                     MLQEVNDQGSSTGYDFKEPNRHLKYNIEEQIGEELPASESLKDVVQRLEPFIRNVVIP
                     TSQKNNLDSSLIIGHGSSVRSILKILQGISDEDIKSVDIANATPLVVELDKQNFTFVR
                     RYYLDPEKAKIDAEKVRREGFQSNP"
     gene            complement(<435197..>437278)
                     /locus_tag="ZYRO0A05346g"
                     /db_xref="GeneID:8201870"
     mRNA            complement(<435197..>437278)
                     /locus_tag="ZYRO0A05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494558.1"
                     /db_xref="GeneID:8201870"
     CDS             complement(435197..437278)
                     /locus_tag="ZYRO0A05346g"
                     /note="similar to uniprot|Q08225 Saccharomyces cerevisiae
                     YOL057W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494603.1"
                     /db_xref="GeneID:8201870"
                     /db_xref="GOA:C5DPQ9"
                     /db_xref="InterPro:IPR005317"
                     /db_xref="UniProtKB/TrEMBL:C5DPQ9"
                     /translation="MVNSVADRDAPISMLSVRDYFPQLSKQKQLYAHYMSKASHAGTR
                     IVLRQVSKESESIYDTLLYVHLQLDGNYPDEPETKLYLDYFSQFLSNLGNYKSFGDAK
                     FVPGCSKEFFTKILKSASLKLENPPPSGSKDFNTLGQLVDEGIYFINEKIAFLGYPSE
                     GFVSSYYLGGKVSAEDMALLKQEVFGRLGILPENTRIEKLKEKEFAIWVASENKTNTL
                     APTYPNSNFTLSNGSTVSFKFGDHSRELGIVASYLQKAKEYAANDTQRHMLDQYIDHF
                     TSGSSHAHKEAQKLWVKDISPAIETNIGFIETYREPSGIIGEFESLVAIQNEERTAKF
                     STLVSNAQDFITLLPWDSAFEKNEFHPPDFTSIEVLTFAGSGIPAGINIPNYDDVRLN
                     VGFKNVSLGNILSASAKGSSTHPPSFIAPEDRPIYDKCQGDSFEVQVGIHELLGHGSG
                     KLLSETKDGFNFDKENPPLGLDGKPVTTYYKLGETWGSKFSSVAGSFEECRAEVIAMY
                     LITNRKLLEIFGFKTKEDQDNIIYAGYLQMARAGLLALEYWDPESGKWGQPHMQARFS
                     IMKTFLKHSPNPKFLQIEPLDDGKDLVIRLDKSLIETAGHECVKDYLQHLHIYKSTAD
                     VENGSKYYNERSQVTPDLAKLRDLVVSKRLPRKQFVQANTILTPSGEVELKEYEETPF
                     GLIKSFIERET"
     gene            complement(<437507..>438766)
                     /locus_tag="ZYRO0A05368g"
                     /db_xref="GeneID:8201871"
     mRNA            complement(<437507..>438766)
                     /locus_tag="ZYRO0A05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494559.1"
                     /db_xref="GeneID:8201871"
     CDS             complement(437507..438766)
                     /locus_tag="ZYRO0A05368g"
                     /note="highly similar to uniprot|P22768 Saccharomyces
                     cerevisiae YOL058W ARG1 Arginosuccinate synthetase
                     catalyzes the formation of L-argininosuccinate from
                     citrulline and L-aspartate in the arginine biosynthesis
                     pathway potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494604.1"
                     /db_xref="GeneID:8201871"
                     /db_xref="GOA:C5DPR0"
                     /db_xref="InterPro:IPR001518"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR018223"
                     /db_xref="InterPro:IPR023434"
                     /db_xref="InterPro:IPR024074"
                     /db_xref="UniProtKB/TrEMBL:C5DPR0"
                     /translation="MSKGKVCLAYSGGLDTSVILAWLLEQGYEVVAFLANVGQEEDFD
                     AAREKALKIGASKFVCVDCREDFVKDILFPAVQVNAVYEDVYLLGTSLARPVIAKAQI
                     DVAEAEGCFAVSHGCTGKGNDQIRFELGFYALKPDVKVIAPWRLPEFFERFAGRKDLL
                     EYAASKGIPVTQTKSKPWSTDENQAHISYEAGILEEPDTTPPKDMWKLITDPEDAPNK
                     PQDLSIDFQEGLPVKVTYQDSEGKSHTVTSPSDIFLTVSNLGRANGVGRIDIVENRYI
                     NLKSRGCYEQAPLTILRKAHVDLEGLTVDREVRHLRDQFVTPTYSKLLYNGAYFTPEC
                     EYVRSMIKPSQTTVNGTVRMRLYKGNAMVLGRSSSTENLYDPTESSMDELTGFSPIDT
                     SGFINIQAIRIKKYGESKKSKNQKFTL"
     gene            complement(<439160..>440329)
                     /locus_tag="ZYRO0A05390g"
                     /db_xref="GeneID:8201872"
     mRNA            complement(<439160..>440329)
                     /locus_tag="ZYRO0A05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494560.1"
                     /db_xref="GeneID:8201872"
     CDS             complement(439160..440329)
                     /locus_tag="ZYRO0A05390g"
                     /note="highly similar to uniprot|Q00055 Saccharomyces
                     cerevisiae YDL022W GPD1 NAD-dependent glycerol-3-phosphate
                     dehydrogenase key enzyme of glycerol synthesis essential
                     for growth under osmotic stress expression regulated by
                     high-osmolarity glycerol response pathway homolog of
                     Gpd2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494605.1"
                     /db_xref="GeneID:8201872"
                     /db_xref="GOA:C5DPR1"
                     /db_xref="InterPro:IPR006109"
                     /db_xref="InterPro:IPR006168"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR011128"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017751"
                     /db_xref="UniProtKB/TrEMBL:C5DPR1"
                     /translation="MAATDRLNQTSDILSHSMKKTDSSMSIVTAENPYKVAVVGSGNW
                     GTTIAKVVAENTKEKPELFQGRVDMWVFEEQIDGTPLTQIINTKHQNVKYLPNIDLPE
                     NLVANPDLISTTKDADVIVFNVPHQFLGRIVSQMKGQIKPDARAISCLKGFEVGPKGV
                     QLLSDYVTQELGIQCGALSGANLAPEVAKEHWSETTVAYQVPDDFKGEGKDIDHRVLK
                     QLFHRPYFHVNVIDDVAGISIAGALKNVVALGCGFVTGLGWGNNAAAAIQRVGLGEII
                     KFGRMFFPESKVETYYQESAGVADLITTCSGGRNVRVATEMAKTGKSGEQVEKDILNG
                     QSAQGLITAKEVHQWLESSGHTEEYPLFEAVYQITYENVPMKELPSMIEELDIVE"
     gene            <441743..>442381
                     /locus_tag="ZYRO0A05412g"
                     /db_xref="GeneID:8201873"
     mRNA            <441743..>442381
                     /locus_tag="ZYRO0A05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494561.1"
                     /db_xref="GeneID:8201873"
     CDS             441743..442381
                     /locus_tag="ZYRO0A05412g"
                     /note="highly similar to uniprot|Q12314 Saccharomyces
                     cerevisiae YOR021C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494606.1"
                     /db_xref="GeneID:8201873"
                     /db_xref="InterPro:IPR007364"
                     /db_xref="UniProtKB/TrEMBL:C5DPR2"
                     /translation="MKYVIEHMEHGFSEWVTLEYAQIIREVGSENLILSSLPQGTETK
                     DIPQQLLELGLRWTTCDLLHLRESFQDLVPLSNGRVCLLDPRASQDIQPDESASFDYF
                     VFGGILGDHPPRDRTSEIKNQYPNLVVGRRLGDKQMTTDTAVRTTQLIVEKKVALDKI
                     RFIDYPEFRFNANEATEMPFRYVIDEKGEPILPAGMMELIKKDSEQSLDDLL"
     gene            <443422..>443739
                     /locus_tag="ZYRO0A05434g"
                     /db_xref="GeneID:8201874"
     mRNA            <443422..>443739
                     /locus_tag="ZYRO0A05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494562.1"
                     /db_xref="GeneID:8201874"
     CDS             443422..443739
                     /locus_tag="ZYRO0A05434g"
                     /note="highly similar to uniprot|P38910 Saccharomyces
                     cerevisiae YOR020C HSP10 Mitochondrial matrix
                     co-chaperonin that inhibits the ATPase activity of Hsp60p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494607.1"
                     /db_xref="GeneID:8201874"
                     /db_xref="GOA:C5DPR3"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR018369"
                     /db_xref="InterPro:IPR020818"
                     /db_xref="UniProtKB/TrEMBL:C5DPR3"
                     /translation="MSTLLRSAKSIAPLLDRVLVQRIKAQPKTASGLYLPEKNVEKLN
                     QAKVLAVGPGFTDNNGNKVTPQVQAGDQVLIPQFGGSTIKLQSDEEVLLFRDTEILAK
                     INE"
     gene            complement(<443792..>445051)
                     /locus_tag="ZYRO0A05456g"
                     /db_xref="GeneID:8201875"
     mRNA            complement(<443792..>445051)
                     /locus_tag="ZYRO0A05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494563.1"
                     /db_xref="GeneID:8201875"
     CDS             complement(443792..445051)
                     /locus_tag="ZYRO0A05456g"
                     /note="weakly similar to uniprot|Q03338 Saccharomyces
                     cerevisiae YDR473C PRP3 Splicing factor component of the
                     U4/U6-U5 snRNP complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494608.1"
                     /db_xref="GeneID:8201875"
                     /db_xref="GOA:C5DPR4"
                     /db_xref="InterPro:IPR010541"
                     /db_xref="InterPro:IPR013881"
                     /db_xref="InterPro:IPR027104"
                     /db_xref="UniProtKB/TrEMBL:C5DPR4"
                     /translation="MPAKKDDSAKGRNRGLQTEINPLLLSSNPNLIRRQYRGQNPYLS
                     TYGVEDKKIRKRFEKGLKFHEKGEISANIERERELLKAEKEQELKRREFEAQRREEVR
                     KKVECGELPDTSIGEEKFAPREVPIVEWWDKPFLDDQLNILSKYTADTIAADDEESED
                     EDDERPSIRYVEHPVPIKADSSRPVAKVYLTKSEQKRIRRNRRKLQREEHETRIKMGL
                     EPKLEPKVSLRNMMSVYENNQNITDPTAWESTVRQQVASRKRKHEEMNAARHEEAQQN
                     KKAKNETITPGDHCKVFRFQNLSNPRIRFKLKTNAQQLSLKGLCLRVGENGSGIIVIV
                     GSEKSCKFYDKLVTRRIHWDETFENKETHETADMSGNHAEKVWEGEWEGPSWGPFFMK
                     ICQDRQEMEELLRQRNAEHLITSINGK"
     gene            complement(<445269..>447572)
                     /locus_tag="ZYRO0A05478g"
                     /db_xref="GeneID:8201876"
     mRNA            complement(<445269..>447572)
                     /locus_tag="ZYRO0A05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494564.1"
                     /db_xref="GeneID:8201876"
     CDS             complement(445269..447572)
                     /locus_tag="ZYRO0A05478g"
                     /note="some similarities with uniprot|Q99248 Saccharomyces
                     cerevisiae YOR019W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494609.1"
                     /db_xref="GeneID:8201876"
                     /db_xref="UniProtKB/TrEMBL:C5DPR5"
                     /translation="MSVQNDNDDVLKNAYRHIKLYADLSEVNAKHPKYNPNDERQFRP
                     CVSFNTVPLTLGSSALDDPLADFPGVQIPPEFSLDDLCSNEGIARTVANTHNDYYSPR
                     GPASQNKRLTHKSLAESFKRSENGKIVRVDYPSEPAIFNDALILTKSKNQWHHLWNEK
                     KAYFAAKLDEKYKWFQYPTILFPPTGTKSAVMSSDGFIPLSKEQRRKEKVLNLKLGHL
                     PNPRTILCHISGRRHTWVALDWALRQLAQDTDYIVVVASLPRFSSSVNDRSRSKIRGG
                     SSQYRSLSVGPNSGENETIHQNFIGWSSGYNRYDVESKIMDIFEYIKVILPPKLAVKI
                     TVDVVVGKTKKVMVDAVNCYTPDFCVEGTLKWERTDKLVVYKSRFLKDVLCTKFSVPV
                     FIVPAKRLYDFEAKMEREFLPKVTDVGGITAEELKPSPLTMETLSRTKTEPSNFDSRD
                     SLVLNYSSAEKSSVDYDTDDDSGEDSGDYSDKDDMTVSEKLSSARLIHRKNMMKELQS
                     VESNDKLDYAQKKVGALDSIIKETLEFSEELKSITEEDFKGDEGEELNQLKRVITGST
                     RVLPNSKKSMLDVLDTPGPDSPDHHKRSTAPRRKPRSGQIKFAPNVNAKDGNKALGNS
                     RGKGYLDVARPSLGSQSYSYNQIDGAGKPYNEEELRRVSTGDGTVPLRKVVSANNVAR
                     VKSNDSNSLLPIHSSGSVPGSRSSSSRRNRHSKKSSGGGGLLSFLIPSGSRSHSHSRR
                     SSSDSDGERSSVKSPQEGKKKRSFFGW"
     gene            complement(<448060..>448785)
                     /locus_tag="ZYRO0A05500g"
                     /db_xref="GeneID:8201877"
     mRNA            complement(<448060..>448785)
                     /locus_tag="ZYRO0A05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494565.1"
                     /db_xref="GeneID:8201877"
     CDS             complement(448060..448785)
                     /locus_tag="ZYRO0A05500g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494610.1"
                     /db_xref="GeneID:8201877"
                     /db_xref="GOA:C5DPR6"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPR6"
                     /translation="MMDWGCLKSWFEHIWYKVASIFLFQKELSIAVIGLQNSGKTTFV
                     QLLSGKPFQVDTVPTLGIQSEKFTLGNNSVNVYDLAGQTRFQPLWERCFDKVDLIVYM
                     IDLSDLHSLEESFTKLTKVIQMTNDDRIPLLIMGNKTDAIPDAIANQNYSTRCLPETL
                     LTDYNYDTIECCKLEPSNLHQLKSVESLSKQLGIDLRNRLLHVPFGSATEPLPLDRDI
                     AIFTVSCKTGGFIKDVMDWIVQL"
     gene            complement(<448960..>449613)
                     /locus_tag="ZYRO0A05522g"
                     /db_xref="GeneID:8201878"
     mRNA            complement(<448960..>449613)
                     /locus_tag="ZYRO0A05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494566.1"
                     /db_xref="GeneID:8201878"
     CDS             complement(448960..449613)
                     /locus_tag="ZYRO0A05522g"
                     /note="similar to uniprot|Q03362 Saccharomyces cerevisiae
                     YDR476C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494611.1"
                     /db_xref="GeneID:8201878"
                     /db_xref="InterPro:IPR019595"
                     /db_xref="UniProtKB/TrEMBL:C5DPR7"
                     /translation="MAVGNVQDLLANMNKKHKLALEDYLYVFGGVSSSEKVLNVRLLN
                     LDSQCMTILFNHKDIEYDIEKIIIFEPPLEDRSEATARLNRMAREAAAKRHLAHFQIN
                     DMVYPQSFIEYLVLLGVFLPMLCYKFRPLLYWLPIPLHIRQWLDNDVILRTIMLLEVL
                     MHLAETLIFLRPKLQFYRVPPDFLIEWYLFGILEGFAPVKRLSRMAARVEATGNIEN"
     gene            <450809..>452704
                     /locus_tag="ZYRO0A05544g"
                     /db_xref="GeneID:8201879"
     mRNA            <450809..>452704
                     /locus_tag="ZYRO0A05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494567.1"
                     /db_xref="GeneID:8201879"
     CDS             450809..452704
                     /locus_tag="ZYRO0A05544g"
                     /note="highly similar to uniprot|P06782 Saccharomyces
                     cerevisiae YDR477W SNF1 Protein serine/threonine kinase
                     required for release from glucose repression invertase
                     expression sporulation and for expression of
                     catabolite-repressed genes when glucose is limiting
                     regulates Adr1p-dependent transcription primarily at the
                     level of chromatin binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494612.1"
                     /db_xref="GeneID:8201879"
                     /db_xref="GOA:C5DPR8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR013896"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:C5DPR8"
                     /translation="MNGSAAVSSSGTGSSSERHHRHHHHRHHHHGQGNGHSQQNLLAD
                     GSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGRIEREISY
                     LRLLRHPHIIKLYDVIKSKDEIIMVIEYAGNELFDYIVQRDKMSEEEARRFFQQIISA
                     VEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV
                     ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSEGAA
                     GLIKRMLIVNPLNRISILEIMQDDWFKVGLPTYLIPPELKQQEQEQQQQQEQHDDGTK
                     NNSEEIDDELVTALSKTMGYDRDEIYESLESRDRTSVLNEIREAYMLIKENKSLIKDL
                     KSDRDRSDELDTFLAQSPPTFQQRGDQNLPPVPPLQLQSSPQQHQPNVSRKIATQQRA
                     YNVAPFNDTNNEEDSTISILPTSLPQIHRANMLAQGLPAASKISPLVNKKSKTRWHFG
                     IRSRSYPLDVMGEIYIALKNLGAQWAKPSEEDLWTIRVRWKYDVGQNHNERIPDLMKM
                     VIQLFQIETNNYLVDFKFDGWESSSGEVAHNPNLSEDEMSTFSAYPFLHLTTRLIMEL
                     AVNSQGG"
     gene            <453204..>454574
                     /locus_tag="ZYRO0A05566g"
                     /db_xref="GeneID:8201656"
     mRNA            <453204..>454574
                     /locus_tag="ZYRO0A05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494568.1"
                     /db_xref="GeneID:8201656"
     CDS             453204..454574
                     /locus_tag="ZYRO0A05566g"
                     /note="similar to uniprot|P53687 Saccharomyces cerevisiae
                     YOR025W HST3 Member of the Sir2 family of NAD()-dependent
                     protein deacetylases involved along with Hst4p in
                     telomeric silencing cell cycle progression radiation
                     resistance genomic stability and short-chain fatty acid
                     metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494613.1"
                     /db_xref="GeneID:8201656"
                     /db_xref="GOA:C5DPR9"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DPR9"
                     /translation="MVSLLLSQSSRESSFDESDASMGSRLTPQKNQTTSPKLDLRTER
                     LYVIKELDTNDEKLIQINKMLNRSRKITVLTGAGISCNAGIPDFRSSSGLYEMVKKQF
                     PEISMRSGQEMFDISLFRDELKISMFATFMEKLYSSVKLAQPTKTHRFIAHLKNRNKL
                     LRCYTQNIDGLEENLGLEMSTNEQDPGVIGTSFNARWKNYDVVQLHGDLKTLACTRCF
                     HVFPWNRYWCRSFRRGELPTCPQCEEKNFKRCQEGKRQIDNTGCLRPNIVLYGENHPS
                     SDSIAQGLNLDISRGRSDFFIILGTSLKVDGIRKVVRQIAKQVHERGGIVLLINKTSI
                     GDSSWHGLIDYQILTDCDSWVAHLQEQLPDFFKTQETIDRQKMLKRESSDLRKKKAAE
                     QLAKNHIKTPPATPSRVKSEQEETSKNSIQNVKKRLLNVNDEIPSKKSRTNQAPIESP
                     STYANP"
     gene            <454740..>455297
                     /locus_tag="ZYRO0A05588g"
                     /db_xref="GeneID:8201657"
     mRNA            <454740..>455297
                     /locus_tag="ZYRO0A05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494569.1"
                     /db_xref="GeneID:8201657"
     CDS             454740..455297
                     /locus_tag="ZYRO0A05588g"
                     /note="some similarities with uniprot|P40993 Saccharomyces
                     cerevisiae YDR478W SNM1 Subunit of RNase MRP which cleaves
                     pre-rRNA not shared between Rnase MRP and nuclear Rnase P
                     in contrast to all other Rnase MRP protein subunits binds
                     to the NME1 RNA subunit of Rnase MRP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494614.1"
                     /db_xref="GeneID:8201657"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:C5DPS0"
                     /translation="MSMNRSQAEKFKDIHLNHKYNLIHMLPSTEVPALSGFYLKSFYN
                     GTKRYRLRLPESIVEPDSKFCGNCGAVRIPLFNTDMSITESNNEATSESTRTLQYTCL
                     HCKNQAQVAPVRVQKQTPVNVKQSVGAKEEEQKQDKVNKKTSSARERAKKRKKSTLSD
                     MLSQKNEEKKSKSFSLSLESMIQND"
     gene            complement(<455364..>456959)
                     /locus_tag="ZYRO0A05610g"
                     /db_xref="GeneID:8201658"
     mRNA            complement(<455364..>456959)
                     /locus_tag="ZYRO0A05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494570.1"
                     /db_xref="GeneID:8201658"
     CDS             complement(455364..456959)
                     /locus_tag="ZYRO0A05610g"
                     /note="similar to uniprot|Q03370 Saccharomyces cerevisiae
                     YDR479C PEX29 Peroxisomal integral membrane protein
                     involved in regulation of peroxisome size and number
                     genetic interactions suggest that Pex28p and Pex29p act at
                     steps upstream of those mediated by Pex30p Pex31p and
                     Pex32p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494615.1"
                     /db_xref="GeneID:8201658"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:C5DPS1"
                     /translation="MSVKLGSGKPSGSSSGGATSTGSSSAGNGSGSSLSSAGIQKLLT
                     DNLVEKIMRMALPPGSDVAINSLAKRKQFAKDRPGLSVNTMSRNFRLMNARLSQPFAI
                     LDEIIEVFSWANPAYTISIMLIYTHAVMKPLPTLTSLPIFYLLFGVMVPHYLYMHKPN
                     YSMYLDGNPTPAQGLPLRKPVVPKPVPELSQEFILNLTDLQNHMMIYVSFYDFISVWL
                     TKFAYFTNEKISTAVFFILLVVGLINALFLDTLSKHLPVKGFFVAFGWFLAFMLHPKF
                     REWFLSRVNSEETRLRVLTLTNRFENIINEHLRYTEVRENKLVSVFEIQKFSEKDKCW
                     VLVGFSNDDYTLFSDLRIEQEDIALHCAPTLEEVKPPVEWEWVEAEDSWALDLEPIEW
                     VEQGFIQYVDIDMGTKWVYDLTLEGKRGGYRRRMWTNVCARQMDYHYVDTNGEEEEVV
                     EEDDMVNLARVENYSHGHRRVSRDSMSGSSTHSEETKPAIDRSESNNSINSVISPASP
                     KKLPKGESFSGLGSLTDLLNMTV"
     gene            <457286..>458269
                     /locus_tag="ZYRO0A05632g"
                     /db_xref="GeneID:8201659"
     mRNA            <457286..>458269
                     /locus_tag="ZYRO0A05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494571.1"
                     /db_xref="GeneID:8201659"
     CDS             457286..458269
                     /locus_tag="ZYRO0A05632g"
                     /note="similar to uniprot|P26449 Saccharomyces cerevisiae
                     YOR026W BUB3 Kinetochore checkpoint WD40 repeat protein
                     that localizes to kinetochores during prophase and
                     metaphase delays anaphase in the presence of unattached
                     kinetochores forms complexes with Mad1p-Bub1p and with
                     Cdc20p binds Mad2p and Mad3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494616.1"
                     /db_xref="GeneID:8201659"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DPS2"
                     /translation="MAVHDVVEVDEVAEDYLSDVVIMGSLRQLVVTAWDGTLSIYDYD
                     EQERRVSLNTVLRHAFPLLSCCVLFPSGGYKPEIYCGDVQGQVLLVDLELGKFIPMGG
                     NTAQLGISSLCSYKNQVICGSWDGFLQVIDCRSQNVVYQQRLNDKILSIDAHGDKLVV
                     ATTKNTVLWWKLPLQASDFGAEVESGLKFQTRRIKLTPRGDGYVSSSLDGRVAVEFFQ
                     DDTKKFAFRCHRMNLADTSFVFPVNALAFVPNSTILYTGGSDGCVSCWNLATRKKVDQ
                     LAKFNENSVVQLDCDGKILCVATSDDSFKTNAVVNQDTELQASRLYLVFLN"
     gene            complement(<458280..>459764)
                     /locus_tag="ZYRO0A05654g"
                     /db_xref="GeneID:8201660"
     mRNA            complement(<458280..>459764)
                     /locus_tag="ZYRO0A05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494572.1"
                     /db_xref="GeneID:8201660"
     CDS             complement(458280..459764)
                     /locus_tag="ZYRO0A05654g"
                     /note="similar to uniprot|Q07015 Saccharomyces cerevisiae
                     YDR257C SET7 Nuclear protein that contains a SET-domain
                     which have been shown to mediate methyltransferase
                     activity in other proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494617.1"
                     /db_xref="GeneID:8201660"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR011383"
                     /db_xref="UniProtKB/TrEMBL:C5DPS3"
                     /translation="MMASFDEATDGFYHWLVSSARIEISPKIFVGDLRSVNQGRCVLA
                     SQDIGSDEVLFEIPRSSVLNVATSQLVRDFPQLKDVFWQELGHWEGLILCMVYEIKVM
                     GQQSFWWNYLQVLPKSQDLNTLVYWSADQLAALEPSLVVGRLGADESQEMYRQILKYI
                     QNFGPEFQSKIGQLTFEEFVHVASVIMSYSFDVDLKGEDDEDDEDEDEGEEEEGESNV
                     AHDKYMKSMVPLADTLNADTKQFNAHLVYDKESLKMVSVKPIKMGQQVYNFYGEHPNA
                     EILRRYGYVEWDGSQFDFGELPLSCITQVLQREAPEEFFQICLQLLQNDETILEHLDQ
                     EQIVLESYDCFIDGQVIPECLLLLQVLTVILQIPNVGENLERELQRVVKKCLQLVESG
                     RLTIKCLKLFEHCIDERLRQYPNHSFREVTPIHQYVHDVDVQRGIMAQRVLQSEVESL
                     QNCYLSLGEKFQVIDDVKLMDNILKKRVAPAQKTKNESKRKRTH"
     gene            <459999..>461717
                     /locus_tag="ZYRO0A05676g"
                     /db_xref="GeneID:8201661"
     mRNA            <459999..>461717
                     /locus_tag="ZYRO0A05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494573.1"
                     /db_xref="GeneID:8201661"
     CDS             459999..461717
                     /locus_tag="ZYRO0A05676g"
                     /note="highly similar to uniprot|P15705 Saccharomyces
                     cerevisiae YOR027W STI1 Heat shock protein also induced by
                     canavanine and entry into stationary phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494618.1"
                     /db_xref="GeneID:8201661"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DPS4"
                     /translation="MSADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNR
                     SACYASNKKFEEALKDAEECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELD
                     SSNKAAKDGLEHVQSAKAGPQMPDLGLSQMFNDPNLIQNLKNNPKTADMMKDPQLVAK
                     LEGYRNNPQSISQDLFTDKRLMTIMAALLGIDLNMGDPSAGSEAQESAKPKEPESNPE
                     PRKEPKQEPKQEPEAMEVDEEPNSRVAAEAEKAEGNKLYKARQFEEAIEHYNKAWELH
                     KDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLK
                     DLRKAIEHYNRSLTEHRTAEVLNKLRSTEKELKKAESEAYVNPEKAEEARLQGKEFFT
                     KGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRA
                     YIRKATAQIAVKEFAAAIETLNIAREKDAQVNKGANVREIDQLHAKASSQRFQPASDN
                     ETPEQTYERAMRDPEVASIMKDPVMQSILSQAQQDPAALQEHIKNPEVFNKIQVLIQA
                     GIIRTR"
     gene            463894..463966
                     /locus_tag="ZYRO0A05698r"
                     /db_xref="GeneID:8201662"
     tRNA            463894..463966
                     /locus_tag="ZYRO0A05698r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (TGC) cove score=78.27"
                     /db_xref="GeneID:8201662"
     gene            464185..464257
                     /locus_tag="ZYRO0A05720r"
                     /db_xref="GeneID:8201663"
     tRNA            464185..464257
                     /locus_tag="ZYRO0A05720r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (ACG) cove score=73.40"
                     /db_xref="GeneID:8201663"
     gene            <464812..>465633
                     /locus_tag="ZYRO0A05742g"
                     /db_xref="GeneID:8201664"
     mRNA            <464812..>465633
                     /locus_tag="ZYRO0A05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494574.1"
                     /db_xref="GeneID:8201664"
     CDS             464812..465633
                     /locus_tag="ZYRO0A05742g"
                     /note="highly similar to uniprot|Q05016 Saccharomyces
                     cerevisiae YMR226C NADP()-dependent dehydrogenase acts on
                     serine L-allo-threonine and other 3-hydroxy acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494619.1"
                     /db_xref="GeneID:8201664"
                     /db_xref="GOA:C5DPS5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5DPS5"
                     /translation="MSQGVKAAERLAGKTVFITGASAGIGQATAKEYLDASNGQIKLI
                     LAARRLEKLHEFKEQTTKSYPSAQVHIGKLDVTAIDTIKPFLDKLPKEFQDIDILINN
                     AGKALGTDKVGDIADEDVEGMFDTNVLGLIKVTQAVLPIFKRKNSGDVVNISSVAGRE
                     AYPGGSIYCATKHAVKAFTESLRKELVDTKIRVMSIDPGNVETEFSMVRFRGDTEKAK
                     KVYQDTVPLYADDIADLIVYATSRKQNTVIADTLIFSSNQASPYHLYRGSQDKTN"
     gene            complement(<465717..>466409)
                     /locus_tag="ZYRO0A05764g"
                     /db_xref="GeneID:8201665"
     mRNA            complement(<465717..>466409)
                     /locus_tag="ZYRO0A05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494575.1"
                     /db_xref="GeneID:8201665"
     CDS             complement(465717..466409)
                     /locus_tag="ZYRO0A05764g"
                     /note="similar to uniprot|Q12012 Saccharomyces cerevisiae
                     YOR289W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494620.1"
                     /db_xref="GeneID:8201665"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="InterPro:IPR023473"
                     /db_xref="InterPro:IPR027485"
                     /db_xref="UniProtKB/TrEMBL:C5DPS6"
                     /translation="MSLELSGTSPYAFYAFYTLYNYLNNNNKSHSLNSTKNFLKICQT
                     LYPDYRVNPVERTSLFITWNKKSKKSDKYSLRGCIGTFARPALVHGIEKYSLVAALQD
                     NRFPPISKKELQLLKCSCNILQNFTTIYEGSKGDINDWEIGLHGIELFFKDPGSGITL
                     SATFLPEVMSEQNWDKEETFLNLIYKAGVSSHLQEVLDHYEQYFVQVIRYEGNKSAIT
                     YEQFESQLEKLE"
     gene            <466591..>467526
                     /locus_tag="ZYRO0A05786g"
                     /db_xref="GeneID:8202036"
     mRNA            <466591..>467526
                     /locus_tag="ZYRO0A05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494576.1"
                     /db_xref="GeneID:8202036"
     CDS             466591..467526
                     /locus_tag="ZYRO0A05786g"
                     /note="similar to uniprot|Q12404 Saccharomyces cerevisiae
                     YOR288C MPD1 Member of the protein disulfide isomerase
                     (PDI) family overexpression suppresses the defect in
                     maturation of carboxypeptidase Y and defects in other
                     essential Pdi1p functions caused by PDI1 deletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494621.1"
                     /db_xref="GeneID:8202036"
                     /db_xref="GOA:C5DPS7"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C5DPS7"
                     /translation="MIKMWVFKVLIFFMIQCSNLVWAQNFYDEDPHLIELTPKNFDKV
                     IHRTNYTSVVEFYAPWCGYCKQLKPVMKKVAKKLDGIVQVASVNCDLPKNKQLCAEHR
                     IQGFPTLMVFRPPKIDMSKPHSQRVELRNHAGEVYKGERKMAPIIDFAVSRMKNYVKR
                     LLNVNKLEEIFKKSTRPSMVLFSKKDKLSPVYKSIALDWLGVFNCFIIPNGKLDSLSS
                     DDNLAKSYPNIYGFLQSIAHDQKNSEKSLLVVFDPHNDQYHVFQGDSLVKPQVSKFLT
                     GSIGRNPQEGPGSKRQQFVDAVKSGKNKRVNHDEL"
     gene            <467735..>468128
                     /locus_tag="ZYRO0A05808g"
                     /db_xref="GeneID:8202037"
     mRNA            join(<467735..467792,467890..>468128)
                     /locus_tag="ZYRO0A05808g"
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /transcript_id="XM_002494577.1"
                     /db_xref="GeneID:8202037"
     CDS             join(467735..467792,467890..468128)
                     /locus_tag="ZYRO0A05808g"
                     /note="similar to uniprot|P19956 Saccharomyces cerevisiae
                     YMR225C MRPL44 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL44"
                     /protein_id="XP_002494622.1"
                     /db_xref="GeneID:8202037"
                     /db_xref="InterPro:IPR019716"
                     /db_xref="UniProtKB/TrEMBL:C5DPS8"
                     /translation="MITKYFSKVVVKFNPFSKEAKTARLLLSSIPPAQRQLGTQIQNE
                     VLTNASNKAPVIKVTFKDKKTMEVDPTKYTFQELANYFDTHSRQLSLKETIENS"
     gene            <468586..>469485
                     /locus_tag="ZYRO0A05830g"
                     /db_xref="GeneID:8202038"
     mRNA            <468586..>469485
                     /locus_tag="ZYRO0A05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494578.1"
                     /db_xref="GeneID:8202038"
     CDS             468586..469485
                     /locus_tag="ZYRO0A05830g"
                     /note="similar to uniprot|Q12481 Saccharomyces cerevisiae
                     YOR287C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494623.1"
                     /db_xref="GeneID:8202038"
                     /db_xref="GOA:C5DPS9"
                     /db_xref="InterPro:IPR009292"
                     /translation="MSYYFKNIKPGVESESDEGEDLERLLRRNNQDDADESSDDELRT
                     LSFGSLKKADTMMKKEEDGDRKLNRKIKDKPSKQVKYESEQESAPEQESESESGSSDS
                     EFFEEESSKKNGDQKKKKKRSKHAPAEQSAKKRVSKVREIPGLHLSKSQNPNLYQDIR
                     FDKSTGGPTDSSVIRRRYGFLDEYRQKEIEEMESILHDRKLTSKLPPEEVESIERRLK
                     STKSRLQTMKSKDLEQNIVKDYEQTMNKDNKNKFHLKRSERRKLVQKWKFEHMKSKQR
                     EKVMERKRKKRLGKEFKQFEFNK"
     gene            complement(<469523..>469963)
                     /locus_tag="ZYRO0A05852g"
                     /db_xref="GeneID:8202039"
     mRNA            complement(<469523..>469963)
                     /locus_tag="ZYRO0A05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494579.1"
                     /db_xref="GeneID:8202039"
     CDS             complement(469523..469963)
                     /locus_tag="ZYRO0A05852g"
                     /note="similar to uniprot|Q08742 Saccharomyces cerevisiae
                     YOR286W FMP31 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494624.1"
                     /db_xref="GeneID:8202039"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5DPT0"
                     /translation="MFRSLSVQKASLQSPARTLIRTMSSAGPKPYNFQDVKKLVQHPE
                     QGKVLVDVREPREVEMYKMPTALNLPFQTTPSALSLPEEEFEEQFQVPKPKNNEELIF
                     FCAKGMRARAAEELARSYGFKNTGIYEGSVNDWLANGGDKIKPE"
     gene            complement(<470083..>470460)
                     /locus_tag="ZYRO0A05874g"
                     /db_xref="GeneID:8202040"
     mRNA            complement(<470083..>470460)
                     /locus_tag="ZYRO0A05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494580.1"
                     /db_xref="GeneID:8202040"
     CDS             complement(470083..470460)
                     /locus_tag="ZYRO0A05874g"
                     /note="weakly similar to uniprot|Q12305 Saccharomyces
                     cerevisiae YOR285W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494625.1"
                     /db_xref="GeneID:8202040"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5DPT1"
                     /translation="MTHKIYEYEHIKFLSQNPNSRVVLIDVREPEEFQETNIPTSINV
                     SYRSYPNGLAMDSETFFNTFKTRKPEYDKELVLLCASGRRASEALKVALEAGYSEVSL
                     YPGSMKDWTYREKGGSTTLACPI"
     gene            complement(<470581..>471261)
                     /locus_tag="ZYRO0A05896g"
                     /db_xref="GeneID:8202041"
     mRNA            complement(<470581..>471261)
                     /locus_tag="ZYRO0A05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494581.1"
                     /db_xref="GeneID:8202041"
     CDS             complement(470581..471261)
                     /locus_tag="ZYRO0A05896g"
                     /note="similar to uniprot|Q12040 Saccharomyces cerevisiae
                     YOR283W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494626.1"
                     /db_xref="GeneID:8202041"
                     /db_xref="GOA:C5DPT2"
                     /db_xref="InterPro:IPR001345"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DPT2"
                     /translation="MTVSSFSEACDGNVVRLFVIRHGQTDYNIRQIMQGHKDIELNQT
                     GFEQATLLGKRLVEDSLTFDSVASSDLIRCKQTVATALATSNQNLPVTYYYELRERCM
                     GVIEGMQIDQAEKFAVEQGKKSFRDFGETPQEFIGRFATCFVSVAEQAAANNHKNVAI
                     FTHGGSIRSLLSWLHYNTSSKIPNTSVTVIDYHKDTKQFEVKVVADDMHLTGGSGSMR
                     FVGDSRVL"
     gene            <471425..>473431
                     /locus_tag="ZYRO0A05918g"
                     /db_xref="GeneID:8202042"
     mRNA            <471425..>473431
                     /locus_tag="ZYRO0A05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494582.1"
                     /db_xref="GeneID:8202042"
     CDS             471425..473431
                     /locus_tag="ZYRO0A05918g"
                     /note="similar to uniprot|P32829 Saccharomyces cerevisiae
                     YMR224C MRE11 Subunit of a complex with Rad50p and Xrs2p
                     (RMX complex) that functions in repair of DNA
                     double-strand breaks and in telomere stability exhibits
                     nuclease activity that appears to be required for RMX
                     function widely conserved"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494627.1"
                     /db_xref="GeneID:8202042"
                     /db_xref="GOA:C5DPT3"
                     /db_xref="InterPro:IPR003701"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR007281"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DPT3"
                     /translation="MEYPDADTIRILITTDNHVGYNETDPIAGDDSWKTFHEIMMLAK
                     NYNVDMVLQGGDLFHVNKPSKKSFYQVMKSLRMGCMGDKPCELELLSDPSQVFHYNDF
                     TDVNYEDPNFNVAIPVFAIAGNHDDATGESLLCPMDLLQVSGLVNHFGKVLEADKITV
                     KPLLFQKGITKLALYGMASVRDERLFRTFKEGNVTFEIPSMREGEWFNLMCVHQNHTG
                     HTNTAFLPEQFLPEFLDLVVWGHEHECIPHLVHNPSKQFDVLQPGSSVATSLCDAEAQ
                     LKNVFILQLRHDQSPELIPIPLTTVRTFLMRSVSLQDVNYLRPHDKEGISKYLASQVE
                     ELIAEANTATKAKLGDALDEMDEQQLPLPLIRLRVDYSGPDSDQTTIDYQVENPRRFS
                     NRFVGRVANGNNVVQFYKRRGKHNLSSKRGPNSAVNDADVERLINERGGELEVNTLVN
                     DLLHKMQLSLLPEVGMNEAVKKFVDKDEKSALKDFIDKEIENEVDMLVSSGGGLHSDN
                     PEQIKSLIRQVKKANYVVDSSSSPNHETPVTAVPPPPLTHTETRELDITPTPELSMPT
                     RKRKELPKRKASPPISESIAISDDDEEDGDEIVLSDDDNEDNGMDTQKQRTSKSSKPN
                     TSKPPSRKSRQTTTVGKSSSGSRSKSTKTPKTDILSSLLARKRK"
     gene            <473644..>474480
                     /locus_tag="ZYRO0A05940g"
                     /db_xref="GeneID:8202043"
     mRNA            <473644..>474480
                     /locus_tag="ZYRO0A05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494583.1"
                     /db_xref="GeneID:8202043"
     CDS             473644..474480
                     /locus_tag="ZYRO0A05940g"
                     /note="similar to uniprot|Q12017 Saccharomyces cerevisiae
                     YOR281C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494628.1"
                     /db_xref="GeneID:8202043"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR024253"
                     /db_xref="UniProtKB/TrEMBL:C5DPT4"
                     /translation="MQNDPLVQVQVDESEDTEWNDILRQKGVIPEKPPSPTAQLEEAL
                     EEALNKQHENRLDDKDLSDLEELEDEEDEEFLNMYKQKRLKDIAKLQEKSKFGDVFEI
                     NKPEYHSEITEASMGGAKSGHENVEDAEGVYVFVHLSLQSKLQSRIVNHLFKSLAAKY
                     REIKFVEINAHRAIENYPESNCPTILVYYKGDVLKNLITLLELGGNDTNLNDFEQFMV
                     RVGALNEKDSRLIMNQDDEETREARKLNFAGKSIRSGIQGKFNLGTGAASDDEDEDDF
                     FD"
     gene            complement(<474545..>475942)
                     /locus_tag="ZYRO0A05962g"
                     /db_xref="GeneID:8202044"
     mRNA            complement(<474545..>475942)
                     /locus_tag="ZYRO0A05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494584.1"
                     /db_xref="GeneID:8202044"
     CDS             complement(474545..475942)
                     /locus_tag="ZYRO0A05962g"
                     /note="similar to uniprot|P50102 Saccharomyces cerevisiae
                     YMR223W UBP8 Ubiquitin-specific protease that is a
                     component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
                     acetylation complex required for SAGA-mediated
                     deubiquitination of histone H2B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494629.1"
                     /db_xref="GeneID:8202044"
                     /db_xref="GOA:C5DPT5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DPT5"
                     /translation="MLGCQHIDQVFQNEKSKDGVIRTCNAARFMLSHFTKREKYTHVM
                     KCSDCHEINAGSNFMCLQCGFCGCWNGNHFGQHSKKVGHVFGINSSNGLLFCFKCGDY
                     IGSNELIAASMLNKYWDDVVTKTQIPKLERRDGLQGLLNMGSTCFMSSIVQCLIHNPY
                     FFQFSINQLHSQRCPLQDPLSCISCALDRMVWEFYGHPELIKNGEDDSNNSRTSDEYA
                     GFIGLFVSSWKINENLAGYFQQDAHEYWQFLLNQLHNDYMVSHNKSPDETNFAELCDC
                     IAHSTFQGSLKSSIVCPECKMDSKTTKDPFMDLSLDIKDKSNLYECLDSFHKMEQLHD
                     FNYHCDRCNTTQNAIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMR
                     NYCDGDDVPDIIFELIGIIAHRGTVNEGHYIAFTKVTTGHWFKFNDSMVSSITEEELL
                     QEQAYLLFYVVNQVN"
     gene            <476157..>476840
                     /locus_tag="ZYRO0A05984g"
                     /db_xref="GeneID:8202045"
     mRNA            <476157..>476840
                     /locus_tag="ZYRO0A05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494585.1"
                     /db_xref="GeneID:8202045"
     CDS             476157..476840
                     /locus_tag="ZYRO0A05984g"
                     /note="similar to uniprot|Q05015 Saccharomyces cerevisiae
                     YMR222C and similar to uniprot|Q99369 Saccharomyces
                     cerevisiae YOR280C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494630.1"
                     /db_xref="GeneID:8202045"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DPT6"
                     /translation="MAKKILMLHGIAQTGEYFYHKTKGLRTEFEKLGYELYYPTANNT
                     MPPADVPNCASDEVVASGVNDVSTWIQIDTAKADYSILPSTLDYLRQYVIENGPFDGL
                     LGFSQGAIVGSYLMTDFNVLLNLTHEQQPPFKFFIAFSGFKFETARCASQYVEHPINV
                     PSLHVRGELDTVTEAEKVHALYEACTPETRTFISHPGGHYVPNSRCFSKKVTEWLKTI
                     DPSLEKSKY"
     gene            <476965..>477816
                     /locus_tag="ZYRO0A06006g"
                     /db_xref="GeneID:8201554"
     mRNA            <476965..>477816
                     /locus_tag="ZYRO0A06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494586.1"
                     /db_xref="GeneID:8201554"
     CDS             476965..477816
                     /locus_tag="ZYRO0A06006g"
                     /note="similar to Saccharomyces cerevisiae and to YMR222C
                     uniprot|Q05015 Saccharomyces cerevisiae FSH2 Serine
                     hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494631.1"
                     /db_xref="GeneID:8201554"
                     /db_xref="InterPro:IPR005645"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DPT7"
                     /translation="MPPLPRKKILMLHGFVQSGKIFSSKTGGLRKTLNKIGYDLLYPT
                     SPMGITKEELMAQHNIKPGEDSDKEVASQFNTTTDGQDVYYGWWKRSSSCFQDFDIGQ
                     DVWDYLRGYILENGPFEGIMGFSQGGAFAGYLLTNFHKLLNLTYEQQPPLKFFVTFSG
                     FRLEASQFQSDYDKQPLSVPSLHVQGEQDTVVSEARILSLYNSCQEDKRTLLRHPGGH
                     YVPNSKQYVSQVCNWIQWIESQGKTSSQEESKDDAPKKQDTAKPDLGDDLMGTIDSMM
                     GATRLKD"
     gene            <477825..>479477
                     /locus_tag="ZYRO0A06028g"
                     /db_xref="GeneID:8201555"
     mRNA            <477825..>479477
                     /locus_tag="ZYRO0A06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494587.1"
                     /db_xref="GeneID:8201555"
     CDS             477825..479477
                     /locus_tag="ZYRO0A06028g"
                     /note="similar to uniprot|Q04991 Saccharomyces cerevisiae
                     YMR221C FMP42 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494632.1"
                     /db_xref="GeneID:8201555"
                     /db_xref="GOA:C5DPT8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DPT8"
                     /translation="MFKYHLKNSKSLPRRRTHRPKVGGTARSDKVKDERYLTLYTTYH
                     LATKVTAMSSKAVKVVQIGCASVYCLLSAGVIFGFAAFKAVLLAEDVYGEYCPADSAR
                     PCTEQDLKLNFIFTLAAGVTNVAALPVGWVLDHYGPRISGIVGSLWITVGAAMYIWAQ
                     QFSHILDPYLIGYSMFAIGGPFVFISSFQLANTFPKKSGFILSLITGTFDCSSALFLF
                     YRLGYQHSGKGWHLSQFFGVYMIVPLFILLSQLTVMPNDSYKTQGTIEKISAEHLDEN
                     GRLLEGDSISAFCTDDEERRSLVNEEALDRNEELRTRRGRRKSVVELHVERKLEQKSG
                     GIFGILHDKSVKEQISNPMFYLMVVFTTICMLRINYYVATIRSQEEYLLKDPELALKL
                     NSIFDVLLPLGGVVAIPLTGAILDHMKTFDILVTLVTSSVVVGVLGLIPRSFTLHLIG
                     ILILVVYRPFVYTVISDYTSKVFGFDTFGTVYGLLISISGMFNMVQSILDTLTHKTFN
                     MNPTPLNSILVLITIISGLTLLWDVRRQLRLRTLHKSDQEDN"
     gene            <479754..>480818
                     /locus_tag="ZYRO0A06050g"
                     /db_xref="GeneID:8201556"
     mRNA            <479754..>480818
                     /locus_tag="ZYRO0A06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494588.1"
                     /db_xref="GeneID:8201556"
     CDS             479754..480818
                     /locus_tag="ZYRO0A06050g"
                     /note="weakly similar to uniprot|Q12192 Saccharomyces
                     cerevisiae YOR279C RFM1 DNA-binding protein required for
                     repression of middle sporulation genes specificity factor
                     that directs the Hst1p histone deacetylase to some of the
                     promoters regulated by Sum1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494633.1"
                     /db_xref="GeneID:8201556"
                     /db_xref="InterPro:IPR020318"
                     /db_xref="UniProtKB/TrEMBL:C5DPT9"
                     /translation="MVEYNLDNIQHNLNTDKESPNGFEHFSPSTFSIHNDNNSDNGTQ
                     RDDKNLSEEAAKISKFDNEFLPNLDDDIPIETGFSPRNNDKITWRKIVESSNKRQEIF
                     TKFKEASQQINPIEFESYHDFFVLNTFKKGKSVSGYVDIENVMKNNAQHHRRSKRNNH
                     DPSVREPITSPGSSSLSDDGDYDENDDGNREIEKLSRSRESPVDEIEEGPKKRRSRTQ
                     VPVTSDDHLQIDEAELSLSTNPPGGERRSTRLLNKANNNNSSSNPDSEDSSDEHGEAL
                     IKDLYESIVPKVEQPYRRSDWVLPSRLRYTPDKQMRTKPEFEKVNLSELISVEKIQRV
                     LSKFEGGLKGIRKTNWNSMG"
     gene            complement(<480838..>482379)
                     /locus_tag="ZYRO0A06072g"
                     /db_xref="GeneID:8201557"
     mRNA            complement(<480838..>482379)
                     /locus_tag="ZYRO0A06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494589.1"
                     /db_xref="GeneID:8201557"
     CDS             complement(480838..482379)
                     /locus_tag="ZYRO0A06072g"
                     /note="similar to uniprot|P24521 Saccharomyces cerevisiae
                     YMR220W ERG8 Phosphomevalonate kinase an essential
                     cytosolic enzyme that acts in the biosynthesis of
                     isoprenoids and sterols including ergosterol from
                     mevalonate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494634.1"
                     /db_xref="GeneID:8201557"
                     /db_xref="GOA:C5DPU0"
                     /db_xref="InterPro:IPR005916"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR016005"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DPU0"
                     /translation="MSSIDYVFYTLFYNMIDSYDYYVVLGCGYQYFFLSMALKARTVR
                     TSMHELRSVLDKENIKMTMNSVERVRAFSAPGKALLAGGYLVLDPSYRSYVVALSARM
                     HAVVKTSDLEQNAHFELKISSSQFNNDYWTYTLGAKDGYNILETDGKKNPFIEMVLFN
                     LFNYFKPQQGKKILIEIFSDDGYHSQSNSVRKGNAYKEFSYHANSITKVPKTGLGSSA
                     GLVTVLTTVLVSVFKSELDVQNNKDLQLIHGLAQVAHCQAQGKIGSGFDVAAATFGSI
                     VYRRFAPELISGLPEHSDVNYSIKLRSLIDDTDWKISNTRVRLPDGLRLVMGDVNNGS
                     ETTKLVSKVKAWYTSNPSKGLEVYQNINSNNEKVMAALTEMDALNQKTPTAYSKLIEA
                     LDAQDEALINQSPELVKIRNAVNEIRNNFRQVTKESGADIEPPVQTALLDNCSKLKGV
                     LTGVVPGAGGYDAIALIATEQSNLQLQTQGKKEFAAVTWLDLHQEDVGVKQENPVHYQ
                     NLVKL"
     gene            complement(<482390..>486925)
                     /locus_tag="ZYRO0A06094g"
                     /db_xref="GeneID:8201558"
     mRNA            complement(<482390..>486925)
                     /locus_tag="ZYRO0A06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494590.1"
                     /db_xref="GeneID:8201558"
     CDS             complement(482390..486925)
                     /locus_tag="ZYRO0A06094g"
                     /note="some similarities with uniprot|Q03661 Saccharomyces
                     cerevisiae YMR219W ESC1 Protein localized to the nuclear
                     periphery involved in telomeric silencing interacts with
                     PAD4-domain of Sir4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494635.1"
                     /db_xref="GeneID:8201558"
                     /db_xref="UniProtKB/TrEMBL:C5DPU1"
                     /translation="MTSKKGGPNSSRLKLAAPRRGLKRPRSVFIERSGSNGRNNDMRY
                     RVNKTSRTDISQDTGHALDWLDSLIRKGRGILDSLEEEETSFKRELGEEKQRIRIQEQ
                     LIENALNGGSEDVFEKENIGIDTSSFRRLEDSVRNTKTEYDDEEEEEEEEEEEGDNSD
                     LYDEVQDMQDREDKHQPVFEQEEIVILSDEDEDEGETQKPEKSEEEDSEQLFGDEQEI
                     DLMSSDENVEEDHEAKEDEYEEEEAPERQELDEEESQVGSEEIEGQEEEIDQSEKKSE
                     SNDEQEEGSVEMAKDLESRFFPSSTQSSQEKFKDGLNADTQTPSPDETSYYDASDREE
                     TDNFESEHESIRNLENGDEPVSTQDGGINEFNLAGNDEAVLIDGDTEEQEVEQSLESE
                     QEYEFEGKGQDDLELEQDQERDLEDQEREYEQEEEPRNDEGEYEQDEQEQYGEGEQAE
                     EPEQESAYVSAEASLQVPDYLYDYRMIANQAVQQLLQTTDGQAVSSESTGNESFNDTK
                     YETPEASVPLQEDKGDQQNINETANDFKEIPGVSVPLQDDKGDQKDINETVNGIKEEP
                     EIVGHSGRILDTTGNRKNSLLEQLFKPKLQAGDANASTSSLEDDSTVYYSTEEPSIVE
                     EPSDLKADNQTYLSAKKTEGTNNVPSRYEILFCESAYSTTSNEDNAQVIEPFGSYVSP
                     FSKDTFSTTQKAEDPKELLRRTLESLGESFDSESEDEVMVDANDFNSSSSEEFFSQTS
                     DININDDVDVDVDVEEDEDTGNDDETVKGSEISDGNNTDTTDTPGKGTPLERYEQIDI
                     TQGPDIDPIHSPDAFDDAEFLVFGPNEPDWIEEAESEQSIQDQEGLVLEDVSSGVDQE
                     EIALVASEPIIEFNSEPLNFADIILDEFTAPDLVEEASDTESRADNILLEEIEDLQAL
                     DVIHVISTEPIVEQPEPLSFANVEIFELTENDSDDTDEVMVDVGPSSFDENASFQMRT
                     ERGFNVGALAGNSSSESHESEYSVDGAEEESNEHRSGSVASKIFSSPIRALGRVISGV
                     KDVGNVLADFVNTIDTTNAQTDTDVGSSSPEEHNEDSQSEAEPEAEPEAEPEAEPEAE
                     PEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPEAEPE
                     AEPEAGRSVEHDLRNFLDEEGFKLEYPSENNGSEFTGNDREPLFENNSNNKELLSEVV
                     AIQKLARELESRPISAFRDSSPSTDDNEAEKEEINISVKNDNDPELDIGEEDSFLKST
                     EDDVLQKSSGNEGTKDKCDKDEDARDDVKHIEVEEEDLDGMKEKYVKDLPANEEGDVK
                     GQQARVNPEEIDIVGKRSNDAVKSEDFASKREGIEIYENKEVESGKNSSSVLVKPIEV
                     DANYSDEAPFQHEEVHKKKDESNSPTREVQVRDENEDAIQIPVEIEDEETKIPPENKD
                     MPKEKGSEPTQSGSKKKRGRKRKHASPISESNKRKGPGSSKTQNKRTKGPITRSRTTP
                     SSTERKTRGNTRSKKTR"
     gene            <487142..>490417
                     /locus_tag="ZYRO0A06116g"
                     /db_xref="GeneID:8201559"
     mRNA            <487142..>490417
                     /locus_tag="ZYRO0A06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494591.1"
                     /db_xref="GeneID:8201559"
     CDS             487142..490417
                     /locus_tag="ZYRO0A06116g"
                     /note="similar to uniprot|Q03660 Saccharomyces cerevisiae
                     YMR218C TRS130 Component of the targeting complex (TRAPP)
                     involved in ER to Golgi membrane traffic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494636.1"
                     /db_xref="GeneID:8201559"
                     /db_xref="InterPro:IPR022233"
                     /db_xref="UniProtKB/TrEMBL:C5DPU2"
                     /translation="MSSQTSSRAVTISYFDPFDVFESIKGEFLQIFPFQNIHWKSPGG
                     AVRTVRQLPVNLVIESEASELNIDDVNHFVRFIVVNCISVDDYRGKVRPLLRQWLPVS
                     DKTSVDVDSVETPKPIVLLYANSEVVDSNLFKSISLIDKFAKDFPGLKTLVLRSVYKS
                     PTDREDFWNQMGNKIKSCLLDIFQKRLTNYRKKLSNPKNADEELGLREKILELYLAFN
                     MHEEATTQLNEIRDNVVSKRENSLPNGELETPFNFAQNENVDDGSIAKMLLENKLTKF
                     QYFKYFFVKRFRVLNMGKTNVPRLLQLYRLIRDFLHCIESIFRDSPQILEFKYCFIDD
                     ILKYINDGGIPIFLEMKAELSLLKRDCWVQGVLANTDFKLIDKSFPKSNVKFTFDRLK
                     ESYKDENTFHENFVKSTSLLLALYNKSSDKKRRIVDILSLEIGMLHYQRGEYEKAVSL
                     FDSCYEYYMETGWDIIGLKIVQMYYDSLIHCPQIKYLKRDDEDVSVSIVLSNAFLNIL
                     RISKDEDEKRQIWKKFFELQKEMESPSLVYQTDGLFCIALSDLSYLSEANVYKIDVTI
                     RNLAFLEPITADSIKLILKNSDDQFVEFKLSSVNFAPSTNHYALEATEISFGEFQPVS
                     IEIKVGNATFLEGFVNENHPIFIEPLYHPENISCSVQQSKRLNLGEYAIDLIHQNVKG
                     LESFAVEIMVEPNLGSFPISFSQDQDLYRKRVVDIKNDTTIRYFPKDSINSFRLKVKT
                     SFTKKDNPREFSEIRHFTISCYLPLSVSVEDIFKKDAFIFKFLLNSSTEEEPIILYSS
                     KLRAPENSERYTLFGDFEPNDLIYLTADPNESALNCYQVTTKDKFDHNDLFQLKVTYN
                     TLKEQINGLVTDSIMLQGDMEWYQEFELWKHLWENKILPLFQYDYNAFIQSCTITTMP
                     GTLNITDICDYLLKLSVSKPVTKRIIETLKKIVRGVELTDIDIYAYVKNLTPRTLIVP
                     VELPQMDYFFYVEFSKTLEEQYQVGSPMLIKIRVENLSGKWGSQEVSDAFVLEVASSN
                     EWLAHGKKRMLIRSEINEFELYVIPLKKGYLNYPRIEISSVETGVPTRIDNPNASETL
                     LVL"
     gene            complement(<490489..>491241)
                     /locus_tag="ZYRO0A06138g"
                     /db_xref="GeneID:8201560"
     mRNA            complement(<490489..>491241)
                     /locus_tag="ZYRO0A06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494592.1"
                     /db_xref="GeneID:8201560"
     CDS             complement(490489..491241)
                     /locus_tag="ZYRO0A06138g"
                     /note="similar to uniprot|P06174 Saccharomyces cerevisiae
                     YOR278W HEM4 Uroporphyrinogen III synthase catalyzes the
                     conversion of hydroxymethylbilane to uroporphyrinogen III
                     the fourth step in the heme biosynthetic pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494637.1"
                     /db_xref="GeneID:8201560"
                     /db_xref="GOA:C5DPU3"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="UniProtKB/TrEMBL:C5DPU3"
                     /translation="MQRAILLKNKTAQQDKYEIEFQSNGFEPVFIPLISHTHIPQGLL
                     KLLEDDAYLKDLQDIIVTSQRTVECLYESVLPQLHASTRQLFLEKTVYAVGPSTKDFL
                     IRIGFKNVKGGEDAGNGSILSDIIISDYREQGKNSEPLLLVGEIRRDIIPKKLSSNGI
                     QVKEVITYKTENLPDNLTRFQAMARENSWVVFFSPQGTEEIIESIKNGSNHRVASIGP
                     TTEEFLQRKGLEPDVVSLKPDERNLVNAILSI"
     gene            complement(<491453..>493024)
                     /locus_tag="ZYRO0A06160g"
                     /db_xref="GeneID:8201561"
     mRNA            complement(<491453..>493024)
                     /locus_tag="ZYRO0A06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494593.1"
                     /db_xref="GeneID:8201561"
     CDS             complement(491453..493024)
                     /locus_tag="ZYRO0A06160g"
                     /note="highly similar to uniprot|P38625 Saccharomyces
                     cerevisiae YMR217W GUA1 GMP synthase an enzyme that
                     catalyzes the second step in the biosynthesis of GMP from
                     inosine 5'-phosphate (IMP) transcription is not subject to
                     regulation by guanine but is negatively regulated by
                     nutrient starvation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494638.1"
                     /db_xref="GeneID:8201561"
                     /db_xref="GOA:C5DPU4"
                     /db_xref="InterPro:IPR001674"
                     /db_xref="InterPro:IPR004739"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="InterPro:IPR022955"
                     /db_xref="InterPro:IPR025777"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DPU4"
                     /translation="MSEEVSKVFDTILVLDFGSQYSHLITRRLREFNIYAEMLPCTQK
                     ISELSWKPKGVILSGGPYSVYEDGAPHVDHDVFALNVPILGICYGMQELAWINGKQVA
                     RGEKREYGPATLNVVDKECPLFQGVDHSRVWMSHGDKLHGLPTGFKVIATSDNSPYCG
                     ISHESKSIYGIQFHPEVTHSTHGKILLKNFAVDICHAAQNWTMENFIDTEIQRIRNLV
                     GPTAEVIGAVSGGVDSTVASKLMTEAIGDRFHALLVDNGVLRLNEAAMVKETLGDGLG
                     INLTVVDASEEFLTKLKGVEDPEKKRKIIGNTFIHVFEREAAKIKPRDGKDIEFLLQG
                     TLYPDVIESISFKGPSQTIKTHHNVGGLLEDMKLKLIEPLRELFKDEVRHLGELLGIP
                     HDLVWRHPFPGPGIAIRVLGEVTESQVQIARLADYIYIEEIKKAGLYNKIAQAFACLL
                     PVKSVGVMGDQRTYEQVIALRAIETSDFMTADWFPFEHDFLKRVASRIVNEVDGVARV
                     TYDITSKPPATVEWE"
     gene            <493846..>496062
                     /locus_tag="ZYRO0A06182g"
                     /db_xref="GeneID:8201562"
     mRNA            <493846..>496062
                     /locus_tag="ZYRO0A06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494594.1"
                     /db_xref="GeneID:8201562"
     CDS             493846..496062
                     /locus_tag="ZYRO0A06182g"
                     /note="similar to uniprot|Q03656 Saccharomyces cerevisiae
                     YMR216C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494639.1"
                     /db_xref="GeneID:8201562"
                     /db_xref="GOA:C5DPU5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DPU5"
                     /translation="MMESSKYTGFNHDSTGIPMPIRHEDEPSRCAEIEIQVSADEYQP
                     PVPKVQPQVELQKVRSGTNGNANDAKLFKKYFVEKVKSSSPSGNRGDNSSLSRAGGTK
                     SNLSLALKQSDMASSSVKATPPLLHKGLTNQGDMDMEAESDSGSSDSSCDEKNEESFR
                     DYRPGGYHPAFKGERYKDGRYVLVRKLGWGHFSTVWLAKDLHDVNATQHVAMKIVRSD
                     KVYSEAAQDEIKLLKRIRSQTEKGHVGSDYILKLLDNFYHAGPNGDHIVMVFEVLGEN
                     LLALIKKYEHRGIPLVYVKQISKQLLLGLDYMHRKCGVIHTDIKPENVLMEIGDVEGI
                     VEMVELMDKQKKNIKRFQRKYSQDFSTAVSPMGVPNSPSSSHLNKVKRDVSGSAIASD
                     YSTNHPRIPSGRRARRHTVITSSQPLPSPLASANFKEMKNQFINGGNSSSSVSSQWGA
                     HSLHSKGSFPTQTTGGGNDFNGYSMGSASTTLHPSVSENVDSGSGPMNEGQLANSLSS
                     FEISQNEENGPLSSYVPSNSAIFPNNSDSNTIQIKIADLGNACWYDEHYTSSIQTREY
                     RSPEVLLGVPWGCSADIWSAACLIFELITGDLLFEPDEGHSYTKDDDHIAQIMELLGE
                     LPPYLLAQGRYARTFFNSRGKLRNISKLKHWPLKSVLHEKYNFSVSESRDIADFLIPM
                     LEMDPRKRADAGGLVNHPWLSDTHAMQDVSVADRKLYCSGADIPGWYQEVTGHPKH"
     gene            complement(<496891..>498471)
                     /locus_tag="ZYRO0A06204g"
                     /db_xref="GeneID:8201563"
     mRNA            complement(<496891..>498471)
                     /locus_tag="ZYRO0A06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494595.1"
                     /db_xref="GeneID:8201563"
     CDS             complement(496891..498471)
                     /locus_tag="ZYRO0A06204g"
                     /note="similar to uniprot|Q03655 Saccharomyces cerevisiae
                     YMR215W GAS3 Putative 1,3-beta-glucanosyltransferase has
                     similarity to Gas1p localizes to the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494640.1"
                     /db_xref="GeneID:8201563"
                     /db_xref="GOA:C5DPU6"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DPU6"
                     /translation="MLSLIQILVLVLAVPVRAVLPLQIQNHRFIKATSAENNARDNEI
                     YFVKGIDYQPGGSSGFNSYGVHDTLSEPSQCARDIYAFQQLGINTIRIYQLNPYLNHD
                     ECMTMLNNAGIYVILDVNSGNVGEHLNRADPEGTYNADYLSRVFKFIESFKNYPNVLG
                     FFSGNEVINDDKDYAEIDPPFLRALQRDMKQYISRHCDRTIPVGYSAADNTALRLATF
                     KYLQCNSWDGTSVSEELDESRSDFYGLNSYQWCSGSSNWQNSGYRELAQTFNDPKIPV
                     IFSEYGCNQNSPRTFDEVSQGLYDGLKDTFSGGLIYEFSEEANSYGVVCIDDEDKSLT
                     YKKDFENLAYQFSQLDLPRTKQFQLSNSSVSKCDAAAIKAVYKKFGTKDFEIPDQPAD
                     ITFMIEHGVGDVTPGSIIGNYSNPKKLDYEVKDVKGKRVDATLTWEKSNKINEFYHKA
                     GTSNRTFKAPIITSSVFQRRNSSTRPSTTSLSSKELRTTTLKATTSEIKKSKAQAAEL
                     QVTGGTIIGLVAVLLSIV"
     gene            complement(<499313..>500446)
                     /locus_tag="ZYRO0A06226g"
                     /db_xref="GeneID:8201564"
     mRNA            complement(<499313..>500446)
                     /locus_tag="ZYRO0A06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494596.1"
                     /db_xref="GeneID:8201564"
     CDS             complement(499313..500446)
                     /locus_tag="ZYRO0A06226g"
                     /note="similar to uniprot|P25303 Saccharomyces cerevisiae
                     YMR214W SCJ1 dnaJ homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494641.1"
                     /db_xref="GeneID:8201564"
                     /db_xref="GOA:C5DPU7"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DPU7"
                     /translation="MLFLLLISQLLTVLALAQDYYSILGLNKDASDKDVKSAYRQLSK
                     KYHPDKNPGDESAHQRFIEVGEAYEVLSDPEKRGIFDQYGADGLKNGAGGGGGPGGGF
                     GGFHDPFDIFEQMFNRGGGGGGFGGGFGGMHRGKGPSLRVHEELSLKDYYSGTGVEFE
                     LMLNDICDHCEGSGSEDGKVETCPDCGGQGILIQIIRMGIMTQRIQQPCGRCSGRGHI
                     IKNQCKACGGHKVVKKPKSFQVEVPAGAPRDHVEVRHQEADQSTDMEAGDIFVEFTES
                     DKNNMGYRRRGDHLFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEI
                     EQIPGFGMPKGSSGKSFGDLFVEYAVVMPAQFKQTNQWIRDEL"
     gene            complement(<500653..>501123)
                     /locus_tag="ZYRO0A06248g"
                     /db_xref="GeneID:8201565"
     mRNA            complement(<500653..>501123)
                     /locus_tag="ZYRO0A06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494597.1"
                     /db_xref="GeneID:8201565"
     CDS             complement(500653..501123)
                     /locus_tag="ZYRO0A06248g"
                     /note="similar to uniprot|P12962 Saccharomyces cerevisiae
                     YOR276W CAF20 Phosphoprotein of the mRNA cap-binding
                     complex involved in translational control repressor of
                     cap-dependent translation initiation competes with eIF4G
                     for binding to eIF4E"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494642.1"
                     /db_xref="GeneID:8201565"
                     /db_xref="UniProtKB/TrEMBL:C5DPU8"
                     /translation="MVRYTIEELLQLKPSEALTPNFDAVEFRAMIEKVKHLQALKEEE
                     FGHFGHFNRRRSSHHHGKPKVKHTKPKVTIDSDGWSTFEANKKGSGDEEEQEKPARES
                     APQPTIAQETIKVKPNNKNISSTKPADAKDIVADKPIQSFNAFAALESEEEDDE"
     gene            <502230..>503411
                     /locus_tag="ZYRO0A06270g"
                     /db_xref="GeneID:8201566"
     mRNA            <502230..>503411
                     /locus_tag="ZYRO0A06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494598.1"
                     /db_xref="GeneID:8201566"
     CDS             502230..503411
                     /locus_tag="ZYRO0A06270g"
                     /note="highly similar to uniprot|P32468 Saccharomyces
                     cerevisiae YHR107C CDC12 Component of the septin ring of
                     the mother-bud neck that is required for cytokinesis
                     septins recruit proteins to the neck and can act as a
                     barrier to diffusion at the membrane and they comprise the
                     10nm filaments seen with EM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494643.1"
                     /db_xref="GeneID:8201566"
                     /db_xref="GOA:C5DPU9"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPU9"
                     /translation="MTIESAPLPSIGISNLPNQRYKIVSDNGGSLTIMVCGESGLGKT
                     TFINTLFQTTLKHGEGHGNRKHHPVKRTVEIDILRALLEEKNFTLRVNVIDTPGFGDN
                     VNNNRAWQPIVDFIDDQHDSYMRQEQQPYRDVKYDLRVHAVLYFIRPTGHGLKPLDIE
                     TMKRISTRANLIPVIAKSDTLSAAELQSFKLRIRQVIEAQEIRIFTPPLNRDEGSVLS
                     QDAAAVEHARQLIESMPFAVIGSEEKYDNGSGSLVSGRRYPWGLVEVENDLHCDFRKL
                     RSLLLRTNLLDLILTTEELHYETYRRLRLEGHAEDNDPALPVRAPARKLSHNPKYKEE
                     ENALKKYFTDQVKAEEQRFRQWEQNIVNESIRLNGDLEEMQNKLKKLEEQVRKLQLQK
                     H"
     gene            complement(<503607..>504644)
                     /locus_tag="ZYRO0A06292g"
                     /db_xref="GeneID:8201567"
     mRNA            complement(<503607..>504644)
                     /locus_tag="ZYRO0A06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494599.1"
                     /db_xref="GeneID:8201567"
     CDS             complement(503607..504644)
                     /locus_tag="ZYRO0A06292g"
                     /note="highly similar to uniprot|P29509 YDR353W
                     Saccharomyces cerevisiae TRR1 Thioredoxin reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494644.1"
                     /db_xref="GeneID:8201567"
                     /db_xref="GOA:C5DPV0"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR005982"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C5DPV0"
                     /translation="MLVNSGRTLFSRASSTTSTTNTIIKRMVHNKVTIIGSGPAAHTA
                     AIYLARAEIKPTLYEGMMANGIAAGGQLTTTTDIENFPGFPQGLLGSELMDRMKEQSV
                     KFGTEVITETISKVDLSSKPFKFWTEFNEDGPANTTDAMILATGASARRVNLPGEETY
                     WQQGISACAVCDGAVPIFRNKPLAVIGGGDSACEEAGFLTKYGSKVYLLVRKDHLRAS
                     TIMQRRVQKNDKIEILYNTVAVEAKGDGKLLNTLRIKNVKENQESDLQVNGLFYAIGH
                     TPATSIVQGQVTTDESGYIKTIPGTAETNVPGFFAAGDVQDSKYRQAITSAGTGCMAG
                     LDAERYLSSLE"
     gene            complement(<505151..>505651)
                     /locus_tag="ZYRO0A06314g"
                     /db_xref="GeneID:8201568"
     mRNA            complement(<505151..>505651)
                     /locus_tag="ZYRO0A06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494600.1"
                     /db_xref="GeneID:8201568"
     CDS             complement(505151..505651)
                     /locus_tag="ZYRO0A06314g"
                     /note="similar to gnl|GLV|CAGL0I01144g Candida glabrata
                     CAGL0I01144g and some similarities with uniprot|P38815
                     Saccharomyces cerevisiae YHR105W YPT35 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494645.1"
                     /db_xref="GeneID:8201568"
                     /db_xref="GOA:C5DPV1"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DPV1"
                     /translation="MNKVDILMPEPISLMDDESQVRNLNQIYSLQRCQVSDCTIVNGE
                     NGTKFAVWKITLLLHPQDTASQQVYYPRVETFRRYSDFCQLREQLIKRCIDEQRPNID
                     VPELPPGVKWYDVWRYQEINLNRKWLSKRRQGLEFFLNHVLLNGELISLARDLVVKFL
                     EPPQTD"
     gene            complement(<505818..>506801)
                     /locus_tag="ZYRO0A06336g"
                     /db_xref="GeneID:8201569"
     mRNA            complement(<505818..>506801)
                     /locus_tag="ZYRO0A06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494601.1"
                     /db_xref="GeneID:8201569"
     CDS             complement(505818..506801)
                     /locus_tag="ZYRO0A06336g"
                     /note="highly similar to uniprot|P38715 Saccharomyces
                     cerevisiae YHR104W GRE3 Aldose reductase involved in
                     methylglyoxal d-xylose and arabinose metabolism stress
                     induced (osmotic ionic oxidative heat shock starvation and
                     heavy metals) regulated by the HOG pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494646.1"
                     /db_xref="GeneID:8201569"
                     /db_xref="GOA:C5DPV2"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DPV2"
                     /translation="MASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFD
                     GAQDYGNEKEVGEGVRRAIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGL
                     DYLDLFYIHFPIALKPVSFEEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVE
                     EGLIKSIGVSNFSGSIMLDLLRGARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAY
                     SSFGPQSFVDIGSEVAKATPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKS
                     SKKERLRQNLLVDQEVTLTGDEIKEISGLNKNLRFNDPFTWSEKTPFPIFD"
     gene            complement(<507164..>508054)
                     /locus_tag="ZYRO0A06358g"
                     /db_xref="GeneID:8201570"
     mRNA            complement(<507164..>508054)
                     /locus_tag="ZYRO0A06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494602.1"
                     /db_xref="GeneID:8201570"
     CDS             complement(507164..508054)
                     /locus_tag="ZYRO0A06358g"
                     /note="similar to uniprot|Q06328 YDR352w Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494647.1"
                     /db_xref="GeneID:8201570"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C5DPV3"
                     /translation="MSCSHSVWPWVSSANGVASFALSFVSLFPQIIETYRDKTVAGLS
                     PLFLLAWVCGDITSLLGAVLTNQLTFQIVLAFYFLLNDLFVCGQYYYYGILHGNQLAT
                     AGHESKISYQEGTQNNDDHHHHHHSPTQRSSSPGLWQRFLSTFFLIGVSNALPLVYQE
                     PGNAPPSAPLPSPESPLGTTLSWVGASFYVGARIPQLIKNYRRKSTDGISPLLFGTTL
                     LCNLTYNFSILSSCDFIDSSDKSAFLWNAAPFIAGSAGTVAFDVLYFYQHYVLYSDDL
                     HYREALTNHHEDDERAPLLE"
     gene            complement(<508452..>510998)
                     /locus_tag="ZYRO0A06380g"
                     /db_xref="GeneID:8201571"
     mRNA            complement(<508452..>510998)
                     /locus_tag="ZYRO0A06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494603.1"
                     /db_xref="GeneID:8201571"
     CDS             complement(508452..510998)
                     /locus_tag="ZYRO0A06380g"
                     /note="similar to uniprot|P38814 YHR103W Saccharomyces
                     cerevisiae SBE Protein involved in the transport of cell
                     wall components from the Golgi to the cell surface"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494648.1"
                     /db_xref="GeneID:8201571"
                     /db_xref="UniProtKB/TrEMBL:C5DPV4"
                     /translation="MTSKLETLREVSPPDLTRDLKNNSTTGTTNSSTGTNNNKMVGLG
                     LGRRPSDNLLLNMTALEGLDLNEKDFSALSTPPPKKNFIQKSERPISNDSIATRTTEL
                     FSATSSDVNSGSSSIDNEQDIKERTAETIVPTMDQEVSQADESMVSTDGDDSHNSPPR
                     PFLQQQQQQHHHHQQQHHQEPQKPILPPTQQQQRNQYIFSNGNRAKSQVALRPPPLHR
                     EMMEMAQPPQVPMGPSLYGHSNSTSAILPNKTPLTPSQRYRLRKAQNESALRKSIRKK
                     EKFYDEQETNSQLKNDNFDASLVWNVPMASFSNSSFLEVADLQVGHHNHHNPHPHNHP
                     HNHNIHNMNKNTNNTNPHRTNNRSKHTRNLSDPFHENSNKSMTSNGAGNNKIHPHHHS
                     YPKGLPQPGANLSFLNFYDMPTSPIPGLSKTSDFEYMQQTSSNLTNIYENSSHNLSKS
                     KLTERTASTDFLPLEFKTASDLGFEDLLLVSENKLEVTSHSRPSWLPPKSPEERKMHE
                     EQISKSTSMASIEQLDRNKEKEGRIIKNETNRQKYVLLLDRGITRNSSLQSLRKIVWE
                     TALTDEVRYNVYDEVLQSDARAVTAHYLEPYQDMMDLLNKMDFPTAKEKEIEQLIDSG
                     VRNKLSGQQDEISPELLLMLKLKSISRQGLQPGDELLFHHFLQSNSFTDLQQVWEMGN
                     LVQMICFNDICKEKYDSRILNPRGIVAHYLLRSDDFKEEFNATALNSTTWWNVLQRVS
                     HKLFMWIIDIIVVANNQCFKKYPIVKEDFQGKSWEYYRSKRVVNNYKILLAFALNVLL
                     NYHFGFNDLKLLSSLDDPNFAIPMPLDHLLDADAINSMFIRKWLHYYKKF"
     gene            512858..512929
                     /locus_tag="ZYRO0A06424r"
                     /db_xref="GeneID:8201572"
     tRNA            512858..512929
                     /locus_tag="ZYRO0A06424r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=60.59"
                     /db_xref="GeneID:8201572"
     gene            complement(<513126..>515957)
                     /locus_tag="ZYRO0A06446g"
                     /db_xref="GeneID:8201573"
     mRNA            complement(<513126..>515957)
                     /locus_tag="ZYRO0A06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494604.1"
                     /db_xref="GeneID:8201573"
     CDS             complement(513126..515957)
                     /locus_tag="ZYRO0A06446g"
                     /note="weakly similar to uniprot|P38692 Saccharomyces
                     cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
                     kinase family required for cell integrity possibly through
                     regulating 1 6-beta-glucan levels in the wall physically
                     interacts with Cdc31p (centrin) which is a component of
                     the spindle pole body"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494649.1"
                     /db_xref="GeneID:8201573"
                     /db_xref="GOA:C5DPV5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DPV5"
                     /translation="MMKKSSNEASGSSSLAVQRPDNQDVTSVFKRTEVIGTGKFGVVY
                     KGHHARTKQVYAIKVLNLDSDEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTLW
                     IIIEYCAGGSLRTLLRPGKIDEKYIGIIMREVLIALKYIHKDNVIHRDIKAANVLITN
                     EGHVKLCDFGVAAQLNQSSLKRQTMAGTPYWMAPEVIMEGVSYDTKVDIWSLGITTYE
                     IATGNPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDL
                     LKSKLIKHHRTASTTVLKELITRYLLFRDKTKSKRSSVSISEADQPVNDADDDATDSQ
                     DEDAEESSDPNAMQVEMRWDFDSLSSSDYIMANDINVEEIPEESAVDWKSHFDQFNFA
                     YPDEERHYYQTGNNTGKLVYQGTTMGKSHPSMGVSNSTLNAFPTNNNSTAQPGKMFKS
                     SHTNSTGINGSHNSNTANNSSKKTEAKAPKKLMELFEDNDVINEEEDGDPKELSRINK
                     NLPNDLAGRPHAVLMNGAAYHSQSTPALPQLQTKFNKPPKGPTSAVTTTAPTPIEIEI
                     PEELPTSTTTPSAIPSALPSSLSSVSMDPLAQPQPVVATNLTKPRSSTVSSHKQPSSI
                     SGRIPGGRDMPGKIPEEIPRRASGGAENSSDGSISSGMHGVNNGTAAMKLPLRTPSPS
                     KVLNNYMNSPTKKPGSSPTGSGPPPTMKPVGTNNETKDVLLQPLNNGNPTSSNNANTG
                     TADKETSRVNRDFKRNNPNLKLHMPLPTPMVATKLLDSTDLQSAGPPSSDNINQFGFN
                     TSTVSNVPVSMTPISEKHMDFGNRTRRSQSVANRKNSQSADPVLPVTTSITNANNNAT
                     GSSPAVATPLNSMASQLIPPPSDFLSLDLFLDMNTDAGGYTFIDRKPSMLDKLESLLK
                     MYEDGLPVLEDALKKQLLSMDTTYEDSGH"
     gene            <516399..>518438
                     /locus_tag="ZYRO0A06468g"
                     /db_xref="GeneID:8201886"
     mRNA            <516399..>518438
                     /locus_tag="ZYRO0A06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494605.1"
                     /db_xref="GeneID:8201886"
     CDS             516399..518438
                     /locus_tag="ZYRO0A06468g"
                     /note="weakly similar to uniprot|P50273 YDR350C
                     Saccharomyces cerevisiae CM10 Mitochondrial inner membrane
                     protein required for assembly of the F0 sector of
                     mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494650.1"
                     /db_xref="GeneID:8201886"
                     /db_xref="UniProtKB/TrEMBL:C5DPV6"
                     /translation="MLRSWNCLRPSCVRFLSDLSSRHEITESSFQRAIGFLETVDIRD
                     IVRPNSLQATQLLKVINSVQDGHEMRKLRNRMKKQFGQNYHLIYPRLRQLSDDSLRLQ
                     MSLFRNSGRRQYDSFLKCLINILNRKDLIDTDKRQRLYDIITFQHEMYPGKNANSAMI
                     LPNEVHKWFWEHVPRQESFNHYYFLIKNDVYLSWPRYSWKFVKRMMQGSELELQLASF
                     QLFLYQGNHQSIFHEKFHKLYSFHAMLLILHRVFKANDLRFAKVYVAVLLRSMETREP
                     SELSFFRFNNFLLYYLSQTGDIELFFQAFSVELQFIKNVSKNGASLKILHRPLLFVLK
                     LLRRQGYHEEFFTILSILQKVSLGQSQTFKQHAFTELITLLRSFNDCKLTSQYVMSGF
                     DRESTGLLLNELGLWNAAFHGNAAVLDSLELQSEIDSLESLLPSSMSLKGQPSMAVMT
                     ELYRLVLSTNAKVLNVDQYRDLLMTLYSNYTRVLQERKFIHPRHDTGILNVFLYHARY
                     ELRDCKLSLALLQNFYASGLARNIRVTSNKCPFSIVVYQNNEITQAEINQLLILMHDA
                     KIPVHFQFCTSMVLRYLQLNNQEEAHAWYQRILHAGFKVEHRLLIKAIRDNNWQYPAG
                     FDKVLVEKLDDDDGGMVQDDAFFLEEEDSNTTTSIQDNQGHKASLQHIIGLLKTL"
     gene            <518601..>519669
                     /locus_tag="ZYRO0A06490g"
                     /db_xref="GeneID:8201887"
     mRNA            join(<518601..518707,518772..>519669)
                     /locus_tag="ZYRO0A06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494606.1"
                     /db_xref="GeneID:8201887"
     CDS             join(518601..518707,518772..519669)
                     /locus_tag="ZYRO0A06490g"
                     /note="similar to uniprot|P38813 Saccharomyces cerevisiae
                     YHR101C BIG1 Integral membrane protein of the endoplasmic
                     reticulum required for normal content of cell wall beta-1
                     6-glucan"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494651.1"
                     /db_xref="GeneID:8201887"
                     /db_xref="InterPro:IPR024722"
                     /db_xref="UniProtKB/TrEMBL:C5DPV7"
                     /translation="MLFLWSVLNLLLAVVSSAEELVEQTHVPVLMWSHHLIPALHKYL
                     GKFDNSLELPLSTLFQVVREFTEDCETSAFIFINQPGLRKDDLVEYEEEFVNLERYLR
                     KSSTALAFEQVELMPDDTFEQLTEYVQEICRIDKLLYVEGDNLESFQPYIDIEKRIIR
                     IEYPPLPEDPELRGQAILTFDSNLKKMLAQVPSPAHRVIYTSLEPNTDVLESTGRIFQ
                     HIFQDKDREIPIERNNHHLDIPPQFNDYKPKFEGMTGEYLSIFDADFIQENKQLLIAI
                     TTSLFGFLILQLVPSRSPTTTGTTKDKNPAEDIKIADKKPLEPPKINLETSDETDSSN
                     "
     gene            <519847..>520407
                     /locus_tag="ZYRO0A06512g"
                     /db_xref="GeneID:8201888"
     mRNA            <519847..>520407
                     /locus_tag="ZYRO0A06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494607.1"
                     /db_xref="GeneID:8201888"
     CDS             519847..520407
                     /locus_tag="ZYRO0A06512g"
                     /note="similar to uniprot|P38812 Saccharomyces cerevisiae
                     YHR100C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494652.1"
                     /db_xref="GeneID:8201888"
                     /db_xref="InterPro:IPR010021"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027706"
                     /db_xref="UniProtKB/TrEMBL:C5DPV8"
                     /translation="MNISGTLNAFRVVYNPRICMPQLAVPTFNDLPIPINPNIKAVVL
                     DKDNCFAYPRENQVWHAYSDKWLDLKKKYPGAALLVVSNTAGSNDDRDYREAQLLEKD
                     LGTCVLRHSVKKPGCGQEVMKHFYENKIVESPDQVAVVGDRLFTDVMMANLMGSYSVW
                     IRDGVKISSNPIVKFEKALYSMFKPS"
     gene            complement(<520491..>531740)
                     /locus_tag="ZYRO0A06534g"
                     /db_xref="GeneID:8201889"
     mRNA            complement(<520491..>531740)
                     /locus_tag="ZYRO0A06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494608.1"
                     /db_xref="GeneID:8201889"
     CDS             complement(520491..531740)
                     /locus_tag="ZYRO0A06534g"
                     /note="highly similar to uniprot|P38811 Saccharomyces
                     cerevisiae YHR099W TRA1 Histone acetyltransferase
                     component putative ortholog of human TRRAP which is an
                     essential cofactor of c-Myc"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494653.1"
                     /db_xref="GeneID:8201889"
                     /db_xref="GOA:C5DPV9"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DPV9"
                     /translation="MSLSAQIDHFVTKFGGEGISLPARHSALSELSDIVEFVSNPEEY
                     QALLKVIIPLLLGQLQEINVSFDVGSPENKLRNSILKVFNRLPINQNFEPYVNQVLQV
                     IMGALPNENEENGVLCMKILTTLFKSFKAPLQDEVEEFIKIILRIYKNTPETVTKTFQ
                     NVNGTGASSDDDMRDEQMLNDEVDGGENNSTQDGSSVSVSSISGAGGATKTSDPKDSK
                     AAMYSFKVLSECPITMVTLYSSYKQLTTSSLPEFMPLVMDLLNMQVEQQRKAREEVES
                     RGERYTTVSPDIRNREAYCEFILAQIKATSFLAYVFIRGYTPDFLQNYVGFIPDLIIR
                     LLQDCPSELSSARKELLHATRHILSTNYKRLFLPKLDYLFDEKVLIGTGFTTHETLRP
                     LAYSTVADFIHNVRTELQLDDIEKTIQMYTRYLLDQSLALTVQIMSAKLLLNLVERIL
                     KLGKENPQEAPRAKKLLMIIIDAYVSRFKVLNRQYDTIMKYHKKHEQTKTAKTKYLQE
                     AILVDNKDSNELMDHILQPAGPVASINGKTKETDTKVDESKMEIDGESNEDNDQEEPV
                     DDNCSMYDIKNYAPILLIPVSTNDPIKDAFYLYRTLMSFLKTIIHDLKVFNPPPAEYT
                     IANPKLWVSVSRVFSYEEVLVFKNLFHECIIGLRFLSSNVGKPPQPVKKHFDITMPSL
                     PVSATKDGRELMDYLAFMFMQMDSSTFNEIIESEMEFMYESMLEDSALLHVAQSFLTS
                     EITSPNFAGILLRFLKSKLKDLGNVDFNKSNILIRLFKLSFMSVNLFPTINEIVLLPH
                     LNDLILDSLKYSTTAEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQSLNGM
                     ILTACLPHERELYVELCITVPVRLSVLAPFLPYLMKPLVYALQGYPDLVSQGLRTLEL
                     CIDNLTAEYFDPIIETVVEDVSKALFKLLKPQPFNHTISHTAVRILGKLGGRNRRFLR
                     PASDLESQNELDIEINAFFKMNGLTEEVPLSVTPGVKSALEILADYRADAGYKVSAFK
                     YLSSVLLLFVKSSTNFDENYDALLETAVHTVTLEKIEIKPDFTAEPVKNNRTFHSQEK
                     LFIKLLQAMFFSYTVPELKEDSSKLLNWLIDHFSLLQVNNTLLDKRNYSSVFNIDLKQ
                     PGVMIDSRVLVEAISYSLSSYITEIRNIAISGIKRVYERGKLIYGEELVFTHSLVFAL
                     FRRFIHNCYEEAFYDKRAGVIGIKTLIEIGISAKFLKRSQFELIDGLLFVLKDTPSET
                     PADITESAEELLLQVLRTTLSDVNELNSKISQNTITDIVCELSNPKAKVRQACQRCLA
                     VISEATNVPIVNLMEHSKHFLLSPIFAKPLRALPFAMQIGNVDAVTYCLGLPNTFLNF
                     NEELYRLLQEAIVLADAEDESLSSLQRATEYRTSEQLVQLRVSCIKLLAFALKNEEFA
                     AAQQGNIRFRILAVFFKTMLKTSPEIIDTTYHALEGVLAENSRLPKELLQNGLKPMLM
                     NLSDHQKLTVPGLEALSKLLKLLIAYFKVEIGRKLLDHLNAWCRVEVLDTMFGQDICE
                     QTPTKIIVGIINIFHLLPPQADMFLNDLLLKVMLLERKLRIQLDSPFRAPLAKYLNRF
                     HVSFMEYFKKNMALRQLILFMCSIIQKSEARDLADDFEKEMDTFYEYYITNIPTNQVR
                     VVSFFTNMLDLFSTLVKIRGKEWLKGKGEMVLKLKDMLDLVLRTIRKNAFYIDKLQLN
                     QAIERYQGIYLDFISFYPEEQNLLLDFIEFAISHGFELSHRFKLFIFENVVSTDNREQ
                     QAAYLTSSLNFALSDKNLDAGVFVLQNIVNATFIYEGSRNKSLKSFSVNNVRPEWLDL
                     IYQKIWKSSNEVLLSNVAGRYDVYRFELLQLSSVFIKWAPEMITDIRKDVIKFNWHFL
                     KLGDTLVKQAAYLVTSYFIAQFEFPLKVVTQVFVAILRCSHAEARYLVKQSLDVLAPV
                     MHERMISAGTPNAWIIWVKRVLFENDSGQNNTLYEFLINHPDLFFESRELFISNIIHH
                     MSKVTFISNSSPDNHTLAIDLASLILYWEDRAQDIEQSKKQDQDGDVIMDETPEVEND
                     ESGKSTSPPKKESNQTVSMNLRETCVAFLIRYVCSSNHRASETELGLRAMKILSSLLS
                     EKHWSNVNVKLFYFEKFLMYQDLGSENILYYSMNALDVLYVFFKNKSADWVMENLTTI
                     QNLLDKCLKVDHHDIQEVLQKVLTVILKAIKQKNVINDNEEETPGKNFVNTVIATIGQ
                     DLQGTSSIAAGVMLLWTLFMVFPHSVDPLLGPIMKTFSKLCKDHLSTPQPRDAAGVEE
                     ARITTRLLEKVLCLLSMKVSSLGDSRRPFLSTVALLIDRSMDQNFLRKIVNIARGWVF
                     NNEVFPTVKEKAAILTKMLAFEVRGEPSLSKLFYEIILDLFDQKHFNNTEITVRMEQP
                     FLVGTRVRDVSIRRRFMTILDNSLERDIKERLYYVIRDQNWEFISDHPWLNQALQLLF
                     GAIEKDRPLTLIDAYGLSSPKILGEFLPDNVTVSSESKNKDLSSFVKEHVVSLESFCN
                     ITAANIFDPLVEIFYQNPTAIHKTWVSVFPQAYKCIPRNEKYGFVRSLIALLSKPYHS
                     RQTNSKANVISTLLDSISRVDSLELPPHLVKYLAISYNSWYQCIKILESIQNNTSIDN
                     SKIVEANEDALLELYVNLQEEDMFHGLWRRKAKYTETNTALSYEQIGLWDKAQQLYEV
                     AQVKARSGALPYSESEYALWEDNWILCAEKLQHWDILTELAKHEGFTDLLLECGWRVA
                     DWNSDREALEQSVKSVMDVPTPRRQVFETFLALQNFADTRKGDQDVRRLCDEGIQLSL
                     HKWASLPERYSPSHKYLLHSFQQYIEFLEATQIYANLHTTTAQNLDAKAQEVKRVLQA
                     WRDRLPNIWDDVNMWNDLVTWRQHAFQVINNAYLPLIPSLQHANSNSNVNTHAYRGYH
                     EIAWVINRFAHVARKHNMPDVCISQLARIYTLPNIEIQEAFLKLREQAKCHYQNMNEL
                     TTGLDVISNTNLVYFGTVQKAEFFTLKGMFLSKLRAHDEANQAFATAVQIDLNLAKAW
                     AQWGFFNDRRLSEEPNNISFASNAISCYLQAAGLYKCAKTRKLLCRILWLISMDDASG
                     SLANAFESFRGEVPVWYWITFIPQLLTSLSHKEANMVRQILIRIAKSYPQALHFQLRT
                     TKEDFAVIQRQTMAVMGDRIDNQNSSNDGPRQPWEHLQELNNILKTAYPLLALSLESL
                     VAQINERFKTTTDEDLFRLINVLLIDGTFNYNRLPFPRGNPKLPANTENNLIRFSETL
                     LAPHIRPKFNADFIDSKPDFETYIKRLRYWRRRLENKLDRAPKVENLEKLCPHLSNFH
                     HQKFEDIEIPGQYLLNKDNNLHFIKIARFLPSVDFVRGTHSSYRRLVIRGHDGSIHYF
                     AVQYPSVRHSRREERMSQLFRLFNSSLSKNVQTRRRDIQFTVPIAVPLSPQVRIMNDS
                     PQFTTLHQIYDEYCAQKGINPDSIQDFVTEQLNIAHDKALPTPDLTVVKVEIFSSIQS
                     MFLPTTVLMDYFISLFTEFEDFWLFRKQFASNYGAFVFMTYMMMINGRTPHKIHVDKQ
                     SGDVFTLEMLPSRYPYERVKPLMKNLELNLPPDTPIFHNNEPVPFRLTPNIQKLIGES
                     ALEGIFAVNVFAISRALIEHDSELNTYLTLFIRDEIISWFSNLHRPIVENPQLREMVQ
                     ANVDLIIRKVAQLGHFSSSPAVTTQFILDCISSAVNPRNLAKTDANYLPWF"
     gene            complement(532685..532757)
                     /locus_tag="ZYRO0A06556r"
                     /db_xref="GeneID:8201890"
     tRNA            complement(532685..532757)
                     /locus_tag="ZYRO0A06556r"
                     /product="tRNA-Met"
                     /note="tRNA-Met (CAT) cove score=71.12"
                     /db_xref="GeneID:8201890"
     gene            <533368..>535530
                     /locus_tag="ZYRO0A06578g"
                     /db_xref="GeneID:8201891"
     mRNA            <533368..>535530
                     /locus_tag="ZYRO0A06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494609.1"
                     /db_xref="GeneID:8201891"
     CDS             533368..535530
                     /locus_tag="ZYRO0A06578g"
                     /note="similar to uniprot|Q66RD4 Saccharomyces cerevisiae
                     YDR349C YPS7 Putative GPI-anchored aspartic protease
                     located in the cytoplasm and endoplasmic reticulum"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494654.1"
                     /db_xref="GeneID:8201891"
                     /db_xref="GOA:C5DPW0"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DPW0"
                     /translation="MIRNGFGPSMIKIWLFLLIWLPCIIAKGGHAGGGHAGGGHAGGG
                     HVGGGHGSESGSDGKKGSGDSESTTEVSSSDSESESSPNSNSHSGSKPGSNSNSHPDS
                     KPGGKAGSKPAASSRVNEEGPSASQHKKTAIGHHTSAYAVCNGNSKSSSSHQRRSTVQ
                     QVLPTISLNRDNNSLYYTNVSIGTPGQKQPLVIDIVEPYNWVTHNHFESHDPISSNSS
                     GSYQSNLSRTSQQVDGSHVFHLDFVDLDDINATAMMDKISFESLSLKNQSSHTINNTQ
                     NDGSGALYNSHSLTLSNSSFFEINDTTSSKGVLGLGGKINDKGTDIDSSQFDSSFFLL
                     ESLRDNGIIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPLKKF
                     NNLIFLDSRTDMLSRGYPVLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHLP
                     AETIVQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNP
                     ETNSTMKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQARRKY
                     TTLITPDGAGTSATASISHYLSPSLSSTGKATPIASGYIPYAVSSNETLSMTLSPSQP
                     PETRIPDQFTATVFSNGLISTGRSFYNTYRSTSSSSTVPTDFASFTVTSAQRTSSTGQ
                     QGNKGSNAYRLKPPEIANKYWISHIFLLAGSIMLVMIW"
     gene            <535933..>538773
                     /locus_tag="ZYRO0A06600g"
                     /db_xref="GeneID:8201892"
     mRNA            <535933..>538773
                     /locus_tag="ZYRO0A06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494610.1"
                     /db_xref="GeneID:8201892"
     CDS             535933..538773
                     /locus_tag="ZYRO0A06600g"
                     /note="similar to uniprot|P38810 Saccharomyces cerevisiae
                     YHR098C SFB3 Member of the Sec24p family forms a complex
                     with Sec23p that is involved in sorting of Pma1p into
                     COPII vesicles peripheral ER membrane protein potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494655.1"
                     /db_xref="GeneID:8201892"
                     /db_xref="GOA:C5DPW1"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DPW1"
                     /translation="MEPDALAKDVSSLSLDQTGSRNTGKKGRRPNRAYHNLGSGAGTP
                     NTTPFLNASASQESFQFGAQPPQAPFAGASAGAGSVGNGFDTQSSPVPMTVPGFPPGS
                     PAIMAQERERVATAVDSPASPWFPKGNTPVQSSSHFVTTQRWEDQLLHLPKTFETARD
                     SVPPLPTTAFYAIDQGACDPRLLSLSMYNIPVDEHLRSATKLPLGLTIQPFATTIPDE
                     PLPLIDQRTETGPLRCKRCRAYINPGFKFGFDATATCNICGVKLRLPSDEFISPGISL
                     QGPDISFKPELQKGSVEFLVPQIYNAVQDQPALPLHYVFLMDLSLFSNENRSSLAVVE
                     GIRTSIEHIAGSQPNCKVAIMAYDNKIRFFNLRPDSESAQEYVVSDIDDVFLPFCNGL
                     FVRPQESMRLIDMTLNKIVEYITVDKFSHVAPVCYGSALEAAKLAIDTVTGGQGGKII
                     CTLNSLPTVGNGNLALKKDDAARKKLNCDNDFYKKIGNQFLRSYISLDLFVTSPGFVD
                     MATIGYPVEATSGNLKWYSNFNHENDAFTLINDMSNAVTSIVGYQALIKVRCSTGLNV
                     SQYYCESSEYSDRDPMIPVLTKNTTLDVLLKYDQKLPVGKNIAFQMALLYTDINGVRK
                     VRSINTNGAVSDNIREVFKFLNQNVAQRIMIKDVVQHLGDCDFPAIRKTIDDKMVEIL
                     TQYKALVGGSLTSQLVLPEALKTLPSYMLAFEKSELMLPNNHSTRGNARIYDLFRYKT
                     LSSAQLHYKLYPQIVPLHVLLSEDDLSFYDANEKMLQVRPESVESLSVRNGHQHLTNG
                     GCYLIFQGDTVYVWINENTNRMLLQDLLQADEEVPVSQISLFGGSLPEVGTEVNQKAL
                     DLIKNWSQLVSQPYLPVVLLRPNVDPYYAQVMNQLLCEDRAVNRIESLDNYLIAMHRR
                     IQEKLKKDDYIKVQTNHNAEQDGSLLQKFVQF"
     gene            <540195..>541724
                     /locus_tag="ZYRO0A06622g"
                     /db_xref="GeneID:8201893"
     mRNA            <540195..>541724
                     /locus_tag="ZYRO0A06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494611.1"
                     /db_xref="GeneID:8201893"
     CDS             540195..541724
                     /locus_tag="ZYRO0A06622g"
                     /note="similar to gnl|GLV|KLLA0F22154g Kluyveromyces
                     lactis KLLA0F22154g and some similarites with YDR348C
                     uniprot|Q66RD5 Saccharomyces cerevisiae YDR348C Protein of
                     unknown function green fluorescent protein (GFP)-fusion
                     protein localizes to the cell periphery and bud neck
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494656.1"
                     /db_xref="GeneID:8201893"
                     /db_xref="InterPro:IPR013226"
                     /db_xref="UniProtKB/TrEMBL:C5DPW2"
                     /translation="MLSRKSTSPSTNPFLDDVENENLNRGSRSSSQNGYTPPRYPKTS
                     PTTAAYPSAEEEKQMLRDRYRETEDMDNSGYGDADADADADLPPSYDEVAGPTKSNAP
                     YRREKASVSSNAAHTPSSPKDPLINSNRESDPRRRYSHYRGPVPSRAGGSGGNNERSV
                     PTAPMVAAPEPRRRYDRDHTPVQPRDRYKERDYSDREHREHREHRDRERSHHHPHRHR
                     SHRHRDHAPSSSKDKKSSNGTKPQPKNVDKIDKMDVTALFGSSFHHDGPFDAVTPHRN
                     KNAKAPPVLAFPADGPNNSIGGAPTKKNAMNEVFGRMDPEDDDDIYQARPKSSPRTTV
                     FGVSSDPSSANGSSTTLDAVKPGAKDLTAFDPRGRVQAVEGPTTDGLGSTTFLDGAPA
                     SNKAIGEDVRAHARQTRLGGVQRKPSLSQKLTSTVRGGSSSGPSSSYGNGSGSGTVYS
                     RNLAPEKPLSLTRSHSGHLENGDDDEDVYLGLPSSELSRKKSTGTRLMRRVRSMKVGR
                     K"
     gene            complement(<541958..>542881)
                     /locus_tag="ZYRO0A06644g"
                     /db_xref="GeneID:8201894"
     mRNA            complement(<541958..>542881)
                     /locus_tag="ZYRO0A06644g"
                     /product="mitochondrial 37S ribosomal protein MRP1"
                     /transcript_id="XM_002494612.1"
                     /db_xref="GeneID:8201894"
     CDS             complement(541958..542881)
                     /locus_tag="ZYRO0A06644g"
                     /note="similar to uniprot|P10662 Saccharomyces cerevisiae
                     YDR347W MRP1 Mitochondrial ribosomal protein of the small
                     subunit MRP1 exhibits genetic interactions with PET122
                     encoding a COX3-specific translational activator and with
                     PET123 encoding a small subunit mitochondrial ribosomal
                     protein"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP1"
                     /protein_id="XP_002494657.1"
                     /db_xref="GeneID:8201894"
                     /db_xref="GOA:C5DPW3"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="InterPro:IPR019832"
                     /db_xref="UniProtKB/TrEMBL:C5DPW3"
                     /translation="MFRSSLSFLRTSRSYITPTLEHLNSGSGLKGLFSPQGLDNGWFS
                     RAEHYTNKLNSLTNGIEEIPLEKLIYENAKSGVKRNIVNYATLLYNLKFAFSTLHGCP
                     KELPNASDIDVKELLKTPELTLKYANEPLDTGKEKLHSALVSSFGSIVEFRTLLLNSN
                     NAISGDGFTWLVARRVASQDFDSQKLEFDRLFILNTYNAGSPFNFNKKGHMDELKNQY
                     EKASKELDQEQQEFNAPLRSKSVEEARQMESFKDTEYLPLLAIDASPKAWLYDYGPYG
                     KQMYLDRVWESIEWDLVESRLPEKSQSHQLL"
     gene            <544036..>545427
                     /locus_tag="ZYRO0A06666g"
                     /db_xref="GeneID:8201895"
     mRNA            <544036..>545427
                     /locus_tag="ZYRO0A06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494613.1"
                     /db_xref="GeneID:8201895"
     CDS             544036..545427
                     /locus_tag="ZYRO0A06666g"
                     /note="similar to uniprot|Q05515 Saccharomyces cerevisiae
                     YDR346C SVF1 Protein with a potential role in cell
                     survival pathways required for the diauxic growth shift
                     expression in mammalian cells increases survival under
                     conditions inducing apoptosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494658.1"
                     /db_xref="GeneID:8201895"
                     /db_xref="GOA:C5DPW4"
                     /db_xref="InterPro:IPR013931"
                     /db_xref="UniProtKB/TrEMBL:C5DPW4"
                     /translation="MLKWIQGGISAVTGIAEPEYGSDYIHSVADRVKGKQPYKETSRE
                     DLYWLNPDYTNVETATFYFTNIKTGVLGFAQIIHSNIIGLHTQAQFTFRVYNAKEGKE
                     ALNLWTSTKLENFRIDGPNFYADNLSVELDQDSKTYHFKSDVNEKSKVDLTFTKLTPG
                     CKVGDDPSTYYGDNIEEPWGRMRHVFWPRNKVTGKIDIKVPVKQQASEEHKDIKGEQT
                     SQDTRQKDRESAEEKGTSEENEEEEEEEELEDLHIKFTDESPALSMFVMAFQGMKPHH
                     AAKAWNFLYFHSEDHTAVLMEFITPKSYANTKVSVGIITSKNEVLSVSVNNDFRHLNS
                     SVDSVGWNVPKNLSVKFNGFKSTAPDEKIAAITNSPTKQEKYDNDTQLHATVEGKLDQ
                     LVERIDVMNEIPNFVKSIVSGVAGTKPYIYQYADEFTLQFQDASKEKGLAWVEVTFIS
                     EGETVTDESYNEA"
     gene            <546489..>548204
                     /locus_tag="ZYRO0A06688g"
                     /db_xref="GeneID:8201600"
     mRNA            <546489..>548204
                     /locus_tag="ZYRO0A06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494614.1"
                     /db_xref="GeneID:8201600"
     CDS             546489..548204
                     /locus_tag="ZYRO0A06688g"
                     /note="highly similar to uniprot|P39003 Saccharomyces
                     cerevisiae YDR343C HXT6 High-affinity glucose transporter
                     of the major facilitator superfamily nearly identical to
                     Hxt7p expressed at high basal levels relative to other
                     HXTs repression of expression by high glucose requires
                     SNF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494659.1"
                     /db_xref="GeneID:8201600"
                     /db_xref="GOA:C5DPW5"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DPW5"
                     /translation="MSKSEEHNETAITPEFSPELSPTESPSPSGGLPAKLEDEALKDY
                     VLHPEDEEPIIDLPKKPASAYISVAIMCVMIAFGGFVFGWDTGTISGFVNQSDWIRRF
                     GTQRSDGTYYLSKVRMGLVVSIFNVGCAIGGLTLSKIGDIYGRKIGLISVVVVYVVGI
                     VIQIASVDKWYQYFIGRIISGLGVGGTAVLSPMLISEVSPKHIRGSLVSCYQLMITAV
                     IFLGYCTNYGTKNYTNSVQWRVPLGLCFAWALFMIGGMTFVPESPRFLISVGKIEEAK
                     RSLSKSNKISTEDPGLLAELENIQASVEEEKLAGSASWSEMFSPKTKVLQRMIMGIAL
                     QSLQQLTGDNYFFYYGTTIFKSVGLEDSFQTSIIIGVVNFFCTFLSLFTVDRFGRRKC
                     LLWGAIGMVCCFAVFASVGVTRLWPNGQGNGSSKGAGNCMICFTMFYIFCFATTWAPL
                     CYVIVSESYPLRVKSKGMALATAANWLWGFLISFFTPFITDAINFYYGYVFMGCLVFA
                     YFYVFFFVPETKGLTLEEVNEMWMDNVLPWKSPDWVPSSRRNVDYDANAMSHDDKPFY
                     KKLLG"
     gene            <548548..>550488
                     /locus_tag="ZYRO0A06710g"
                     /db_xref="GeneID:8201601"
     mRNA            <548548..>550488
                     /locus_tag="ZYRO0A06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494615.1"
                     /db_xref="GeneID:8201601"
     CDS             548548..550488
                     /locus_tag="ZYRO0A06710g"
                     /note="highly similar to uniprot|Q05506 Saccharomyces
                     cerevisiae YDR341C Cytoplasmic arginyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494660.1"
                     /db_xref="GeneID:8201601"
                     /db_xref="GOA:C5DPW6"
                     /db_xref="InterPro:IPR001278"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005148"
                     /db_xref="InterPro:IPR008909"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DPW6"
                     /translation="MWKRITSSLFQRFTLPLYHRKFPIKKLSIKRELSTLQPIKMSNT
                     FAQHLQKLSINDPPVFEGSHPEANVVDLMRNYVAEELSKVSGVDAKQIYPALEWTNTL
                     ERGDLLIPVPRLVRQKGINPREIAQEWAEKFPQGELISNVEANGPFVQFFFNPQFLFH
                     TVVPDILTRTEDYGACKYVENKKVLIEFSSPNIAKPFHAGHLRSTIIGGFLSNLYEKC
                     GWEVIRMNYLGDWGKQFGILAVGYERYGDEKKLAEDPIDHLFQVYVRVNKDIEQESDS
                     LPESESTDGQSRAYFKRMEDGDPAAIKLWQKFRELSIEKYIGTYARLNIHYDVYSGES
                     QVSKESMEKALKLYDEKGLVHIDRGAKLIDMTRFNKKLGKVIVQKSDGTTLYLTRDIG
                     AAIDRYNKYHFDKMIYVIASQQDLHTAQFFELLKQMGFEWAKNLHHVNFGMVQGMSTR
                     KGTVVFLNNILEETKDNMHEVMKKNEVKYAQVENPDEVADLVGISAVMIQDMQGKRIN
                     NYEFKWERMLSFEGDTGPYLQYAHSRLRSMERNVPDITVADMKNADFKLLQEPAAIAL
                     VRLLSQYPDVLRNALKTHEPTTVVTYLFKLTHQVSSCYDVLWVAGQTKELATVRLALY
                     AATRQVLFNGMKLLGLTPVERM"
     gene            550669..550768
                     /locus_tag="ZYRO0A06732r"
                     /db_xref="GeneID:8201602"
     tRNA            join(550669..550705,550724..550768)
                     /locus_tag="ZYRO0A06732r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (GCT) cove"
                     /db_xref="GeneID:8201602"
     gene            <550964..>551533
                     /locus_tag="ZYRO0A06754g"
                     /db_xref="GeneID:8201603"
     mRNA            <550964..>551533
                     /locus_tag="ZYRO0A06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494616.1"
                     /db_xref="GeneID:8201603"
     CDS             550964..551533
                     /locus_tag="ZYRO0A06754g"
                     /note="highly similar to uniprot|Q05498 Saccharomyces
                     cerevisiae YDR339C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494661.1"
                     /db_xref="GeneID:8201603"
                     /db_xref="GOA:C5DPW7"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR006984"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5DPW7"
                     /translation="MGKAKKTRKFGLVKRTLNAKKDPRLKQNQDKKPQKADPELTRNI
                     PQVSSALFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCV
                     MAELEKLGPKYRIALKLARDPRIKRLSCTHKGTYADDCLVNRVMQHKCYIVATNDAPL
                     KQRVRKIPGIPLMSVGGHSYVIEKLPDAF"
     gene            <551779..>552669
                     /locus_tag="ZYRO0A06776g"
                     /db_xref="GeneID:8201604"
     mRNA            <551779..>552669
                     /locus_tag="ZYRO0A06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494617.1"
                     /db_xref="GeneID:8201604"
     CDS             551779..552669
                     /locus_tag="ZYRO0A06776g"
                     /note="similar to uniprot|P38806 Saccharomyces cerevisiae
                     YHR090C YNG2 Yeast homolog of mammalian Ing1 NuA4 histone
                     acetyltransferase complex component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494662.1"
                     /db_xref="GeneID:8201604"
                     /db_xref="GOA:C5DPW8"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:C5DPW8"
                     /translation="MDPSSVLDQTIQDVSNLQAEFTHILGEIRASDTQLLDQRKKYMQ
                     KDSQIHKFIRQHGSLQEHPKEQELSEKIREKMSACKNLQEQKCTMANTALYLVAKHLS
                     RLEKNIGLLEEDGLLAPVDEDADSSTEFSRESSSVSGTGERRRKAASSSSHEPSHVKR
                     RRTGRASSPNQTAHTPSVPPPATSLSQPVASREDESHENTEGSPLPVVEKDVNFDLQD
                     YNDDLFSGYNNNEEEDRTLYCFCQSVSYGEMVACDGPNCKYEWFHYSCVNLKEPPKGQ
                     WFCPDCRQEMAKDKLKKKKI"
     gene            <553122..>555185
                     /locus_tag="ZYRO0A06798g"
                     /db_xref="GeneID:8201605"
     mRNA            <553122..>555185
                     /locus_tag="ZYRO0A06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494618.1"
                     /db_xref="GeneID:8201605"
     CDS             553122..555185
                     /locus_tag="ZYRO0A06798g"
                     /note="similar to uniprot|Q05497 Saccharomyces cerevisiae
                     YDR338C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494663.1"
                     /db_xref="GeneID:8201605"
                     /db_xref="GOA:C5DPW9"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="UniProtKB/TrEMBL:C5DPW9"
                     /translation="MVTALISKALSEVHPTLRTNGMGIGNTHRRISLGFLPVNKKNPL
                     VRKYRRRNGRADQRSYQSLGEDFGSSAREPDFFLNEAIEEEDYLNDTDGGELSRTISL
                     PSRVSETPDVSQLDNDWILQEHERRYSSAYNSDHEEQEELDIMGRYPGRELDYDEFMQ
                     RLQVQKQMYENERANFGMKPRRPSFISVTSRGTVPIVYEEYDENAPTERFTNVTFQSE
                     SKVIASYSFPLIFTFLLEQMFPMVCSLTVGHLGSNELAAVSLASMTSNITLAIFEGIA
                     TSLDTLCPQAYGSGRFYSVGIHLQRCIAFSHVVFIPFAIFWFYSEPILSLVVPEKELV
                     ALTAKFLKVLILGAPPYIFFENLKRFLQAQGIFDAGIYILSICAPLNVLVSYTLVWNR
                     YIGVGFIGAAIAVVINFWMMFIMLLLYTMFIQGKKCWGGFTRKAFTHWGDLARLAISG
                     IIMLEAEELSYELLTLFSAYFGTKYLAAQSAVSTTAALLYMVPFAVGISTSTRIANFI
                     GAKNQVAADIASRVGLTFSFAAGLSNCCFLVFGRHIVARIFSRDETVLNLMSSLLPLV
                     GIVQNFDSLNAVAGACLRGQGMQALGSIVNLVVYYIIAIPLGMFLSYFLDWKLYGLWV
                     GIGIGMLLIGLIESYYVLFPDWDSIMTYAEMLKETEEDDESDDDSDYRDSDEEPDETS
                     PLLRL"
     gene            <555383..>556831
                     /locus_tag="ZYRO0A06820g"
                     /db_xref="GeneID:8201606"
     mRNA            <555383..>556831
                     /locus_tag="ZYRO0A06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494619.1"
                     /db_xref="GeneID:8201606"
     CDS             555383..556831
                     /locus_tag="ZYRO0A06820g"
                     /note="weakly similar to uniprot|P08465 Saccharomyces
                     cerevisiae YNL277W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494664.1"
                     /db_xref="GeneID:8201606"
                     /db_xref="GOA:C5DPX0"
                     /db_xref="InterPro:IPR000073"
                     /db_xref="InterPro:IPR008220"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DPX0"
                     /translation="MRSLMGLIKPNLVLLRAKRFNSSGSTNPAMMFPCLDKMERVSEE
                     LRTTTVGTQGQNEPVYGKVKSGFEIFKSNRPFYTDYGGVLPNFQIAYETWGTLNEDKS
                     NAILIHTGLSASSHAHSTNLNQQPGWWEKFIGPGNVCLDTNKWFLICTNVLGGCYGST
                     GPSSPDPADGLPYATRFPMLSVHDMVRAQKRLINEHFGIEKLYASLGSSMGGMQSLSY
                     AQQFPSEVNKVISVSACARSHPSSIAMRHAQRQVLMGDPNWNRGFYYPTAAEPNKIPP
                     HVGMKLAREIATVTYRSGPEWESRFGTERLDDERSPVLCPDFLIETYLDHQGEKFSLE
                     YDANSFLYISKTMDLFDLSLSHKERSIRRRARAKELYESGTLNEAQDPLLDRTSDKKR
                     HRTSTVEQSYQDLKQGCKPLLDNDVLVVGVKSDGLMPCWQQREIYSLLDGDTNPNVAH
                     VELQESESYFGHDTFLLDLEHIGRSIGQFLCK"
     gene            complement(<556881..>557750)
                     /locus_tag="ZYRO0A06842g"
                     /db_xref="GeneID:8201607"
     mRNA            complement(<556881..>557750)
                     /locus_tag="ZYRO0A06842g"
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /transcript_id="XM_002494620.1"
                     /db_xref="GeneID:8201607"
     CDS             complement(556881..557750)
                     /locus_tag="ZYRO0A06842g"
                     /note="similar to uniprot|P21771 Saccharomyces cerevisiae
                     YDR337W MRPS28 Mitochondrial ribosomal protein of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS28"
                     /protein_id="XP_002494665.1"
                     /db_xref="GeneID:8201607"
                     /db_xref="GOA:C5DPX1"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR005290"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="UniProtKB/TrEMBL:C5DPX1"
                     /translation="MFAACGFVVHDLRQSFRPIMSISRSFSCSRPTQGVKAVKFLKSQ
                     RKKQANLARQSELSSSVDAVDPVLGRRDTPFINRVVAELREPGVLSHGYQQNEVEKLM
                     SALESTKRRTLELSSLNSELVEPESLESLEARREAISRILSMRNADSKNSLKMALKLA
                     REEFQRFPGDTGSSEVQASCMTIRIHNLVKHIKDHQKDYANIRILRMLVQQRQSILRY
                     LKRDNPERYFWTLEKLGLTDSVVMQEFNMDRRYMQDFKMFGDKILIKDSKKVADQKRR
                     ELRKQRRVAGPSI"
     gene            <558027..>558638
                     /locus_tag="ZYRO0A06864g"
                     /db_xref="GeneID:8201608"
     mRNA            <558027..>558638
                     /locus_tag="ZYRO0A06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494621.1"
                     /db_xref="GeneID:8201608"
     CDS             558027..558638
                     /locus_tag="ZYRO0A06864g"
                     /note="some similarities with uniprot|P28007 Saccharomyces
                     cerevisiae YHR089C GAR1 Protein component of the H/ACA
                     snoRNP pseudouridylase complex involved in the
                     modification and cleavage of the 18S pre-rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494666.1"
                     /db_xref="GeneID:8201608"
                     /db_xref="GOA:C5DPX2"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR021154"
                     /db_xref="UniProtKB/TrEMBL:C5DPX2"
                     /translation="MSFRGNLRGGRGGMRGGRGNGRPNGRFVPQGPPDTVLEMGQFMH
                     PCEGDIVCKSINTKIPYFNAPMYLENKTQVGKVDEILGPLNEVYFTIKCTEGVHATSF
                     KDGDKFYIGSDKLLPIERFLPKPKVAGPPKPRKKKAPMRGGPSFGRGGSSFGRGGSSF
                     GRGGPSGGRGGFGARGSSRGGFRGGGRGASRGGFGRGRGGKRF"
     gene            complement(<558674..>559645)
                     /locus_tag="ZYRO0A06886g"
                     /db_xref="GeneID:8201609"
     mRNA            complement(<558674..>559645)
                     /locus_tag="ZYRO0A06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494622.1"
                     /db_xref="GeneID:8201609"
     CDS             complement(558674..559645)
                     /locus_tag="ZYRO0A06886g"
                     /note="similar to uniprot|Q05473 Saccharomyces cerevisiae
                     YDR336W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494667.1"
                     /db_xref="GeneID:8201609"
                     /db_xref="GOA:C5DPX3"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPX3"
                     /translation="MMSLWTKRWFSTTSSLTNRAADIGKIVLNTKVQQPFKSDGGRKQ
                     RQVAKTKKPARDSNPPAWYTLNQKYSSLFSEPSATEINSVNHFFNSSDVRYEWSAAHF
                     IDVPGERLKEKVSNESNGKKFQGKTYVPFELVNGLPEVAFLGKSNAGKSTLLNSLTTD
                     LKQTSLGEYARASKRAGFTKTLNSFNIGNKFRIVDTPGYGYNSSAEQGNLTMEYVSQR
                     QQLARCFLLISGEQGFNDMDLQIVEFLSSIGKPFEIVFTKMDKVKDLKGFQNMNLHEL
                     PGLPGIIFTNSLISKTCPKRYGVDLLRRLIFQSCGLQIGTKPSRQRK"
     gene            complement(<559934..>563608)
                     /locus_tag="ZYRO0A06908g"
                     /db_xref="GeneID:8202026"
     mRNA            complement(<559934..>563608)
                     /locus_tag="ZYRO0A06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494623.1"
                     /db_xref="GeneID:8202026"
     CDS             complement(559934..563608)
                     /locus_tag="ZYRO0A06908g"
                     /note="highly similar to uniprot|P52918 Saccharomyces
                     cerevisiae YDR335W MSN5 Karyopherin involved in nuclear
                     import and export shown to be responsible for nuclear
                     import of replication protein A and for export of several
                     proteins including Swi6p Far1p and Pho4p cargo
                     dissociation involves binding to RanGTP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494668.1"
                     /db_xref="GeneID:8202026"
                     /db_xref="GOA:C5DPX4"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DPX4"
                     /translation="MDSDGASQVVTALGVIYDPKSNNQQRLEAQKFLDDVKSKEESPY
                     WGYQIALNNPTDFILKHFGLGLLADAIKKKWNDYDEDKRLALRKWIMELNYRVLNTDP
                     RYIKQKLAFLWVEITKRTWGEALKEESPSEQELLNSWADMDSNLTELWNISEASRELT
                     LLIFKILFEDVFLLVDLTVLKRMTVIQPLCVMIVCPMDVFATKYKFTEKWTLFKANRE
                     GWFALWVSELNEALIQNNSSYVVRLLETLKTCLNWPLSEVIIENDIFSTSLQCFLSNI
                     PEAQSMALDSMHILLTRPYSNDEHYQAVIDKVFNSMDLLERVYDYLQFDPKEGIDEVK
                     YPIVKKCVDMISCLYVCVFKIKDNNQQIEKYLRLVLKATFHPSLIVSGLTLDLWCSCL
                     RNDDFLPLLDRYVMSDLLQFAADALIYYEQIEGHVSKNFVDIDFQSNSEFQNFCSTYR
                     KRIRDIIRLISCVKLDYTYDWLNNRLNSFFSSPYGQEVLNSTFLDRKGEPYLSALSQF
                     MIIECFINGCIRWKIWYPSGSDYSEKLDGILTKLEILSNQLIALNIREPLLLKKQIQN
                     FALFLTMLKDNVLFTLLEKIITSATMEYPEIDLEERSAEADAVRDLRYACGIELNRMA
                     LLMPESLMAIFPDLENVVAKILPNLSYHERISFKSFLLTIVLKSSLDRKQERFSAIVD
                     SELMAWSDQTTVVGLSELPWFMERLGIVQIAEYFQRHNINETSDLLSIPIDDEGKRLK
                     FDLTKRWQALFPVRATRMFIHYSMQSVKKDDEFKMLQDIWRPRIVPILPYIMRLLYQL
                     QAYHDPANWSQLPIVVQSFVKYSTIERFWEAGASNKSKDEFIDEHMRAMQTLRDFADS
                     VGHIVRYTREYTLLVINAISSLGSVFFDIDEAPHLLIDSIAIFKPDTNEISPGVSTHG
                     WKHIMNVAIRPLLKNCPEECIPKFMSAFLPKLFETLDLLLCQKWSLYMNDIDVNPIPM
                     DDEEMTEDILEENLLRQLTTVVVRIMVDCVGQASTNPQTSKPKFTSHQLNMRSTIFGN
                     LNVLAPFLKLLNHLMSFRDSKCSFNAILVMKCCLNDVLVREDSVDEFFTVEVMKNLLL
                     NVLCQSSFKDSFYEALNVFTVLFLTLCKEYKPARAYLYEISHGYDIDALYDQLRSVDH
                     YRNQRALMIEFIDWIKTANGNNDDEDSENSPEHKRQERRAAILQRANERLVKKNKDAG
                     DILDDPNTEDAAFGNLFGSS"
     gene            complement(<564255..>565136)
                     /locus_tag="ZYRO0A06930g"
                     /db_xref="GeneID:8202027"
     mRNA            complement(<564255..>565136)
                     /locus_tag="ZYRO0A06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494624.1"
                     /db_xref="GeneID:8202027"
     CDS             complement(564255..565136)
                     /locus_tag="ZYRO0A06930g"
                     /note="highly similar to uniprot|P38805 Saccharomyces
                     cerevisiae YHR088W RPF1 Nucleolar protein involved in the
                     assembly of the large ribosomal subunit contains a
                     sigma(70)-like motif which is thought to bind RNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494669.1"
                     /db_xref="GeneID:8202027"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:C5DPX5"
                     /translation="MAAEELKIKNKMLRQQIIADLKDQKNKERHKMRAQRAKEEREDP
                     TAKEKRLAENVPKTIEGMRVYDETIGQKDEADEEDLMQLFNNNGEPPKILLTTSINAK
                     RNAYEFANVLIEIFPNVTFVKRKFGLTMKDIVEASSKRNFTDIIIINEDKKKVTGLTF
                     MHLPEGPSFYFKVSSYVDVKKIVGHGRPTSHIPELILNNFSTRLGKTVGTLFQSIFPK
                     NPDFEGRQVITLHNQRDYIFFRRHRYVFENEKKVGLQELGPQFTLKLRRLQRGIKEET
                     EWEYRPEMDKEKKKFYL"
     gene            <565557..>566516
                     /locus_tag="ZYRO0A06952g"
                     /db_xref="GeneID:8202028"
     mRNA            <565557..>566516
                     /locus_tag="ZYRO0A06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494625.1"
                     /db_xref="GeneID:8202028"
     CDS             565557..566516
                     /locus_tag="ZYRO0A06952g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494670.1"
                     /db_xref="GeneID:8202028"
                     /db_xref="UniProtKB/TrEMBL:C5DPX6"
                     /translation="MNSNIQGPQRSYTDGSRFDNESPVLPILDFNTSKINTPIQLLPI
                     NVVLPELKYWQEQFSNTSEEDIWKRRNLRFQQRHQLKPLIRPNRRQDRTPHLKRDSKL
                     STETKMSNFGEYIKDMKSHGHTQILMRTRVITELGITRAKLQSPTLIMNNWGGTMNSI
                     QVQTRALSLGQETFRTEHALSCQRTTRDQVIELHFGPVSQSPADYQFAVYSTAVRQPH
                     GGYRWFHYVKGATYVNLAIFLLGSDFNYSINDNLVEPTIGNDLKVISAKKRCISRLRS
                     HAKSSMIANPCPGNNDTGGSIMEIQHVHPKLYKLLHHHTFLQL"
     gene            complement(<566600..>566908)
                     /locus_tag="ZYRO0A06974g"
                     /db_xref="GeneID:8202029"
     mRNA            complement(<566600..>566908)
                     /locus_tag="ZYRO0A06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494626.1"
                     /db_xref="GeneID:8202029"
     CDS             complement(566600..566908)
                     /locus_tag="ZYRO0A06974g"
                     /note="similar to uniprot|P38804 Saccharomyces cerevisiae
                     YHR087W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494671.1"
                     /db_xref="GeneID:8202029"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:C5DPX7"
                     /translation="MSSAVKYFYKGKETDLIVFATSIEDVNEYLKEPSIGKLSQVVEV
                     FKVFSNDQGSGAEGNLGEASKAQVQNEFGRKKIEEIIDLILKEGKPNASVGQVKKSFN
                     "
     gene            complement(<567369..>571958)
                     /locus_tag="ZYRO0A06996g"
                     /db_xref="GeneID:8202030"
     mRNA            complement(<567369..>571958)
                     /locus_tag="ZYRO0A06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494627.1"
                     /db_xref="GeneID:8202030"
     CDS             complement(567369..571958)
                     /locus_tag="ZYRO0A06996g"
                     /note="some similarities with gnl|GLV|CAGL0M01188g Candida
                     glabrata CAGL0M01188g and some similarites with
                     uniprot|Q05471 Saccharomyces cerevisiae YDR334W SWR1
                     Swi2/Snf2-related ATPase component of the SWR1 complex
                     required for the incorporation of Htz1p into chromatin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494672.1"
                     /db_xref="GeneID:8202030"
                     /db_xref="GOA:C5DPX8"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DPX8"
                     /translation="MTRDNGKYNQRDNEKYSNLAQLKFEYDLLSNELFHLKEYISLVE
                     FDPSYVNDTESYNRFIQDQGLSLENVHLQNHKEPSVDIPVRRRNLRAATAVGGGSSSS
                     PENGVGSWLKEVETLVRDKYEELGEQFDKGRSIKRPAVSKPKAVKKPKIQNRAPKSPD
                     GPLNERIEFDDMHQEEFDGNSDNYYFTTSSEDEDDNRRKPPRKKPRIKLVVNPPRQTV
                     TNPVHVLKPHYKSLHNYLESFKSMDEDVSIEEYENYIKEQKDVFKAIRRGLENGALRY
                     DPETDSIQPITTKEARLIQSHRPDPVTFFYKEQNLQTYQEYLINHGVYMSKLFQNSKK
                     ARIARARKVSQMIEQYFKHIAGAEERKAKEEEKRKKGLARAAMQAVKKRWTLAERAYK
                     ILRSDEEEKLKKIRGKEHLSKMLEQSTQLLGAQLNQNVEESVSESDVDDSDDDLGETD
                     SNRDDDDDRDDDNISSSEDDSEHEDMSSEGQETATTTSPPPMDSAPENGKTIPFSNRS
                     SPEPLSEHDGSSESDDSLVSTESSSEEEGASSDGEDATPATSNGLGLSSLFDDHIEDE
                     EKDEEDYEMSGSQSESEAEDKVKRETREVFEDEIKGKDKESVNTNNHTSDDSQNGNSD
                     LGLTKEKKPLMDEGYLENKGFEMDDKTVEETTPEQEVKPEEEKTKVAERANNVLDKAV
                     PEADPLSVVDVPVPFLLRGSLRIYQKQGLNWMASLYNNNTNGILADEMGLGKTIQTIS
                     LLAYLACEKENWGPHLIVVPTSVLLNWEMEFKRFAPGFKVLTYYGSPQQRKEKRKGWN
                     GPNAFHICIVSYQLVVQDQNSFKRKKWGYMILDEAHNIKNFRSTRWQALLNFNTERRL
                     LLTGTPLQNNIAELWSLLYFLMPQTITDGAGFSGFADLDAFQQWFGRPVDKLIETGQD
                     PAQDAETKKTVAKLHQVLRPYLLRRLKCDVEKQMPAKYEHVVYCRLSKRQRFLYDDFM
                     SRAQTKATLASGNFMSIVNCLMQLRKVCNHPDLFEVRPISTSFSMDHCVAYDYSDLNK
                     YVLRLLGQNERDRKVDFDFMNLSFTNNDAKMTTHRAQSISKLQCIQEFQRQVDLLREQ
                     NSLKSSEDEQLPSNLRHAEEFFRQLGQQKGQRAIDSLQFLQYVNRSKCEKKPLYGQNL
                     INLLRVGPTKEAGPQAQCLEEMLTPLQTRITKHKNLIENYAVLTPNVVALDLRELSLG
                     LNETNSVDSYSQAQLLSQFQSMTNPLHHLQTKLAIAFPDKSLLQYDCGKLQKLAILLQ
                     NLKDHGHRALIFTQMTKVLDVLEQFLNYHGYLYMRLDGATKIEDRQVLTERFNTDPRI
                     TAFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQDRCHRIGQTRDVHIYRFVSD
                     HTIESNILKKANQKRQLDNVVIQEGDFTTDYFTKFSVKELLGPEVPNVMGVNDKPLLQ
                     ESSQASKDPRRLEKLLAQAEDEDDVKAAHLAMKEVDADDNDFAENVNPDGTEGQKPIT
                     SKVDDDAQDEFDEYEGTNHVEEYMIRFIANGYYYS"
     gene            complement(<573135..>574811)
                     /locus_tag="ZYRO0A07018g"
                     /db_xref="GeneID:8202031"
     mRNA            complement(<573135..>574811)
                     /locus_tag="ZYRO0A07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494628.1"
                     /db_xref="GeneID:8202031"
     CDS             complement(573135..574811)
                     /locus_tag="ZYRO0A07018g"
                     /note="some similarities with uniprot|Q00539 Saccharomyces
                     cerevisiae YHR086W NAM8 RNA binding protein component of
                     the U1 snRNP protein mutants are defective in meiotic
                     recombination and in formation of viable spores involved
                     in the formation of DSBs through meiosis-specific splicing
                     of MER2 pre-mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494673.1"
                     /db_xref="GeneID:8202031"
                     /db_xref="GOA:C5DPX9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DPX9"
                     /translation="MSFKMNSGSNFYPRSGTTSGQRPFRYNSNINGTGSPVNAVGNRG
                     SQLYMGDLDPSWDENTIRQIWGSLGESNVVIRLMLHNNVSGSGTMGPRNNLGYCFLEF
                     PSTVHASNALLKNGMQIPNFVHKRLKLNWASSSHSSAGAFNEYSVFVGDLAPNVTESQ
                     LFELFISRFNSTSHVKIVYDQLTGVSKGYAFVKFTNPAHQQRALLEMQGIFLSGRAIR
                     VSNAGHLQNSADGKSKATGAASASNANAVGGINTGNNSGLMSGSQFMYPVQPQPALNS
                     FTDPNNTTVFVGGLSSLVAEDELRAYFQPFGTIVYVKIPVGKGCGFVQYVDRISAETA
                     IAKMQGFPIGNSRVRLSWGRSAKQAATVQQALINNALQQQQQQQQQQQQQQQQQQQQQ
                     QQQQQQQQQQQQQQLQQLHQHQQPLLQQPTYGYMPASSSAASTPMSSLYDEMSYLAAG
                     KSISPLPNYAPSLSSAKMLLPGYQNIDYFGFPQSASGLASTSNHDYLTTNPMQSNSDS
                     MQSQTTGGVPFYNGLNQPQVALQNNDRGFINGKTASLDRLENGSNGFVFA"
     gene            complement(<575254..>576435)
                     /locus_tag="ZYRO0A07040g"
                     /db_xref="GeneID:8202032"
     mRNA            complement(<575254..>576435)
                     /locus_tag="ZYRO0A07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494629.1"
                     /db_xref="GeneID:8202032"
     CDS             complement(575254..576435)
                     /locus_tag="ZYRO0A07040g"
                     /note="similar to uniprot|P30775 Saccharomyces cerevisiae
                     YGL143C MRF1 Mitochondrial polypeptide chain release
                     factor involved in stop codon recognition and hydrolysis
                     of the peptidyl-tRNA bond during mitochondrial translation
                     lack of MRF1 causes mitochondrial genome instability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494674.1"
                     /db_xref="GeneID:8202032"
                     /db_xref="GOA:C5DPY0"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="InterPro:IPR005139"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:C5DPY0"
                     /translation="MFRTFRIARWVLPRRIGLLGCRFQSTLEFKELHPSLLKKAHQSV
                     QEIVQLDQALSKGDGFDAETQKTYSRVSSIRSMYEEYQELLDNLKGLQEMIQTDPSLK
                     DDAKSEFDNSLPQFRQVSNNLLRKLLPPHPFAEKACILELRPGVGGTEAMIFTQDLLN
                     MYIGYAQYHHWKYHVIAQNENQSGNGLVDAILSIDEPGAYDKLKYESGVHRVQRIPAT
                     ETKGRTHTSTAAVIVLPQIVESVKDAEQSERSFRPDEIRIDVMRAGGKGGQHVNTTDS
                     AVRITHFPSGIVVAMQDERSQHKNKAKAFAVLRARLAERERKEKENSERAARKDQVTT
                     TDRSDKIRTYNYPQNRITDHRCNFTLYDIEGVTSGVKLDEVIDSMAARDFEERSKSLI
                     E"
     gene            <576600..>577561
                     /locus_tag="ZYRO0A07062g"
                     /db_xref="GeneID:8202033"
     mRNA            join(<576600..576615,576675..>577561)
                     /locus_tag="ZYRO0A07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494630.1"
                     /db_xref="GeneID:8202033"
     CDS             join(576600..576615,576675..577561)
                     /locus_tag="ZYRO0A07062g"
                     /note="highly similar to uniprot|P06242 Saccharomyces
                     cerevisiae YDL108W KIN28 Serine/threonine protein kinase
                     subunit of the transcription factor TFIIH involved in
                     transcription initiation at RNA polymerase II promoters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494675.1"
                     /db_xref="GeneID:8202033"
                     /db_xref="GOA:C5DPY1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DPY1"
                     /translation="MEYTKEKKVGEGTYAVVYLGTKQSTARRIAIKEIKTSEFKDGLD
                     MSAIREVKYLQEMQHQNVIELVDIFMASENLNLVLEFLPSDLEMIIKDKSILFTPADI
                     KSWMLMTLRGVHHCHRNFILHRDLKPNNLLIAPDGQIKVADFGLARTMPLAHEILTSN
                     VVTRWYRAPELLFGAKHYTSAIDLWSVGVIFAELMLRIPYLPGANDVDQMEITFRALG
                     TPTDREWPEVSTFPSYNKLQIYPPPSREELRRRFIAASENALNLMCGMLTMNPQKRWD
                     AVQCLESAYFREAPAPTEPSAIKM"
     gene            complement(<577593..>578798)
                     /locus_tag="ZYRO0A07084g"
                     /db_xref="GeneID:8202034"
     mRNA            complement(<577593..>578798)
                     /locus_tag="ZYRO0A07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494631.1"
                     /db_xref="GeneID:8202034"
     CDS             complement(577593..578798)
                     /locus_tag="ZYRO0A07084g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494676.1"
                     /db_xref="GeneID:8202034"
                     /db_xref="GOA:C5DPY2"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="UniProtKB/TrEMBL:C5DPY2"
                     /translation="MNCLGLRNAGLSGINRFFKRSLSAQYSHALIGGGVVGLAIAAEL
                     SKVKSNRVILLEKNDRIGMDVSSHNSEVIHAGLYYPPDSLKSKLCIQGKKIIYNELDP
                     VKTGVNWINCGKWIVAQTDYEDAVLEGLYYKCKNELGVDVEMMTSLEAMKKEKFIQVQ
                     RSVLNSPTTGIIDSHSLMEYLLAIIEANDGEVIYGSEVVNLQYEAGCGYTVTVKDHFS
                     DSQELTDVSTENLVNAAGLYADRISKMLLPPERHLKQYYAKGNYFKLTSAGFPGVRRL
                     IYPVPPKNGKSLGTHLTIDMDYQMKFGPDLEYVDSPTDYAANGASIPTAFKAISRYYP
                     YIGPDDLEVVGSGIRPKLAAPGDGEFKDFYIKQEEGFPGFVNLLGIESPGLTSSVAIG
                     RYVKDIYHT"
     gene            <579004..>580134
                     /locus_tag="ZYRO0A07106g"
                     /db_xref="GeneID:8202035"
     mRNA            <579004..>580134
                     /locus_tag="ZYRO0A07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494632.1"
                     /db_xref="GeneID:8202035"
     CDS             579004..580134
                     /locus_tag="ZYRO0A07106g"
                     /note="similar to uniprot|P40990 Saccharomyces cerevisiae
                     YDL107W MSS2 Peripherally bound inner membrane protein of
                     the mitochondrial matrix required for export of C-terminal
                     tail of Cox2p through the inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494677.1"
                     /db_xref="GeneID:8202035"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DPY3"
                     /translation="MLRFIRIAKCYSTASLSRQRPQFHEVFPQKRTVNRILFELDSKH
                     TFGKLYPVYDNIYQNMQKGIDTEIPKGISPSDLMIMKKVLEKIRHRTKSINPHLLALE
                     NALLDRSAELGNNDAISLLAFDVLRDPGHNNPEDVDYGKKLIKELYKKNHHLTMKLLG
                     DLSLKSGNDTEACKYYLKFLDLEDRTFLAGEVYGKLGQINFRKPDLRKAEQFFLKAIK
                     LSPLEYSVHSHFYLAQIYMNSDPLRARVLMENCATQGFRESFKTLGFLEMNYFEDFFK
                     AQEWFRLGLELFQIECFIGFFDCCAKLKNWTGANKCYETMLKLQEVNANYKEIIDKFV
                     TNRQAEVKEAMKYSSKPLSDPKTFESAAKKDPFVSKENKWGL"
     gene            complement(<580129..>581784)
                     /locus_tag="ZYRO0A07128g"
                     /db_xref="GeneID:8201959"
     mRNA            complement(<580129..>581784)
                     /locus_tag="ZYRO0A07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494633.1"
                     /db_xref="GeneID:8201959"
     CDS             complement(580129..581784)
                     /locus_tag="ZYRO0A07128g"
                     /note="similar to uniprot|P30777 Saccharomyces cerevisiae
                     YGL142C GPI10 Integral membrane protein involved in
                     glycosylphosphatidylinositol (GPI) anchor synthesis
                     putative alpha 1 2 mannosyltransferase required for
                     addition of the third mannose onto the GPI core structure
                     human PIG-Bp is a functional homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494678.1"
                     /db_xref="GeneID:8201959"
                     /db_xref="GOA:C5DPY4"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:C5DPY4"
                     /translation="MALKAVDKHHRLILLGLFGWRLFNALITRTFFQADEFWQALEPA
                     HFKAFGYGGLTWEWNNGLRSYAFPFLLEIAYRLARLVSKGCQYHWGEDRGDKVEYYCV
                     IIFPKVMMAFIAALGELYTILFVKKLYLLTFDKTDDKKPHDDWNVEKITIILSVTNFF
                     NCFLITRTFINSFEMSLTSAALYYWDWTGGDEVFTTNFTKSLCIAVFACLQRPTNGLI
                     WIIFGSRLIWNLFVKSQYGKVLRLIGKVAFWFALVCSINMIIDYHFYNENIFPPLNFL
                     RFNVLSPLSTFYGANQWHFHITQSLPLILNYTIPLFCLGLTYGRHSDVLTQIKIVIGF
                     NLIAYSMLSHKEFRFVYPLQPLLVLISTFGALKLQENNVLKHCFLLLAPLGSIIAAFL
                     LCWYHESGTIAVMKYLHDRPVVDSIGFIMPCHSTPWQSYLHRNDIKSLWAITCDPPLH
                     LMGDPDASAKLPYYMDESDFLYDDISGFIERNFPLLDINSSKRHTYQYEWPRLLVVFQ
                     HLENAYIKEHLKDNAYVEETRFFNSLVHWDSRREGDVIVYRKL"
     gene            <581984..>584734
                     /locus_tag="ZYRO0A07150g"
                     /db_xref="GeneID:8201960"
     mRNA            <581984..>584734
                     /locus_tag="ZYRO0A07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494634.1"
                     /db_xref="GeneID:8201960"
     CDS             581984..584734
                     /locus_tag="ZYRO0A07150g"
                     /note="similar to uniprot|P53119 Saccharomyces cerevisiae
                     YGL141W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494679.1"
                     /db_xref="GeneID:8201960"
                     /db_xref="GOA:C5DPY5"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="UniProtKB/TrEMBL:C5DPY5"
                     /translation="MLNFTGHTRRRNINLGNRSATTKQDLLIKAKQERDRRAQERQNE
                     GAVRVIQTHLRKYITCDYVIKHWNQGLTPMEEKEQIKHLVLAYGPRIYEHLNPPQVFD
                     ILQRSQPILSSYPGLLGNIQLCRMLGNYKDDTLVVITLSAMNAKFRTNKEFVEGLTSF
                     LRHTKSLSATTCNPLCEVLNVWGLNRTEELQPLFELNSNELTFYRPLLEFYQCLGSLN
                     ILPKITNPTSILLENLSYIYATGSRSDDLIYCIASCFRDIVHSPANPQLQESFSKLYE
                     KSFIDKLARMVEEDQHEEINPGTIVYFMQSAPEENLKNSILMTLLSRPLFFKKLFQDV
                     QRTTLDLNSLHLSASYSIFIKLLEMHLMISTDHELLSENSGFTIQQLVTFTTYLKDFV
                     FDSLWNSANDVKSEIVDETLSLLHKIYLRDSRLHFCSTKAEPDYWSNKDQEFLNVGIF
                     KYIEDYERLYRDFAERREEMYTNDEDQAVVDEMSSIKFKILDQLSTSFKHTVSTRQFR
                     KLQILIRAPFFIPFEQRVDLFYAFISLDKQRLMLDEDSTIMNMFMPWGMPGMGRQSAT
                     ISREHMLEDACNAFNSIGERFKAKLAVTFVNEFGPEVGIDGGGITKEFLTSVSDEGFN
                     SDKYGLFQSNDNYELYPSTSVDSQQLRYLWFLGKVLGKCLYDHVLIDVTFADFFLKKL
                     LNYSTRFTSSIDDMCSLDPTLYSNLVKLLSMSAEEIASLDLTFEITTDNGPVELIPNG
                     SKTRVQKETVLYYIVKVSDYKLNRSLFKQIFNFHGGMSMIIAPHWMEMFNSVELQMLI
                     SGKGKDVDLQDLKNNTEYGGFSQTDPTIRHFWQILEEFEREERFSFIKFVTSVPRAPL
                     QGFKSLEPKFGIRNAGSELERLPTASTCVNLLKLPDYRDKELLKKKLLYAINSGARFD
                     LS"
     gene            <585252..>587033
                     /locus_tag="ZYRO0A07172g"
                     /db_xref="GeneID:8201961"
     mRNA            <585252..>587033
                     /locus_tag="ZYRO0A07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494635.1"
                     /db_xref="GeneID:8201961"
     CDS             585252..587033
                     /locus_tag="ZYRO0A07172g"
                     /note="similar to uniprot|P32343 Saccharomyces cerevisiae
                     YKL124W SSH4 Suppressor of SHR3 confers leflunomide
                     resistance when overexpressed (putative) involved in ER
                     functions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494680.1"
                     /db_xref="GeneID:8201961"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR027713"
                     /db_xref="UniProtKB/TrEMBL:C5DPY6"
                     /translation="MINSIAPSLASFIGLLGFSNGYVIPRTEVVHDDTAGVMYILDGD
                     GQYEGLSGQFGDDELDMDIMIFSLITIIFIYISICFVYITIRFVVKRILTRNARATLL
                     QDGDEVRRTRRTIENLNARWPSALDDEDAVRDKLARLSPEEQFYYKQGEEYIRQNPPL
                     IIPHALSSHDHVEDPVIDDAARQFINEEGAWAWEFQPDPNLPNDTILVENKSEISFLN
                     YNYEASVCTNLPIPRINRVYYCEFKIFELNTQDGSGHHLGENELISFGLSTSPYPYFR
                     LPGKHHHSIAYESTGARRFNDSFELEPKLATLFPRLEKGDVVGIGYRSNSGTVFFTRN
                     GKKLKEDTVGGHVKGWKFKYVYPIVGANIPCKIHVNFGTYGFVYIEANVKKWGYAKSN
                     GMKLPPPSYEEYNQDTLLESGCEDEVSDNESVSSANEGDIVDSQGELLPPPPGFEFST
                     SPNAHSHIDREEITLDSLPMEPPSYSDDERSASINPKVGNSTSSGKHPPRLHHLGKSQ
                     YDHVSGEDALERERLVDDEEYDDEDDYYEYEDLEYDEEQDEDGDGEGRERAEYEAEGT
                     NGESRNEGYGAHENIHDNTVTNQFLQN"
     gene            complement(<587457..>588950)
                     /locus_tag="ZYRO0A07194g"
                     /db_xref="GeneID:8201962"
     mRNA            complement(<587457..>588950)
                     /locus_tag="ZYRO0A07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494636.1"
                     /db_xref="GeneID:8201962"
     CDS             complement(587457..588950)
                     /locus_tag="ZYRO0A07194g"
                     /note="similar to uniprot|P07269 Saccharomyces cerevisiae
                     YDL106C PHO2 Homeobox transcription factor regulatory
                     targets include genes involved in phosphate metabolism
                     binds cooperatively with Pho4p to the PHO5 promoter
                     phosphorylation of Pho2p facilitates interaction with
                     Pho4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494681.1"
                     /db_xref="GeneID:8201962"
                     /db_xref="GOA:C5DPY7"
                     /db_xref="InterPro:IPR001356"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017970"
                     /db_xref="UniProtKB/TrEMBL:C5DPY7"
                     /translation="MDYQYDENFDSHFPQDLALLSGQGADSHGTHNGSLEGSNGQTGM
                     EEVNAAVSFPNSSSTSPQEDRKSATITANSVISNSDNSSSKPKRTRARGEALDILKRE
                     FETNPNPTSQRRKKLSEMTGLPEKNVRIWFQNRRAKLRKDDRAGVRDGSGGLTGDNTG
                     DSNAFYSYDNGENSTLFDQIPLNINNNYYFIDICSITVGSWNRMKSGALRKSNWSTVK
                     DLSNLSPISINEIMSNATDLMVLISKKNFEINYFFSAMANNTKILFRIFFPINSVVNC
                     SLSLEANDIIEPRNSDQQDDENGESSLGDDNRSSNEDSEKLGELKINVSRPPNFAVYF
                     LEAPDEATNNQWSICEDFSEGRQVNDAFIGGSNLPHALKGLQNSLRFMNSLILDYNST
                     NQIIPPPPPQPFVMDSNPLSMHHPSATAPTPFFDQYDDTSNDVLGLEKDPTTTIKDAG
                     SHNSSNNNMNTSNDGSNLLSLSHDNQLQGMPDFFKSPPELTDDTRWL"
     gene            complement(<589193..>590704)
                     /locus_tag="ZYRO0A07216g"
                     /db_xref="GeneID:8201963"
     mRNA            complement(<589193..>590704)
                     /locus_tag="ZYRO0A07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494637.1"
                     /db_xref="GeneID:8201963"
     CDS             complement(589193..590704)
                     /locus_tag="ZYRO0A07216g"
                     /note="similar to uniprot|P47771 Saccharomyces cerevisiae
                     YMR170c ALD5 and similar to uniprot|P54114 Saccharomyces
                     cerevisiae YMR169c ALD4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494682.1"
                     /db_xref="GeneID:8201963"
                     /db_xref="GOA:C5DPY8"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR015657"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DPY8"
                     /translation="MSLYQEIVLPSGQKYSQPLGLFIDNEFVPSSNGSTLTTENPGTG
                     EVITSVQAADPVKDVDRAVKSARNGFKPWKAVSLVEKRDLFLKLAQLVEDNVDLLSQV
                     ESLDSGKPIKTNAAGDVESVSATLKYLAGWIDKTSGDAFSPAKGKLCYTLHQPLGVVG
                     CIIPFNFPLAMMSWKWTAIAAGNTAVFKSAHQTPLSILVFAQLVVKAGFPPGVFNVVS
                     GEGETVGNALVSHLDVNKIAFTGSTRVGQLVQKNAAINLKPVTLECGGKSPIMVFEDA
                     DIDEAVKWAAFGIFCNMGQICSGTSRCFVQRSKYNEFLTKLVAYTKENFPTGVPEDPE
                     VVVGPQITRDQQTRVFNYIDGAVAEGCRVVLGGSGLPETVASDEKHNGGFYASPTILA
                     DAEPHFKIAQEEVFGPVLSVGQFDDYEDALKIANDSQYGLGASVFTQNIAQAHEFADE
                     VESGMVWINSSNDLDFHMPFGGVKMSGHGRELGSYGLLNFTNVKAVYVNYCKF"
     gene            <591382..>592896
                     /locus_tag="ZYRO0A07238g"
                     /db_xref="GeneID:8201964"
     mRNA            <591382..>592896
                     /locus_tag="ZYRO0A07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494638.1"
                     /db_xref="GeneID:8201964"
     CDS             591382..592896
                     /locus_tag="ZYRO0A07238g"
                     /note="similar to uniprot|P47771 Saccharomyces cerevisiae
                     YMR170C ALD2 Cytosolic aldehyde dehydrogenase that uses
                     NAD as the preferred coenzyme expression is induced in
                     response to high osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494683.1"
                     /db_xref="GeneID:8201964"
                     /db_xref="GOA:C5DPY9"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DPY9"
                     /translation="MFTPIHIPQVGITYKQPIGLFINNEYVKSKDGSLIDTFNPATGE
                     KITSFYAAGTADIDEAVQAARNAYEDVWSKTTPSERSELLWKLASLVERDKKLLAAME
                     TLDSGKPYHSNALGDLDQIISVTKYYAGVVQNLTQGKQIPVSHDKFAVTFEVPYGVVG
                     QVVPWNYPLAMASWKMQGCLAAGNTIVIKPAENTSLSLLYFAQLFVEAGFPPGVVNIV
                     PGHGAQAGTALAAHPDVDKVAFTGSTKVGQAVMEAAGKSNLKPVTLECGGKSPAVVFE
                     DAEIEQAAEWCALGIFYNSGQNCTANSRIYVQESIYEKFLQEFKAQAAKAWKFGAKRD
                     PFDEECTLGPVISEVQQKRVKSYIEHGVKEGLNIETLHELPADVKGFFVQPTFFTNVP
                     QSSKLNREEIFGPVAVISTFKNESEALKLANDTNYGLASAVFTQNIGVATRFVRDIKA
                     GTVWVNSSNDEEISVPFGGFKMSGIGRELGEAGLGSYLQTKSAHFNLSVSAHKL"
     gene            <592998..>594788
                     /locus_tag="ZYRO0A07260g"
                     /db_xref="GeneID:8201965"
     mRNA            <592998..>594788
                     /locus_tag="ZYRO0A07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494639.1"
                     /db_xref="GeneID:8201965"
     CDS             592998..594788
                     /locus_tag="ZYRO0A07260g"
                     /note="similar to uniprot|P40969 Saccharomyces cerevisiae
                     YMR168C CEP3 Essential kinetochore protein component of
                     the CBF3 complex that binds the CDEIII region of the
                     centromere contains an N-terminal Zn2Cys6 type zinc finger
                     domain a C-terminal acidic domain and a putative coiled
                     coil dimerization domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494684.1"
                     /db_xref="GeneID:8201965"
                     /db_xref="GOA:C5DPZ0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ0"
                     /translation="MEIGLKKSKHPCGVCARRKVKCDRLIPCTNCIKRGQENECVDTG
                     KRDAEKKDYNSELIKFWHTYEYYVLDVGLFKLQLTDSNGKLEDFSSRWGDVQSIMDLV
                     DLDQSFQLLDYSMERLGPLFFGCLSDIGEIYVKLDDYWGRRDEGVPSNLDECYWDALL
                     WAIFTMAVYYMTPEKLATVFSEDQLQKWVGQESKNTQLNLLPAFTECTIMQLYNANFM
                     ANPDIKLIQIYLILCNTNFNWSNTHLSSTLLILCLHVAKMFHIDDFRSLINDSTAMKL
                     SKLTCEKLWYRLCTYDYLQSSPQRSISCHGEISSLLQHAAYLEDLPNTDVNQSEDNFE
                     VLYWKLISLDRDLDQYLASPTKPPLKTLDAIQRQTEIFQTKISNMVEEESFSSAFEKF
                     LAIFLLRSVCWKLHKMYFIFYDTSDSLTASIHHAKSLIALLVNNVRAKKRIFFNKHPI
                     VLMTFSRVASFYAFANIFMQKLTVEEIHADLKELLAHLPPTFGYKLENLTYLVDRLDQ
                     LKSIWEKIILIDSKNPFQHPIMLILKNDVERIYQILQRGPSLIRGTGLQSPKRLFQDD
                     YEFNMDDNNKEIALIVIEFEKKFDIGGILT"
     gene            complement(<594796..>597015)
                     /locus_tag="ZYRO0A07282g"
                     /db_xref="GeneID:8201966"
     mRNA            complement(<594796..>597015)
                     /locus_tag="ZYRO0A07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494640.1"
                     /db_xref="GeneID:8201966"
     CDS             complement(594796..597015)
                     /locus_tag="ZYRO0A07282g"
                     /note="similar to uniprot|Q2I041 Saccharomyces cerevisiae
                     YMR167W MLH1 Protein required for mismatch repair in
                     mitosis and meiosis postmeiotic segregation and spore
                     viability forms a complex with Pms1p and Msh2p to repair
                     mismatched DNA human homolog is associated with hereditary
                     non-polyposis colon cancer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494685.1"
                     /db_xref="GeneID:8201966"
                     /db_xref="GOA:C5DPZ1"
                     /db_xref="InterPro:IPR002099"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR011186"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ1"
                     /translation="MVSKIKPLDESVVNKIAAGEIIISPVNALKEMMENSIDAGASSL
                     DILVREGGIKLLQITDNGSGISKEDLPILCHRFTTSKLAKFEDLEKIATYGFRGEALA
                     SISHIARLTITTKTGDDRCAWRVSYSDGKMIGEPKPVAGKDGTVILVENLFYNMPSRL
                     RALRSSSEEYSKILDVVGRYACHSEGIAFSCKKFGDSQFALTVRANLSTVERIRCVFG
                     STVSSKLLDLELGPLEEFGVQKVVGKVSNLDLSFKKSISPVFFINNRLVTCNPLARAL
                     RQIYSTYLPKGDKPFMYLSILINPEILDVNIHPTKREVRFLHEEEIIEAISSKLNEEL
                     SKIDTSRTFKTSSIVTPQPLKETFESTKGPKGSVSKAPHTPVQNKQSPLGNSIKRYEN
                     KLVRTDASQSKITSFMANQSTPPIALRSTEKVVAEGIEGREGIENARESPWNDNNETT
                     KVESSPLRGRGSNVHGYTIVPKERVDVNLTSIKRLLEAADSSAHKDLTDIFANMTYVG
                     VVDGERRLATIQHDLKLFLLDYGAVCYELFYQICLTDFANFGVINLQSGNDSSLNLVH
                     ILSHFENLDEKSIKAIISKIWEMREMLSEYFSINIAGNTDAEDENTQLESVKITSIPL
                     LLKGYLPPLSKLPFLIYRLGTKVNWEEEQPCLDGIMRQLALLYVPEIIESIDLEESDI
                     PEDKKAAFVDKTKELSVVLDDVVFPCIKKRFLAPRHLTKDIVEIANLPGLYRVFERC"
     gene            <597220..>598392
                     /locus_tag="ZYRO0A07304g"
                     /db_xref="GeneID:8201967"
     mRNA            <597220..>598392
                     /locus_tag="ZYRO0A07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494641.1"
                     /db_xref="GeneID:8201967"
     CDS             597220..598392
                     /locus_tag="ZYRO0A07304g"
                     /note="similar to uniprot|P43124 Saccharomyces cerevisiae
                     YDL105W NSE4 Nuclear protein that plays a role in the
                     function of the Smc5p-Rhc18p complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494686.1"
                     /db_xref="GeneID:8201967"
                     /db_xref="GOA:C5DPZ2"
                     /db_xref="InterPro:IPR014854"
                     /db_xref="InterPro:IPR027786"
                     /db_xref="InterPro:IPR029225"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ2"
                     /translation="MAVRSDKRRRDSQDDSSRQVDKRLRLEGGSQGTQGTAVNEVEFE
                     VLQGYRKFSEAVAEDRARMARTGDIDIAVKNLQAVDSLFNQLTGSRNNGLFAHDSRAM
                     LSISELAQISVRNLKFDNFRSLVNLEDVLNSLKKYMLRDYFEWNGISEGNAASSMMNQ
                     SQNGARDGEEVGGDDNDDEEEEQSDNIRQTEMRKCHLKQYSGYEDFYQLNWFKLGGLF
                     NNLSRKVSTVDHLLGPFSMQRKTRAPVVRKEQDTVGALTTAEKVTQSSLNSTQQITTP
                     EQVKRMFKILERKNGKRQINLFKFVINPQSFSKSVENLFYVSFLIKEGRVVLEEDQDG
                     FPSIRIRGGPPTDPKAREIEIRKRREASENHIIFQMDMPTWKKLIEKFDIRSAFVE"
     gene            complement(<598428..>599573)
                     /locus_tag="ZYRO0A07326g"
                     /db_xref="GeneID:8201968"
     mRNA            complement(<598428..>599573)
                     /locus_tag="ZYRO0A07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494642.1"
                     /db_xref="GeneID:8201968"
     CDS             complement(598428..599573)
                     /locus_tag="ZYRO0A07326g"
                     /note="similar to uniprot|P43122 Saccharomyces cerevisiae
                     YDL104C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494687.1"
                     /db_xref="GeneID:8201968"
                     /db_xref="GOA:C5DPZ3"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ3"
                     /translation="MFTLSKAFPVGHTVAKRWYKVLAIETSCDDTCVAILDRKSSIEP
                     PRTIVHLKETLNSASAGGIIPTKAHLHHQQQIGPVTHRALQSAGMPNIDLVCVTRGPG
                     MPGSLSGGLDFAKGLAVAWKKPFVGVHHMLGHLLIPRMLNNGQNPRFPFVSLLVSGGH
                     TVLVLSRSCVDHEILCDTLDIAVGDSLDKCGREIGIRGNMIAKEMEKFINQEPLQLNV
                     PMQLPNPLRNKSTRVDVQAFSFAPFITALKGNLTKPLSEYQVHEVRSMAYQMQEAIFH
                     HIVTKLKLVIRLNKEKFEGVSSFVLSGGVGANARLRNLLETEFGDTFDNFCYPPLELC
                     SDNAIMIGWAGIELFEKHCLTTDLQATPVRKWPLTHLLEVPCWDSTK"
     gene            <599958..>601049
                     /locus_tag="ZYRO0A07348g"
                     /db_xref="GeneID:8201949"
     mRNA            <599958..>601049
                     /locus_tag="ZYRO0A07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494643.1"
                     /db_xref="GeneID:8201949"
     CDS             599958..601049
                     /locus_tag="ZYRO0A07348g"
                     /note="similar to uniprot|Q03829 Saccharomyces cerevisiae
                     YMR166C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494688.1"
                     /db_xref="GeneID:8201949"
                     /db_xref="GOA:C5DPZ4"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ4"
                     /translation="MWSLTSSLPIVHAPHHHGHPHAIPPPTTGGAGGDGGNRPSPPAI
                     DDEMEATNSPILHCILAGGFGGAIGDTSMHSLDTVKTRQQGAPNVAKYKNMLAAYRTI
                     FVEEGIFRGLYGGYSAAMLGSFPSAAIFFGTYEFSKRKLINEWGFNDTLTHLFAGFLG
                     DLVSSFIYVPSEVLKTRLQLQGRYNNSHFDSGYNYKNLRDCITTVVKTEGPVALLFGY
                     KATLARDLPFSALQLAFYEKFRQAAFKLEYKQIGQDHLSIMSELSTGALAGGVAGVLT
                     TPLDVIKTRVQTQQTSPTSELGKPASLSSSLFSSLRIVYKSEGLIGFFSGVGPRFIWT
                     SIQSSIMLFLYQYTLGRLNTIFPSNNGLG"
     gene            <601469..>603958
                     /locus_tag="ZYRO0A07370g"
                     /db_xref="GeneID:8201950"
     mRNA            <601469..>603958
                     /locus_tag="ZYRO0A07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494644.1"
                     /db_xref="GeneID:8201950"
     CDS             601469..603958
                     /locus_tag="ZYRO0A07370g"
                     /note="similar to uniprot|P32567 Saccharomyces cerevisiae
                     YMR165C SMP2 Protein involved in respiration and plasmid
                     maintenance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494689.1"
                     /db_xref="GeneID:8201950"
                     /db_xref="InterPro:IPR007651"
                     /db_xref="InterPro:IPR013209"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ5"
                     /translation="MQYVERAIGSVSKTWSSINPATLSGGIDVIVVEHPDGTLACSPF
                     HVRFGKFQILKPSQKKVEVIVNGKSTNIPMKLGDSGEAYFVFETSTDVQGIPEELLSS
                     PVMSATSSPPQSPRPDGQVEESDKLEEGVEVSKKLEEPDFLDINDSESSTDTSNGTGI
                     PLPTMSRTKTFQEKLNRRLTQIHIPSKLDNNGDLLLDMEGYKPNKDKVQDTDNQLKQL
                     LKDELGNDLDISGFVKEDSNGNIRIVNPFENHPHHHYPVSPPESPPMTANEPGLSLDF
                     SGDSSTLSGFTSSNTEADTNTNTNTDSKGSSTSSDGKFFIKTLRLSSEQLKCLDLKYG
                     ENDLTFSVDQGRALVSSKLFVWRWSVPIVISDIDGTITKSDALGHVMTMFGKDWTHIG
                     VAKLFSEIAKNGYNIMYLTARSTGQADSTRSYLRSIVQNGNRLPVGPVILSPDRTIAA
                     LRREVILKKPEVFKIACLNDMRSLYFDRHGHFKGEAEDRRHEKENEERVLEQEQLSLE
                     EMEEKPTPFFAGFGNRITDALSYRTVGVPSSRIFTINPDGEVHMELLELAGYRSSYVF
                     INELVDHFFPPVNNDDDDRSIRSAGPGSPINKSIDTDANIESNLYLRSKQEEKFTDVN
                     FWREPIPDLEELTDTSNSDGEDAKSKDARDGNYNSNDGRSSMLDKSLSHDHLQLSSPI
                     SFKNGTPKERSPSTESGRNIKGTSLFRSISPESIDEEDHNASHPQLSTPGRDKTRPPT
                     REEIGQQIYLELGSPLRQPQLLETTREDVPGTPASEISRLNISESEGPRDSGKDTASC
                     EQESDQDGDDEEEEEDDDEEDDDEFDEDEFT"
     gene            <604410..>605009
                     /locus_tag="ZYRO0A07392g"
                     /db_xref="GeneID:8201951"
     mRNA            <604410..>605009
                     /locus_tag="ZYRO0A07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494645.1"
                     /db_xref="GeneID:8201951"
     CDS             604410..605009
                     /locus_tag="ZYRO0A07392g"
                     /note="some similarities with uniprot|Q03825 Saccharomyces
                     cerevisiae YMR164C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494690.1"
                     /db_xref="GeneID:8201951"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ6"
                     /translation="MVRQASTFEGIYSTNKPEYPDFGGAGGPAVDMSGDSKYGTKSGN
                     IMPSSNTELDSTTTVVSDANASDPRQLLHAHVYNYLVKNGHYATARQFLKEADLPLDN
                     KNANEIINNSVNTNINNDNEDQQLPPGLLPTRLQVDSEETLLFEWWNSLCRLHDHVEQ
                     TPVEELRSTPQKVPTPFLPRVRQPFTEDQQDNVGASVSK"
     gene            605335..605408
                     /locus_tag="ZYRO0A07414r"
                     /db_xref="GeneID:8201952"
     tRNA            605335..605408
                     /locus_tag="ZYRO0A07414r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=67.58"
                     /db_xref="GeneID:8201952"
     gene            <605660..>607582
                     /locus_tag="ZYRO0A07436g"
                     /db_xref="GeneID:8201953"
     mRNA            <605660..>607582
                     /locus_tag="ZYRO0A07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494646.1"
                     /db_xref="GeneID:8201953"
     CDS             605660..607582
                     /locus_tag="ZYRO0A07436g"
                     /note="weakly similar to uniprot|Q03824 Saccharomyces
                     cerevisiae YMR163C Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494691.1"
                     /db_xref="GeneID:8201953"
                     /db_xref="GOA:C5DPZ7"
                     /db_xref="InterPro:IPR026235"
                     /db_xref="InterPro:IPR026859"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ7"
                     /translation="MGVDHLTSSVDTLLEKSMLSPIGWKCENFQSNIHPSAPTVVNGG
                     EWEYQFEIPNKWNQLIDRVFSRLPSVANEHFLEEFHYTVVSSDLLNASNPWRLSKMST
                     SGLLPTIIPDKSKTIRIRNFPYMTTILHVRKILNRLKFSNGSRRRVVITLLIALYLTY
                     QQEFHKMQSSRQNALSILKSMLDSLQRLTVLQHNYFAAHKEISNQCGSDRIGLVVTDL
                     LGSSLDLLFYSMTNATQDLLTISNSSELSKYCGIYGVPLSELYYRLTEPANDMESRWT
                     RLKVMRSFMLCCLLSQNHSGGRVGNNSTCDLEMCNFLRKIFPNYNLTQNSLINQSNRW
                     KLITTNMQQLQNLTVSMTASMLRHTELINNHRNSVPNARSVKRYSKFYLPPEDKKSSS
                     QGPIRLSTTLHGLRELEKLLIVTNEETTTTDSTIELVRQRLIDLLALWQTDDNDEVVS
                     QGRKNGISKTKFGNRGLSLDVVQNPRESIIKCGGPHLNLSPKLKDHVVFTPVDETQSD
                     IEQDSDYELQKTAATETSNDEEAVNSKKTLRSSDKTLIDQRIAKFQSLSDDELRLKLE
                     EGISKFAQENKKGRQKLRSQKSFELLRKPHNKEFMSVQGALRQISSASEITLNNTFST
                     EETIPMYYELQKILDK"
     gene            complement(<607607..>609028)
                     /locus_tag="ZYRO0A07458g"
                     /db_xref="GeneID:8201954"
     mRNA            complement(<607607..>609028)
                     /locus_tag="ZYRO0A07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494647.1"
                     /db_xref="GeneID:8201954"
     CDS             complement(607607..609028)
                     /locus_tag="ZYRO0A07458g"
                     /note="highly similar to gnl|GLV|CAGL0L07370g Candida
                     glabrata CAGL0L07370g and similar to uniprot|P43123
                     Saccharomyces cerevisiae YDL103C QRI1
                     UDP-N-acetylglucosamine pyrophosphorylase catalyzes the
                     formation of UDP-N-acetylglucosamine (UDP-GlcNAc) which is
                     important in cell wall biosynthesis protein N-
                     glycosylation and GPI anchor biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494692.1"
                     /db_xref="GeneID:8201954"
                     /db_xref="GOA:C5DPZ8"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ8"
                     /translation="MSVIDLYKSAGQEQLFQHLDQLNETDKSQFLSNLEAASRRISPQ
                     KLVDDCKKAISQSAENARDSSSVEPLPATSYQSVIDNASAQEEYYKIGLESVTNGEVA
                     VVLMAGGQGTRLGSSAPKGCYDIGLPSHKSLFQIQAEKLISLQRLSGTKSPIPWYVMT
                     SKPTHNTTKDFFEKHNYFGLESSQVVFFNQGTLPALDLQGEKLLLSSPTDLVESPDGN
                     GGLYRAIKDNQLLQDFEKKGIKHVYMYCVDNVLSKLADPVFIGFAIKHGFELATKVVR
                     KRDANESVGLIATKDNKPCVIEYSEISPELAAEKDSSGLLKLRAANIVNHYYSVELLK
                     RDLDQWCEHMPYHIAKKKIPCYDNTTGESLKPTEPNGIKLEQFIFDVFPGVSLDKFGC
                     LEVDRAQEFSPLKNAPGTANDNPETSRAAYLELGGNRLKKIGAQIADGVSVEVSSKLS
                     YAGENLSQYKGKVFDKDNTVLEN"
     gene            <609274..>614082
                     /locus_tag="ZYRO0A07480g"
                     /db_xref="GeneID:8201955"
     mRNA            <609274..>614082
                     /locus_tag="ZYRO0A07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494648.1"
                     /db_xref="GeneID:8201955"
     CDS             609274..614082
                     /locus_tag="ZYRO0A07480g"
                     /note="similar to uniprot|Q12674 Saccharomyces cerevisiae
                     YMR162C DNF3 Non-essential P-type ATPase that is a
                     potential aminophospholipid translocase localizes to the
                     trans-Golgi likely involved in protein transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494693.1"
                     /db_xref="GeneID:8201955"
                     /db_xref="GOA:C5DPZ9"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DPZ9"
                     /translation="MPDTPSKRKRAASLRTQLFNKHMYELFNGNNGQDIELAYVNEMD
                     GDENQQLEDEDELEEDDIEEDNNQFENKGRPTLFTKLMDVLLNRKRIVRSKDGRQIPI
                     SLDHETAEYRRYAYKNGNLLIDERTEQPYVDNQITSSRYTVYSFLPRQIYAQFSKLAN
                     IYFFLIAILQMIPGWSTTGSYTTIIPLCVFMGISMTREAFDDFKRHQLDREENDKTVK
                     VLRKTNGGYNNFMATSQNFTELNNNRSKLPAQGTLDTRFHNFELLSERHGVNIEKRKW
                     KDLRVGDFVLLNQDDWVPADLLLLASDGENNECFIETMALDGETNLKNRQPSAQLSKL
                     AGAASGLANINAKVIVEDPNIDLYNFEGNLDLENDQTGESIKHPLGLDNVVLRGSILR
                     NTENVVGMVIFTGEETKVRMNAIKNPRLKAPKLQRKVNLIVIFMVIVVTAMSLFSYLA
                     HIINNRRYINGDQAWYLFQQDAGTAPTIMSFIIMYNTIIPLSLYVTMEIIKLIQSKLM
                     EWDIDMYHPVTDTPCETRTATILEELGQVSYIFSDKTGTLTENKMLFRKFSLCGSSWI
                     HKADPSANEDQLPSIQLTTDVETVSPEGNEITGDHSDEFLSRQSFANDAAKTSVKYKG
                     NSGAIYSGRPSMRSLAGEEEQSLHSRSSNTTSRPTNLKSSLDLIKFIQLHPNSLFAHK
                     ARFFILSLALCHSCLPKRCNIKDDGETNEDPIEYQSSSPDELALVTAARDLGYIVLNR
                     NGKILTIKSFPNGFEKEPLLEDYEIMETIDFNSNRKRMSVLVKTPNEPNRILLVCKGA
                     DNVILERLPNHKDARQKMEEFNISTKERKEAEAEVVLQQRRSLERNATDDDVASNRLR
                     SSLSSMPKGSLSLKAMKKSFSNKSHHGEFQVNSIGQFLDTIKKADEEIDDVILHSRKS
                     VQKHQQKRYGDIKSIPYAGPQQAIPWENSCSSHDQNMWDYIGSDELISNEGYLLERTL
                     QAIDEFSTEGLRTLLYGYKWIDSSDYMEWEMRYRTAKTSLTDRRAKVEKVGEEIEDNL
                     ELIGATAIEDRLQDGVAESIEKIRRAGIKMWMLTGDKRETAINIGYSCKLIYDYSTVV
                     ILTENDENIISKMNAVSQEIDSGNIAHCVLVINGATLAIFESNPILLSVFVELCTKTD
                     SVICCRASPSQKALMVTNIRNINKDQVTLAIGDGANDIAMIQSADIGVGIAGKEGLQA
                     SRSSDYSIAQFRFLIKMLFVHGRYNYIRTSKFVLCTFYKELTFYMTQMIFQRYTMFSG
                     SSMYESWALSMYNTLFTSLPVLCIGMFEKDLKPMTLLAVPELYTAGRLDKAFNLPIFC
                     QWIILGTLNSLLITFLNVTAWGESALKDNTLYPLGVVNYTSIVILVNLKCQFVETHDR
                     NWLAFASVAISIIGWFVWCCILPLVYTDGSIYDVSTGLYHHFGRDITFWCAVLVLAAS
                     SVMVDVIYKTVKVMLWPTDTDIFKHLEQKDEIRKKLEFGAYNEMKQGWTWERDPSTLS
                     VYKDKVFPSSRSRANSQQSSNKEGSSHKNKHNNNSDTLVSETTHTLDLNYDDKRYEML
                     PSGKLIKRQELEEEQKTNHLLPKKLRFNMKNTESNENIRAIVEQRMHDLE"
     gene            complement(<614282..>614998)
                     /locus_tag="ZYRO0A07502g"
                     /db_xref="GeneID:8201956"
     mRNA            complement(<614282..>614998)
                     /locus_tag="ZYRO0A07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494649.1"
                     /db_xref="GeneID:8201956"
     CDS             complement(614282..614998)
                     /locus_tag="ZYRO0A07502g"
                     /note="similar to uniprot|P48353 Saccharomyces cerevisiae
                     YMR161W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494694.1"
                     /db_xref="GeneID:8201956"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DQ00"
                     /translation="METYTSEQEQIALEVLSKDKHQFYEILKVERTANDNEIKKSYRK
                     LAIRLHPDKNPHPRASEAFKLINRAFEVLGDSEKRSLYDRLGRDPDDRSVPSAASSAF
                     NGDTGFENMFFRRRREPSEDLFDILFNMRGGGGGGAFGGPFGGSPFGGSPFGGPFGGS
                     PFGGSPFMDGGGSTFTFAGPDGFRVYTSGPRGAQTRQRQHQRQQFEAEQEQDLYQSIK
                     VLLPLLILFLVPIIERFLFG"
     gene            <615902..>619174
                     /locus_tag="ZYRO0A07524g"
                     /db_xref="GeneID:8201957"
     mRNA            <615902..>619174
                     /locus_tag="ZYRO0A07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494650.1"
                     /db_xref="GeneID:8201957"
     CDS             615902..619174
                     /locus_tag="ZYRO0A07524g"
                     /note="highly similar to uniprot|P15436 Saccharomyces
                     cerevisiae YDL102W CDC2 Catalytic subunit of DNA
                     polymerase delta required for chromosomal DNA replication
                     during mitosis and meiosis intragenic recombination repair
                     of double strand DNA breaks and DNA replication during
                     nucleotide excision repair (NER)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494695.1"
                     /db_xref="GeneID:8201957"
                     /db_xref="GOA:C5DQ01"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:C5DQ01"
                     /translation="MVADLKRPGEEEEYGSEKKLRLQSFDHGVGSEPVSHLEIVPSDS
                     YAKHKSKGFKADESDIRGSQQASLFEEQLSLMDHKEAEVGEHKEKYGRDPLPKDFNPE
                     THEISFQQLEAEQSTLPFSKDEGTSTIVRFFGVTKDGHSILCNVTGFKHYLYVPVPSA
                     PEAQDPNEVASFTKYLNENFENSVDRIDIVSKQSIWGYEGESMLPFYQVFVTNPNTVN
                     KMRTAFEKGYLSHKSWFSAGTTTYDNIAFTLRMMIDCGISGMSWITLPKGEYQLVPEH
                     ERVSTCQLEVTINYRKLVSHPAENEWSQASPLRILSFDIECSGRPGIFPEPETDPVIQ
                     IANVMSVAGAKKPFIRNVFTVDTCSPITGSQIYSHATEEEMLKHWRDFVVAADPDIII
                     GYNTSNFDFPYLINRAKALKVESFPYFGRLFNVKQEITSSVFSSKAYGTKESKNINID
                     GRLQLDLLQFIQREYKLRSYTLNAVSAHFLGEQKEDVHHSIITSLQKGDSETRRRLAV
                     YCLKDAYLPLRLMEKLMALVNYTEMARVTGVPFSYLLSRGQQIKVISQLFRKCLQIDT
                     VIPNMQSQASDEQYEGATVIEPIRGYYDIPIATLDFSSLYPSIMMAHNLCYTTLTSKS
                     TVEKFNMKLDEDYIMTPNGDYFVTSKVRRGILPTILEELIGARKRAKKDLKNETEPFR
                     KDVLNGRQLALKVSANSVYGFTGATVGKLPCLAISSSVTSFGRNMIMLTKQAVEEKYS
                     IKNGFKHDSLVVYGDTDSVMVKFGTTDLKEAMKLGAEAAAYVSTLFKHPINLEFEKAY
                     FPYLLINKKRYAGLFWTNPDKYDKIDQKGLASVRRDSCPLVSIVMNKVLKKILIERNV
                     EGALGFVKEIIDDILHNKADISKLIISKTLAPNYTNPQPHAVLTERMKKRDGVGPNVG
                     DRVDYVVIAGNDKLYNRAEDPLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQA
                     NAMFVVKSIKINTGNMKGGLMGFVKKVDSCKNCKGPLKKGEGPLCSNCQAKSGELYIK
                     ALYNVRDLEEKFGRLWTQCQRCAGSLHNEVLCSNKNCDIFYMRVKMKKELQENIENLS
                     KW"
     gene            complement(<619278..>620847)
                     /locus_tag="ZYRO0A07546g"
                     /db_xref="GeneID:8201958"
     mRNA            complement(join(<619278..620747,620833..>620847))
                     /locus_tag="ZYRO0A07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494651.1"
                     /db_xref="GeneID:8201958"
     CDS             complement(join(619278..620747,620833..620847))
                     /locus_tag="ZYRO0A07546g"
                     /note="highly similar to uniprot|P39009 Saccharomyces
                     cerevisiae YDL101C DUN1 Cell-cycle checkpoint
                     serine-threonine kinase required for DNA damage-induced
                     transcription of certain target genes phosphorylation of
                     Rad55p and Sml1p and transient G2/M arrest after DNA
                     damage also regulates postreplicative DNA repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494696.1"
                     /db_xref="GeneID:8201958"
                     /db_xref="GOA:C5DQ02"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DQ02"
                     /translation="MSVKRENSNENVESSKRHQTIQAGNSDQVIAKLISLIPGKEQSI
                     DLMGNAVVTVGRSRHCDVVLKEVDISTIHCQLYTIQVDLDRERRKLINIVDKSRNGTF
                     INGNRLIKRDYLLKNGDRIVFGKSTSFLFKYTENSDEIEGNANSSNNDGVFKKPQMAA
                     SSSQTSLRKKLKPRPTSVFDKYLLERELGSGHYATVKEGINKKTGEVVAVKIFHPQQN
                     DDQKKSNQFREETNILMRVHHPNIVKMLDSFVEPVSKSQIQKYLVLEKINDGELFDRI
                     VKKVCLRQNETQALFKQILEGIKHLHSQNIIHRDIKPENILLNITRRQSPNEMQLGPW
                     DQDEIDVQVKIADFGLAKFTGEIQFTNTLCGTPSYVAPEVLLKSDYSSKVDMWSAGVL
                     LYVCLCGFPPFSDSLGPPSMREQILQGKFAFYSPYWDEIDDSVLHLISNLLVVNASER
                     FSVVETMNHPWFRNADYETIPMEPERLQISQEKIPKTYSELSKI"
     gene            complement(<621018..>623360)
                     /locus_tag="ZYRO0A07568g"
                     /db_xref="GeneID:8201508"
     mRNA            complement(<621018..>623360)
                     /locus_tag="ZYRO0A07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494652.1"
                     /db_xref="GeneID:8201508"
     CDS             complement(621018..623360)
                     /locus_tag="ZYRO0A07568g"
                     /note="similar to uniprot|Q03823 Saccharomyces cerevisiae
                     YMR160W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494697.1"
                     /db_xref="GeneID:8201508"
                     /db_xref="UniProtKB/TrEMBL:C5DQ03"
                     /translation="MSELNDSRPQRGRWVSWWYSRGSSDTNGEANPSTGSNSNNSGNN
                     NNNNNNDNNNNDNDTKAIHDEGRNVEFQGSADSEMPNEVAKEQPTGWYSSIMSKMPSI
                     PFVRNRQEALVIDSNARYSQLNDPQVEYLEVEAKETIVRRNNTWCWYENLTDITAECS
                     TWGDRPGVVSVYSTGSAHCPLPLPHYPISDGCRGYHVYIKNSLILPSDSPSQTLHEQS
                     WLSKAATEVKNYYNFPNEKHLYLKKITEGLLRERKVVIISLVGNLPEKYKKLTLGDQR
                     SAHYLATKLALSLQREMPSKIESLSFECPLDSKDLTIVFQECIELLKNWTHILHDADA
                     IFVESVYHAVPLAISLTKYILQNHESFQFRPTIPVGILAIESSLQGYRFWDHSVDLSN
                     SSEQDYHKIQQNREKQLFQGASKVERETLSKLTSYRKLNSDESRLVQKDLNWLLTNWG
                     TFRLNLFGKLFDNFMTVSQKLAIDYVHPKIFRHLWCDGRSLGLDTRNPEELGIPDVNI
                     RTPEYENNVSVPKNRRFEISLIGNILLALNLGNTKFVPILKLISPFFISRSFNENTIS
                     PTLRKATQQELKIWTQEMDARWKILNSSDQIPDELPEEVSTVYKFLKFSHYQNLKNPD
                     IMTLYCEIYDDDCVYKTFIENTMKTRSPLNRKHLVLLNDHSTPQSILNTVNQYDLVWK
                     FHECLSDYMKLRNLPSQMHLPNLFFVISLDRWFWKPAQSNPTSFRKDNSEALARLQQL
                     WESYQDWDPPTRGLKQLRNILSVLSLYSDSTEMLHDIEHK"
     gene            <623505..>623888
                     /locus_tag="ZYRO0A07590g"
                     /db_xref="GeneID:8201509"
     mRNA            <623505..>623888
                     /locus_tag="ZYRO0A07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494653.1"
                     /db_xref="GeneID:8201509"
     CDS             623505..623888
                     /locus_tag="ZYRO0A07590g"
                     /note="similar to uniprot|Q03818 Saccharomyces cerevisiae
                     YMR159C ATG16 Protein that interacts with the Atg12p-Atg5p
                     conjugate during formation of the pre-autophagosomal
                     structure essential for autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494698.1"
                     /db_xref="GeneID:8201509"
                     /db_xref="InterPro:IPR013923"
                     /db_xref="UniProtKB/TrEMBL:C5DQ04"
                     /translation="MDSALLERLLQRDRIESRFQELFIEPKPGPNTQSDRELTSNDTL
                     TITLARLRKELKGKELQIASLREVINVKNKDSEKLNDEIISLNIENNLLQKRFGELEE
                     EHNKLVKRWLDKVQQDVEKLNANLQ"
     gene            625358..625430
                     /locus_tag="ZYRO0A07612r"
                     /db_xref="GeneID:8201510"
     tRNA            625358..625430
                     /locus_tag="ZYRO0A07612r"
                     /product="tRNA-Met"
                     /note="tRNA-Met (CAT) cove score=71.12"
                     /db_xref="GeneID:8201510"
     gene            complement(<625564..>626625)
                     /locus_tag="ZYRO0A07634g"
                     /db_xref="GeneID:8201511"
     mRNA            complement(<625564..>626625)
                     /locus_tag="ZYRO0A07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494654.1"
                     /db_xref="GeneID:8201511"
     CDS             complement(625564..626625)
                     /locus_tag="ZYRO0A07634g"
                     /note="highly similar to uniprot|Q12154 Saccharomyces
                     cerevisiae YDL100C ARR4 ATPase involved in resistance to
                     heat and metal stress active as a dimer normally localized
                     to the cytosol but appears to localize to late endosomes
                     under stress conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494699.1"
                     /db_xref="GeneID:8201511"
                     /db_xref="GOA:C5DQ05"
                     /db_xref="InterPro:IPR016300"
                     /db_xref="InterPro:IPR025723"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027542"
                     /translation="MDLVVEPNLHSLINSSTHKWIFVGGKGGVGKTTSSCSIAIQMAQ
                     SQPHKQFLLISTDPAHNLSDAFGEKFGKDARRVTGMNNLSCMEIDPSAALKDMNDMAV
                     SQANENGAQGDDGLGGLLQGGALAELTGSIPGIDEALSFMEVMKHIKNQEKGEGERYD
                     TVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITGRLGPMLNSLAGAGNVDISTKLNQL
                     KESVETIKDQFTNPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFA
                     DDDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLENLRKFSRFLN
                     KEYNPAMDNKIIYELENKK"
     gene            <626809..>627747
                     /locus_tag="ZYRO0A07656g"
                     /db_xref="GeneID:8201512"
     mRNA            <626809..>627747
                     /locus_tag="ZYRO0A07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494655.1"
                     /db_xref="GeneID:8201512"
     CDS             626809..627747
                     /locus_tag="ZYRO0A07656g"
                     /note="weakly similar to uniprot|Q12191 Saccharomyces
                     cerevisiae YDL099W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494700.1"
                     /db_xref="GeneID:8201512"
                     /db_xref="UniProtKB/TrEMBL:C5DQ06"
                     /translation="MSEVSADEKRAKQLEEARKRVEELKKKNKKKGKKGKKTEDDNDS
                     SQAATADEATPELEKESSPAAAVTEESVKPTESDEKEHEATTKKGQSQGENPKEEKPT
                     ESEEEKPEASKEDQPRGEESKAQEKSTQPPKDQSEDKEPETAEKVTSEQQDVQDLFQG
                     DEGSDFLDTIQKQKEEGELQTVKSQLEKVTADLKRLKFVNIEQETTIDELNQQINILQ
                     TQLQSSQQELETSREELQKFKQTTSTPPPLQFAPFNVPPQQQQQAQPHQYQQQQNPSF
                     VSQPTHIDRTALDKWRNWNIDMTTWRSIGSGPIVEF"
     gene            complement(<627809..>628276)
                     /locus_tag="ZYRO0A07678g"
                     /db_xref="GeneID:8201513"
     mRNA            complement(<627809..>628276)
                     /locus_tag="ZYRO0A07678g"
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /transcript_id="XM_002494656.1"
                     /db_xref="GeneID:8201513"
     CDS             complement(627809..628276)
                     /locus_tag="ZYRO0A07678g"
                     /note="highly similar to uniprot|Q03799 Saccharomyces
                     cerevisiae YMR158W MRPS8 Mitochondrial ribosomal protein
                     of the small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS8"
                     /protein_id="XP_002494701.1"
                     /db_xref="GeneID:8201513"
                     /db_xref="GOA:C5DQ07"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:C5DQ07"
                     /translation="MSLVKLANTCAHLQNCSRVRTSLTSIPYTKLHLQFAYNLYTHGF
                     LSSLQKGSTKGPDDIPEDVTPDNISTRRLWVGLKYRDTKSVLSSCRLVSKPNLRIHLS
                     HNEMKKLCSGVPVRLIKPLQPGELMMVRTKESVIDINEAVLKKLDGEVLCRVK"
     gene            <628437..>629153
                     /locus_tag="ZYRO0A07700g"
                     /db_xref="GeneID:8201514"
     mRNA            <628437..>629153
                     /locus_tag="ZYRO0A07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494657.1"
                     /db_xref="GeneID:8201514"
     CDS             628437..629153
                     /locus_tag="ZYRO0A07700g"
                     /note="similar to uniprot|Q03798 Saccharomyces cerevisiae
                     YMR157C FMP39 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494702.1"
                     /db_xref="GeneID:8201514"
                     /db_xref="GOA:C5DQ08"
                     /translation="MLPFRRILLRRGPLTGRAALFSPAFRTLGGVSREYASKPAKPAA
                     RNNTGPGFAMIFALAIIGTVIFNETAKNLDKNKPRNTFTEEEYEHVMQGLKRRVAMFP
                     DGQLDVQFSLQKDSTQLKKLLGDSKLYIDPGQVVENYRSDREDPYEPLLNEVYSKYGP
                     EYLKYLPQGLLVSLLGRYMKAHCRQGDHVVILDFPHSIKDAIKFENEVSSASKLLVPK
                     ESLDSDVCKYYQTVQKSQQL"
     gene            complement(<629192..>629758)
                     /locus_tag="ZYRO0A07722g"
                     /db_xref="GeneID:8201515"
     mRNA            complement(<629192..>629758)
                     /locus_tag="ZYRO0A07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494658.1"
                     /db_xref="GeneID:8201515"
     CDS             complement(629192..629758)
                     /locus_tag="ZYRO0A07722g"
                     /note="similar to uniprot|Q12368 Saccharomyces cerevisiae
                     YDL098C SNU23 23 kD U4/U6.U5 snRNP associated protein
                     Putative RNA binding zinc finger protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494703.1"
                     /db_xref="GeneID:8201515"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DQ09"
                     /translation="MANFGRRTWDREEYAQLAQEEPLSHEETLKSSLSDAKLQQLKNK
                     YTDHNRLVRQSMHDLNKKVLATGISSYKRGKQFGFYCELCDLTHKDTAQYIDHLNHKT
                     HQLKFEAIFGEDLVADKRDNDDIPPEEFSKEYKTLVSRFVKQHASKPKATSTGTRIGK
                     SQNVNAPSNPPSAIHQSMGFSTFGSTKM"
     gene            <629851..>630471
                     /locus_tag="ZYRO0A07744g"
                     /db_xref="GeneID:8201516"
     mRNA            <629851..>630471
                     /locus_tag="ZYRO0A07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494659.1"
                     /db_xref="GeneID:8201516"
     CDS             629851..630471
                     /locus_tag="ZYRO0A07744g"
                     /note="similar to uniprot|Q03796 Saccharomyces cerevisiae
                     YMR156C TPP1 DNA 3'-phosphatase that functions in the
                     repair of endogenous DNA damage functionally redundant
                     with Apn1p and Apn2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494704.1"
                     /db_xref="GeneID:8201516"
                     /db_xref="InterPro:IPR006551"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DQ10"
                     /translation="MSHRLKVLPYLIKHTPKAPILSQNLIQVYAFDLDHTLIQPISSS
                     TFSKTAEDWQFVKYGNRNSIDTLLQLVRDEPNSLIVVFSNQGGVLASPPDSKSCIKYL
                     TKIELVLKHIATMAQGDQLLNRLWIYASPKAPARIADRSMFIDMRKPATGMMNQFQQD
                     IGSLPIELKYYCGDAAGRPTDFSDSDVKFAHNLHTIFKLPEDLFIT"
     gene            complement(<630468..>631733)
                     /locus_tag="ZYRO0A07766g"
                     /db_xref="GeneID:8201517"
     mRNA            complement(<630468..>631733)
                     /locus_tag="ZYRO0A07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494660.1"
                     /db_xref="GeneID:8201517"
     CDS             complement(630468..631733)
                     /locus_tag="ZYRO0A07766g"
                     /note="highly similar to uniprot|Q12377 Saccharomyces
                     cerevisiae YDL097C RPN6 Essential non-ATPase regulatory
                     subunit of the 26S proteasome lid required for the
                     assembly and activity of the 26S proteasome the human
                     homolog (S9 protein) partially rescues Rpn6p depletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494705.1"
                     /db_xref="GeneID:8201517"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:C5DQ11"
                     /translation="MSLEQARQLVQSKQYAEAETIYLNLLNKDESSVTDSRKNEQEAC
                     LLELGSLYATTHDKTKLRNFIPNSTEYMLQFAKSKTAKVLKTLIEKFGEVPDSLDDQI
                     YVCQKSIEFAKKEKRQFLKHSLSIKLATLYYQKTQYKDSLDLINSLLKEFKKLDDKPS
                     LVDVHLLEAKVYHKLRNLTKAKGASTASRTAANSIYCPTATVAELDLMSGILHCEDRD
                     YKTAYSYFFESFENFHHLSTHNSYGKACRVLKYMLLSKIMLNLISDVNNILNAKYTKE
                     TYQSRDIDAMSAVAEAYNSRSLLQFNAALRQYKEELMGDELIRSHFNALYDTLLESNL
                     CKLIEPFECVEVSHISKMIGLDAKQVEGKLSQMILDKVFFGVLDQGKGWLYIYDTPHQ
                     DATYDSALELVGELDKVVDQLFEKASVLY"
     gene            <632639..>634924
                     /locus_tag="ZYRO0A07788g"
                     /db_xref="GeneID:8201686"
     mRNA            <632639..>634924
                     /locus_tag="ZYRO0A07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494661.1"
                     /db_xref="GeneID:8201686"
     CDS             632639..634924
                     /locus_tag="ZYRO0A07788g"
                     /note="similar to uniprot|P33775 Saccharomyces cerevisiae
                     YDL095W PMT1 Transfers mannose residues from dolichyl
                     phosphate-D-mannose to specific serine/threonine residues
                     of proteins in the secretory pathway acts in complex with
                     Pmt2p dolichyl phosphate-D-mannose:protein
                     O-D-mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494706.1"
                     /db_xref="GeneID:8201686"
                     /db_xref="GOA:C5DQ12"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027004"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5DQ12"
                     /translation="MSALNEKRLKSEELNQDPVVDLDIKQGPSRPYVSSEPPEKLSKL
                     RTVHTKNERLLVATLAIITGAVRLYNLSWPNSVIFDEVHFGKFASYYIRNNFFMDVHP
                     PLAKMMFAWIASLVGFEGDFDFDTIGKAIPANAPYVLMRSLAATSGALTVIMLYFTLR
                     ASGVRVWIAFASALCFALENSYVTISRYILLDAPLIFFISASVYCFKRYELYPSGTCQ
                     SLKYLVATGICLGLASSAKWVGLFTVAWVGVLCLWRLWFFIGDLSKPVCSTFKIAAAK
                     GSILLGIPVLLYTFFFYLHFQTLDKDGEGAGFFSPEFRTSLKGNTIPQNVMAEVGTGS
                     IITLRHTGTMGGYLHSHPHDFPAGSQQQQITLYPHLDANNEWYVMLYDQPNSTVTSFE
                     NLTDGTKIRLLHPLTSRRLHSHDHKPPVSENSDWQKEVSCYGFEGFDGDANDDWVIEI
                     DKEASAPGPAQERVRALETKFRLRHAMMNCYLFSHEIKLPKWGYDQQEVTCAYSGLPS
                     LTLWAVEQSYNEFLPEDTEIISYKPSSFWQKLVEYHEKMWHINNNLVDSHVYESMPSS
                     WPFLMRGIGYWSQHYRHVYLLGNAILWWSVTAFIFIFGLVAVAELVAWQLGKPILQDS
                     RLVNFHIQVIQYLLGYAIHLAPSFLMQRQMFLHHYLPAYYFGILAFGHALDILVTYVF
                     RRQRTVGYIIVGAFVLSCLYFFKNYSPIIYGLPWTKQLCEKSQWLSGWDYSCANYLNT
                     YEEYSTVDLNEGLIPEATAAL"
     gene            complement(<635126..>637057)
                     /locus_tag="ZYRO0A07810g"
                     /db_xref="GeneID:8201687"
     mRNA            complement(<635126..>637057)
                     /locus_tag="ZYRO0A07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494662.1"
                     /db_xref="GeneID:8201687"
     CDS             complement(635126..637057)
                     /locus_tag="ZYRO0A07810g"
                     /note="some similarities with uniprot|Q03795 Saccharomyces
                     cerevisiae YMR155W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494707.1"
                     /db_xref="GeneID:8201687"
                     /db_xref="InterPro:IPR010658"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DQ13"
                     /translation="MARPERSRLIKTFIGSNIVAIGAGTPYVYSFYAPQLLAQCHIPV
                     SKVSTLSLSLNLGSSLLGFIAGMVIDKNPALSCLIGTLCTFIGYATLDYCYQTQLSSV
                     LLISTALCLIGYGSISGFYASVKCCTTNFPHHRGTAGAFPVSLYALAGMMYSSLCSEL
                     FGDDMGKVFKFLTLVCSLAIFTGCLTLEILVHPKTQRSHSRQSSGVRDTALDRSQPIS
                     VANQPDFPAATAGNKQDQASLASGSSTASSSQSMWSTQGTDSYVWSTELSGSLPFWGW
                     GRERDLPAGSPAPNVPNTGATPESPRIPTPSYSRPGLSYSATNQSRRMDTLPLNNTRR
                     DSFKRNDSDGPDARGTLSAQPPVRLDTTPTTAAPTKPKKWTENYVLHTITTPRFLTYY
                     IILATLQGLGQMYIYCVGFIVQTQVNSLPAGRYNLNPERIQSIQVSIISILSFAGRLS
                     SGPISDLLVKKLDAQRMWNIVLAGFLMFWGSGQMLHQIPGAAVSTATNLPQSLTNISF
                     CSAIFGFAFGVLFGTYPAIIADSFGTAAFSTIWGISTSGGLPSIKIFAAILGKDLDKH
                     TDPSETVCKKGIDCYKHTFHVTQICCSLIVLLTLSLIAVTYWKARHKKLDPLDDSRAQ
                     HLLEEDENTLQSNDRQLDA"
     gene            637431..637504
                     /locus_tag="ZYRO0A07832r"
                     /db_xref="GeneID:8201688"
     tRNA            637431..637504
                     /locus_tag="ZYRO0A07832r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.64"
                     /db_xref="GeneID:8201688"
     gene            <637801..>638217
                     /locus_tag="ZYRO0A07854g"
                     /db_xref="GeneID:8201689"
     mRNA            <637801..>638217
                     /locus_tag="ZYRO0A07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494663.1"
                     /db_xref="GeneID:8201689"
     CDS             637801..638217
                     /locus_tag="ZYRO0A07854g"
                     /note="similar to uniprot|P38985 Saccharomyces cerevisiae
                     YDL092W SRP14 Signal recognition particle subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494708.1"
                     /db_xref="GeneID:8201689"
                     /db_xref="GOA:C5DQ14"
                     /db_xref="InterPro:IPR003210"
                     /db_xref="InterPro:IPR009018"
                     /db_xref="UniProtKB/TrEMBL:C5DQ14"
                     /translation="MVDGGHLENEEFLVKVPQFFHIANEKHITVRLSTKRLVKHDSVE
                     GNAEFDAVNRPHYDVSQKSQNLKIDDNSKDVYQLLVRMSYGSKAQKTKCSTVVDSNNL
                     DKFWQDYSNAVKNGMSGLIKKKKKKSKAKNGKTHKK"
     gene            complement(<638258..>639580)
                     /locus_tag="ZYRO0A07876g"
                     /db_xref="GeneID:8201690"
     mRNA            complement(<638258..>639580)
                     /locus_tag="ZYRO0A07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494664.1"
                     /db_xref="GeneID:8201690"
     CDS             complement(638258..639580)
                     /locus_tag="ZYRO0A07876g"
                     /note="similar to uniprot|Q12229 YDL091c Saccharomyces
                     cerevisiae UBX3 UBX domain-containing protein that
                     interacts with Cdc48p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494709.1"
                     /db_xref="GeneID:8201690"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR006577"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DQ15"
                     /translation="MDLLRRAMHGGDPPFTPIPGSFPEETTTIHDSRMEGNVEDTSSG
                     HSSRRNRWNRKAILITLVRIPFVLLYYIMVWTIVILSLLKPLCNISGFYKKKNSRLSD
                     PKSQLNNLLETLDHESQRTLNPSVQDVNTPTYTFESLYSLEHGSLAPDIVQGGYADLL
                     NACSEQCKFAIIYLHDSLLDNSMQYVNELLCSEKFATLIKKYQVLLWFSEVTVSEGLQ
                     AANALKVRQFPFLGVLCLKAEKKIEVIGRLEGNLDKYGTNALENVLTKGHNKLVQIRQ
                     QRQNLALQRLIREQQDSRYSESLRRDQELARQRNAQRQAALEQERQELLRKQWLLWRK
                     SILRPEPTSTGGSACRIAIRTDGGARIVRKFDSNLTIDEIYAYVELSMEGLLDSAEVN
                     NSPPLGYEHHYRFLLLTPVPRKELDPGTTIGDEPAIYPSGNIVMEPLT"
     gene            complement(<639798..>641066)
                     /locus_tag="ZYRO0A07898g"
                     /db_xref="GeneID:8201691"
     mRNA            complement(<639798..>641066)
                     /locus_tag="ZYRO0A07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494665.1"
                     /db_xref="GeneID:8201691"
     CDS             complement(639798..641066)
                     /locus_tag="ZYRO0A07898g"
                     /note="similar to uniprot|P22007 Saccharomyces cerevisiae
                     YDL090C RAM1 essential for processing of ras proteins beta
                     subunit of farnesyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494710.1"
                     /db_xref="GeneID:8201691"
                     /db_xref="GOA:C5DQ16"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026872"
                     /db_xref="UniProtKB/TrEMBL:C5DQ16"
                     /translation="MTSQDNGSKNPAAKLLGRKRSPIERVVPSEEESSSESEQSIVAM
                     VKEMETETTEARDKLIHECRILLERDDLNTLDKEFHKKFLDSPFSHQLPPGMVALDAS
                     APWLLYWVANGLRVMNPSWLERETQRRIQEKVFRINPHGGPFGGGMGQLPHLAGTYAI
                     VNALAICDNTDGCWDKINRSSIYNWLLTLKREDGGFQTCFRVGEYDTRGVYCAISVAS
                     TLGLLTQELCENVVEFLVHCQNYEGGFGGVPHEDEAHGGYTFCAVASLAILGALDTIN
                     VEKLADWCSQRQYNDEKGLSGRSNKLVDVCYSFWVAGTAAILEAYGHGNCIDKAGLKE
                     YILKCCQMTTRPGIRDKPGTKPDFYHTNYGLLGVAITENTFQLDPSVPNALKINSSAI
                     NPDDNSGLESINPVYGLPSRDLETFYKHFK"
     gene            <641244..>643334
                     /locus_tag="ZYRO0A07920g"
                     /db_xref="GeneID:8201692"
     mRNA            <641244..>643334
                     /locus_tag="ZYRO0A07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494666.1"
                     /db_xref="GeneID:8201692"
     CDS             641244..643334
                     /locus_tag="ZYRO0A07920g"
                     /note="similar to uniprot|Q03792 Saccharomyces cerevisiae
                     YMR154C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494711.1"
                     /db_xref="GeneID:8201692"
                     /db_xref="GOA:C5DQ17"
                     /db_xref="InterPro:IPR001300"
                     /db_xref="UniProtKB/TrEMBL:C5DQ17"
                     /translation="MDDWRLLDELRHLIYLGNGLQGREEDLNRLISVASKSNDMELIK
                     SVLILKEDSDNLSPKQKLLWLTSKLRDRLYPPLAVDIAGPLPWNNDLSLSNTNVHYCY
                     ERHLKGDLEVLGLSQCRDLEDCSFVASLISIKNQRVPFPRIKQVNDHLYHVNLHFNGC
                     DRRLVSVDTSKVPTNDEGYQLSLLSDKIMDKIVEMAYLQVKSGSYATTGSNTAVDTFL
                     LTGYVPEVKSTDNISSIQEAVSCFKTGSCLLALGTGQQATNLDAPLIRNHDYPVIDVD
                     LRQGIAVLQDPLDPYLHLQTALEDFIENYEQLYVNWCTDKLFAFEKTLEFFYNFAKCD
                     KFNTAMNKQLFLLENGSDSEQDVWLLLESHLQSEKSIAYLQELPRDVLSSAGAPHEGA
                     CDIGLQLLKLKLSPRSTKRFFCHSSKSNAFTIHLYSNSSSVNIVRWSADKCTKILECK
                     ANNLEQCYMGSPFYYKNPTFQLEIVHSEARQFPLNLQLLSENCQDMVNLQLYHLKDHS
                     LQKPIFADPNYTQQRYDKSFVLLSTNVPYKLVCSSYSNKSEHSYRLQVSPSDDQLLLP
                     HIQIKQIYMQFGGLPFQLERKIPCTKNKVLIPFATSTNTTCFIRVVPPTFSSLMRMRL
                     AVCDKCGNPLRSAQFSQPPAPGGMVIDDWKSTGPAQYILVIDFDGPETDLSSSHFTMC
                     IGSSKKIMIDGRYC"
     gene            <643465..>645000
                     /locus_tag="ZYRO0A07942g"
                     /db_xref="GeneID:8201693"
     mRNA            <643465..>645000
                     /locus_tag="ZYRO0A07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494667.1"
                     /db_xref="GeneID:8201693"
     CDS             643465..645000
                     /locus_tag="ZYRO0A07942g"
                     /note="weakly similar to uniprot|Q12066 Saccharomyces
                     cerevisiae YDL089W Protein of unknown function interacts
                     with meiotic division protein Csm1p green fluorescent
                     protein (GFP)-fusion protein localizes to the nuclear
                     periphery potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494712.1"
                     /db_xref="GeneID:8201693"
                     /db_xref="GOA:C5DQ18"
                     /db_xref="InterPro:IPR018819"
                     /translation="MSLRISKDVSVSVNTADLLPEDDGFDRVDGDNRGWFSVFLGLFN
                     THPSDWNIALNEAIETIDWDSKSITLAQPLGNFFTFAFYVVRLLQLSLIKPNLSRINE
                     KTDHFDLSKSEMLKKYEYLYHFTNDKNQSVGNVYYRFLGRLGKFFDICIVLLTFTNGF
                     ITYKFFWGNFKMYCLFYLKKGPHLRNVTKASLQKLGQDDDDGSLWSSLRYFWNGTKDK
                     EGSTDDRDDDDGDIHYKLFKWTPSQFITMLFVSFAPTAVVFLLFTEVSFLTLIAVIVH
                     QWVLHRLVIDCYGNRLVHESVIASANLAEVEAKFVKPRMSKKVQDVAIDCTPHGDGMV
                     KFYPALTTNRSHIFQTHSLTGELITETFNPSTKEFEDLQTEGTTHNVIRTAPYAAGDL
                     LHRDPYWYQRNMIMRDVAHRPYFHSREVSPTRYHPSRISPRPGQYSPLVSSTSGMSTP
                     LMRPDRSPFLNTRPSLGEREELFHRGNSRSPLRQPIENFKSLDRSSDSQSPIRRHNGD
                     SDA"
     gene            complement(<645073..>646500)
                     /locus_tag="ZYRO0A07964g"
                     /db_xref="GeneID:8201694"
     mRNA            complement(<645073..>646500)
                     /locus_tag="ZYRO0A07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494668.1"
                     /db_xref="GeneID:8201694"
     CDS             complement(645073..646500)
                     /locus_tag="ZYRO0A07964g"
                     /note="similar to gnl|GLV|KLLA0F07227g Kluyveromyces
                     lactis KLLA0F07227g and weakly similar to uniprot|Q05166
                     Saccharomyces cerevisiae YDL088C ASM4 Nuclear pore complex
                     subunit part of a subcomplex also containing Nup53p
                     Nup170p and Pse1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494713.1"
                     /db_xref="GeneID:8201694"
                     /db_xref="InterPro:IPR007846"
                     /db_xref="UniProtKB/TrEMBL:C5DQ19"
                     /translation="MFATQNPSANGSRFANVSVNFPQQQPQQLQQQNPYQPLNPTTTS
                     QQQPQSLLSVSGSSTNGLQTQREPEWFNNPKKRAIPQSIVKRTTKRSPSADSSQADND
                     SGSSTVRSGFNSIAFGTKRNAGGFQSSQIAKPTTNVEKNTGILIDSNEAPPSISLYDW
                     QREDEFGTTLPQLNSNSLLPNDTQVASQSSSSSIKKGISTGTEFNAFDKGSVAKTNTQ
                     IRPESGGNDVGENLGQTHNESAVIVFGYPESISNLIITHFSKFGYILEDFEVLRSSSG
                     INTATLRLHGSKPGRKYPIFTGDGWVKLTYDSPPSALRALEENGLVYGGSLIGCVPYN
                     KRAVEQLASCKIEKEDDIGNLNFSVAPSTLADNGPDVFENGEDVSSVTSPQQFVNGKQ
                     DRKGLSPTKNTANNLLDHSKVAHPTRRLDIKDGKSLFVHNGAADNHYFLRSLEQKMRQ
                     QEENNRKQSSVLHKVNNWLFGWNEL"
     gene            complement(<646729..>647823)
                     /locus_tag="ZYRO0A07986g"
                     /db_xref="GeneID:8201695"
     mRNA            complement(<646729..>647823)
                     /locus_tag="ZYRO0A07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494669.1"
                     /db_xref="GeneID:8201695"
     CDS             complement(646729..647823)
                     /locus_tag="ZYRO0A07986g"
                     /note="similar to uniprot|P28625 Saccharomyces cerevisiae
                     YMR152W YIM1 Mitochondrial inner membrane protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494714.1"
                     /db_xref="GeneID:8201695"
                     /db_xref="GOA:C5DQ20"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /translation="MSKVINRAVTFINNKTPATITTKELDLDRCFKDTEIVIKIHAAS
                     LNPIDVMVHNLAFKLPFNSSPKTFSRDYAGVIVKAGDKVDPEWKINDRVVGNFAHIYG
                     EQGTLSDYLILDPSVQKAIAHIHDTTKLDTKYDPFTLNAAWPLVFGTAHTALFDYGQK
                     LGPDSKILVIGASTSVSYALVHIAKNVLNVGTVVGICSSQSFEHNKAAGFDHLVPYDQ
                     GPLTEEVGKLLVGTLRNEKFDLIFDSVGNNDFFPVMDKFLKPKSENSYYISISGDYKN
                     NFNKHPFNISSARSLFRAANPFRGYNYALETLPCKREYMDLGAKLIADGKYAPKIDSV
                     YNFDDYQKAMDRLKSNKAKGKVVIKINGEK"
     gene            complement(<647965..>648702)
                     /locus_tag="ZYRO0A08008g"
                     /db_xref="GeneID:8201528"
     mRNA            complement(<647965..>648702)
                     /locus_tag="ZYRO0A08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494670.1"
                     /db_xref="GeneID:8201528"
     CDS             complement(647965..648702)
                     /locus_tag="ZYRO0A08008g"
                     /note="highly similar to uniprot|Q07508 Saccharomyces
                     cerevisiae YDL087C LUC7 Essential protein associated with
                     the U1 snRNP complex splicing factor involved in
                     recognition of 5' splice site"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494715.1"
                     /db_xref="GeneID:8201528"
                     /db_xref="GOA:C5DQ21"
                     /db_xref="InterPro:IPR004882"
                     /db_xref="UniProtKB/TrEMBL:C5DQ21"
                     /translation="MGSSATEQRKLLKQLMGRDPNKIQNRPSYGYKRRDLGLYDPKIC
                     KSYLVGECPYDLFQGTKQSMGRCPQIHLAKHKLQYERERKRGKQFPEFEQEYYAILHK
                     FIYDCNGQVAIALKKLEHTPEERARIQEVTSELDVLDSRIGLMIQEIESLIRANEVSQ
                     AMIQARNLQELQSKRVEVGKKVKNMTENVGQSAQQKLQVCEVCGAYLSRLDTDRRLAD
                     HFMGKIHLGYVKMRSELDSMDQRLKNS"
     gene            <649194..>650048
                     /locus_tag="ZYRO0A08030g"
                     /db_xref="GeneID:8201529"
     mRNA            <649194..>650048
                     /locus_tag="ZYRO0A08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494671.1"
                     /db_xref="GeneID:8201529"
     CDS             649194..650048
                     /locus_tag="ZYRO0A08030g"
                     /note="similar to uniprot|Q03085 Saccharomyces cerevisiae
                     YPL033C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494716.1"
                     /db_xref="GeneID:8201529"
                     /db_xref="GOA:C5DQ22"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DQ22"
                     /translation="MISQKLYKFANLIYGIVGSGKKLESTDTVLILGGSNGLGKDICT
                     QLCQNEIKVINVDTQDTSIPLMGKCYTFIPCKSFAETHSVQEAMQAVKSLVQPITILI
                     NNVQRDFKSVYQMEEPLSPLDESIDQFKECVAANLTNVMIATKFFLEQLVPQSVCLTG
                     NKSQDYYLVNLSSILTLNVPEQASHYVSSKAALNQFHDSLTSELKSSRHKKVHYKTLL
                     VFLPFSKDYLIWNQSTSCLSQQLIDCLHDGRKGDVLLRIDDSPLTAFKVSASGSCRFS
                     NMVSKWKQ"
     gene            <650137..>650709
                     /locus_tag="ZYRO0A08052g"
                     /db_xref="GeneID:8201530"
     mRNA            <650137..>650709
                     /locus_tag="ZYRO0A08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494672.1"
                     /db_xref="GeneID:8201530"
     CDS             650137..650709
                     /locus_tag="ZYRO0A08052g"
                     /note="similar to uniprot|P28627 Saccharomyces cerevisiae
                     YMR150c IMP1 protease, mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494717.1"
                     /db_xref="GeneID:8201530"
                     /db_xref="GOA:C5DQ23"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019757"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR026730"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:C5DQ23"
                     /translation="MNSTIQAWLKTGSYAVRAVCFVHIIHTYVYEFTETRGESMLPTL
                     AASNDYVHAFKKYKDGKNCKMGDCIVAVKPSDPDHRVCKRITGMPGDVILVDPSMGTQ
                     LDRLPSDVDEIDEDENFNTYIKVPKGHVWVTGDNLSHSLDSRTYNSLPMGLIRGKIVA
                     ANDFNQPFWSGSKGNFWGFRKIGNSFVNED"
     gene            complement(<650765..>651595)
                     /locus_tag="ZYRO0A08074g"
                     /db_xref="GeneID:8201531"
     mRNA            complement(<650765..>651595)
                     /locus_tag="ZYRO0A08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494673.1"
                     /db_xref="GeneID:8201531"
     CDS             complement(650765..651595)
                     /locus_tag="ZYRO0A08074g"
                     /note="similar to uniprot|Q02795 Saccharomyces cerevisiae
                     YMR149W SWP1 oligosaccharyl transferase glycoprotein
                     complex delta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494718.1"
                     /db_xref="GeneID:8201531"
                     /db_xref="GOA:C5DQ24"
                     /db_xref="InterPro:IPR008814"
                     /db_xref="UniProtKB/TrEMBL:C5DQ24"
                     /translation="MKFLKALGLLALASWGQALTIKDANFAFPDTDTRGIMVGPIDHE
                     TKKLNKPLTLDTLDQTVELNFASDSRLTQATLLLGLPDRGLEQAIQATLTENQGLLLY
                     RVRIPINQLSQHLLHLAVNEKQLLAGSLVLANEDEGFLLSLFDIKLDVNETAFEYVKP
                     ERLEAKPEIHHVFNAEPQTVPWSFAQIFSFLIVLVTFGLVVSWMSAGALTWSGLPKGL
                     NTIYFLAFVGSVIGFEFIFVRYYTGTSIFETLRCTFLLSIPSLWLGTHFLRSWGKELR
                     "
     gene            complement(<651760..>652167)
                     /locus_tag="ZYRO0A08096g"
                     /db_xref="GeneID:8201532"
     mRNA            complement(<651760..>652167)
                     /locus_tag="ZYRO0A08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494674.1"
                     /db_xref="GeneID:8201532"
     CDS             complement(651760..652167)
                     /locus_tag="ZYRO0A08096g"
                     /note="some similarities with uniprot|P40219 Saccharomyces
                     cerevisiae YMR148W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494719.1"
                     /db_xref="GeneID:8201532"
                     /db_xref="GOA:C5DQ25"
                     /translation="MATLSSVYFLIYFVSFLAIAAVASFFIIPLLGISFLFASAVVVF
                     GFLSDITFKFAQSLYIKTDHRLKSTLSKMGNQKKGTNNSQAGNSPPPTPQPSVEPQLG
                     PNANVWDAPGAETSTTSAIARSLEAREDVRVTN"
     gene            complement(<652540..>653166)
                     /locus_tag="ZYRO0A08118g"
                     /db_xref="GeneID:8201533"
     mRNA            complement(<652540..>653166)
                     /locus_tag="ZYRO0A08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494675.1"
                     /db_xref="GeneID:8201533"
     CDS             complement(652540..653166)
                     /locus_tag="ZYRO0A08118g"
                     /note="some similarities with uniprot|P40218 Saccharomyces
                     cerevisiae YMR147W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494720.1"
                     /db_xref="GeneID:8201533"
                     /db_xref="UniProtKB/TrEMBL:C5DQ26"
                     /translation="MGVNTTPKFKERNSNSFRKLQKSQGKSQEPEPIKSNLKLNSTAH
                     MKFAALPDREAENSKQPFSPIIDVKFSPRPSESSGASAAKPLSLKEQIKTLEPINEIP
                     NEKVEKLADSIKGPFTESEVQELLLSYTYTSGMIDGGGSGSTVAGKRGAYLKSQLRKK
                     WTSVALKAVDSIDKLQSKLYEYFWLGAIYLNVWFPKLTSFVRYVLDCS"
     gene            complement(<653497..>654045)
                     /locus_tag="ZYRO0A08140g"
                     /db_xref="GeneID:8201534"
     mRNA            complement(<653497..>654045)
                     /locus_tag="ZYRO0A08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494676.1"
                     /db_xref="GeneID:8201534"
     CDS             complement(653497..654045)
                     /locus_tag="ZYRO0A08140g"
                     /note="some similarities with uniprot|Q03083 Saccharomyces
                     cerevisiae YPL034W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494721.1"
                     /db_xref="GeneID:8201534"
                     /db_xref="InterPro:IPR018306"
                     /db_xref="UniProtKB/TrEMBL:C5DQ27"
                     /translation="MYHSLVTRSVADIDWLYLDESILSARGKRRHWSSNDQILCKIGM
                     TTRSSVNTRLLEWQNTCKHPVINLTPERIHLLYESGRNSRTLTKILSKLSLNGSKVRP
                     SNPKLQTYNNGGFYTNGKGPKTLAMIENTIHRQLWQRYGQGLIWCYGCDPEGHTRHKE
                     WFRVPIKDLPLLARYIDRVCGG"
     gene            <654330..>655148
                     /locus_tag="ZYRO0A08162g"
                     /db_xref="GeneID:8201535"
     mRNA            <654330..>655148
                     /locus_tag="ZYRO0A08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494677.1"
                     /db_xref="GeneID:8201535"
     CDS             654330..655148
                     /locus_tag="ZYRO0A08162g"
                     /note="similar to uniprot|Q07505 Saccharomyces cerevisiae
                     YDL086W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494722.1"
                     /db_xref="GeneID:8201535"
                     /db_xref="GOA:C5DQ28"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DQ28"
                     /translation="MLITETFEDVKTSYGTDLRVYIFTPKVHGYPHAKFPGVVLYSEI
                     YQVTGPVRRFAQKIASKGYVVAAPDIYHNFVSPGPLAYDAKGTDDGNEYKIKKPLESY
                     DEDNRLCVDLLYRLPQFGGRIGATGMCLGGHLAFRALLDKRVTCATCFFPTDVHSKTL
                     GLGKNDDTLQRVSQEANADQELVLIFGTWDTHVPPEGRDLIRDQLRKSGVAFSFLEVH
                     AAQHAFIRDESSKGRYDAEITDSCLGFLFEQFNRKLNLTLGEFVPERGELKHVC"
     gene            <655686..>656726
                     /locus_tag="ZYRO0A08184g"
                     /db_xref="GeneID:8201536"
     mRNA            <655686..>656726
                     /locus_tag="ZYRO0A08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494678.1"
                     /db_xref="GeneID:8201536"
     CDS             655686..656726
                     /locus_tag="ZYRO0A08184g"
                     /note="highly similar to uniprot|P40217 Saccharomyces
                     cerevisiae YMR146C TIF34 Subunit of the core complex of
                     translation initiation factor 3(eIF3) which is essential
                     for translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494723.1"
                     /db_xref="GeneID:8201536"
                     /db_xref="GOA:C5DQ29"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR027525"
                     /db_xref="UniProtKB/TrEMBL:C5DQ29"
                     /translation="MRPIMLVGHERPITQVKYNREGDLVFSCSKDNVASVWFSINGER
                     LGTLEGHQGSIWSIDVDQYTQLCTTGSADYSVKVWNVSDGKTVHTWKSPVPVKWVEFS
                     PCGRYVLAILDDVMKYVGSVNIYEIKRDPKTHQVLEFVEEPVARIETHEGLAAAQVAG
                     WSSEGKYILVGHKDGSISKYDTTKNYEFCGSLPLHKGNVSDIQFSPDRSYFITSSRDS
                     NSYIVDVDQLQVLKKYEADCPLNSACITPLKDFVILGGGQAARDVTTTAAREGKFEAR
                     FYHKIFEEEVGRVRGHFGPLNCVAVNPQGTSYTSGAEDGFVRIHHFEKSYYDFKYEVE
                     KAAEAKEHMLAA"
     gene            complement(<657779..>658909)
                     /locus_tag="ZYRO0A08206g"
                     /db_xref="GeneID:8201537"
     mRNA            complement(<657779..>658909)
                     /locus_tag="ZYRO0A08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494679.1"
                     /db_xref="GeneID:8201537"
     CDS             complement(657779..658909)
                     /locus_tag="ZYRO0A08206g"
                     /note="highly similar to uniprot|Q08911 Saccharomyces
                     cerevisiae YOR388C FDH1 NAD()-dependent formate
                     dehydrogenase may protect cells from exogenous formate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494724.1"
                     /db_xref="GeneID:8201537"
                     /db_xref="GOA:C5DQ30"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:C5DQ30"
                     /translation="MANGTVLLVLYEGGKHAVEQERLLGAIENELGIRKFIESNGYQL
                     LTTIDKDPEPTSAVDRHLADAEIVITTPFYPAYITESRIAQAPNLKLAITAGVGSDHV
                     DLDAANERKITVAEVTGSNVVSVAEHVLTTILVLIRNYNGGHDQAVTGEWDIAGVAKN
                     EYDLEDKVISTVGAGRIGYRVLERLVAFNPKKLLYYDYQDLPVDAIKRLNDVSQLLNG
                     RGDIVQRVEKLEDMVSQSDVVTINAPLHEGTKGLFNKELISYMKDGAYLVNTARGAIC
                     VAQDVADAVKSGKLAGYGGDVWDVQPAPKNHPWRSMNNKDQVGNAMTVHISGTSLDAQ
                     QRYAEGVKNILESYFTKKFDYRPQDVIVKDGKYATRAYGQKK"
     gene            <661528..>663150
                     /locus_tag="ZYRO0A08228g"
                     /db_xref="GeneID:8201646"
     mRNA            <661528..>663150
                     /locus_tag="ZYRO0A08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494680.1"
                     /db_xref="GeneID:8201646"
     CDS             661528..663150
                     /locus_tag="ZYRO0A08228g"
                     /note="similar to uniprot|P40215 Saccharomyces cerevisiae
                     YMR145C NDE1 Mitochondrial external NADH dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494725.1"
                     /db_xref="GeneID:8201646"
                     /db_xref="GOA:C5DQ31"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C5DQ31"
                     /translation="MNKMFRSLAGFARRSPSLKTTVQSRCFASGKTAEAAAAAGAKPS
                     LLRRGGKLALHAALYSALAGTAYVSYELYRESNPLPQVAQSATFADGSPRKTIVILGS
                     GWGSASLLKNLDTSLYNVVLVSPRNYFLFTPLLPSTPVGTVELKSIVEPIRSIARRAP
                     GEVHYYEAEALDVDPQDKTVKIQSVNKDQEYTLDLKYDYLVYGVGAQPTTFNTPGVYE
                     NASFLKEISDAQEIRVKIMTAIEKAATLSPSDPERQRLLTFVVVGGGPTGVELAAELK
                     DYVDQDLKKWMPGLSKEIKVTLAEALPNILNMFDRSLVEYAQDLFKQEKIDLWLNTMV
                     KSVDKTHIRAKCGDEMIEVPYGVLVWATGNAPRDVTKNLMNKLEPQDSRRGLLINEKL
                     QLLGAEDSIFAIGDCTFYPGLFPTAQVAHQEGEYLAKALKKIHGVDQLKWQIAQAAEE
                     DKQMLESRLDKLQGDFEHFKYNHMGALAYIGKEKAIADVSFGQSQYKLAGSFTFLFWK
                     SAYLAMCLSFRNRVLVAMDWCKVYFLGRDSSV"
     gene            <663381..>665177
                     /locus_tag="ZYRO0A08250g"
                     /db_xref="GeneID:8201647"
     mRNA            <663381..>665177
                     /locus_tag="ZYRO0A08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494681.1"
                     /db_xref="GeneID:8201647"
     CDS             663381..665177
                     /locus_tag="ZYRO0A08250g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494726.1"
                     /db_xref="GeneID:8201647"
                     /db_xref="UniProtKB/TrEMBL:C5DQ32"
                     /translation="MMDTTTADRVLKLPIDSPFDTHRQPERNDDPNQNSDKRPLVTTV
                     TDQSLSAAAAAVASVQDTWGENFNEPLPTNKEDRIKQALEFMRGERQAFAADKNIKKH
                     SIRQIAMFFQVPKSTLYDRLKNKSVDPQVSDGRIYMGPAYSVSSRAHSQQMKLSPEKE
                     VALLDQLHHLCHALGNTLNLTHIRDFIVSLVDGISLGKKWVHNFNRRHDDAIIYGTTS
                     SHYNVRMFNSKSSRSNFENLWKCFVPLLQERIRQIPPSQPFYYITRACFHQASMSSIF
                     TCFKIMPEDASISLLCPPRVIVFPDYFGKVYLQLRDLKNDENHFRDVDEDVEDHSSAS
                     SSSVSESGGRGDKLEKDHSNVDHNRINSQEKLQKEFKHKKLNDVFQRIYTECCSQGSN
                     QDDVPLVIFEGFEDRYNWDPITCRSMVVLGKFLALPWNQQVLQRLVITELQPVVEELA
                     QSASITATQLPSMELDLGRMELDLDPFMHSLRRLLQSHTEVLPTSLNHNGVLVNDLFS
                     SALPQSPPPPPQTAATASTTTTTAPTTDHHQAENSTSGNIFEDSTLSQLQEVLGLIEH
                     NESQIYRELPDGSSSKAVIQQIFNKIRGILPQ"
     gene            <665522..>666853
                     /locus_tag="ZYRO0A08272g"
                     /db_xref="GeneID:8201648"
     mRNA            <665522..>666853
                     /locus_tag="ZYRO0A08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494682.1"
                     /db_xref="GeneID:8201648"
     CDS             665522..666853
                     /locus_tag="ZYRO0A08272g"
                     /note="highly similar to uniprot|Q07478 Saccharomyces
                     cerevisiae YDL084W SUB2 Suppresses the cold-sensitive
                     snRNP biogenesis brr1-1 mutation RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494727.1"
                     /db_xref="GeneID:8201648"
                     /db_xref="GOA:C5DQ33"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQ33"
                     /translation="MSHEGEEDLLEYSDNEQEIQVANKAEGGADAAGGEGTNGAEGTN
                     GDADKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQ
                     AKSGLGKTAVFVLSTLQQLDPVPGEVAVVVICNARELAYQIRNEYLRFSKYMPDVKTA
                     VFYGGTPISKDADLLKNKETAPHIVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVL
                     EELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLH
                     GLQQYYIKLDEKEKNRKLAQLLDDLEFNQVIIFVRSTARANELTKLLNASNFPAITVH
                     GHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLALNYDLTTEADQYLHRVG
                     RAGRFGTKGLAISFISSNEDEEVLNKIQERFDVKIAEFPEEGIDPSTYLNN"
     gene            complement(<667023..>668105)
                     /locus_tag="ZYRO0A08294g"
                     /db_xref="GeneID:8201649"
     mRNA            complement(<667023..>668105)
                     /locus_tag="ZYRO0A08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494683.1"
                     /db_xref="GeneID:8201649"
     CDS             complement(667023..668105)
                     /locus_tag="ZYRO0A08294g"
                     /note="some similarities with uniprot|P40214 Saccharomyces
                     cerevisiae YMR144W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494728.1"
                     /db_xref="GeneID:8201649"
                     /db_xref="UniProtKB/TrEMBL:C5DQ34"
                     /translation="MVDTSTTTNDNTRDISTSSQTSFHWENENENGVSNEELQMAIAS
                     GMKLMRVFEQQDSENETSSSNLQDQENSKQVLNGILDAKYDKFIPPRDINAVVSSLIH
                     VLNQSVRQNQQLKLKNMILKSNSGDVQSRYEVEENLKKQQFERKKCQLFLEREHLIKR
                     IQTKDGKVAKYKNKIIEKNREINRLMRILNEHSISDTPKINDDNSNNNNKNNNNSKNQ
                     NSNNSAPNRVLKPSSASNTPTAVSSTSNKEKASDMLRTLGMLASQVLNDEVDEDSANQ
                     TTIQANNSGLKGPADCNTTEPEILHSPNVSVAIPNSESINGQSGEPRSTSTGNGNHSN
                     FLKQLPIQMPKMKRFSTVDGTVKDIE"
     gene            complement(<668561..>669088)
                     /locus_tag="ZYRO0A08316g"
                     /db_xref="GeneID:8201650"
     mRNA            complement(join(<668561..668968,669065..>669088))
                     /locus_tag="ZYRO0A08316g"
                     /product="40S ribosomal protein S16"
                     /transcript_id="XM_002494684.1"
                     /db_xref="GeneID:8201650"
     CDS             complement(join(668561..668968,669065..669088))
                     /locus_tag="ZYRO0A08316g"
                     /note="highly similar to uniprot|P40213 Saccharomyces
                     cerevisiae YMR143w RPS16A or uniprot|P40213 Saccharomyces
                     cerevisiae YDL083c RPS16B"
                     /codon_start=1
                     /product="40S ribosomal protein S16"
                     /protein_id="XP_002494729.1"
                     /db_xref="GeneID:8201650"
                     /db_xref="GOA:C5DQ35"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:C5DQ35"
                     /translation="MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEIL
                     RFKVYEPLLLVGLDKFANVDIRVRISGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
                     NELKKAFTSYDRTLLIADSRRPEPKKFGGKGARSRFQKSYR"
     gene            <669862..>670461
                     /locus_tag="ZYRO0A08338g"
                     /db_xref="GeneID:8201651"
     mRNA            <669862..>670461
                     /locus_tag="ZYRO0A08338g"
                     /product="60S ribosomal protein L13"
                     /transcript_id="XM_002494685.1"
                     /db_xref="GeneID:8201651"
     CDS             669862..670461
                     /locus_tag="ZYRO0A08338g"
                     /note="highly similar to uniprot|Q12690 Saccharomyces
                     cerevisiae YDL082w RPL13A ribosomal protein or
                     uniprot|P40212 Saccharomyces cerevisiae YMR142c RPL13B"
                     /codon_start=1
                     /product="60S ribosomal protein L13"
                     /protein_id="XP_002494730.1"
                     /db_xref="GeneID:8201651"
                     /db_xref="GOA:C5DQ36"
                     /db_xref="InterPro:IPR001380"
                     /db_xref="InterPro:IPR018256"
                     /db_xref="UniProtKB/TrEMBL:C5DQ36"
                     /translation="MAVHHNQPILNPHFRKHWQERVKVHFDQAGKKASRRDTRIAKAA
                     QIAPRPLDLLRPVVRAPTVKYNRKVRAGRGFTFQEVKAAGLTPTYARTVGIAVDHRRV
                     NRNQEIFDANVQRLKEYQSKLIVFPRNGKAPEANQVLSTAATFPIVQPATDVEARAVE
                     DDGKSAFRTLRLARSDKKFKGIREKRAKEKAEAEAEKKK"
     gene            complement(<670714..>671040)
                     /locus_tag="ZYRO0A08360g"
                     /db_xref="GeneID:8201652"
     mRNA            complement(<670714..>671040)
                     /locus_tag="ZYRO0A08360g"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_002494686.1"
                     /db_xref="GeneID:8201652"
     CDS             complement(670714..671040)
                     /locus_tag="ZYRO0A08360g"
                     /note="highly similar to uniprot|P05318 Saccharomyces
                     cerevisiae YDL081C RPP1A Ribosomal protein P1 alpha a
                     component of the ribosomal stalk which is involved in the
                     interaction between translational elongation factors and
                     the ribosome accumulation of P1 in the cytoplasm is
                     regulated by phosphorylation and interaction with the P2
                     stalk component"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_002494731.1"
                     /db_xref="GeneID:8201652"
                     /db_xref="GOA:C5DQ37"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:C5DQ37"
                     /translation="MSVETALSYAALILADSEVEISSDKLLTLTSAANVPVEAIWGDI
                     YSKALEGQDLKELLVNFSVGPAAAGGAAAAGGAAAAEGAEAAEEKKEEEAKEESDDDM
                     GFGLFD"
     gene            complement(<671669..>673087)
                     /locus_tag="ZYRO0A08382g"
                     /db_xref="GeneID:8201653"
     mRNA            complement(<671669..>673087)
                     /locus_tag="ZYRO0A08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494687.1"
                     /db_xref="GeneID:8201653"
     CDS             complement(671669..673087)
                     /locus_tag="ZYRO0A08382g"
                     /note="similar to uniprot|P40210 Saccharomyces cerevisiae
                     YMR140W SIP5 Sip5p facilitates the interaction between the
                     Glc7p phosphatase and the Snf1p kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494732.1"
                     /db_xref="GeneID:8201653"
                     /db_xref="UniProtKB/TrEMBL:C5DQ38"
                     /translation="MGNTFAKLDENENAFKGRSTSVGSGTMRPNNIAERRRGVSMGLS
                     NNVRSRANSTGSQLMYKKKSTRERDLIKESFAKQLVVRYDESVDGGYLAPHGCYTFEK
                     LDYDPSLVRSLITARKLAPFYIPLQDFDESWTRDELIKIVDGLPLHAAVNENPEEFED
                     IPIGNLKRQNFDELIDKSLSKKEQRKQRSKIFKARLHRKRIMWQEQENVAFLEQKLES
                     KREPNPSKRNLALPSPDLNHTIYKKGIECPICFLYYPEPLNYSRCCLQPICTECFVQI
                     KRGDPHFPHEEVDPTKPVTSDDEKDPNLLISEPASCAYCATPNFGITYQPPTNRKTGI
                     GGMPPGSYKAPRDDEINVNDGSDSEEGPRTPSKSPEDPEVVTSDMIRPDWKAKLDKER
                     LRLARRSANATAIHVSNQLVDPDHPSRRDSNTDSGPTPTTARSQRLVPNPMAELENQM
                     VEQAIRLSLVDEEERKSSQRHR"
     gene            complement(<673433..>674830)
                     /locus_tag="ZYRO0A08404g"
                     /db_xref="GeneID:8201654"
     mRNA            complement(<673433..>674830)
                     /locus_tag="ZYRO0A08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494688.1"
                     /db_xref="GeneID:8201654"
     CDS             complement(673433..674830)
                     /locus_tag="ZYRO0A08404g"
                     /note="weakly similar to uniprot|P18544 Saccharomyces
                     cerevisiae YOL140W ARG8 Acetylornithine aminotransferase
                     catalyzes the fourth step in the biosynthesis of the
                     arginine precursor ornithine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494733.1"
                     /db_xref="GeneID:8201654"
                     /db_xref="GOA:C5DQ39"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DQ39"
                     /translation="MTSHVFHSSIAKPKAIAKDGKGVFMTIEKNGKEHKQVLDAITGA
                     AVGSLGWGDPDVHKIMADAALHHTYSFPGYIVNEAAEELARFYIDKTPKGVFRSCLWT
                     CSGSESNENALKIVRQYQLERGRPEKLKIISREGAYHGFTLGAMSIGDGPRGIPFKDI
                     MIDQENVCLKMPMFYPYRRMREGETVEQYAQRLLDSLEKMIIENDPNTVSVVCVETMS
                     GSSIGTPVPPKNYLKGIRDICNKYDLIFMVDEVMCGTGRINDGKLCCWENFLAPEDAP
                     DIQTVGKTLGSGYVTIAGVLVGPKIYDAFEKGSGVVVGAQTYHSHEFNCRVALQIQQK
                     IFAQGLTSNVFKMGNLMGAKLQKALLSDSSNIVGDVRGLGGFWTIELVKNKSTKEPFD
                     QSLHIGSRFADLALNNGANVMGLTGGNTKGEHWDIVVLGPAFIISEQEVELLCSKLEQ
                     TVKDLTKTLQDEGLR"
     gene            complement(<675104..>676858)
                     /locus_tag="ZYRO0A08426g"
                     /db_xref="GeneID:8201655"
     mRNA            complement(<675104..>676858)
                     /locus_tag="ZYRO0A08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494689.1"
                     /db_xref="GeneID:8201655"
     CDS             complement(675104..676858)
                     /locus_tag="ZYRO0A08426g"
                     /note="similar to uniprot|Q07471 Saccharomyces cerevisiae
                     YDL080C THI3 Probable decarboxylase required for
                     expression of enzymes involved in thiamine biosynthesis
                     may have a role in catabolism of amino acids to long-chain
                     and complex alcohols"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494734.1"
                     /db_xref="GeneID:8201655"
                     /db_xref="GOA:C5DQ40"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DQ40"
                     /translation="MYVDTTSMGPTITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDK
                     LYGIEGLRWAGNTNELNAAYAADGYARLKGLGCIISTFGVGELSAINGIAGSYAEHVG
                     LLHVVGMPPTSAQTRQLLLHHTLGNGDYTVFHRMATEVSCHSAVIIDTELCAQEVDEC
                     IRNAYIFQRPVYMGIPVNLVSMPVDSDRLNEPIDLSVPPNDTSKENEVIDQILTHFYK
                     ATNPVIVADACVTRHRIEAETEELCRRTKFPLFVTPMGKGSVDEGLPQFGGVYTGSIS
                     SPSVREVVDFADCLIVIGCMLADFETTTFHFNYRANELVLLYPTSVKFKHATYPDLSI
                     KPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTHPLRQEWVWNQISQWFMEGDVI
                     ITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACLGAAMAVDEKPRTHRVVLFV
                     GDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHSNASYYDIQQWNYSTLPSV
                     FGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPMDVPQALREKWIREEKR
                     DQERRASVESVKRLKLGP"
     gene            complement(<677122..>678225)
                     /locus_tag="ZYRO0A08448g"
                     /db_xref="GeneID:8201979"
     mRNA            complement(<677122..>678225)
                     /locus_tag="ZYRO0A08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494690.1"
                     /db_xref="GeneID:8201979"
     CDS             complement(677122..678225)
                     /locus_tag="ZYRO0A08448g"
                     /note="highly similar to uniprot|P38615 Saccharomyces
                     cerevisiae YMR139W RIM11 Protein kinase required for
                     signal transduction during entry into meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494735.1"
                     /db_xref="GeneID:8201979"
                     /db_xref="GOA:C5DQ41"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DQ41"
                     /translation="MNLELVTNTEVVHKQVYCGHPSGNNGENEPAEITYPTTEVVGHG
                     SFGVVFTTTIKETDEDVAIKKVLQDRRFKNRELEIMKLLKHPNIIDLKYYFYEKDSHG
                     EVYLNLILDYMPQSLYQRLRHFVHIPSAMPRLEIKCYMYQLFKSLNYLHNFALVCHRD
                     IKPQNLLVDPNTCALKICDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATHYSNQID
                     VWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSRQEICAMNPNYMEHKFPQIK
                     PIPLSRVFKKEDEQTVQFLADTLKYDPMERFNALQCLCSSYFDELRHAQGQLKQIVDS
                     LQLLQFEYDTELAHLTQDQLEAVRLKLQPTQIR"
     gene            complement(<678838..>679824)
                     /locus_tag="ZYRO0A08470g"
                     /db_xref="GeneID:8201980"
     mRNA            complement(<678838..>679824)
                     /locus_tag="ZYRO0A08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494691.1"
                     /db_xref="GeneID:8201980"
     CDS             complement(678838..679824)
                     /locus_tag="ZYRO0A08470g"
                     /note="similar to uniprot|P32419 Saccharomyces cerevisiae
                     YDL078C MDH3 Cytoplasmic malate dehydrogenase catalyzes
                     interconversion of malate and oxaloacetate involved in the
                     glyoxylate cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494736.1"
                     /db_xref="GeneID:8201980"
                     /db_xref="GOA:C5DQ42"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:C5DQ42"
                     /translation="MKVAIVGASGGIGQPLSLLMKLNPLVTELSLYDIRLAPGVAQDL
                     SHISTNSVCQGFEKDDIARALQGAHVVIVPAGVPRKPGMTRDDLFKINASIVKGIVTS
                     VAQYAPEARLLIVSNPVNSTVPIAVETLKSMGKLQPGNVMGVTTLDCVRAETFLGEYL
                     GRDKTQVNQDVSVIGGHSGNTIVPVILNPKLRDGLKPHYQEFVHRVQFGGDEVVKAKA
                     GAGSATLSMAFAGYRFADSILKSLAGEQVSGVPTFVYLPGINGGSEVQSKLGGVDYFA
                     LPVVFSNGSVSKVDSSILSSLSSQEKKLVSESVRQLVGNIDKGKKFALGAKL"
     gene            complement(<679908..>680420)
                     /locus_tag="ZYRO0A08492g"
                     /db_xref="GeneID:8201981"
     mRNA            complement(<679908..>680420)
                     /locus_tag="ZYRO0A08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494692.1"
                     /db_xref="GeneID:8201981"
     CDS             complement(679908..680420)
                     /locus_tag="ZYRO0A08492g"
                     /note="similar to uniprot|P39110 Saccharomyces cerevisiae
                     YMR138W CIN4 GTP-binding protein involved in beta-tubulin
                     (Tub2p) folding isolated as mutant with increased
                     chromosome loss and sensitivity to benomyl"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494737.1"
                     /db_xref="GeneID:8201981"
                     /db_xref="GOA:C5DQ43"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQ43"
                     /translation="MGLLTIVKKQKLRDKEIRCLILGLDNAGKSTIVNQLLPQERRQH
                     HVSPTVGFAIHNVEMGPYNVSMWDVGGQTTLRPFWDNYYDTTDVLVWCIDVSSSHRLP
                     ESLQELQPFLMGDSRVIIAFNKCDLLEDYQSELLQLQNQLPKVQFVPCSGRTGMGMRE
                     LCSAIASCSI"
     gene            <680521..>681993
                     /locus_tag="ZYRO0A08514g"
                     /db_xref="GeneID:8201982"
     mRNA            <680521..>681993
                     /locus_tag="ZYRO0A08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494693.1"
                     /db_xref="GeneID:8201982"
     CDS             680521..681993
                     /locus_tag="ZYRO0A08514g"
                     /note="similar to uniprot|Q759M6 Ashbya gossypii ADR250C
                     ADR250Cp and weakly similar to YMR137C uniprot|P30620
                     Saccharomyces cerevisiae YMR137C PSO2 Required for a
                     post-incision step in the repair of DNA single and
                     double-strand breaks that result from interstrand
                     crosslinks produced by a variety of mono- and
                     bi-functional psoralen derivatives induced by
                     UV-irradiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494738.1"
                     /db_xref="GeneID:8201982"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR011084"
                     /db_xref="UniProtKB/TrEMBL:C5DQ44"
                     /translation="MGIKRQRTLAEFGISETRSLQIRNQQSSFGSSQDPIVVEEDEER
                     VQEVRCPLCNADITHLEIYMKEAHAQKCLDKAPEPKKPKTRPPLPGTKIVKLFSLQIV
                     VDGFAYDRHGDIEHYFLSHFHSDHYGGLKKSWTNGIIYASSITINLVRDKFKIDGSRL
                     RPLPMNEKIWITDKVSVVLLDANHCPGAVVFLFEEYDNDAVVKTVLHTGDFRANNKLI
                     EEVKRWTTRLDEVYLDTTYLIPGFHFPSQESVLEVTSNFAKDLVNRGFQSIFQNDQKS
                     IVNYTHQSPKLYKLLFLVGTYTIGKEKLAISLAQVLGTKIFIPAGTPRHRMISQYMEY
                     FPSGLITHDVKESCVHLVPLRILNSKDSIQSYFQNYSSIYEDVVGFIPTGWTFTSKWA
                     KKPEFSTILSRMDYCKEVLHNTQDALDINFVLKQFKKYQRFQVFKVPYSEHSSFKDLV
                     NFGCSMDYKTILATVNLHNIKEMNEWFATWQNMRNDSTFC"
     gene            complement(<682125..>683711)
                     /locus_tag="ZYRO0A08536g"
                     /db_xref="GeneID:8201983"
     mRNA            complement(<682125..>683711)
                     /locus_tag="ZYRO0A08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494694.1"
                     /db_xref="GeneID:8201983"
     CDS             complement(682125..683711)
                     /locus_tag="ZYRO0A08536g"
                     /note="weakly similar to uniprot|P40209 Saccharomyces
                     cerevisiae YMR136W GAT2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494739.1"
                     /db_xref="GeneID:8201983"
                     /db_xref="GOA:C5DQ45"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C5DQ45"
                     /translation="MSAAKTTTMRALPTAEEAGSGSTEGGNVFGRTRHPVLSRSISTS
                     AKVPSVPYLLNISGETTTSATDEDPRSTLTPPASSTKMQFLSSQGYPGSGSSLEGSPL
                     ESRTTGITTTGSALSSGRRRQSSMDSLMRAAATVENDNELNQLYQDKLSFIIELKNCI
                     SDEIRNWPVVQDPEELSSTPTSSNSRILLDRVSNEQLSSLGNVVCRLKETVEELVELK
                     SQTPHIKENMASKLQRDLRVSTPQQQPRKVVLPPMESLTMNLPHQERTAFHGYRFPSG
                     PTSPATAIPPQEQQRRQSQQQQQQQRQPQDPEQRHHQPPPPRPPPTQHQVISSWPSAT
                     QPSPTEPSHRFTLSDPSAYVGRTTMPMIFKSSQPQQSQAQPQSIIPGKKNPKNLKFQK
                     KRKKSLTEVSLAAPQNYRRSLTQGLLIAENVRQTEQATTSCVHCKEGITPEWRRGPYG
                     NRTLCNACGLFYRKLIKKFSTRDANILMRYKRQVNPEDRRVPSALDVPELFISQLEND
                     PNLDSEFNTIGGLVSNYKLG"
     gene            <684534..>685511
                     /locus_tag="ZYRO0A08558g"
                     /db_xref="GeneID:8201984"
     mRNA            <684534..>685511
                     /locus_tag="ZYRO0A08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494695.1"
                     /db_xref="GeneID:8201984"
     CDS             684534..685511
                     /locus_tag="ZYRO0A08558g"
                     /note="similar to uniprot|P40208 Saccharomyces cerevisiae
                     YMR135C GID8 Protein of unknown function involved in
                     proteasome-dependent catabolite inactivation of fructose-1
                     6-bisphosphatase contains LisH and CTLH domains like
                     Vid30p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494740.1"
                     /db_xref="GeneID:8201984"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:C5DQ46"
                     /translation="MTSSYERKSFSRDEWKENVGKNQLPASGEPSVPHLLLNYFVSMA
                     FEESSVRMARELGYISNNREAEEFNELYRVRERAHIISLIKSGRVAEAMERISEVFGT
                     EVLEDESGEEDLHFKLLLLNLTEMIREHRQAPPNGGEDSHEFILKLVEYSQQKLAMKA
                     ASSKTHMQELELVMTLLLVPHDGEVNKLPRSLKGLYSLPLRAQVAEMVNRRLLKSMHS
                     HVAEGKYPDLVGGTGINSGSRYTGVLRVRPREDIAKELTTHRLGEIRDESNNPHNDGG
                     DWASTAKLLGGEDEGEQRFEARLIQVMKLWAWCENQLHGGDIGVPRVES"
     gene            complement(<685544..>686257)
                     /locus_tag="ZYRO0A08580g"
                     /db_xref="GeneID:8201985"
     mRNA            complement(<685544..>686257)
                     /locus_tag="ZYRO0A08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494696.1"
                     /db_xref="GeneID:8201985"
     CDS             complement(685544..686257)
                     /locus_tag="ZYRO0A08580g"
                     /note="similar to uniprot|P40207 Saccharomyces cerevisiae
                     YMR134W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494741.1"
                     /db_xref="GeneID:8201985"
                     /db_xref="UniProtKB/TrEMBL:C5DQ47"
                     /translation="MVWIIDRYLELEAPLLHALARMPYVQNFIHDPISARITLFLMIM
                     GSIAIINELNMTRKMAQVTHETSEELNKGYIDESLKLHRLIVSDEYHSKEYLDEKSGI
                     VIEEFEDKEKFFAKPVHVAHLYVECQCIRTIESQPLLEKPLLFHLEFSPEEYENEKRP
                     EFGTRLRVLRKRLYHLFKDSHLFEELVTDRQKFAIGNNVRIFNSQNELLPVSTDDVQL
                     CFLKIETGDKIKCEFVLGE"
     gene            <687322..>687801
                     /locus_tag="ZYRO0A08602g"
                     /db_xref="GeneID:8201986"
     mRNA            <687322..>687801
                     /locus_tag="ZYRO0A08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494697.1"
                     /db_xref="GeneID:8201986"
     CDS             687322..687801
                     /locus_tag="ZYRO0A08602g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494742.1"
                     /db_xref="GeneID:8201986"
                     /db_xref="UniProtKB/TrEMBL:C5DQ48"
                     /translation="MKFILPLAVVAPIAEAHLIQRDNIDPSSRSSVNTVYTFIGSGSS
                     SNVLQMQSSSSSPSETSDSARESSALSQLLHASTVSAPQSTEFSSASVTSSPSNMSAS
                     GSSDASSKKHTGTNTGDKPSSSPSSSSTKSAASSGAANHLDVPIMAGGIAVAAIAML"
     gene            <688292..>688894
                     /locus_tag="ZYRO0A08624g"
                     /db_xref="GeneID:8201987"
     mRNA            <688292..>688894
                     /locus_tag="ZYRO0A08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494698.1"
                     /db_xref="GeneID:8201987"
     CDS             688292..688894
                     /locus_tag="ZYRO0A08624g"
                     /note="some similarities with uniprot|Q07988 Saccharomyces
                     cerevisiae YLR040C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494743.1"
                     /db_xref="GeneID:8201987"
                     /db_xref="GOA:C5DQ49"
                     /db_xref="InterPro:IPR000992"
                     /db_xref="UniProtKB/TrEMBL:C5DQ49"
                     /translation="MVSCIHIAVNFFLFVGASAASSTITKGPDRVEVSKATDSASLRL
                     DAAEADMRFFSVFLSDFRVNMDSYTSYLGAHHKTMPQKVADYYHHVAELPQSADLEKD
                     IAASFPFSQFRTFIADFPWYSTLLSSANESTMFLPEDFATEGASHGTKTTNVQPYSSS
                     RSTSSLSSTKSHSHNGAMRGSDSSFPLQFFSIPLLVGMLL"
     gene            complement(<688899..>690134)
                     /locus_tag="ZYRO0A08646g"
                     /db_xref="GeneID:8201988"
     mRNA            complement(<688899..>690134)
                     /locus_tag="ZYRO0A08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494699.1"
                     /db_xref="GeneID:8201988"
     CDS             complement(688899..690134)
                     /locus_tag="ZYRO0A08646g"
                     /note="some similarities with uniprot|P32841 Saccharomyces
                     cerevisiae YMR133W REC114 Protein involved in early stages
                     of meiotic recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494744.1"
                     /db_xref="GeneID:8201988"
                     /db_xref="GOA:C5DQ50"
                     /db_xref="InterPro:IPR004354"
                     /db_xref="UniProtKB/TrEMBL:C5DQ50"
                     /translation="MDVEFSFPLKFYHAYLENIYAPQGLNASSRHLEKIKWRRFGPEA
                     QMQFTVRREGNYTIVKVTRNGQALDYALVNSNEGRKLIQFCAKKPSISCKYMISSTHM
                     RRFQVAFDNDSDFSDATNKIIGLGLIVVRAHMPPVISQSAAPPQCSSQTPLQSMLSLL
                     NQRATNDNAFPQSQLVPDMSMNVWEELGPLTRTDAIFTSTREPDSNLVQLQESSSLEK
                     MVSEEGVSGFPRFNDPIAAPSITTGNCLAVNPAIEILASQPYVKSTIENKGPKDPPSP
                     PLEDRITLPKGLIKLAPAPLPILPTAPAPLVQFQVPQSPESAPHASATHSQIPIPASE
                     PHSVHPLASAAISPPNQEQNNETNGKLKKTEDNNTNATLPELKISKKLIKRKLKDKKF
                     LKWVSKVESVLSEMVEKTS"
     gene            <690427..>691041
                     /locus_tag="ZYRO0A08668g"
                     /db_xref="GeneID:8201784"
     mRNA            <690427..>691041
                     /locus_tag="ZYRO0A08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494700.1"
                     /db_xref="GeneID:8201784"
     CDS             690427..691041
                     /locus_tag="ZYRO0A08668g"
                     /note="similar to uniprot|P40206 Saccharomyces cerevisiae
                     YMR132C JLP2 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494745.1"
                     /db_xref="GeneID:8201784"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="UniProtKB/TrEMBL:C5DQ51"
                     /translation="MVYVYESKPIDTFDSHFIISGRDQFENDLLIKYGFREWGLIWFH
                     TDKYSSGHIYLKLLPHEKSLDDVPDEVLQDCLQLCKSNSIQGNKLGQCKIITTPWHNL
                     RKSGFMKPGEVSYKSTKNCKKFQCYERNQKLLNRLCKTRVELYDAEPLLHQAKKEKDA
                     CALLEYVEANHDKLIEEEKLRKREKKLKKRNPDKEDELVNDQSV"
     gene            <691253..>692803
                     /locus_tag="ZYRO0A08690g"
                     /db_xref="GeneID:8201785"
     mRNA            <691253..>692803
                     /locus_tag="ZYRO0A08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494701.1"
                     /db_xref="GeneID:8201785"
     CDS             691253..692803
                     /locus_tag="ZYRO0A08690g"
                     /note="highly similar to uniprot|Q04225 Saccharomyces
                     cerevisiae YMR131C RRB1 RiboSome Assembly 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494746.1"
                     /db_xref="GeneID:8201785"
                     /db_xref="GOA:C5DQ52"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:C5DQ52"
                     /translation="MPKRSLEKDEEQRIVSARTEAQDAPKTVVDQEPDVQMDEYGDQY
                     SDDFESEDDIVELDGNDDVEEVEEGDDKDYIERKQKEAQEAIQRDQEESAEGKEIYLP
                     HMSRPLGPDEVLEADPSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTAT
                     QATRKKDNELMVLKLSQLSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTN
                     RLKVSPFATHGQEVLTATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNH
                     GNVEGYGLDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQW
                     SPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDD
                     NGSWGVWDLRQFSPANSEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLW
                     DLSVEADDDEIQQQTKEYKELQKIPPQLLFVHWQKEVKDVKWHKQIPGCLVSTGTDGL
                     NVWKTISV"
     gene            <693061..>696000
                     /locus_tag="ZYRO0A08712g"
                     /db_xref="GeneID:8201786"
     mRNA            <693061..>696000
                     /locus_tag="ZYRO0A08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494702.1"
                     /db_xref="GeneID:8201786"
     CDS             693061..696000
                     /locus_tag="ZYRO0A08712g"
                     /note="similar to uniprot|P40395 Saccharomyces cerevisiae
                     YLR039C RIC1 Subunit of a Golgi membrane exchange factor
                     (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6p
                     involved in transcription of ribosomal protein genes and
                     ribosomal RNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494747.1"
                     /db_xref="GeneID:8201786"
                     /db_xref="InterPro:IPR009771"
                     /db_xref="UniProtKB/TrEMBL:C5DQ53"
                     /translation="MSKHIWPLQPPQRLRISNSVVDLPEFNNNDILQVESLAQVNVLI
                     MLTPARVLVYNLRPMALVASHERTAESIAEFGPNKFLTRSDALEEAVEGLISEKEVEN
                     LIGHQGKIIFHVATEKNALLTYQILKNCTNMTTFKNYGIPVVDLANLQDEDHQEYDEN
                     LDDDTLTVFEKDKSSKIIQNGYCVTKETGFLQFLTSSQDSTDELPLKKLELRLKVVLK
                     FDYPVLDMIGFKRLSDTGDGKAEESLLLLFPHGLQQLTMIDFKLKDTYLVELIDGKKI
                     CIVRGQVMVVSQNEDLSILVHRLGISSQIHKDTELRIGEKLLNCFEMNGIMVLAFTQT
                     ILYYDPVSDKIGGKWNIGSQIKTCGKLNNSTLLIITQAGSIRFYSQYGNLLSCTASDD
                     DDDQDNDERQSYDHSSFTCVDKILVIVTHSGEYEMWDLWEELPQTFSDNRFQRGYALQ
                     NSNNDIAIYSPPIDNSTNQQFLNTIKLPTSTINNCISLFRVNPTFKMSAVYVANKSVL
                     LLQNMETNSWYCFRDITIIDMHWLGSTYLVCHIKQEDCSHVVRCFRFPLQDLDTSEIE
                     KYRLWEYELPSHEQLQSFHVNTAVRYRLLRVKARDGEEVDKYGEKFFRTADIVLVTSH
                     QIMVFAVISTMHWSGLNVIKKFYEQMKVEIPLTDKINWITNHKEGLVYLSRNKLIKMD
                     KEHGGWRSQVVLRDVERIIDLVGEDIFLVKNQSVLIYKMDDLYESLPALLSSPIEDFY
                     PVSLTPESATIHGLHCIFQPNYVKLVIKHKIYLDQMIKAKIALGVSAQDIMMEYGSLR
                     HYNFALEKILSTNILTNESLDGILPLVKLCDNEGTAISGHSNMLEIVSNSLRKIETKH
                     WNILFSKLQMTPKDLLAKCLEGKDAKILGVLLLVFLNYDKTDFMEDLRSGDDTVADVI
                     EDQDMMLSVLRLLVTSAANATDSTLAADSWDMCFQLMRLLKALDKGNNTNLVQEALQM
                     INPSSSE"
     gene            <696226..>696477
                     /locus_tag="ZYRO0A08734g"
                     /db_xref="GeneID:8201787"
     mRNA            <696226..>696477
                     /locus_tag="ZYRO0A08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494703.1"
                     /db_xref="GeneID:8201787"
     CDS             696226..696477
                     /locus_tag="ZYRO0A08734g"
                     /note="highly similar to uniprot|Q01519 Saccharomyces
                     cerevisiae YLR038C COX12 Subunit VIb of cytochrome c
                     oxidase which is the terminal member of the mitochondrial
                     inner membrane electron transport chain required for
                     assembly of fully active cytochrome c oxidase but not
                     required for activity after assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494748.1"
                     /db_xref="GeneID:8201787"
                     /db_xref="GOA:C5DQ54"
                     /db_xref="InterPro:IPR003213"
                     /db_xref="UniProtKB/TrEMBL:C5DQ54"
                     /translation="MSDEKGGSPLHTVGFDPRFPNQNQTRHCWQSYVDYHKCINMKGE
                     EFAPCKVFWRTYSSLCPVDWVDKWDEQREKGIFAGDIQP"
     gene            696692..696764
                     /locus_tag="ZYRO0A08756r"
                     /db_xref="GeneID:8201788"
     tRNA            696692..696764
                     /locus_tag="ZYRO0A08756r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (TGC) cove score=80.16"
                     /db_xref="GeneID:8201788"
     gene            complement(<696844..>697794)
                     /locus_tag="ZYRO0A08778g"
                     /db_xref="GeneID:8201789"
     mRNA            complement(<696844..>697794)
                     /locus_tag="ZYRO0A08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494704.1"
                     /db_xref="GeneID:8201789"
     CDS             complement(696844..697794)
                     /locus_tag="ZYRO0A08778g"
                     /note="similar to uniprot|Q04223 Saccharomyces cerevisiae
                     YMR130W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494749.1"
                     /db_xref="GeneID:8201789"
                     /db_xref="GOA:C5DQ55"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR011949"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DQ55"
                     /translation="MMMINRIYSCQRNTQRSMTWPKRIPIISWTSKLKPPVPKVITFD
                     AYNTLYSTTLPVMEQYGLVGKKYGIEADPQQLTQNFVTVFKELKSQHPNYGKTTRISA
                     NDWWCLLIQGVFQPLSPPREMVDEILTRFEGSGAYEVLPDVKSFLQKVKSQYPDVIMG
                     IVSNTDPVMYTLLKNIGLYEYFQGHIYLSYDLEVKKPGKEIFERALEDIVSKNPELKR
                     ISNLASRCWHIGDEEVNDMLAASNVGWNGILLDRVNKYGYLSESFDKVQRTEHHLSID
                     KIDGNSEEVYRQSISQTDIVQASERTFIASNFESLKRMLL"
     gene            <697861..>699711
                     /locus_tag="ZYRO0A08800g"
                     /db_xref="GeneID:8201790"
     mRNA            <697861..>699711
                     /locus_tag="ZYRO0A08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494705.1"
                     /db_xref="GeneID:8201790"
     CDS             697861..699711
                     /locus_tag="ZYRO0A08800g"
                     /note="some similarities with uniprot|Q07980 Saccharomyces
                     cerevisiae YLR035C MLH2 Protein required for DNA mismatch
                     repair in mitosis and meiosis involved in the repair of
                     mutational intermediates forms a complex with Pms1p and
                     Msh1p to repair mismatched DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494750.1"
                     /db_xref="GeneID:8201790"
                     /db_xref="GOA:C5DQ56"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR013507"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DQ56"
                     /translation="MAIKPINFDASGKIGSSPLILSPISAVKELIDNAIDSGAKNIYI
                     DIDEQTSGSEYIRVRDDGSGIDGAGRQLMCLNHTTSKISNPQEIAQVSTLGFRGQALF
                     SLASLCKAEGSMEVITKCRKDAVGEKWFVNGDGSIKNSKITRIPYLQGTTLVLRRLFR
                     GLRARHLKTSAKPFKQIGNCKTLIDHYSLDYRSIRFHFYLISLDKNGLVVKRELQQSH
                     DTKFTKIKILSSIARLRNTHGHTFFEELGILIDRSTKIDVILPRMLPHGGEEDLDNIK
                     KPKKFLSFNGRPLSLELSFGKSINELIDSLYHQLQLFDPMVWYLNLRSVMNIGDVNVE
                     PEKNDVLIKDVDRLLNNMRRALLGHIMQELKLNVHKESVLTAEEQTKANSHSQIRRPL
                     TAGSMVSNEGEWTHTLLDDDDINDPNSQDIQSSMDDLPSSLTYNYKETSFENEDLEIS
                     KELSISNPFMTAKLRRAFKYGSHNRHTNQTHSLPTKRWTSSPTKSKENFMDGHRPMNK
                     VRKLDKTEKEQCEEFDLGHSLEDTTLVSAEEDQKDEEAILKRSIYNFSELTNNETTTE
                     IFEIPHYSSCTYDQEMNWLSRRGNPSEWLTTYIRSRSHGGVYTTEARANH"
     gene            complement(<699898..>703824)
                     /locus_tag="ZYRO0A08822g"
                     /db_xref="GeneID:8201791"
     mRNA            complement(<699898..>703824)
                     /locus_tag="ZYRO0A08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494706.1"
                     /db_xref="GeneID:8201791"
     CDS             complement(699898..703824)
                     /locus_tag="ZYRO0A08822g"
                     /note="similar to uniprot|P39685 Saccharomyces cerevisiae
                     YMR129W POM152 Nuclear pore membrane glycoprotein may be
                     involved in duplication of nuclear pores and nuclear pore
                     complexes during S-phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494751.1"
                     /db_xref="GeneID:8201791"
                     /db_xref="UniProtKB/TrEMBL:C5DQ57"
                     /translation="MDRDFFLNTTTPRGNHWIGATSSYRTQHNGTTSQRRFQPTTNSS
                     KEFKFGSLPEVKAKKPKQASDVDYSSLPLISPEVLDVSRQRFLALLVFIIIQSYKAYD
                     LFLLKTGLPVIGLLSTSSWFNFVSKYVVVDAMFLYFLPSFKIPKLTFQPWMVLLQILC
                     MWVITFFISTEHDFSIFTGAITLLWRFNNKEVSLSGSSVSHRKLMDSSAHFKGAMTIK
                     ILPENTAMLNPSHESYCLPQDTDLLPEGHLKVPIRINSTSDIQLIQLEYRDLYTNGVE
                     LRNLTAKDFKVVNDPSALLSKDHLSMKGIVDTNSIKYVELPLNEIGFYQIKRIIDSKN
                     FSLKVYHSHLIVSHCPVATIAGAGSFDRCIGDSDKLTIELQGVPPMRLGYSKAVGGQQ
                     HTYLDSNLQPEYFESPLQSTPRHMFSSGDLEDLRWARTHPVTISLDLPVTQEGLYNYR
                     IDRLVDGLGNVMDFTKIPESVQKENGVSYNFKVHGIPRASLEEKFDPNSSTKKSISVN
                     FEQIQDWGAATPYWAKISHVAADGGAQTFNVSTNSLSHGFQADLPGTYKLDSVGSTFC
                     PGVVIGKSSVLVTKPIPPELEVNSTPILDQCVGQVGLNFDLTFTGVPPFYYRAFIYRI
                     ENGKRKLYDTKKYTSQGTRNQFSYSPTSEGNYEIVFDELSNQLFSEPISLIPREKYTF
                     KTSMRVKPSAVFKNINEKKLCLGDQTKAPVKLNGEPPFYVKYDIFETSSNKRKTYEVK
                     DIQSNDYDINLPKFDLGGDYIMSLVSVKDSSGCLVGLSEPDVMIKVRRDVPSASFNLL
                     ENANSIKIKQGSLAEIPIKLAGEAPFTVKFQHLNHEGEVLGVYESRFNSNYKPSLKVS
                     KEGSYKLLEMHDSYCSGKIDNENFQFKVSFLDKPNFSVIENAKTNKLSAITFSKEQVC
                     QGRESTIDLSLSGSPPFILRYDIIAPNGYTSSDSIQVATKYAAIKLPNQEPGEYTAVI
                     NALFDANYGEDDFARAGSPYEEVFVKQTVNPTPYVTFADMGKTYRTCSINVQEDTLSL
                     EPIKLKFVQGVAPFSVTFSIYHESKGRSDQFTLEDVDPANFPYHKLYENLKLGNHVVT
                     IEKVVDANGCTNDLIATQNNHVLISITDVPKIHLLDPTAEYCVGDYVAYQLNGVAPFS
                     IRYEFNQKQLKLKEYTSQFVRIASEPGIISIASIEDSISQCVVNFTTPSMKKEFEKLS
                     LLVHPLPSVTVSRGKNIIEDIHEGDQAEIIFTFEGNPPFSLTYVRTEEAEGSKGRGIP
                     QVVETHKVTDIYAYEYRVVTSLQGTYQAIEVSDAFCFAKNDAYFSS"
     gene            <704383..>705783
                     /locus_tag="ZYRO0A08844g"
                     /db_xref="GeneID:8201792"
     mRNA            <704383..>705783
                     /locus_tag="ZYRO0A08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494707.1"
                     /db_xref="GeneID:8201792"
     CDS             704383..705783
                     /locus_tag="ZYRO0A08844g"
                     /note="highly similar to uniprot|Q12078 Saccharomyces
                     cerevisiae YLR034C SMF3 Putative metal transporter Nramp
                     homolog homolog of SMF1 and SMF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494752.1"
                     /db_xref="GeneID:8201792"
                     /db_xref="GOA:C5DQ58"
                     /db_xref="InterPro:IPR001046"
                     /db_xref="UniProtKB/TrEMBL:C5DQ58"
                     /translation="MSGTLQAISKFVKFIGPGILVSVAYMDPGNYSTSVSGGAQFKYV
                     LLSSVFISNLFAVVLQCLCVKLGTVTGHDLAENCRRHLPRRLNLTLYFFAELAIIATD
                     LAEVVGTAIALEILFGIPLTWGVVLTVLDVLAILMFYSPDVGSMKKTRIFEIFVSLLV
                     VGTVTCFILELFKISVPNKVELFRGFMPSTIIFKDQQALYISLGILGATVMPHSLYLG
                     SSLVKPRLQDYDIKHYGKVQDRPSLRAINYSLNYSYAELIISLFLIATFVNSAILIVA
                     GATLYGQPEAADADLLSIYRLLVQYISPAAGLIFAWAMIFSGQSAGIICTLAGQVVSE
                     GFLQWSLPPWAIRICTRMMAVVPCLIVTLTMGQHGISDILNFSQVVLSLILPIVSAPL
                     IYFTANRKLMTVPKSVDERQEPGENTALISNKEEYVDFTNSTWLTATSVIIWALIGSL
                     NCYLVISFLLGADVHF"
     gene            complement(<705859..>707478)
                     /locus_tag="ZYRO0A08866g"
                     /db_xref="GeneID:8201793"
     mRNA            complement(join(<705859..707266,707339..>707478))
                     /locus_tag="ZYRO0A08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494708.1"
                     /db_xref="GeneID:8201793"
     CDS             complement(join(705859..707266,707339..707478))
                     /locus_tag="ZYRO0A08866g"
                     /note="similar to uniprot|Q07979 Saccharomyces cerevisiae
                     YLR033W RSC58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494753.1"
                     /db_xref="GeneID:8201793"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="UniProtKB/TrEMBL:C5DQ59"
                     /translation="MAFRHELKKQSSSTISKNDNKELIVHTPPKMTEFSEVLSSIHAI
                     LKVASSKCKVLDESFPAKFFDPNPDKIFDSYYKFIKNRSNNEGIIKNEDKLAMTTISQ
                     QFETGEYSAERGGFYRLYHDINLVCMMLIHYYPQGTRNYQMVDKFSKFATELLLRECY
                     RVGVSLMQIDPEEYASKPEEKTELDRIVARDFIKISTNYKVPIAKTYHIKTKESELFS
                     SIIGKSSLDRRPQELPNSNFEINKIILQSNMCEDAPRLGFVAANTSNVPDPTLPPTEM
                     MTRFLHPNWYALPTTMWLEYGDYKSWVPSFNENGTVIDSTTKGIIWLERVGYMEAFSN
                     GNEEKENEKEEEQNDKTEKKEESEADDSESKEPETTKPAEEDDASKDVPSENGKPQEV
                     SDSEPPVIKLQNLLQWSPANSLDEESISSFKEGSQSQLISNTLLQIQKMRKTRIKNKI
                     TKPSVEETRLYNKTRRLMKEVILAKQTSGLPMNHCRSFPVLQANYNGSVPVVRTQPTR
                     KRKHKRV"
     gene            complement(<707590..>711390)
                     /locus_tag="ZYRO0A08888g"
                     /db_xref="GeneID:8201518"
     mRNA            complement(<707590..>711390)
                     /locus_tag="ZYRO0A08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494709.1"
                     /db_xref="GeneID:8201518"
     CDS             complement(707590..711390)
                     /locus_tag="ZYRO0A08888g"
                     /note="similar to uniprot|Q04217 Saccharomyces cerevisiae
                     YMR128W ECM16 Essential DEAH-box ATP-dependent RNA
                     helicase specific to the U3 snoRNP predominantly nucleolar
                     in distribution required for 18S rRNA synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494754.1"
                     /db_xref="GeneID:8201518"
                     /db_xref="GOA:C5DQ60"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQ60"
                     /translation="MGTYRKRFNEKARAGQIAKQDELKKIRNKQFLRAAEDAEDAEDA
                     EEVPEASKESQGPDTNAEILPPMSQEEKALKKRKLQELFTPKETKVSRLKRKRLDKFI
                     EHQLRKEEKKDIMNKLQDYKIDTSLLTSSKKLGHGKQTKKEEFEEALSLERQGRGDED
                     TKEILYEEHDQKDWFQDHPEDAQQDESEKSGDEDEGEGEGEERKSAFVDFRPAQGTGM
                     GFGFANAKVVHKHKAPKKKYHWRTLVEMEEKRKHGIEDEMDFASSGSDSEDKSSEEDS
                     GDEDSGADDEEEVQEHAEVDKEENAEVSDSSEEHQEESSDGESESSEPVNPEELAAER
                     QTTADTFKEWANEQIREMDGGNVDVEMPSLDFKYEPIVREEDLDDGLGSEDVPIDESS
                     KRKAFYVPVTRPEEIQAVRMQLPVFGEEHKIMEAIHHNDVVIVCGETGSGKTTQVPQF
                     MYESGFGSPESPDHPGMIGVTQPRRVATVAMANRISNELGDHSDKVAYQIRFDSSVKD
                     DTRLKFMTDGVLLREMMHDFKLSNYSSIIIDEAHERNINTDILIGMLSRCVKLRAREH
                     AKNPEQNKKLKLVIMSATLRVADFSENLSLFSTPPPVLNVEARQFPVSVHFNRRTPYN
                     YVDEAFKKTCKIHQRLPPGAILVFLTGQQEINHMVKKLRKEFPFPKDTNNIGRKDMQS
                     SSSNVKVSSKNVDLEAEDIDLSVKVVDEDNMGYIEGDRGEDEEEEEEEEGFEETLEEN
                     QTPNDPLYVLPLYSLLSTKEQMKIFKEPPAGSRLCVVATNVAETSLTIPGVRYVVDCG
                     RSKERTYNESNGVQSFEINWISKASADQRSGRAGRTGPGHCYRIYSSAVFEEDFEQFS
                     RPEVLRMPVESVVLQMKSMAIQNVINFPFPTPPDPRTLSKAVKLLQYLGALDSREKIT
                     EDGKTMSLFPLSPRYSKILLVSTEHNCLPYAISIVSALSVGDPFLKEHEIGLDFENSD
                     SEEEDSDQKKLLRQRYYKSKAKFSKLDKQSDVFRLLSVVSALDFIPEKEKASFMRQNF
                     LRAKFLEEIAKLRKQLTYIIKSNTTQENVAARVVDQDLKSDLPTELQLKMLKQMICAG
                     FVDQVAIRADYLFPEDVKLTNKMTIINIPYVNVLAPKSPEMEENFVYIHPTSVLSNSG
                     ESPPKFLVFHSLHQGNSSRTRMNTLCDIKSTPLANIAGKGSLLTYSKPLTGKGLNTIT
                     VSHKERYCYVVPRFGSSVDSDLSISWDLNPIAVHQVKENGQWIVKKFITNKNFEEERN
                     KHNQ"
     gene            <711674..>712612
                     /locus_tag="ZYRO0A08910g"
                     /db_xref="GeneID:8201519"
     mRNA            <711674..>712612
                     /locus_tag="ZYRO0A08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494710.1"
                     /db_xref="GeneID:8201519"
     CDS             711674..712612
                     /locus_tag="ZYRO0A08910g"
                     /note="similar to uniprot|P40963 Saccharomyces cerevisiae
                     YMR127C SAS2 Histone acetyltransferase (HAT) catalytic
                     subunit of the SAS complex (Sas2p-Sas4p-Sas5p) which
                     acetylates free histones and nucleosomes and regulates
                     transcriptional silencing member of the
                     MYSTacetyltransferase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494755.1"
                     /db_xref="GeneID:8201519"
                     /db_xref="GOA:C5DQ61"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DQ61"
                     /translation="MSHDGEGLYGILNERNIKEVQFGVDKRFPTWYGSNVYFDPESRA
                     LGYLEKNGSDGLSGSNGTNGHNKGDVQFWLDTLYVCEYCFKYTDNEEDLAGHAKHCRF
                     QKHSPGKIKYKSPNYTIKRVKGTKHRLFCQCLCLFTKLFLDNKSMYFKVDHYEFYIVY
                     ETSSTKPMGFFSKDTVSYYQNNLACVLVFPPYQRRQLGTFLLDFSYKISKSEGLISGP
                     EFPLSPFGLIGYVKYWSLKICWEFSEGELANMEKITLENISSVTGFRISDIITALKYL
                     GCLGESDEIYLSILRKKLNRHSCEALVEDEYLLLDD"
     gene            complement(<712694..>716260)
                     /locus_tag="ZYRO0A08932g"
                     /db_xref="GeneID:8201520"
     mRNA            complement(<712694..>716260)
                     /locus_tag="ZYRO0A08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494711.1"
                     /db_xref="GeneID:8201520"
     CDS             complement(712694..716260)
                     /locus_tag="ZYRO0A08932g"
                     /note="similar to uniprot|P32849 Saccharomyces cerevisiae
                     YLR032W RAD5 Single-stranded DNA-dependent ATPase involved
                     in postreplication repair contains RING finger domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494756.1"
                     /db_xref="GeneID:8201520"
                     /db_xref="GOA:C5DQ62"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014905"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQ62"
                     /translation="MADERERYFKDEFDSSQEKERHEFKLNGGSFLFGSNGQEPVEPA
                     APIVPSESGLHTSAGSDSQSQNDLQDETLQDESLQEEFEPASNELQSPDYISQIRQII
                     PGMNLDVARGLVEKYRGEGDVVSKAISEYFEEGLIVEHEKPRNSSSPTAGGNEGAESN
                     SNGNSRNGSLVGQPLTREKRRKEVTPRPIKRLKSEIEWRKFIGSLQVNAMATRPTLRP
                     LKYGTELEILKSSGGLPTSKLYNTNGRKKVSMASFVKIFDTQQNREIGRLPEDVAQIV
                     YPLINTDDVVFEATMVFCENKRLSIGDSFVLQLDCFLTSSIFDEDQNKELTPSRSARW
                     GSNSSMVETEEELQSRSKKVGLLSLFDRLRLRTVDDKADDASKSSANSEEDGVEVIDL
                     DDDDNDGDEKLEDIVAREEDDARRFSSQEEGVMNLNQLKVFYKATQSSDSLKTLPETE
                     PPSTTINLTLRKYQRQGLTWMLRREHEFEKAADSQGFQNVNGNMMNPLWKCFKWPKDM
                     SWTAQRMEDHTEVDLGKFFYANLHTGEFCLEKPILKTMMKGGVLSDEMGLGKTISALS
                     LIFTSPYDSSLVDKHLFMDGNEDENLSPPSSQSSKKPYAMKTTLVIVPTSLLSQWHSE
                     FTKFNNSPDLYCEIYYGGNVSSLKTLLTKTKNPPTVVLTTYGIVQNEWTRILKMDRRD
                     ADMDSTTGLFSLKFYRVILDEGHVIRNRTTSTSKAVMEISSMCRWVLTGTPIINRLDD
                     LYSIVKFLKLEPWAQISYWKMFVSDPFERKDYRQAFDVVNAILEPVFLRRTKQMQDAD
                     GRPLVELPPKEVVVEKLTFNEAQNTIYKHYLEEAETSVKKGLARGDLLKKYSTILVHI
                     LRLRQICCDPKLLGAQDENDEDLSKSNQLLKESVDVNKVYQKVGLNESSNRLDSGRLN
                     TIKSRIQEKYPTADSLKTLECSICTADPIELHKVLFTECCHSFCEECLKEYLEFQKQK
                     ELELKCPNCREPVNKNYFFTLMLKDGESPQVVPLREVAKSAKIEALLKHCSILQETSP
                     GEQIVVFSQFSSFLDILETELANTFLGNGVKVYKFDGRLNLKERAAVLENFSTKDFDN
                     QKVLLMSLKTGGVGLNLTCASYAFMMDPWWSPSMEDQAIDRIHRIGQINQVKVTRFIV
                     ENSIEEKMLKIQERKRTIGEAMDADEDERRKRRIDEIQMLFE"
     gene            <717007..>718056
                     /locus_tag="ZYRO0A08954g"
                     /db_xref="GeneID:8201521"
     mRNA            <717007..>718056
                     /locus_tag="ZYRO0A08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494712.1"
                     /db_xref="GeneID:8201521"
     CDS             717007..718056
                     /locus_tag="ZYRO0A08954g"
                     /note="similar to uniprot|Q04216 Saccharomyces cerevisiae
                     YMR126C DLT1 Protein of unknown function deletion causes
                     sensitivity to thermal stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494757.1"
                     /db_xref="GeneID:8201521"
                     /db_xref="GOA:C5DQ63"
                     /translation="MPIIDFEIWKLWLFRSIKAIVIIFLVGFSIVLPVDSIVQAAESS
                     NTALNTFIVVGALVAFGLVSIIIIVGRIIFCRSCIQDIPRRYLPITPNDLPHRGSRKM
                     IMENMEKSKELSILFKKPKEPVIHAGLEPPSRCDDPRYEKLFPDYLNYRSCIKSLSDR
                     LKYQGIFLNNMNIDMKLGETFADVVSNQFTRNTRNKTQIDNSKKFIDLYETIRYSGRE
                     VTRQQFIDFVSLAIYFVEVSLTRDDRSPALGELNTGSQLQFNFDNGTWENDVSNYSFP
                     NDAYSNGADYYYPESINYLKRTNSTSTVARKVPSFVPTNPEEEHKMALDPQDPVSHKP
                     SMHTLADSFKYVTHR"
     gene            complement(<718141..>721059)
                     /locus_tag="ZYRO0A08976g"
                     /db_xref="GeneID:8201522"
     mRNA            complement(join(<718141..720719,721035..>721059))
                     /locus_tag="ZYRO0A08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494713.1"
                     /db_xref="GeneID:8201522"
     CDS             complement(join(718141..720719,721035..721059))
                     /locus_tag="ZYRO0A08976g"
                     /note="similar to uniprot|P34160 Saccharomyces cerevisiae
                     YMR125W STO1 Large subunit of the nuclear mRNA cap-binding
                     protein complex interacts with Npl3p to carry poly(A) mRNA
                     from the nucleus to the cytoplasm also involved in mRNA
                     degradation in the nucleus orthologous to mammalian CBP80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494758.1"
                     /db_xref="GeneID:8201522"
                     /db_xref="GOA:C5DQ64"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR015172"
                     /db_xref="InterPro:IPR015174"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027159"
                     /db_xref="UniProtKB/TrEMBL:C5DQ64"
                     /translation="MFSKKRRADFEEDDGYRDFRPRMPKRQRVPPVVQLCKEMMPDIR
                     TIGESVKAFEEDIKFLSDAIVNEYGHEDYFNDALLSTFRAVVLEQPQKQPAIALLTMV
                     VNASNEVAAKSVINFFFEELQKLCDASTDENYEAVSNETGIWNKFKLVLRFLSLLSPI
                     VSTDDLLAIYKSVFQLAVDLNRDAGPESRNALSEALYTNTLLDLPYLFFFNRSDDVLQ
                     SKVEELFNFVETEYQVKTSDVNLLKQFNKNAPYQTTELIHVVLPNVKKVLANNMEQLF
                     QLFPDWQYLLSEQPSERHGFNEPLKLPPLGQLKPFSSLDRGVGSVDSMWREPRYTFHV
                     YLPNSVGDFETVVPITSYAGQLFKDIIIDIVESLEFNRKEVAKQVITLDLFFKQGIFA
                     EPGESIAQLAATYEENPLASTFKIEDIAIETILELVFKLPDVSQPFAYFYTLLVEICQ
                     NSPKAIAPVFGRAFRFFYNNLDNLDLELKLRYLDWFSIQMSNFNFSWKWNEWENDSIR
                     FGSTFYNAKMNFAKNLIRKELRLTSNTLDVEDSLPDEFKKYLDSSYVPREQLVEYYQS
                     LFVGESFQVNPNDIKKNDLYFRHESFPAHQQVRQLLDYVHKQNDSREVSELETIINSI
                     RQEYGDIIANFEKFIIVVLIQTVVHSGSRSLSHANKYIGDLKDDLTHILGQMEMDDST
                     KQFTIVEAVLRFWNSNSQNGFLIADTFKFAGFLSPLSIFQFSFNEEKSGGSTKNYGLV
                     DGTSIESTFRNLTQHIGDQECLTFIFEKLINITNECITQLALQPEEAVNIPDVNDTNI
                     EIDWQNDLPKLDLLWKYETTMSFFKSILRKYVDEYRTSEERLRDFVETTISHTPTKRQ
                     LLLWIDETHKL"
     gene            complement(<721298..>724213)
                     /locus_tag="ZYRO0A08998g"
                     /db_xref="GeneID:8201523"
     mRNA            complement(<721298..>724213)
                     /locus_tag="ZYRO0A08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494714.1"
                     /db_xref="GeneID:8201523"
     CDS             complement(721298..724213)
                     /locus_tag="ZYRO0A08998g"
                     /note="weakly similar to uniprot|P39523 Saccharomyces
                     cerevisiae YMR124W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery cytoplasm bud and bud neck"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494759.1"
                     /db_xref="GeneID:8201523"
                     /db_xref="UniProtKB/TrEMBL:C5DQ65"
                     /translation="MVRSRGLLRSELLKTDGSIDVNNIDVNDDDDDGIDVNRARQQRE
                     PIPMGFGYVPQMAQVGQGKIPGLPPGVPAGTPMGSPSPMPNPHPNPQQNMGFRQNGPM
                     RMQNGMPYRGGPPMGGMPPNGMPPNGMPPVGVPQQPQQPQRRAYSLNNVWRQRPRISH
                     KNNKKRNSGGNEDDEVIMQESEDDVTFNDIRTMGKSEKYGFGADTAPIIPTLITKSHN
                     NMNNTEYRKAMTAQRKNAMNAMAKQRQPGPVGAVPAAGADPRAMSLQGYGRGSPFNPM
                     GPGGGPGVYPGTSPGFGGNPRTPSGMPRSMSMMTTQSRPSVGYMRQHQQNMFAARDNE
                     PPPGGRANSLINIPSSSSVGPSPNTAAPVSGVPGVAGPSSGSNPTPAPRRNLRLGINP
                     PMPQSLDPGPLTPDNDQSKNVTSPLKNQLVAPSPGSPPINGGQLNVLQLSQPQQNELK
                     EREKQLADRERELKEKEEMVKKREAEVQEELKQKEQELERERLRKDQEELQKQEQREL
                     MGPSEENQQQMKTEYSSNVPLQNQSLPPQDLSRCNTYDGLDLQPSSTLERGLDGLSLN
                     DKLESESVADNKESENGRERKTEKKNNKNPSSYNNRESTISFGDLQNNRISTSTFMSA
                     LSDSPQKKNKPATGLYQLENTGNNEFFTAEEFFGHDANTNQGNSTLDISNMSPAASNT
                     TATLNSNARMSGQLHSDTPVDRSRNGPNRKPLSKIPSASSRENESGSGARTFSRNSVS
                     NVSMGSFLGSNDDTFDFKHANTDRNPSVKSVPSGKVTKGSSVKQVSEQNPESLKEEDG
                     EMEHFSFDNTMGEPYEPMFAHGSELIPPKIRFKTIIVSSDQLNILKENKSLMSEISII
                     SAELADSIKRECILEEKLQTISTNRDGNDKPLSGESLLDYEAQLRTKSEKIVDLLKQL
                     NEQRLRRLIAEEQIFLSENGAKPTSTDLVHKITDLESQLTAKDYEISRLREYQPQPF"
     gene            complement(<724485..>724880)
                     /locus_tag="ZYRO0A09020g"
                     /db_xref="GeneID:8201524"
     mRNA            complement(<724485..>724880)
                     /locus_tag="ZYRO0A09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494715.1"
                     /db_xref="GeneID:8201524"
     CDS             complement(724485..724880)
                     /locus_tag="ZYRO0A09020g"
                     /note="similar to uniprot|Q03880 Saccharomyces cerevisiae
                     YMR123W PKR1 Protein of unknown function overproduction
                     confers resistance to Pichia farinosa killer toxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494760.1"
                     /db_xref="GeneID:8201524"
                     /db_xref="InterPro:IPR013945"
                     /db_xref="UniProtKB/TrEMBL:C5DQ66"
                     /translation="MSFFQNLWGSIFEPGTNPQLLIATHLSFTSLILVLVWLCYETRN
                     VHFFALLTIAAILWALVTWFINELKHQPLRDNDQLAKDNGARAEEEQEDKKEKNTNNN
                     KKANQESRTTGTTAAASSANTRRTKSRKT"
     gene            complement(<725340..>725696)
                     /locus_tag="ZYRO0A09042g"
                     /db_xref="GeneID:8201525"
     mRNA            complement(<725340..>725696)
                     /locus_tag="ZYRO0A09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494716.1"
                     /db_xref="GeneID:8201525"
     CDS             complement(725340..725696)
                     /locus_tag="ZYRO0A09042g"
                     /note="some similarities with uniprot|Q3E842 Saccharomyces
                     cerevisiae YMR122W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494761.1"
                     /db_xref="GeneID:8201525"
                     /db_xref="UniProtKB/TrEMBL:C5DQ67"
                     /translation="MSLNSSLNNSNLSNSTSGIGSNLTSNLTSNLTSNSSSITTNSRL
                     VHSNVVAPSSVTAGGLSGFNTSSGSLSSATPTVSDGSKIKNGAGAGLVANPLSWKYGA
                     ALGAVIVGSFVLGSGL"
     gene            727755..727845
                     /locus_tag="ZYRO0A09064r"
                     /db_xref="GeneID:8201526"
     tRNA            join(727755..727791,727810..727845)
                     /locus_tag="ZYRO0A09064r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8201526"
     gene            complement(<728275..>729615)
                     /locus_tag="ZYRO0A09086g"
                     /db_xref="GeneID:8201527"
     mRNA            complement(<728275..>729615)
                     /locus_tag="ZYRO0A09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494717.1"
                     /db_xref="GeneID:8201527"
     CDS             complement(728275..729615)
                     /locus_tag="ZYRO0A09086g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494762.1"
                     /db_xref="GeneID:8201527"
                     /db_xref="UniProtKB/TrEMBL:C5DQ68"
                     /translation="MYFKPQLVLALLALTQARETTILAPNAAPSASGASVAAPSFPGA
                     ANNSVPAAGGGANGTSLSPNGTSFSPNGTNASPGYANNTAPSSSVAAGPAGSNPLNAV
                     GAGGSGTGSQGSGSGGSPGGGSGGGSGGGSGAESSPAAQSGAGSGSQGSSGSGSSSHS
                     SAEGANSQSESSSSSGGGSSVAQAGSQGTDEDGNQSSSQSETNSGPGGSSSDSDSSSE
                     PASSASPSSSSGGSTGSSAAPPSAASSAAPIGSAPASGSSAPNPSGAHPTIAVASPSA
                     SQGGFSNNTAPSSPAAAVASPSLNGTNAAPAASVPAASAPAASAPAASAPANNATAPT
                     DASPAPADDSSAPAASAPAASAPANNATVPTGVSSAPADASSAPADASAAPTDAASAP
                     AASAPAASAAPSAVPSQAAPGNSTGSNSGLLRRSLLKRAETAIKADQFNLTGVN"
     gene            <731224..>731838
                     /locus_tag="ZYRO0A09108g"
                     /db_xref="GeneID:8201723"
     mRNA            <731224..>731838
                     /locus_tag="ZYRO0A09108g"
                     /product="60S ribosomal protein L15"
                     /transcript_id="XM_002494718.1"
                     /db_xref="GeneID:8201723"
     CDS             731224..731838
                     /locus_tag="ZYRO0A09108g"
                     /note="highly similar to uniprot|P54780 Saccharomyces
                     cerevisiae RPL15B and to uniprot|P05748 Saccharomyces
                     cerevisiae YLR029C RPL15A"
                     /codon_start=1
                     /product="60S ribosomal protein L15"
                     /protein_id="XP_002494763.1"
                     /db_xref="GeneID:8201723"
                     /db_xref="GOA:C5DQ69"
                     /db_xref="InterPro:IPR000439"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR020925"
                     /db_xref="InterPro:IPR024794"
                     /db_xref="UniProtKB/TrEMBL:C5DQ69"
                     /translation="MGAYKYLEELQRKKQSDALRFLQRIRVWEYRQKNVVHRASRPSR
                     PDKARRLGYKAKQGFVIYRIRVRRGNRKRPVPKGATYGKPTNMGVNELKYQRAMRATA
                     EERVARRASNLRVLNSYWVNQDSTYKYFEVILVDPFHKAIRRDAHYNWICNPVHKHRE
                     ARGLTATGKRSRGINKGHRYNNSQSGRRKIWKRHNTLSLWRYRK"
     gene            <732139..>733920
                     /locus_tag="ZYRO0A09130g"
                     /db_xref="GeneID:8201724"
     mRNA            <732139..>733920
                     /locus_tag="ZYRO0A09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494719.1"
                     /db_xref="GeneID:8201724"
     CDS             732139..733920
                     /locus_tag="ZYRO0A09130g"
                     /note="highly similar to uniprot|P38009 Saccharomyces
                     cerevisiae YMR120C ADE17 Enzyme of 'de novo' purine
                     biosynthesis containing both
                     5-aminoimidazole-4-carboxamide ribonucleotide
                     transformylase and inosine monophosphate cyclohydrolase
                     activities isozyme of Ade16p ade16 ade17 mutants require
                     adenine and histidine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494764.1"
                     /db_xref="GeneID:8201724"
                     /db_xref="GOA:C5DQ70"
                     /db_xref="InterPro:IPR002695"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR024050"
                     /db_xref="InterPro:IPR024051"
                     /db_xref="UniProtKB/TrEMBL:C5DQ70"
                     /translation="MGDYESTAILSVYDKTGLLDLAKGLSEANVRILASGGTARMVRE
                     AGFPVDDVSSITHAPEMLGGRVKTLHPAIHGGILARNLEQDEEDLQKQHIDKVDFVVC
                     NLYPFKETVAKVGVTVSEAVEEVDIGGVTLLRAAAKNHARVTILSDPHDYPAFLSELK
                     KGNGQVSQELRNHLALKAFEHTADYDNAISDFFRKQYSEGKSQLPLRYGANPHQKPAQ
                     AFVTQQEELPFKVLCGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAV
                     GLPLSDVEKQVYFVSDIENLSPLACAYARARGADRMSSFGDYIALSNIVDVPTAKIIS
                     REVSDGIIAPGFEEEALAILKKKKGGKYCVLQIDPNFVPEPLETKQVYGVSLQQKRND
                     AIINKSSFREIVSANKNLTEQAVIDLTVATIALKYTQSNSVCYARNGMVVGLGAGQQS
                     RIHCTRLAGDKVDNWWFRQHPRVLSIKWAKGVKRPEKSNAIDLFVTGQIPTEEPEKSD
                     YESKFEQIPTPFTEEERKDWSSKLTNVSLSSDAFFPFPDNVYRAVRSGVKFIAAPSGS
                     VMDKAVFSAADSFQVVYVENPIRLFHH"
     gene            complement(<734930..>736831)
                     /locus_tag="ZYRO0A09152g"
                     /db_xref="GeneID:8201725"
     mRNA            complement(<734930..>736831)
                     /locus_tag="ZYRO0A09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494720.1"
                     /db_xref="GeneID:8201725"
     CDS             complement(734930..736831)
                     /locus_tag="ZYRO0A09152g"
                     /note="similar to uniprot|P54074 Saccharomyces cerevisiae
                     YMR119W ASI1 Putative integral membrane E3 ubiquitin
                     ligase genetic interactions suggest a role in negative
                     regulation of amino acid uptake"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494765.1"
                     /db_xref="GeneID:8201725"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DQ71"
                     /translation="MNATSAIGSNVLESFSYLNQTAHSLIPDSVIFSPVVNYPYRLAL
                     SFVNAAKLQYEQALDVDILWFGVRCLKELTYYLLSSYATASFVTALILNRIVIMASLR
                     STANRVVLPLWSRVLLHLAAIIPLIYTLLQVLCQYGIVQKLEPLEFTTFLSSTFASYA
                     WSNCVETFVASTTNTLPLEESDYSIFELSILFYCLKKSKQLDLPLQDYLPDCMMATLG
                     RLLVHSVELFQCRKYRLFGSTILNFAGIGHFIYKVRWFGFNSLPVATRYINFPKMFSL
                     FLIVMSVSTYSLAYLVRLDPFGRGGLDPQELQFYSFMRNWWEHLNCTGEEEFSCVVVK
                     LATMLCMGRESMSKGVLREFSHINAPSSIHHSYVISGYLNNISTIPEDIEIRYRESIM
                     TMHPGTSNAPGLVKRFKICIMLVKHFFAFFRKSRAPEIRQEPLAKDPNRYVTERNYAK
                     FLSKPQFSQKETDLDNNQYLLPEDDLSGDYVPDQSEEVETDTEFGSDDEDLGTILAPE
                     SMDNLQEDLSWYISMWSILKSAVHSGTRLTRKQYAAIEPQKILTEVVLERTASHRTDD
                     DDDDDDDDMDSTFACVVCKTNSRNVVLWPCRCFALCESCRVSLGLRGFNSCVCCRRDV
                     HGYSKLHAI"
     gene            complement(737318..737437)
                     /locus_tag="ZYRO0A09174r"
                     /db_xref="GeneID:8201726"
     tRNA            complement(join(737318..737361,737400..737437))
                     /locus_tag="ZYRO0A09174r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8201726"
     gene            <738006..>739091
                     /locus_tag="ZYRO0A09196g"
                     /db_xref="GeneID:8201727"
     mRNA            <738006..>739091
                     /locus_tag="ZYRO0A09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494721.1"
                     /db_xref="GeneID:8201727"
     CDS             738006..739091
                     /locus_tag="ZYRO0A09196g"
                     /note="highly similar to uniprot|P32473 Saccharomyces
                     cerevisiae YBR221C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494766.1"
                     /db_xref="GeneID:8201727"
                     /db_xref="GOA:C5DQ72"
                     /db_xref="InterPro:IPR005475"
                     /db_xref="InterPro:IPR005476"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR027110"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DQ72"
                     /translation="MLNVRIPSIAAKLAPLKSSSALLQSTRMASSQTMTVREALNAAM
                     AEEMDRDDDVFLIGEEVAQYNGAYKVSKGLLDRFGERRVVDTPITEYGFAGLSVGAAL
                     KGLKPIVEFMSFNFSMQAIDHVINSAAKTHYMSGGTQKCQITFRGPNGAGVGLGAQHS
                     QDYAAWYGAIPGLKVLTPWSSEDAKGLMKAAIRDPNPVVVLEDEVLYGESFEVSDEVM
                     SPDYVTPFKAKVEREGTDVTLVAYTRNVGFAVQAAEILDKQHGVAAEVINLRSIRPLD
                     MDTVIKSVKKTNHLVTVESGFPHFGVGAEIAAQIMESEAFDYLDAPVQRVTAADVPTP
                     YAKKLEELSFPDADTVVTATKEVLSIE"
     gene            <739559..>741226
                     /locus_tag="ZYRO0A09218g"
                     /db_xref="GeneID:8201728"
     mRNA            <739559..>741226
                     /locus_tag="ZYRO0A09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494722.1"
                     /db_xref="GeneID:8201728"
     CDS             739559..741226
                     /locus_tag="ZYRO0A09218g"
                     /note="similar to uniprot|P38318 Saccharomyces cerevisiae
                     YBR220C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494767.1"
                     /db_xref="GeneID:8201728"
                     /db_xref="GOA:C5DQ73"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR024371"
                     /db_xref="UniProtKB/TrEMBL:C5DQ73"
                     /translation="MAGKKNLAKHDLPQFYLLVALYFLQGIPVGLAFGTIPFLLKSMA
                     KDTSFTTLGIFSIATYPYSLKILWSPIVDSIYDSKVGRRRSWIIPIQLLSGSMLFILG
                     WAVSNNLVFKGVDDAFHGRHTNGLHDLNILTLAWYFGLLVFLCATQDIAVDGWALTIL
                     SAQSLSYASTAQTVGINLGFFLSFTIFISLNSSDFANKYFRSQPLEHGFVSLGGYMKF
                     AGILYILVTIYVIMFTRERPLDDVLPRLGPSAAKKYDESKYAAEYPDGDAIGTSNKAS
                     IKYTYKCFGRILKLKSVQTLVFIHLTSKLAFQCNEAATNLKLLERGFKKEDLAVTVLI
                     DVPFEVIFGYYVAKWSSESNHHHHSPRPIVSHRNSWVRFLVGDPGILTPWLWGFLGRL
                     AAAALGSYVLSVFPKDSQITKPFFLLVIIQHLLGSFMNTVQFVGISAFHTRVADPVVG
                     GTYMTLLNTLSNFGGTWPRLIIMSMINYFTVYECYVPATNHAITYQGGSMERCTEGLN
                     GKLSILRDGYYVTNGMCVLFGLILYFGFLKKKAQQLQTIPVDSWRCS"
     gene            complement(<741195..>742313)
                     /locus_tag="ZYRO0A09240g"
                     /db_xref="GeneID:8201729"
     mRNA            complement(<741195..>742313)
                     /locus_tag="ZYRO0A09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494723.1"
                     /db_xref="GeneID:8201729"
     CDS             complement(741195..742313)
                     /locus_tag="ZYRO0A09240g"
                     /note="weakly similar to uniprot|P53012 Saccharomyces
                     cerevisiae YGL126W SCS3 Protein required for inositol
                     prototrophy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494768.1"
                     /db_xref="GeneID:8201729"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:C5DQ74"
                     /translation="MKRSVRTFGIITLFLCPLTLLLGHILGYLSSYPSSVDKDGWINT
                     VFVKKGWFWTSLVMWMCVYRYGKFNRQSFTRYLILTAWWYVFTQALWFHTAPIMDLIF
                     LATGGLCRFDVLDADGNLNSSFQDSDSRKSRSLSKIYSFLVRFQLTTQDELKGNLASH
                     TLATLRRLMGISNEKSDSTEPLVSPSEINIFIHDSIKSVREISTSAACRATGGHWKGG
                     HDPSGHIFLNTLMIMFLLGELDFFAPLAWSKLSSKGLGPLSYFTTLLDNSPLRNLMQR
                     RPETVGEKIWVVGFLPAWECIQGLIKFIIICVRYLVWENPVLLLIALVILWWYSLIVT
                     TLVFHTVSEQLSGLACAYLVAGGLYWYAIKNNARNQPV"
     gene            <742441..>742824
                     /locus_tag="ZYRO0A09262g"
                     /db_xref="GeneID:8201730"
     mRNA            <742441..>742824
                     /locus_tag="ZYRO0A09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494724.1"
                     /db_xref="GeneID:8201730"
     CDS             742441..742824
                     /locus_tag="ZYRO0A09262g"
                     /note="similar to uniprot|P38633 Saccharomyces cerevisiae
                     YGL127C SOH1 Protein with sequence similarity to RNA
                     polymerases; interacts with a DNA repair protein, Rad5p,
                     in the two-hybrid system; may provide a link between
                     recombination in direct repeats and transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494769.1"
                     /db_xref="GeneID:8201730"
                     /db_xref="GOA:C5DQ75"
                     /db_xref="InterPro:IPR008831"
                     /db_xref="UniProtKB/TrEMBL:C5DQ75"
                     /translation="MSVEADQEPPVAEEVPSLPTRFEVELEFVQSLANIPYVTYLLTQ
                     QQQLWKDPKFKNYLKYLEYWCEPPYALCIVYPNCLFVLKLINGFMENSTVNEDGLLDG
                     LEDLPKVLQMQGPQWMNEMVDRWVS"
     gene            <743360..>745516
                     /locus_tag="ZYRO0A09284g"
                     /db_xref="GeneID:8201731"
     mRNA            <743360..>745516
                     /locus_tag="ZYRO0A09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494725.1"
                     /db_xref="GeneID:8201731"
     CDS             743360..745516
                     /locus_tag="ZYRO0A09284g"
                     /note="similar to uniprot|P32501 Saccharomyces cerevisiae
                     YDR211W GCD6 Catalytic epsilon subunit of the translation
                     initiation factor eIF2B the guanine-nucleotide exchange
                     factor for eIF2 activity subsequently regulated by
                     phosphorylated eIF2 first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494770.1"
                     /db_xref="GeneID:8201731"
                     /db_xref="GOA:C5DQ76"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR003307"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DQ76"
                     /translation="MAGKKIKAHPKEEMVQDDRLQAIVLTDSFETRFMPLSNDKPRCL
                     LPLANVPLLEYTLEFLAKAPVKEVYLVCSAHATLISDYIEASKWSFPWSPFKVFTIMS
                     PEARSVGDAMRDLDNKGVIAGDFVLMSGDAVTNLDFDKFWDFHKRMHAKDKDHIVTTC
                     LSKATQFHRTRAFEPASFILDKSDNRCLYYQEIPLPSSRVKTSVEIDPDLLEGVDEFV
                     LRNDLIDCRIDICSPLVPAIFQENFDYQMLRSDFIKGVLSSDLLRKHVYAYITEEYAA
                     RVESWQSYDSISQDFIGRWCYPLVLDSNLMPDQTYSYESNHIYKEQGVVLAQSCKIGK
                     CTAIGSRTKIGESALVENCVIGRNCYIGSGAVIRDSHIWDNTVIGNNSVINHSIVASG
                     TKLGTNVVLNDGCIIGFNVVIEDGKELPRGVRVNGTPVKDSEDNAFGLSDEEDEEETP
                     EKDNPEIAFELCGTKGRGYIYEDPLSEDEHDLPIGEEMVSGLSHRLDEVYLSDSSISS
                     VTKSKKKRTMSTNSAYTDREEDPTEFEDEEDFGVEGVATVKRAIENNHDLDTALLELN
                     TLRMSLNVSYHEVRTVTVVALLDRVYHFIATQTLGPKDAANKVFTRWGPMFRREAFDP
                     DEYVDLMNIVMEQVVEQELEKGDLILFSAFNALYDSDILEEEIIYDWWSHVSKDPKFD
                     DIKKLVAKWIEWLKEADEESSGEEEEEEESEEEEEN"
     gene            <745829..>746404
                     /locus_tag="ZYRO0A09306g"
                     /db_xref="GeneID:8201732"
     mRNA            <745829..>746404
                     /locus_tag="ZYRO0A09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494726.1"
                     /db_xref="GeneID:8201732"
     CDS             745829..746404
                     /locus_tag="ZYRO0A09306g"
                     /note="highly similar to uniprot|P19073 Saccharomyces
                     cerevisiae YLR229C CDC42 Small rho-like GTPase essential
                     for establishment and maintenance of cell polarity mutants
                     have defects in the organization of actin and septins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494771.1"
                     /db_xref="GeneID:8201732"
                     /db_xref="GOA:C5DQ77"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQ77"
                     /translation="MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTV
                     MIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVH
                     HHCPGVPCLIVGTQVDLRDDKVIIEKLQRQRLRPISQAEGERLSRELRAVKYVECSAL
                     TQRGLKNVFDEAIVAALEPPVIKKSKKCTIL"
     gene            <747277..>748956
                     /locus_tag="ZYRO0A09328g"
                     /db_xref="GeneID:8201666"
     mRNA            <747277..>748956
                     /locus_tag="ZYRO0A09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494727.1"
                     /db_xref="GeneID:8201666"
     CDS             747277..748956
                     /locus_tag="ZYRO0A09328g"
                     /note="highly similar to uniprot|P12612 Saccharomyces
                     cerevisiae YDR212W TCP1 tailless complex polypeptide 1
                     chaperonin subunit alpha"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494772.1"
                     /db_xref="GeneID:8201666"
                     /db_xref="GOA:C5DQ78"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DQ78"
                     /translation="MSQVYNNSHSDTLFLGGEKISGDDIRNQNVLAAAAVANVVKSSL
                     GPVGLDKMLVDDIGDFTVTNDGATILSLLDVQHPAGKILVELAQQQDREIGDGTTSVV
                     IVAAELLRRANELVKNKIHPTTIITGFRLALREAIRFINEVLSISVDTLGKSTLVNIA
                     KTSMSSKIIGSESEFFSNLVVDALLAVKTQNSKNEVKYPVKAVNILKAHGKSAKESVL
                     VHGYALNCTVASQACPKRIGGGNVKIACLDINLQKARMAMGVQINIDDPEQLEQIRKR
                     EAGIILERVKKIIDSGAQVVLTTKGIDDLCLKEFVEAKIMAVRRCKKEDLRRIARATG
                     ATLISSMSNLEGDETFESSSLGTCQEVVQSKFSDDECILIKGTSKHSSSSIVLRGPND
                     YSLDEMERSIHDSLSVVKRTLESGNVVPGGGCVETALNIYLDNFATTVGSREQLAIAE
                     FAQALTVIPKTLAVNAAKDSSELIAKLRAYHAASQMAKLDDHKRRNYKNYGLDLIKGK
                     IVDEVSSGVLEPTISKVKSLKSALEACVAILRIDTMIAVDPEPPKEDPHGH"
     gene            <749695..>752076
                     /locus_tag="ZYRO0A09350g"
                     /db_xref="GeneID:8201667"
     mRNA            <749695..>752076
                     /locus_tag="ZYRO0A09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494728.1"
                     /db_xref="GeneID:8201667"
     CDS             749695..752076
                     /locus_tag="ZYRO0A09350g"
                     /note="similar to gnl|GLV|KLLA0A04169g Kluyveromyces
                     lactis KLLA0A04169g and some similarites with YDR213W
                     uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
                     involved in sterol uptake zinc finger transcription factor
                     of the Zn(2)-Cys(6) binuclear cluster domain type"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494773.1"
                     /db_xref="GeneID:8201667"
                     /db_xref="GOA:C5DQ79"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DQ79"
                     /translation="MIKDKMDRKSVLKKREKVVELIEIDGKKVSITSTGKRKFHNKSK
                     NGCDNCKRRRVKCDEGKPLCRKCVNMKLDCVYTPAQPKKRRESTVVKYVTRRAASGQE
                     ERVPASELADHSSDDSSCDSSRSASRAPNPTPEEITQTDLQERRIFEGMPAKAPPTST
                     PQQLPQPQQLPQVPQQLLQRQQTHKNIGSPDKTFSTTNGSRGMLDGLLLPPLGSESSH
                     LNQQQQQQQLQQQLLLLPQLMTLSNSEKYAAFEMPNSPPLQPAGMNITNSIGSIFSPN
                     RFQQQQQQQQQQQQQQQQQQQQQQPPAQPPTLPSFQAESIAQLNKASINLKAMGMFPT
                     AGIGGVTYDFQELLGIKYPGNSQASKASNAEEALANMQEQQEQATKGDGDGNGNEETT
                     ANNDNEHSAVHMLATPSLPNNPTISPAAPITPMTKTSINAAAATSSPSVTAVPGTTAT
                     LAGAGRTDQHPAQEQVSSRNDSSDGYVANLLQLSREGNLNLIDLKLFHHYCTKVWPSI
                     TAAGISGREVWSTEIPELAFEHPFLMHSLLAFSATHLSRTESGLEPYVSCHRLDALRL
                     LRQAVLQISEDNTDALVASALILIMDSLANASNQGTTNPSSMSPSAWIFHVKGAATIL
                     TAVWPLTERSRFYNLISVDLSDLGDVINQESATISELVCFDESIADLYPVEIDSPYLI
                     TLAYLDKLQREKNQSDFILRVFAFPALLDKTFLALLMTGDAGAMRIMRSYYKLLRGFT
                     TEMKDKIWFLEGVSQVLPQDVDEYSGGGGMHMMLDFLGGGLPSMTTTNLSEFM"
     gene            <752252..>753262
                     /locus_tag="ZYRO0A09372g"
                     /db_xref="GeneID:8201668"
     mRNA            <752252..>753262
                     /locus_tag="ZYRO0A09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494729.1"
                     /db_xref="GeneID:8201668"
     CDS             752252..753262
                     /locus_tag="ZYRO0A09372g"
                     /note="similar to uniprot|Q7LIE3 Saccharomyces cerevisiae
                     YDR214W AHA1 Activator of Heat Shock Protein 90 ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494774.1"
                     /db_xref="GeneID:8201668"
                     /db_xref="GOA:C5DQ80"
                     /db_xref="InterPro:IPR013538"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:C5DQ80"
                     /translation="MVVHNPNNWHWVDKNCIGWAREYFGEKLTKLNTGDVNGKFAEIA
                     SVSSVEGDCEVNQRKGKAISLFDLKVVLLIKGHVEDLPFDGSINVPEVAFDSEESDYQ
                     FEISIYKETTKLNEVKPVIREKLLPQLRTVFQNFGKDLLAVHASDIQVPESQVKSKFT
                     RANASTTSSSSATPASTPKPAPTTATKSSAPTTSGANRSSLHLEPTFNVPAIELYRTF
                     LYKPLIMAWSRGSLQSATPGDQLKTGDQFDLFGGNVTSKLLECKEPTRLVFEWRLKEW
                     SEKVVSKLVMEFHESQEYHETKLQVSWSGIPVGEEDRVRGNFEEYYVRSIKLTFGFGA
                     VL"
     gene            complement(<753381..>755078)
                     /locus_tag="ZYRO0A09394g"
                     /db_xref="GeneID:8201669"
     mRNA            complement(<753381..>755078)
                     /locus_tag="ZYRO0A09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494730.1"
                     /db_xref="GeneID:8201669"
     CDS             complement(753381..755078)
                     /locus_tag="ZYRO0A09394g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494775.1"
                     /db_xref="GeneID:8201669"
                     /db_xref="InterPro:IPR006353"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DQ81"
                     /translation="MADKLSQKLNKMSQSSSKKAGVSAAKETGPSGMGSPVSFPVEDE
                     EPKSKVGEQQQPQPRRKSFLENNNPQEFQPMPRKKRVSSLSLSDQWSAVTPLHPEGSS
                     SKVSRHGSVTSGGHKGSRSRKSSIPVRHRKSVVNHERVASYAFAFDIDGVLVKGPETI
                     PQGPEALRMLNGHNKYNIKVPYIFITNGGGRSEKARCRDLSKRLGITVTEDQVIQGHT
                     PMKDLVDVYENVLVVGGVLDSCRKVAEGYGFKNVYIPLDVMKWKPSVTPYYVLNEEER
                     NIAKDVDFSKINIQAILVFADSRNWAADQQIILELLMSEKGVMGTISPTYDQGPGLYF
                     AHSDFVWATDYGLCRYGMGALQVSIAALYEEHTGKELQVTRFGKPQRGTFRFAEKVLS
                     NWRRETLSEHVENLKLEDPDEGENKETPFGDSDSEEDEADWGNDSGERPGDLVLELPP
                     ASTVYFVGDTPESDIRFANSHDSTWYSILVKTGVYKDGVTPRYTPKKTCENVLEAVNF
                     AIEREHAKELKEWNESCAEETVIHQEGNKKPVKEEDDEGEAPLTTNDLKSIRAETSS"
     gene            <756859..>760899
                     /locus_tag="ZYRO0A09416g"
                     /db_xref="GeneID:8201670"
     mRNA            <756859..>760899
                     /locus_tag="ZYRO0A09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494731.1"
                     /db_xref="GeneID:8201670"
     CDS             756859..760899
                     /locus_tag="ZYRO0A09416g"
                     /note="similar to uniprot|P07248 Saccharomyces cerevisiae
                     YDR216W ADR1 Positive transcriptional regulator controls
                     the expression of ADH2 peroxisomal protein genes and genes
                     required for ethanol glycerol and fatty acid utilization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494776.1"
                     /db_xref="GeneID:8201670"
                     /db_xref="GOA:C5DQ82"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DQ82"
                     /translation="MEMNELIDRSSDEKEITTTIASSATSVTGEDLTLSDQKPISNNN
                     NNNNNNNTENHSMNSRVNKQFNRLPENLRLNGRTPSGKPRLFVCQVCTRAFARQEHLT
                     RHERSHTKEKPYCCGICNRKFSRRDLLLRHAHKIHGGNYGDTIIKQNNVKENSNNRVS
                     KGRRSGSVTAANAANAVNTANVAATMTPNLSHPSSLPPIRGRRASYSAQSGNYVAPAQ
                     NEQWHKADRVKFSTPELLPINMMDDDLSNNATKSNNFDGIGDDGNCNGNGFMESIAPL
                     ELNAPWEFNMLDSNDWIYEYNNQNVTTSGSATAAGGPTPGDSPNSSSVDPSNSSIRLG
                     NFPQSSGELRRETIDNSYFENNKSRKLSWAINEEDGRLQVKSLFMNRNNSAPLPRPIR
                     NVTKNIGSPSRSSISGSGALGVRDSLTGSTASATTQTTTATTAATTTTTTTAETEDDW
                     LPMANHTDSVSSSVAPLHTIDGNSNTGALLEQFNRLEFNDNGMGDLSEFTKDVQTIFG
                     HYIQDEQSDVYNIPHQFPLSSSNDENLTDPTMGSTNQTSTSANDNYTFYGLDYLTLSN
                     ISRASPPNNLNSEDLPSSKLFTHELRQICLHSLRYYSNHCNGVLGSDPVFISKDLILP
                     SCSELNGYSSYFQKYFNPHTAFIHPDFFQLDLPSLMNYINEGDTNDEEDSQYLQYSNI
                     ACLPLFVATVGSIYKSGCNSRTMELYEISRRVLHVYLERRKQQQRQQSAGETPMEGVR
                     YENRQRIWLIQSLILSITFALFADYLERMDSGMIKRQVSAICSIIKGNFLKIISIDCH
                     EFFSSYKDLTFDNPCDYVFFESKIRCTLMVYKICQFLKIFYRVGSKLFLNEKDLDPVC
                     IPDDESTWLNSSLLVPSKSTKKKYTVDFQKFYHSFTFNNTGMHSIPECLTTAMLYYEF
                     NEINFSPFHVFLTRIDTKKLELNQTQLSQIDSDPNIVTAHDILNSDSITLRNCLMSMV
                     FLTKIDVTFGSKIWNGKLRELFTSFLDPSSINILTKGSYSLLTDFLVALNFSIKNVSH
                     FLTLNENGTAIELDKTNMSLFNCQGFYCNFLILIKFILDFECTPNFKLLCIFTELKKL
                     ANNLLIPKYSNLYPMEFAKFQDVSLTNTYLQHHPKSDASAKFSTINAHKLEKLINNVL
                     VHAFNDASFLNMSEQPTNEFLFNNNHPTYYPYASPTTTAFNYEEIQFKSPSSPTSNDN
                     DFLPSKSSVDLLRYQNNNSDNNANDNVGGSVNSNNDEGNLSKQGFAERYQLSDKYIVI
                     AKCFFTHIREIYAHCHIFKKMIADFQQLEDCIDEKRRKSNMFKMSREDGSNATMAKNA
                     SSNSTVTMTKNHSSGDLINKFLQTQV"
     gene            complement(<761287..>764670)
                     /locus_tag="ZYRO0A09438g"
                     /db_xref="GeneID:8201671"
     mRNA            complement(<761287..>764670)
                     /locus_tag="ZYRO0A09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494732.1"
                     /db_xref="GeneID:8201671"
     CDS             complement(761287..764670)
                     /locus_tag="ZYRO0A09438g"
                     /note="weakly similar to uniprot|P14737 Saccharomyces
                     cerevisiae YDR217C RAD9 DNA damage-dependent checkpoint
                     protein required for cell-cycle arrest in G1/S intra-S and
                     G2/M transmits checkpoint signal by activating Rad53p and
                     Chk1p hyperphosphorylated by Mec1p and Tel1p potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494777.1"
                     /db_xref="GeneID:8201671"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR013914"
                     /db_xref="UniProtKB/TrEMBL:C5DQ83"
                     /translation="MSNGIIQSNDSVENSMKDPAMQETPIADHLMISNDVPHATDGSR
                     DNTRSIGNGKVFSNDNVNENSGDYYSSPLVDKNRDMDVFSKESKGDEIEHLPQSPLRL
                     NKRTPDLDKIADFFRNNRTPKQKRLLAQFESSVTQDTPVSQRRDHSPLRLKSNKKSSS
                     TEYVRNLHSVDDEPSLEVTEADIQYNLNASREGKTLESQTDYEHTNRLKFFGQGTQSQ
                     EKLQTQGIQEVESFHHDNDTIQRPDNDYHEHTKISSNEKDPDVFMGNKTNDENMCHEE
                     TRVNDTTDGDISVQWVFRSNKNDQENSNKSTQIIPTGETQKDEMNSEFQNTQTSLSQA
                     NETQTQVVASFNAQETPVDHKKNEMESPTQIVRSPERNMDGNTQEIPSEPGRFSGVGA
                     ITEVLGTSPASKSRDIIDVESRSSSPRYSVPSVSRNDSEQERDNQGKVLLQISGKPEL
                     FPNFDIEPGAEENADKNTAIVISENDLTQDLPELEEQGSQEKRKEQESFRRIADGSFE
                     ESQEITKKTWKRSGRTRPTIVQEEEEEEEEEEGEEGELDERCRNHPKKKLRRGDTDHG
                     HQVQVQTPDTSPQIDGEKSALTELRSGNEVPSESWLEKIRDFPQDVRKREEDFLSKKD
                     IKFEDAVWCQYNLNYCFYPGRLISYDEKADGCWVVFETGQSLTKNDDIYYLDIRVGDT
                     VNWHGRVHKVIALERRTQDPIVIRCIRGYDTIHLKKRNVSGKLGKKTSVVPLSSISLD
                     LNEWAKRPKVILEEGSHTRAKAFKFLQHPIRGRKSITSLSPRKARLDSGATGRLTYKE
                     DSDDESNDSVDSVGKNGIIELSSKLESPGLKRKLFNSQDPGIFKDCLFILSGLNEEKY
                     ELSEVIGSLGGRIVDAGFPDLFDFEFLEERDQHIEKYTLNLGWKSNIKSENLRFGCLL
                     STKHLRSLKYLETLALGWPTLHWKFVERCVSDGKLCTKNIHQYLLPSGESFRLNSRSE
                     DQSGIIKSNDIFQFYLLLLQNALLKDQIGHNYHVLSDYVVIIFGHSGLDQFIRFILAC
                     LGVKTTFQISSKIGNFATIQNLNVLTNFTNTILLGQDNSKIIIYINGDNGLPNEILEE
                     IKGRIWGEFVNGGQTSPNFHVESKEWLIQTLINGNSGFD"
     gene            <764869..>766360
                     /locus_tag="ZYRO0A09460g"
                     /db_xref="GeneID:8201672"
     mRNA            join(<764869..764881,764964..>766360)
                     /locus_tag="ZYRO0A09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494733.1"
                     /db_xref="GeneID:8201672"
     CDS             join(764869..764881,764964..766360)
                     /locus_tag="ZYRO0A09460g"
                     /note="weakly similar to uniprot|Q05955 Saccharomyces
                     cerevisiae YLR227C ADY4 Component of the meiotic outer
                     plaque a membrane-organizing center that assembles on the
                     cytoplasmic face of the spindle pole body during meiosis
                     II and triggers the formation of the prospore membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494778.1"
                     /db_xref="GeneID:8201672"
                     /db_xref="UniProtKB/TrEMBL:C5DQ84"
                     /translation="MNYNELCYAGGKFEYHSLLEYLDEEIELIAKEFQTSLKYSEPLY
                     RKVTKLILILCPEEKMRMIFDKSCYTRLQLEGLMNKEMLKYVELDFNVNPKVVAKALV
                     KSTADHPNVFCYKVFLLLANKGILAYLANFDGDYLKGFIDFRWCLQFIYYIKRLDPLE
                     GEIKNFLEDCERMFAILCAKCLMKEIEEKGDKQITSQLEILRLDEGSILQSLLFTVID
                     CTDPSMMTTGNYLDRYILSMFFESLGEIERFIAIFKGSLAEYECMPNVNDLALRVQRE
                     HLNDTIRRYILSMTTKLNGDPAIIRCIHKILECLVLYGGVHMGIIQFFYSLKKYYLGV
                     LSAASELPFDSKLTKECVTLLDKICQEWDNVKTKSNSRLIQSPQILLKSMFGEFVIVD
                     EVFDENRPLEHHHDLSIMLSSMKLKVKHKWLGEAHTFKEYSNSMWKIGMEWVVFWKDC
                     YIDNHEELPLEMIQIFNGI"
     gene            complement(<766396..>767586)
                     /locus_tag="ZYRO0A09482g"
                     /db_xref="GeneID:8201673"
     mRNA            complement(<766396..>767586)
                     /locus_tag="ZYRO0A09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494734.1"
                     /db_xref="GeneID:8201673"
     CDS             complement(766396..767586)
                     /locus_tag="ZYRO0A09482g"
                     /note="similar to uniprot|Q04921 Saccharomyces cerevisiae
                     YDR218C SPR28 Septin-related protein expressed during
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494779.1"
                     /db_xref="GeneID:8201673"
                     /db_xref="GOA:C5DQ85"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQ85"
                     /translation="MPSAADIRRRRNASKEYRLCMLVLGERGIGKKTFLNNLCGKTVF
                     PTEERIKEVPEPSQAHASPDIQLTTELVQLDDARSTPIDIVLFPGCGDCMDNTSTPGK
                     IKEYLDAQFDIVLNEELRIKRSRVDTDSRSHVCIYFIRATSRGLREFDVQLMKQLGDR
                     VNIIPVIGKADLLTSEELQHNKKLIMHDIAKHELNVFDFKNDKLQDSLVEADDFLCDG
                     RNEKIPDVNIRDMLPFALICGDKEITEPRGEIAHVRNYQWGQIVVEDGSNSDFIFLKH
                     ILLGSHLQELKDVTNDVFYENYRTKMLLSKKVSVEYSREFMGPEPSQLPASATGSKRR
                     NAFSVSSSVPEQEKDEYMPFSKEMEEKNKIIKAYQQKIEALEKMLKNNPDDAAAKACL
                     EAIM"
     gene            complement(<767874..>769064)
                     /locus_tag="ZYRO0A09504g"
                     /db_xref="GeneID:8201674"
     mRNA            complement(<767874..>769064)
                     /locus_tag="ZYRO0A09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494735.1"
                     /db_xref="GeneID:8201674"
     CDS             complement(767874..769064)
                     /locus_tag="ZYRO0A09504g"
                     /note="similar to uniprot|Q05949 Saccharomyces cerevisiae
                     YLR226W BUR2 Cyclin for the Sgv1p (Bur1p) protein kinase
                     Sgv1p and Bur2p comprise a CDK-cyclin complex involved in
                     transcriptional regulation through its phosphorylation of
                     the carboxy-terminal domain of the largest subunit of RNA
                     polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494780.1"
                     /db_xref="GeneID:8201674"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:C5DQ86"
                     /translation="MSSESDNHQAATPTAPAAPTAPAAPAAQPSRKEYNTRLLWPDMI
                     KTPNNTWTFSCKEIVEKLGTNPQATAELKRNMEKCLIYFYTVKKVLNLFDHTYTASCM
                     LFFRYWYVYGLPPYLPDCIHIAQAILVTACKTMENNRPIDAYIKATCDYFIKETTGLR
                     VRQNLDKLKWDVRDRLVSNEKKILCCFGFDLNLENPKELIEDMFSGFYRFNRDYNLPD
                     DFTQIFPKILQEARNFIVQAVTQPVSLLCDGYTFVALALIYCGLQYKKNVDESFQFPS
                     NFFRDKFPVLVTAQRFGQFFNDYRVLEENFFDLKSNKREKLQISVQEIDELINEDPLP
                     DGEVSDPYDYNLIKSGEVRQELKDHIHKRIRDIYERTVAETKKRMSPENVADLEQSKK
                     KLKT"
     gene            complement(<769311..>770327)
                     /locus_tag="ZYRO0A09526g"
                     /db_xref="GeneID:8201675"
     mRNA            complement(<769311..>770327)
                     /locus_tag="ZYRO0A09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494736.1"
                     /db_xref="GeneID:8201675"
     CDS             complement(769311..770327)
                     /locus_tag="ZYRO0A09526g"
                     /note="weakly similar to uniprot|Q04922 Saccharomyces
                     cerevisiae YDR219C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494781.1"
                     /db_xref="GeneID:8201675"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C5DQ87"
                     /translation="MLQGLPLDVVLRIFSLLNMNDLVQVGKCSHLLRQLANHALLTKN
                     VLISAHSNWIRDSLFFDMSRMDLEFIRHDEDEGHEEQEKEDNDEQLLMDMYAKPIMCN
                     NEETLSYMRILQGVHEEDTKLVETDHVTSPDPNDWDAKLEKALKVLSPACSDYSKSSA
                     NSTFSELPPRLSNSEWSSPINELNTLSDVSVHGISDCESTSSANSLDKLRSSNKVRDK
                     AALFEKLMAEDVNHTTRSQGKSMKRKSYGLLSHFFPDRSFDTRDRNVSQGYIEELARC
                     NGEPAATTAPGELQDTQANDNTLECTEEPLSKKNYRNNSKGIQRNRLKAFVTQGNRIC
                     YEKI"
     gene            <770850..>772805
                     /locus_tag="ZYRO0A09548g"
                     /db_xref="GeneID:8201749"
     mRNA            <770850..>772805
                     /locus_tag="ZYRO0A09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494737.1"
                     /db_xref="GeneID:8201749"
     CDS             770850..772805
                     /locus_tag="ZYRO0A09548g"
                     /note="weakly similar to uniprot|Q04924 Saccharomyces
                     cerevisiae YDR221W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494782.1"
                     /db_xref="GeneID:8201749"
                     /db_xref="GOA:C5DQ88"
                     /db_xref="InterPro:IPR002172"
                     /db_xref="InterPro:IPR009011"
                     /db_xref="InterPro:IPR026874"
                     /db_xref="InterPro:IPR028146"
                     /db_xref="UniProtKB/TrEMBL:C5DQ88"
                     /translation="MVNSQLKYGLLGLYSLFSLVKGSEGVVGVPESRQSIYEPRDDGK
                     WACLGDANVIIEATQINDGICDCPDGSDEPGTGACGMKAPQFYCKNGEFLPRYISQSK
                     VGDGVCDCCDCSDEQLTKGEVFYRGTQCSDLRTSFDKFVQQELENHHHGMQTLLQLKA
                     QSPAPVKTQEGLSEQIRSLSEQLSNNEKILASEKADYAEKLKAENPLLYEFEQLHVDA
                     LANAVNDQLSEIIRVGRAYEDLVRILDALVENYSSHLMDLVVNENVKKYQFYKLKKLS
                     KISCNPGNDNEQREQLLVYFQTELPELFANGLSDKPAKYIQGKATFVDMLILSKAEYT
                     EVIMEAINKLRSILQDVAENYNRNYQDQGVRQAAEAFKHYTEKYATVDIVRLPQDLMD
                     ELDHLKSFVIEKAPELVSSSPSLENQDEAGQTGVMQQVQNWVGGIPNFFKPDMRGQIE
                     KHEQDVRSLRAEMAARRKELTSLVEQESSGADERTKYIKALIDATNLSLEKNLDAYIY
                     GIQYNGQILQKEKSGDQNSVLIGNFKSLRLNEELALLKYKEYVRINYSGDDELVQHLI
                     SETTDEEEDYLFGNLYQLNNGLQLEFENGDQCWDGPRRSATVFVQCSDKQELKKITET
                     SRCRYSVEIESPFGCSEDFIYQPFRAE"
     gene            <773230..>774441
                     /locus_tag="ZYRO0A09570g"
                     /db_xref="GeneID:8201750"
     mRNA            <773230..>774441
                     /locus_tag="ZYRO0A09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494738.1"
                     /db_xref="GeneID:8201750"
     CDS             773230..774441
                     /locus_tag="ZYRO0A09570g"
                     /note="similar to uniprot|Q05948 Saccharomyces cerevisiae
                     YLR225C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494783.1"
                     /db_xref="GeneID:8201750"
                     /db_xref="GOA:C5DQ89"
                     /db_xref="InterPro:IPR013931"
                     /db_xref="UniProtKB/TrEMBL:C5DQ89"
                     /translation="MHWGNKDGVRFVPVREVQSEDDYTIVDNLEQLEWYAKSLHKPSH
                     KSNRVLSAVKKSTETKIETQTVYFTDLKSGRCGFIQLLYSSVIGGIYKGFQLNFKSFR
                     SEESEENEEKESRADVWESFKLEDIKEFSELTVNSSRATFAFKHSLDSSAISKLEIKV
                     DIPVGSNTNGLKIDLVVDLYRGILVNPDGCSYYLDKPLTKDEISKQRDAIFSKKMVRH
                     LFVPRAQCCGNISYLDSKGEKVDLQLDKVPGLYIDAVQGLVPYKAANRWNFLCFQSLT
                     TSLLCMEFTTTEEYNRTTVTIWCSTRNNQIETVGSSINGKNIQFEATTKDDKTGYEYP
                     TQIAFPMGFVEQHLRLVNRYDIMGELPSLVKSLAENIAHIKPYIYQYCQSSTHAGQKG
                     ISIIESTFISS"
     gene            complement(<774455..>775522)
                     /locus_tag="ZYRO0A09592g"
                     /db_xref="GeneID:8201751"
     mRNA            complement(<774455..>775522)
                     /locus_tag="ZYRO0A09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494739.1"
                     /db_xref="GeneID:8201751"
     CDS             complement(774455..775522)
                     /locus_tag="ZYRO0A09592g"
                     /note="weakly similar to uniprot|Q05947 Saccharomyces
                     cerevisiae YLR224W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494784.1"
                     /db_xref="GeneID:8201751"
                     /db_xref="UniProtKB/TrEMBL:C5DQ90"
                     /translation="MELDQFPLEILWKLLLACPLELRLVNRKFYHLHNELYREKTLQI
                     VDTVDEEERFWSELKNPIASYIKSLDFLRKDARMIYRTSKDTQEFIDDSWFIIYSALS
                     CPLKCWNSPALCERDSLDMQKPIYAGECVVPVDCHDGIISTKTGRSIPLNAWFFIDKP
                     IAASKVPGFVTEIRQSQYGAYKKRSTQGNVADFIKERGVYCFNLGDLPDIFLNNQDHK
                     INGHYFCPFEIRLVEVGMAPPTYFENSEITFLGYDFNSYGFGKPWILFKCDRDFEASI
                     FNPFESYLAESLAKFTGAFPFSHIDWPSQTADTGEESIEPYFDPNQRAMRHFVYRFPR
                     AQQDWNKERTVADWRAPHLIQ"
     gene            <775967..>779131
                     /locus_tag="ZYRO0A09614g"
                     /db_xref="GeneID:8201752"
     mRNA            <775967..>779131
                     /locus_tag="ZYRO0A09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494740.1"
                     /db_xref="GeneID:8201752"
     CDS             775967..779131
                     /locus_tag="ZYRO0A09614g"
                     /note="weakly similar to uniprot|P39520 Saccharomyces
                     cerevisiae YLR223C IFH1 Essential protein with a highly
                     acidic N-terminal domain IFH1 exhibits genetic
                     interactions with FHL1 overexpression interferes with
                     silencing at telomeres and HM loci potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494785.1"
                     /db_xref="GeneID:8201752"
                     /db_xref="InterPro:IPR018837"
                     /db_xref="UniProtKB/TrEMBL:C5DQ91"
                     /translation="MTEGSSSRKSPLYSGQVGKKLPGPLAKKYPQNNHLGPVTRPRRF
                     SLLYSSDSSVSEGSDVDEKDADPKKQERRGSDRARSISSNAGGKRSKLIRHSSDIQEE
                     EEEEEDDDDDDDDANDDENDNENGNEISVPEQAVSSDDEEVGDDEESDEDDDDDDDDD
                     DDDNSDSESESNDTSSSEEDIDFVKLQAQRKKRSMKALSALKRDGSNLGEERDSKRLA
                     TESRQPDRKTELEPISPILENEQAVSSTDGSDMDEENVNTEALSFKFRKDDDGIRFGK
                     VDDEDSEEDIGEEVQDADDTSNNNSLEIQPDDNLNQLHVPHFSDSEDSEYNIDQDAYF
                     NAIEDEDDLVGIENGLDPNEDEDGDVLREEENMISALQNDDDISFDGSIRESGSDPET
                     MSVSAAEQNRSVDGDDESDDEDDEMMTVFDMPFFEDPKFASLYYCEDGSEPRLSLSTS
                     LPLLTSDEKMLRKNRREAKKLERKERIQRRKQLKEKRSRVKKSGVKKAKSDYNDEEFM
                     FGVFFNNDQDDSESGFNGGSLELKKKLDFDSPLRRLGSAAASDISSDDEYDNILMDIA
                     NIPSSDDSDDEKITKDKKGHENGEEKIDESVESTSDGLELELGETDDELQDDSSVSNV
                     FIDIDDLDPDSFYFHYSEDDASTSYSEMMTDDTDADKKEKEEDSKEDAVETVTYANDE
                     STDEDDNLPPPSSRSKNIGTKAKEVVSANVVGLKPPKLGTWETDSKPFTIIDGLSTKS
                     LYPLIQEHQHLLEQQQRAQSQSPEYHSPHEVTSANGDELTLNELLNMSELEDEEAPAP
                     SYSQAASDWYQRPAVPLSAFRNKGVNSHEDDEVMLPANSTRKVPIGYIGSERTRRKID
                     KVKELQRKKNEKKRKLKKRKRLLKLKRDRQRAEKENGVQSHEAIGVDEGEASLQLPDS
                     DFIMDRAIEDAQQETEGQRSRKNSVKSVGLAEIHEILGNDNSDLLENNVEFFDAQAEE
                     DAAAMEVTDADILASLTAPVDLNDVGRRPFWRRRQSMVEAAAENLRFTKNGLFSESAL
                     ADIEGFFNNSGVTSNAFEFNESLQ"
     gene            <779501..>781927
                     /locus_tag="ZYRO0A09636g"
                     /db_xref="GeneID:8201753"
     mRNA            <779501..>781927
                     /locus_tag="ZYRO0A09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494741.1"
                     /db_xref="GeneID:8201753"
     CDS             779501..781927
                     /locus_tag="ZYRO0A09636g"
                     /note="highly similar to uniprot|Q05946 Saccharomyces
                     cerevisiae YLR222C UTP13 Nucleolar protein component of
                     the small subunit (SSU) processome containing the U3
                     snoRNA that is involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494786.1"
                     /db_xref="GeneID:8201753"
                     /db_xref="GOA:C5DQ92"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013934"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DQ92"
                     /translation="MDLKSSYSNTALNPIYAGSGAVATVSSDGSILATPVLDEINIIQ
                     LVPERKTLFTIENDDEQDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS
                     PSYVVDSDSTSTLLAIGGTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVW
                     LLASGDTNGMVKIWDLVKRKCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDV
                     INYWQFNLKKKCTLLKTLPVSQQVESCGFANSELIYTAGSDAFLQLISLESGKAVKRT
                     HKPVEELFTVGVLSILGGSKLYMVISDQTLALINLEEALESESALIEVESYIAGNHGT
                     IADMNFVGPELDKLALATNSPTLRIIPVSMEGGLPIDVELYEGHKDLLNAVDATEDGL
                     WLATASKDSTAILWWYQSNSNKFVPYAKFEGHSSAVTAVGLPNIMHKGWPEFILTASN
                     DLTVKKWAVPKPVASNESFELQVVKVSEYTRRAHEKDINALSVAPNDSTFATASYDKT
                     CKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATCSGDKTIKIWSLDTFAVVKTFE
                     GHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALCVAEDGD
                     LIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQNYLSQGDWTNAFLLAITL
                     DHPLRLFRVLKQSLGSMDDDERKDSKVIFNRELDQTISNLSNEKLLLLMKRCRDWNTN
                     SRTHSIAQRTVRCILLQHNIAELSEIPGMVQIVDAILPYSKRHYARVESLVEQSYILD
                     YALVEMDKFF"
     gene            <782112..>782699
                     /locus_tag="ZYRO0A09658g"
                     /db_xref="GeneID:8201754"
     mRNA            <782112..>782699
                     /locus_tag="ZYRO0A09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494742.1"
                     /db_xref="GeneID:8201754"
     CDS             782112..782699
                     /locus_tag="ZYRO0A09658g"
                     /note="some similarities with uniprot|Q05942 Saccharomyces
                     cerevisiae YLR221C RSA3 Protein with a likely role in
                     ribosomal maturation required for accumulation of
                     wild-type levels of large (60S) ribosomal subunits binds
                     to the helicase Dbp6p in pre-60S ribosomal particles in
                     the nucleolus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494787.1"
                     /db_xref="GeneID:8201754"
                     /db_xref="InterPro:IPR028217"
                     /db_xref="UniProtKB/TrEMBL:C5DQ93"
                     /translation="MVESDIRAADNVAKKSRRRKKRRTTEVSDSSDSSDSSSEEETKA
                     SDTGAGEALQAAYQLSEDEDEKMPDASAKPERETLSRNTKESLNNIPFTRTELNGKST
                     RNNDDVSMDLQRVNEAINDAKQKIRESKEESQSTSQLKNSYLELLFENYGDDINSLRD
                     APDFTSNSLIMIAQVLKDGSSMFDVETLKTMLETK"
     gene            complement(<783059..>784027)
                     /locus_tag="ZYRO0A09680g"
                     /db_xref="GeneID:8201755"
     mRNA            complement(<783059..>784027)
                     /locus_tag="ZYRO0A09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494743.1"
                     /db_xref="GeneID:8201755"
     CDS             complement(783059..784027)
                     /locus_tag="ZYRO0A09680g"
                     /note="highly similar to uniprot|Q74ZL6 Ashbya gossypii
                     AGR182C AGR182Cp and similar to YLR220W uniprot|P47818
                     Saccharomyces cerevisiae YLR220W CCC1 Functions in the
                     homeostasis of both calcium and manganese ions Possible
                     transmembrane Ca2 transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494788.1"
                     /db_xref="GeneID:8201755"
                     /db_xref="InterPro:IPR008217"
                     /db_xref="UniProtKB/TrEMBL:C5DQ94"
                     /translation="MSIVAIKNAVSDYVSSKKDSGKTAPLLTNDNGSHTSHNAYGSTN
                     GDLENGNGTSSQGNNNGKHNSSGSDRDADTLGGSSDNNNRNGNSNGGLFNNVDPRVIS
                     DLVIGLSDGLTVPFALTAGLSSLGDSKLVITGGFAELISGAISMGLGGYLGAKSEGDY
                     YHAEVKQEKSAFYDNPTMINHEIEDILLDINPNFSDDTILSFIKDLQRTPELMVDFII
                     RYGRGLEEPAENRQLISAVTIGGGYLMGGLVPLLPYFFVQQVGTGLIWSIIVMGITLF
                     WFGYIKTQVSMSDACTLGKKISEGLQMVVVGGVAAGAAFLLVKTLG"
     gene            complement(<784576..>784974)
                     /locus_tag="ZYRO0A09702g"
                     /db_xref="GeneID:8201756"
     mRNA            complement(<784576..>784974)
                     /locus_tag="ZYRO0A09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494744.1"
                     /db_xref="GeneID:8201756"
     CDS             complement(784576..784974)
                     /locus_tag="ZYRO0A09702g"
                     /note="similar to uniprot|P02293 Saccharomyces cerevisiae
                     YDR224C HTB1 One of two nearly identical (see HTB2)
                     histone H2B subtypes required for chromatin assembly and
                     chromosome function Rad6p-Bre1p-Lge1p mediated
                     ubiquitination regulates transcriptional activation
                     meiotic DSB formation and H3 methylation and similar to
                     YBL002W uniprot|P02294 Saccharomyces cerevisiae YBL002W
                     HTB2 One of two nearly identical (see HTB2) histone H2B
                     subtypes required for chromatin assembly and chromosome
                     function; Rad6p-Bre1p-Lge1p mediated ubiquitination
                     regulates transcriptional activation, meiotic DSB
                     formation and H3 methylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494789.1"
                     /db_xref="GeneID:8201756"
                     /db_xref="GOA:C5DQ95"
                     /db_xref="InterPro:IPR000558"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DQ95"
                     /translation="MSAKAEKKPASKAPAEKKPAAKKTASSVEGKGKKNKARKETYSS
                     YIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNRKSTISAREIQTA
                     VRLILPGELAKHAVSEGTRAVTKYSSSTQA"
     gene            <785434..>785832
                     /locus_tag="ZYRO0A09724g"
                     /db_xref="GeneID:8201757"
     mRNA            <785434..>785832
                     /locus_tag="ZYRO0A09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494745.1"
                     /db_xref="GeneID:8201757"
     CDS             785434..785832
                     /locus_tag="ZYRO0A09724g"
                     /note="similar to uniprot|P04911 Saccharomyces cerevisiae
                     YDR225W HTA1 One of two nearly identical (see also HTA2)
                     histone H2A subtypes core histone required for chromatin
                     assembly and chromosome function DNA damage-dependent
                     phosphorylation by Mec1p facilitates DNA repair acetylated
                     by Nat4p and similar to YBL003C uniprot|P04912
                     Saccharomyces cerevisiae YBL003C HTA2 One of two nearly
                     identical (see also HTA1) histone H2A subtypes; core
                     histone required for chromatin assembly and chromosome
                     function; DNA damage- dependent phosphorylation by Mec1p
                     facilitates DNA repair; acetylated by Nat4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494790.1"
                     /db_xref="GeneID:8201757"
                     /db_xref="GOA:C5DQ96"
                     /db_xref="InterPro:IPR002119"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DQ96"
                     /translation="MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRKGNYAQR
                     VGSGAPVYMTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKSAKPGKASQEL"
     gene            786274..786346
                     /locus_tag="ZYRO0A09746r"
                     /db_xref="GeneID:8201758"
     tRNA            786274..786346
                     /locus_tag="ZYRO0A09746r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8201758"
     gene            complement(<786558..>789785)
                     /locus_tag="ZYRO0A09768g"
                     /db_xref="GeneID:8201759"
     mRNA            complement(<786558..>789785)
                     /locus_tag="ZYRO0A09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494746.1"
                     /db_xref="GeneID:8201759"
     CDS             complement(786558..789785)
                     /locus_tag="ZYRO0A09768g"
                     /note="some similarities with uniprot|Q05812 Saccharomyces
                     cerevisiae YLR219W MSC3 Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery msc3 mutants are defective in directing
                     meiotic recombination events to homologous chromatids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494791.1"
                     /db_xref="GeneID:8201759"
                     /db_xref="UniProtKB/TrEMBL:C5DQ97"
                     /translation="MGLLTQRKEHKVPDLSRYDYYYQRKDDYNKSPRLSAAAAYAASR
                     SRGNPVLVQQRSQSLTQPRRVVRTRPRTKSRGAVEAREAREAPRADSIMRDANFQDTK
                     GTKSITRRTIRRINGVDYMETVTTTPLEDEDNARHFNEFSEPVDNYADEHPVRRVRRV
                     KKTAPSSPKSVRSTRTQRGPISPPRSPVRYHRPEDYQYEEPAQAESEFAPPAAAPVRR
                     TTSTTRPVRSRSTRSVRKAGSVPQSAVVANAAGERRLTEQEMYARALEIAQRNVYSGS
                     DFSPDVLDSASSQDGQAPSRMGQRSLRRDSGRGKKKFTLFNKDRDAGAAGALPAADAP
                     RASGASSLDNRLGQNVEPTAVSASTASRRNLSDEEMYGQALAMSQNKSQRNVEEPESG
                     TQPLNLGGVEKDVRSPQSNAAASFVTPAQTIDENYEENFEDAKNYDGEWKDARPKGGA
                     YGNYDYPVENGDRYDFEEPEPEAEPEYIEPELEREYVDPERLPKAAPEYEPEYQTEEV
                     YEPVYEKREERAPIKRNVSGYSRRSGVAQDEALQQPKRSGSGYSRRSGIAQDGALQQP
                     RRSVSGYSGRSGLASGLASPIDTTKSGFSNPIASPEEVRAGDLQAAGANNVGASARSP
                     LRSQVGKQQTVQSPIQSPLEDSAARGGFDSEAELGGLGGAAAAGGVEPASRRKSKGFS
                     SGLSRFKTRKSLFGGKPDEQPLPDLPKTDLTQAGAEDSEIGYSPAHKAQQYEGKTSES
                     RPKNKLKSMLNKVVEFGAENSGYQPPRGVKEQQKAEKTGAGFLREGEGSVPYTKHQRG
                     ASLGNGVGAGGVTTDGGLATDGPAAVDSTTAKYGVVDDGTAAHAPAVGSGAATRGPSA
                     RVPSARGPATAGAATTGATTGPTIGTTAGPTTGATTGDVAAGTTAGAAAGGVGKRSGG
                     GSHPWRRNAQPASATDGGVASGKAPAASSAQQPNNHLGTAAPGLEETSESSNYDTEHV
                     VDEGFADGYADGLRDSQYESGYDRAGRAEGTEKANGLGGSAAAADVAGEGGQEGMGYR
                     QGVQDKLNQAKDSSWGQKVIGKTKEEAQGQAKEQKGNLFKKLFKK"
     gene            <791893..>794520
                     /locus_tag="ZYRO0A09790g"
                     /db_xref="GeneID:8201760"
     mRNA            <791893..>794520
                     /locus_tag="ZYRO0A09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494747.1"
                     /db_xref="GeneID:8201760"
     CDS             791893..794520
                     /locus_tag="ZYRO0A09790g"
                     /note="some similarities with uniprot|P11978 Saccharomyces
                     cerevisiae YDR227W SIR4 Silent information regulator that
                     together with SIR2 and SIR3 is involved in assembly of
                     silent chromatin domains at telomeres and the silent
                     mating-type loci potentially phosphorylated by Cdc28p some
                     alleles of SIR4 prolong lifespan"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494792.1"
                     /db_xref="GeneID:8201760"
                     /db_xref="UniProtKB/TrEMBL:C5DQ98"
                     /translation="MSKEDEAAARNIKLVRYTHPSPQNWKGKDGLEKSRSLPVQHKKK
                     SEGRLMDMLKSRSAKFHNLTVNRSLSAGPKDTRNGVKKNKETCFLPVRTPNTVSRPNP
                     ISPSAVQKLNLDTRLIPGNNSSNHGSFTSNVKKMLEEQRPQLNSIQKQQPVPHTSSRS
                     ANTTPKKTDGTFQGERVKSPQLAKSPQQQHLKTNDKKSEHEDGRQVEKEADHKEEQRE
                     EKNKEPLPQTHPSERGNSIRPERRLDENPHRDQFNKIPSQRQDRLEIEAEQAAEQSRP
                     SSTESRFNDETASSSTERTTPQAIEPENRHDSIRSGLLKLFKQVETENLASDSDSNFR
                     IVQLLQGKRSEAGEQEEQEEEEFEVSDFDERDRSLQGSVVAFEGELGPPEDSGTSRLE
                     VVYLSDEEEEKRPRHKVLPPSSGLLRPASPRRSIPAMKDPMAEKRKNDREVAVDALAK
                     LKDKKTFDKDTFTQIIEKGVADHRALEGNPNVSVTNDVCSVNNYETSHAYYYQQFDRR
                     SKLAWLSLHEPTTSTGNEPLKEIWKSELLANFMSCTIFFHPITSSNLTADQQSSLDYQ
                     ISQLKKLLQNKFYIKLSGSLDKRVDIVILYGQNEKVLNELLEKKQNSSFRVWSLQRAL
                     NYLQDVGIDLQEWNIEKDAQDRESILDVPISEDSIQEDIEDSTEEVEREGNKETEREE
                     ENEETKEGEREEHKETGKENAAEREENKETGKENAVEREEEKELEKEEDEELEEKVEE
                     EPQSEKREPNPEKNAPKLSKSPPKRVVKAKSSRKKDAYVQELLQQASGALDKRDAQLK
                     AAHSIILALSRDVMHQEVQITSLTGQLKYSKKELDRQTELAEQYRLCMAEQEVEMAQL
                     RIQLAKKKSKKNRRASPNP"
     gene            <794785..>796419
                     /locus_tag="ZYRO0A09812g"
                     /db_xref="GeneID:8201761"
     mRNA            <794785..>796419
                     /locus_tag="ZYRO0A09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494748.1"
                     /db_xref="GeneID:8201761"
     CDS             794785..796419
                     /locus_tag="ZYRO0A09812g"
                     /note="some similarities with gnl|GLV|DEHA0A12507g
                     Debaryomyces hansenii DEHA0A12507g"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494793.1"
                     /db_xref="GeneID:8201761"
                     /db_xref="UniProtKB/TrEMBL:C5DQ99"
                     /translation="MDGNKRRGSQDFEDDIEPLNKLPKSNGNSNNIHEQNSGSMWIYS
                     NVSMKRNRIVESDNNPFLKSQKYLRRILSPNPQRDNGSSMNDADSGDARNSNKNLAQS
                     PDAAVKPIDESFRDIMNQLTGEIMNYEVKLASLYGKVEEMKTENVKIRNRYTLMCRGV
                     VGSLGGSNDFDQSVDTEEFSSDDETCASDGTEACDEPEMMNDGGKNEEFGVIVPSERF
                     SKLKDELDTLETRILNRFEELQENQKSTNNTSPNDLERLGVNLEDIPLVKNLRTDLRR
                     SLEELKEVRKFTDIRVSNLKSTLTSERKISATARRDFESSKVYVKNAADFVNRANSHI
                     EQYKLVNQTQHNVIESLQRQLANVQEKIKNTQVQSASDQKNVSDEYRLVSEKYQRIFT
                     AYTVLNSISQKQKSDVALLHHLYEEEKRKSVSLIAVVEQQRKLMNPTRYMGPITASEA
                     LTRLSALYDNRCDESAREERTNLARMATIHVMYKNLLDQKDREHQGAIENLVRELNEL
                     KGINTAPQKSDPSGQSRDIFDGDVDRAMANPEQHGV"
     gene            complement(<796638..>798506)
                     /locus_tag="ZYRO0A09834g"
                     /db_xref="GeneID:8201762"
     mRNA            complement(<796638..>798506)
                     /locus_tag="ZYRO0A09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494749.1"
                     /db_xref="GeneID:8201762"
     CDS             complement(796638..798506)
                     /locus_tag="ZYRO0A09834g"
                     /note="similar to uniprot|P39081 Saccharomyces cerevisiae
                     YDR228C PCF11 mRNA 3' end processing factor essential
                     component of cleavage and polyadenylation factor IA (CF
                     IA) involved in pre-mRNA 3' end processing and in
                     transcription termination binds C-terminal domain of
                     largest subunit of RNA pol II (Rpo21p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494794.1"
                     /db_xref="GeneID:8201762"
                     /db_xref="GOA:C5DQA0"
                     /db_xref="InterPro:IPR006569"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR021605"
                     /db_xref="UniProtKB/TrEMBL:C5DQA0"
                     /translation="MDKEAEIVVKDFTSILEELTFNSRPIITTLTKIAEENIPCAQYF
                     VDALEAKLERCPPKQKLCAFYALDSICKNAGSPYTIYFSRNLFSLYRRTYLLVDNTTR
                     TKLINMFKTWMVPNESTGGYSPLFEKTALEKIEQFLIKASALHQKNFQSMLPTPTVPL
                     LMREIDKLTALSTERLRAQPQDEKLNMKLVVLSQLKQELQREKLTAGALKQLQMQLRQ
                     IFAQDQQTLQDRQRHQQQEQFVQQQQQQLQQQQHQQQQQQHQNQNQNQQQNPLYGQSV
                     IPLFGDSSNIGRGVSSLFGGPQSILSPLNFSEFDRQSKKTKLQELYQSLDEEGLVYKP
                     PKESIVTLCSRLGADQNGLGTHQQQTHKPLPPMDFLHGILADCKASFATVHVDILNTP
                     NLQLSQQVISNENPIVNNCLVHLLYRAKPNKCNVCGKRFGNDVEEKRLQAEHLDWHFR
                     IHKRMKGSEGTVISGTGLGGTAAQKNIQSRNWYLHDSQWVNFKDEEIVSTNRTTDESL
                     TLANLDAQSTNAQSSVPVEEIKSPETVAVDESILRKKYVVVPELAEDMSFQCPICKDA
                     VTGLYDEDLGEWVWKNSMEANGKYFHATCYYEAVKNNSGSNVVQLDLEKLKHLVSG"
     gene            <798939..>799844
                     /locus_tag="ZYRO0A09856g"
                     /db_xref="GeneID:8201763"
     mRNA            <798939..>799844
                     /locus_tag="ZYRO0A09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494750.1"
                     /db_xref="GeneID:8201763"
     CDS             798939..799844
                     /locus_tag="ZYRO0A09856g"
                     /note="highly similar to uniprot|P38988 Saccharomyces
                     cerevisiae YDL198C GGC1 Mitochondrial GTP/GDP transporter
                     essential for mitochondrial genome maintenance has a role
                     in mitochondrial iron transport member of the
                     mitochondrial carrier family (putative) mitochondrial
                     carrier protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494795.1"
                     /db_xref="GeneID:8201763"
                     /db_xref="GOA:C5DQA1"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DQA1"
                     /translation="MSTNDKKQTGLARLLGSASAGMLEIGVFHPVDTISKRLMTNHTK
                     ILNTTELNRVIFREHYQVPLSKRVFTLFPGLGYAACYKVLQRVYKYGGQPFVNEFLNK
                     NYKADFDNAFGSKTGKALRSATAGSLIGIGEVFLLPLDVLKIKRQTNPEAFRGRGFLG
                     ILKDEGLFNLYRGWGWTMARNAPGSFALFGGNAFAKEYVLGIKDYSQATFAQNFVSSI
                     CGACASLVVSAPLDVIKTRIQNRSFDNPETGITILKNTLKNEGITAFFKGLTPKLLTT
                     GPKLVFSFALAQSFIPMFDRLLQKN"
     gene            <800187..>802235
                     /locus_tag="ZYRO0A09878g"
                     /db_xref="GeneID:8201764"
     mRNA            <800187..>802235
                     /locus_tag="ZYRO0A09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494751.1"
                     /db_xref="GeneID:8201764"
     CDS             800187..802235
                     /locus_tag="ZYRO0A09878g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494796.1"
                     /db_xref="GeneID:8201764"
                     /db_xref="GOA:C5DQA2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DQA2"
                     /translation="MVQANYNLDEDGGENPFADPNLREDNHQEEEIDDILTPSPTTSH
                     GFGLHTSIPTDEDLTDVMVGDRRSSGSPKAVEYDGETLQQQIIPPGYNEHMMVKDSFL
                     TGRALLYFTSVFVSIGVFLFGYDQGVMSGCLTGKYFKRHFHDPSRAAIGIMVSILEIG
                     ALVSSLVTSRLGEKLGRRRTIKYGSLVFIIGGLFQAFAGGIGYLIAGRLISGVGVGLL
                     STIVPIYQSEISPPHNRGKLACIEFTGNIVGYATSVWIDYACSYFENNAAWRLPLFIQ
                     SVIGFMLFSGSFVIVETPRWLLNHDRDVEGFIVIANLYSDGDLHHAKAKEEFQSIKET
                     VLISRMQGEGKSYVKVFKRYRRRMLIAMSSQMFAQLNGINVISYYAPLVFEKAGWVGR
                     KALLMTGFNGIMYIVSTLPPWILVDKWGRKPMLLTGSILMGFALACISLSMLANIKAT
                     PKLVVVFVVIFNSSFGFSWGPIPWLYPVEIAPLSARSAMASASTATNWLCNWLVGIMT
                     PILEEKISWGLYWIHATSCFASFLAVYKIYPETAGVRLEDMDTIFNDRLPSFGVTKNN
                     RSNSDPNNLEMDMDSLTVNENNADADPFKSPEDEVNFKSNQSMLSRTNATDSLPIETP
                     SMDEVLQFKEQQKSKGLGMVIRSGSRNMWYMINKFIPSKSSDSGTYNTIWNNDLENGS
                     "
     gene            <802417..>802941
                     /locus_tag="ZYRO0A09900g"
                     /db_xref="GeneID:8201765"
     mRNA            <802417..>802941
                     /locus_tag="ZYRO0A09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494752.1"
                     /db_xref="GeneID:8201765"
     CDS             802417..802941
                     /locus_tag="ZYRO0A09900g"
                     /note="similar to uniprot|P26188 Saccharomyces cerevisiae
                     YDL200c, DNA repair methyltransferase
                     (6-O-methylguanine-DNA methylase) involved in protection
                     against DNA alkylation damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494797.1"
                     /db_xref="GeneID:8201765"
                     /db_xref="GOA:C5DQA3"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014048"
                     /db_xref="UniProtKB/TrEMBL:C5DQA3"
                     /translation="MEEKLYYRYLDHPITTVLLVSRGKTGCLVYASLGSNRKELLKIS
                     QSDFRKLSRSTKVSYGLYYDANDSMVNLERSFASYLDGSFTETIPYEYLFGTKFQHKV
                     WDELLKIKTGETTTYRQIAEAIGSPKAYRAVGTAVGANKIAVIVPCHRCKPCDGSLGN
                     FRWGTQLKNRLLQQ"
     gene            complement(<802951..>803796)
                     /locus_tag="ZYRO0A09922g"
                     /db_xref="GeneID:8201766"
     mRNA            complement(<802951..>803796)
                     /locus_tag="ZYRO0A09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494753.1"
                     /db_xref="GeneID:8201766"
     CDS             complement(802951..803796)
                     /locus_tag="ZYRO0A09922g"
                     /note="highly similar to uniprot|Q12009 Saccharomyces
                     cerevisiae YDL201W TRM8 Subunit of a tRNA
                     methyltransferase complex composed of Trm8p and Trm82p
                     that catalyzes 7-methylguanosine modification of tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494798.1"
                     /db_xref="GeneID:8201766"
                     /db_xref="GOA:C5DQA4"
                     /db_xref="InterPro:IPR003358"
                     /db_xref="InterPro:IPR025763"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DQA4"
                     /translation="MKAKPLSQDPGSKRYAYRVNKEENRKELKHVRIDESEQKIDLPR
                     KRFYRQRAHSNPFSDHQLEYPVSPDEMDWSRLYPEFHDPTTGKMKSQVTIADIGCGFG
                     GLMVDLSPEFPDQLILGMEIRVQVTNYVEDKIIALRNNHAQQKGYQNINVLRGNAMKF
                     LPNFFYKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLREGGVVYTITDVKD
                     LHDWMVKHLEEHPLFQRLSSEWESKDKCVKIMTHATEEGKKVERKKGDKYVACFERLP
                     NPVIE"
     gene            complement(<803998..>804750)
                     /locus_tag="ZYRO0A09944g"
                     /db_xref="GeneID:8201767"
     mRNA            complement(<803998..>804750)
                     /locus_tag="ZYRO0A09944g"
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /transcript_id="XM_002494754.1"
                     /db_xref="GeneID:8201767"
     CDS             complement(803998..804750)
                     /locus_tag="ZYRO0A09944g"
                     /note="similar to uniprot|P36521 Saccharomyces cerevisiae
                     YDL202W MRPL11 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL11"
                     /protein_id="XP_002494799.1"
                     /db_xref="GeneID:8201767"
                     /db_xref="GOA:C5DQA5"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:C5DQA5"
                     /translation="MNFVSRQLWGSSGLGFCSLRICSQTIVSRSFASYASRAAPAAFK
                     TSKSPQDGRDIVKPVTSRKTFLIDSYKQLMGSNPVILFVHYNNLMKNEDHHYRSQIKK
                     AGGSLTVLRNNLFSVYLRNSAFPDPCAPIKRRDQNLSHPLLPLFKGPTAAICFPETDP
                     QSVAKVLKLLEKSQDRLFVVGAKVETAVYDINQLSHFKNLPDKQGLQSQLLGLLHILS
                     GAGLVKTLEAGSQTLYLTLQSHHDNNEKDGQE"
     gene            <804999..>806114
                     /locus_tag="ZYRO0A09966g"
                     /db_xref="GeneID:8201768"
     mRNA            <804999..>806114
                     /locus_tag="ZYRO0A09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494755.1"
                     /db_xref="GeneID:8201768"
     CDS             804999..806114
                     /locus_tag="ZYRO0A09966g"
                     /note="similar to uniprot|Q04934 Saccharomyces cerevisiae
                     YDR229W IVY1 Phospholipid-binding protein that interacts
                     with both Ypt7p and Vps33p may partially counteract the
                     action of Vps33p and vice versa localizes to the rim of
                     the vacuole as cells approach stationary phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494800.1"
                     /db_xref="GeneID:8201768"
                     /db_xref="UniProtKB/TrEMBL:C5DQA6"
                     /translation="MDRPDSGSVSPGRYAPHLSEFYSIVNNTSPSSSDGMVDGERRGS
                     HSMAAPSMTSNFSSISDLRTLVTKRDIKNTVDALQGLLDSSRAYNSSLQEVSRNASLM
                     GHSLENLARLKGCSDDSAEKLLSASGLFYLLANHENIMSQCLKGVLGESLLDKIDQFK
                     VESKKMENEFKSHAREESLKLKIQERHNLKLAQRRTRNLVSYKESLVNLQSQLDQLES
                     LRHDYYQDSYNLVESTCAKVLDAVATVSRARVEISENVARKGWSGGGLDDLLMDAEDP
                     FNKEDSTINEGQSEGEETIEDDNLKKGVASPQFSTAQPHNEMESEAEHDHSHENEDRD
                     DDEDDGNVDPDADNSFSLPLAGSSRSREPPIENDDES"
     gene            complement(<806161..>806757)
                     /locus_tag="ZYRO0A09988g"
                     /db_xref="GeneID:8201838"
     mRNA            complement(<806161..>806757)
                     /locus_tag="ZYRO0A09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494756.1"
                     /db_xref="GeneID:8201838"
     CDS             complement(806161..806757)
                     /locus_tag="ZYRO0A09988g"
                     /note="similar to uniprot|Q04935 Saccharomyces cerevisiae
                     YDR231C COX20 Mitochondrial inner membrane protein
                     required for proteolytic processing of Cox2p and its
                     assembly into cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494801.1"
                     /db_xref="GeneID:8201838"
                     /db_xref="GOA:C5DQA7"
                     /db_xref="InterPro:IPR016529"
                     /db_xref="InterPro:IPR022533"
                     /db_xref="UniProtKB/TrEMBL:C5DQA7"
                     /translation="MGWWPWKSKKDESASEPVTDLPSASPSEPAPSSYSRGQKILLED
                     TSPKFNNEMSQSQLANSKEQINFKQAWGTVSWRDFSVAKLTSIPCFRDSGLIGFTSMF
                     VMGGVTFLYHKNPSRAFNWSIGGLLLGSVVGWEQCRMRRKRSFQIAQMAKQTMANKER
                     PMRRNVDHDERIKGQWDNRHETASEQHDERKKPWYKFW"
     gene            <807115..>808851
                     /locus_tag="ZYRO0A10010g"
                     /db_xref="GeneID:8201839"
     mRNA            <807115..>808851
                     /locus_tag="ZYRO0A10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494757.1"
                     /db_xref="GeneID:8201839"
     CDS             807115..808851
                     /locus_tag="ZYRO0A10010g"
                     /note="similar to uniprot|Q07622 Saccharomyces cerevisiae
                     YDL203C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494802.1"
                     /db_xref="GeneID:8201839"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DQA8"
                     /translation="MYRDKYRQNPSYDEPFNLFPPHSVNSSREAVAPYPIEDANEVIN
                     PIPVFTSSTTNSHSTTPTRRNHDRYEMPFQYAEPGLDPLMTSSHVRVPPSLSTPTDSS
                     FPREVHVGTPLNEAMVPPPPYEESEARILQEKAYRVESPPQEIQEPLPAAPQAQAQRQ
                     AQRQAQPQAQPQPRSKDRHKGVERERDLSEYSPKAIEFYKVYKATVEDSTNFTHSIQM
                     KWCETLLEYAFDDEFLSHYNINAEKLKRTLRPEESLKNQKVILGHSFRVLTKLVSHKC
                     GSAMYLMGTLYSHQPYLQIKNKNIVDRNDKKALEYYCRAAKTNHSDACYRAGVCFEYQ
                     RGTPAEEFTKERALQKAFQYYERGAVHCANSSCMYKLGMFYLYGLSGQQDPLEALQWF
                     KRASEGGKSTQALYELGKIYEFTSLPPQVQSILTRYNINRDPATALKYFHKCAMEYDY
                     PLAQWKLGYCYEFGELQLPVIAKKSIAWYAKAALAQPKGNPMAMLALSGWYLTGAPDV
                     LKPNDKEAFKWASRACEASDGKLSRAEYALACYHENGIGCHRNLTEARIHFETATRLG
                     HIKARDRLEKGF"
     gene            <809241..>810914
                     /locus_tag="ZYRO0A10032g"
                     /db_xref="GeneID:8201840"
     mRNA            <809241..>810914
                     /locus_tag="ZYRO0A10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494758.1"
                     /db_xref="GeneID:8201840"
     CDS             809241..810914
                     /locus_tag="ZYRO0A10032g"
                     /note="highly similar to gnl|GLV|KLLA0C15059g
                     Kluyveromyces lactis KLLA0C15059g and similar to YDR232W
                     uniprot|P09950 Saccharomyces cerevisiae YDR232W HEM1 5-
                     aminolevulinate synthase catalyzes the first step in the
                     heme biosynthetic pathway an N-terminal signal sequence is
                     required for localization to the mitochondrial matrix
                     expression is regulated by Hap2p-Hap3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494803.1"
                     /db_xref="GeneID:8201840"
                     /db_xref="GOA:C5DQA9"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR010961"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DQA9"
                     /translation="MESIARQSVKMCPFMQRAGSAKGLKALHNSNLPAAARQCPIVGH
                     AMKRTYATATGAPREASASNAKAARNANEVVANHATQESTFDYNGLFESEIDKKRVDK
                     SYRFFNNINRLAKEFPKAHRDVEEDKVTVWCSNDYLALSKNQQVVDAMKKTLDRYGAG
                     AGGTRNIAGHNRHALRLEAEIAALHKKEGALVFSSCYVANDAVLSLLGQKVKDLVIFS
                     DELNHASMIMGMKHAQTTKHIFRHNNYAHLEELLQMYPKSTPKLIAFESVYSMAGSVA
                     DIDKICSLAEKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEPHRVTGVESVPGNSTVM
                     DRVDMITGTLGKSFGTVGGYVAASQRLVDWLRSYAPGFIFTTSLPPSVMAGATEAIRY
                     QRSHLELRQLQQLHTGYVKQGMKELGIPVIPNPSHIVPVLVGNPDLAKQASDMLMDKH
                     KIYVQAINFPTVSRGTERLRITPTPGHTDDLSEILLNAVDDVFKELQLPRVRDWESQG
                     GILGVGEPGFVEQSNLWTEEQLSLTNDHLNPNVLDPILDHLEVSSGIKV"
     gene            complement(<811216..>812541)
                     /locus_tag="ZYRO0A10054g"
                     /db_xref="GeneID:8201841"
     mRNA            complement(<811216..>812541)
                     /locus_tag="ZYRO0A10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494759.1"
                     /db_xref="GeneID:8201841"
     CDS             complement(811216..812541)
                     /locus_tag="ZYRO0A10054g"
                     /note="some similarities with uniprot|Q04947 Saccharomyces
                     cerevisiae YDR233C RTN1 reticulon gene member of the RTNLA
                     (reticulon-like A) subfamily"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494804.1"
                     /db_xref="GeneID:8201841"
                     /db_xref="GOA:C5DQB0"
                     /db_xref="InterPro:IPR003388"
                     /db_xref="UniProtKB/TrEMBL:C5DQB0"
                     /translation="MSSYPKGVRAQPPQAPSDYASTGATTGGAAPSVPVKDPTTDLLL
                     WKNPIETGKYFGLSLLTLLILKKVNLITFFLRVLYTVIFTTGGIEFVSKVVLGQGLVS
                     KYSLKECPNVVGCLRPRIEELLRHLPTYQAKLRTLVFADEPKQNMKAGLVLYFLHKFF
                     SWFSVWTIVFLGVISAFTLPLVYHTHQEEIDAAVNHALKIARAKSAEFSKIASEKSRP
                     YLEKLDCKLGPVSKFVKTQYANYNRASAAPKTTSSAAPQATTAGLAAKVPFEHSAAPT
                     GSEEQGAYVSGHAPSATTAASRGVPSSRSAAAGAAGTAGAATHEAHPSEAFSQKQTSS
                     PLQATAQTFSSHIPTETPTAGSTGISHHHLSDLNDEYNSHFGHDFSVHDVEDAANKAS
                     DKTGHKFPQVPSSNPLSSEANHDFSVDQLQNELRQNKDSLTQELNFNKH"
     gene            <814329..>816422
                     /locus_tag="ZYRO0A10076g"
                     /db_xref="GeneID:8201842"
     mRNA            <814329..>816422
                     /locus_tag="ZYRO0A10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494760.1"
                     /db_xref="GeneID:8201842"
     CDS             814329..816422
                     /locus_tag="ZYRO0A10076g"
                     /note="similar to uniprot|P49367 Saccharomyces cerevisiae
                     YDR234W LYS4 Homoaconitase catalyzes the conversion of
                     homocitrate to homoisocitrate which is a step in the
                     lysine biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494805.1"
                     /db_xref="GeneID:8201842"
                     /db_xref="GOA:C5DQB1"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004418"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:C5DQB1"
                     /translation="MLRFSRLFHTTPRRNAQNLTEKIVQKYAVGIPSGKEVRMGDYVS
                     IQPEHCMSHDNSWPVALKFMGLGAKKIHNPRQIVNTLDHDIQNQDAKNLTKYKNIENF
                     AKSQGVDFYPAGRGIGHQIMVEEGYAFPLTLAVASDSHSNTYGGVGALGTPLVRTDAA
                     AVWATGQTWWQIPPVARVELRGSLPHGISGKDVIVALCGVFNNDEVLNHAIEFAGDIS
                     ALSVEHRLTIANMTTEWGALSGLFPVDKTLLQWYKEKRLPKMPNDHPRINSTRLGLLE
                     RQLAQNDAALRPDNDAQYAKKLVLDLNSLTHYVSGPNSVKVSAPVQDLADVKVNKAYL
                     VSCTNSRLADLEDAAAVVCPTGDLNDIRKVAPGVSFYVAAASSEVEADAKATGAWDKL
                     LRAGCTVLPPGCGPCIGLGTGLLEPGEVGISATNRNFKGRMGSREALAYLASPAVVAA
                     SAVTGHIASPAEVIGQPDAKFSGIKASTDTQSEEAPAAEAADSNASAATESGTEILEG
                     FPSKISGELVFCDADNVNTDGIYPGKYTYQDDVPRETMAKVCMENYDSAFGDIAKPGD
                     ILVSGYNFGTGSSREQAATALLAKGIPLVVSGSFGNIFFRNSINNALLTLEIPELISL
                     LREKYSSEAAKPTRRTNIFLTWDVAHKKVVVTEGSPEGPVILEQQVGELGKNLQEIIV
                     SGGLEGWVMRKLGTQ"
     gene            <816642..>817625
                     /locus_tag="ZYRO0A10098g"
                     /db_xref="GeneID:8201843"
     mRNA            <816642..>817625
                     /locus_tag="ZYRO0A10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494761.1"
                     /db_xref="GeneID:8201843"
     CDS             816642..817625
                     /locus_tag="ZYRO0A10098g"
                     /note="similar to uniprot|P28789 Saccharomyces cerevisiae
                     YDL205C HEM3 Phorphobilinogen deaminase catalyzes the
                     conversion of 4-porphobilinogen to hydroxymethylbilane the
                     third step in the heme biosynthetic pathway localizes to
                     both the cytoplasm and nucleus expression is regulated by
                     Hap2p-Hap3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494806.1"
                     /db_xref="GeneID:8201843"
                     /db_xref="GOA:C5DQB2"
                     /db_xref="InterPro:IPR000860"
                     /db_xref="InterPro:IPR022417"
                     /db_xref="InterPro:IPR022418"
                     /db_xref="InterPro:IPR022419"
                     /db_xref="UniProtKB/TrEMBL:C5DQB2"
                     /translation="MSRRIRIGGRQSQLAIVQSELVKHLIEQKFPDITCSVFALQTLG
                     DQQQSKPLYSFGGKALWTKELEDLLYDEDDNRKLDIIVHSLKDMPTTLPDGFELGGIT
                     ERVDPSDCLVMPQGSPHKNLDTLPAGSVVGTSSVRRSAQLKRKYPHLRFESIRGNLHT
                     RIRKLDDPQNDYQCIILASAGMKRLGLGYRITNTFDSSVMYHAVGQGALGIEIRAQDK
                     EMKKILDAVCHKNTTVCCLAERQLMRSLEGGCSVPIGVGSRYDETTGYLHLRGIVVSV
                     DGKQAVELNQELAINDVIRDSIECGKLLAEKMISNGARKILEEINLDKIDQ"
     gene            <817803..>819386
                     /locus_tag="ZYRO0A10120g"
                     /db_xref="GeneID:8201844"
     mRNA            <817803..>819386
                     /locus_tag="ZYRO0A10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494762.1"
                     /db_xref="GeneID:8201844"
     CDS             817803..819386
                     /locus_tag="ZYRO0A10120g"
                     /note="similar to uniprot|Q03776 Saccharomyces cerevisiae
                     YDR235W PRP42 U1 snRNP protein involved in splicing
                     required for U1 snRNP biogenesis contains multiple
                     tetriatricopeptide repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494807.1"
                     /db_xref="GeneID:8201844"
                     /db_xref="UniProtKB/TrEMBL:C5DQB3"
                     /translation="MDRFSRVVSDPAFSELTLEVARFPKSLEGWERLLNHLTTVASPL
                     NKNIDTRLYQLLISTYQSFLCQFPYLENYYVDYALLEYRLGHLNKMHRIFQHGLAVFN
                     NKSLLLWTSYLKICNEVVPKSKQLLEKYELAEDHIGMHFFAGEFWQMYLEQVKLRSNQ
                     QQRFFSILRKTLEIPLYSFSHFYAVWLRCVDDIQDLSQLKKLAPKEDLIKKLKIDIDT
                     GGRKGPRLQEAKKLLRKFTRELYLVIQYQVLEIYSLYESKIQTRYYVSPETLIPTHEL
                     ELWQKYLEYTVNLKIDDLTHLNFQRALLPLAHYDIVWIQYARWLVDWKEDLLTAKQVL
                     TKGISLSLKKSKLLKFLYTILCSLNEFDQLQWIIDHVETAYSNHIEETDDFELFWDYV
                     HFQLFIKPQSGDVLDIISRRLDHCQAREGQFLLLSALLQLQKMDNTSSIEDRIFQHLI
                     KNNWDYYLKDGRFWSLYSRLIYLDPNRSYLERRRCISNQVWTKARERPTKSEILPHLQ
                     QFCQSYLPEDIDHLEDLFQ"
     gene            complement(<819449..>821542)
                     /locus_tag="ZYRO0A10142g"
                     /db_xref="GeneID:8201845"
     mRNA            complement(<819449..>821542)
                     /locus_tag="ZYRO0A10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494763.1"
                     /db_xref="GeneID:8201845"
     CDS             complement(819449..821542)
                     /locus_tag="ZYRO0A10142g"
                     /note="similar to gnl|GLV|KLLA0C15191g Kluyveromyces
                     lactis KLLA0C15191g and weakly similar to uniprot|Q12424
                     Saccharomyces cerevisiae YDL206W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494808.1"
                     /db_xref="GeneID:8201845"
                     /db_xref="GOA:C5DQB4"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:C5DQB4"
                     /translation="MRLYQRCIVAAFFYSINAILIILSLKSERLWQFYVEPIGLFGCF
                     VMLGSIASDFLTPSLSQISRDILHVSDRVSGFTLLAMGNAIPDITGTYQAMNAGAITL
                     AIGELLGGIFFLLTVVLGSMALIKTIELKPMDRLSCNLESLAEPLSVDESGSVAYNRQ
                     LFVQDMSIFAGLILLSIYFLCDGTLMLWECAVMVLAYCAYATFLVFDHKRDNLLPSSP
                     VVSAQRENSDAMADITTIVSNVEVPEISRRGNIHMFNEGIRERRANIRRRIRQYLRVN
                     YNRWIRIRLRDFLDIWENETLLKNQQVAAADICSDIESEFDQDTIPPLVARRRASSWQ
                     EGDISADLPVISHPPPETQSSEGSVHYSGPQENDQLLSVPQKRPVCSKSLSCDHLPDL
                     RPLYYTLTPVGQSDEQHVVVMESQAVEGSPKTFKSWLQRFKLYGYLTDANAFVPTSEF
                     ILLLFTTPLTIWLTILVPVMPQDKQDKPHHILDVIRFSLVPAISSLLLAEECPLSVLL
                     LCSILFIILSFRWYKGIINWNINLRAIAGFVLSLSATSFNVHLVVNILMKWGEKFNIS
                     NTILGLTVFAWGNSFGDLVSNIVFMEIGVLDIALGACFGSPLLYFLLGIGVDGIILML
                     GSHKGCEKSLIKCGIDFQVDSHLSLSAIGVLVSFIILGIVVPINGWRIDKKISITLLV
                     LYIFITGLNIYIEVI"
     gene            complement(<821877..>822446)
                     /locus_tag="ZYRO0A10164g"
                     /db_xref="GeneID:8201846"
     mRNA            complement(<821877..>822446)
                     /locus_tag="ZYRO0A10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494764.1"
                     /db_xref="GeneID:8201846"
     CDS             complement(821877..822446)
                     /locus_tag="ZYRO0A10164g"
                     /note="similar to uniprot|Q03778 Saccharomyces cerevisiae
                     YDR236C FMN1 Riboflavin kinase phosphorylates riboflavin
                     to form riboflavin monophosphate (FMN) which is a
                     necessary cofactor for many enzymes localizes to
                     microsomes and to the mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494809.1"
                     /db_xref="GeneID:8201846"
                     /db_xref="GOA:C5DQB5"
                     /db_xref="InterPro:IPR015865"
                     /db_xref="InterPro:IPR023465"
                     /db_xref="InterPro:IPR023468"
                     /db_xref="UniProtKB/TrEMBL:C5DQB5"
                     /translation="MELRPNDWLIPEEPESPFPIVTNFCDIEFGFGRGSAELGIPTAN
                     VPLEQLPPETQDLELGVYFGYALLKRVNREDTTALRNDGRTVTYNYGKLLKETNDDLK
                     IHPVVLSVGKNPFYHNKLKTVELHILHHFQADFYGAQVKFNLLGRIRPELNYNSKEAL
                     IDDINKDKLIASEILSRPNYLKYQKQVDH"
     gene            complement(<822619..>824211)
                     /locus_tag="ZYRO0A10186g"
                     /db_xref="GeneID:8201847"
     mRNA            complement(<822619..>824211)
                     /locus_tag="ZYRO0A10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494765.1"
                     /db_xref="GeneID:8201847"
     CDS             complement(822619..824211)
                     /locus_tag="ZYRO0A10186g"
                     /note="some similarities with uniprot|Q12315 Saccharomyces
                     cerevisiae YDL207W GLE1 Cytoplasmic nucleoporin required
                     for polyadenylated RNA export but not for protein import
                     component of Nup82p nuclear pore subcomplex contains a
                     nuclear export signal"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494810.1"
                     /db_xref="GeneID:8201847"
                     /db_xref="GOA:C5DQB6"
                     /db_xref="InterPro:IPR012476"
                     /db_xref="UniProtKB/TrEMBL:C5DQB6"
                     /translation="MRFVLDELYDISDDEDVSPFSTDEPSPDEYTFVNEKEVDIPRLK
                     LPRQHSRQSSEVSEKLDAEYEQLLSQLNLRAKLPTVESIPTVVPGSSGQASERSLENS
                     ASPSASASKFASSGSVVAHDTRDILSALANSLVSKMNQLDIDNSAQVQSVRNAKRKAE
                     EDRRRKEEEARKHQEELAKRRREEEDAKKRQLEEERKRQEAERKLKEEKEQQEQRTRD
                     EQEKALIAEQARRGKTVTDFKGIEKTFWHYKDKILQIKKEIVEPVKQMDVDTRNLISR
                     HKRKINPKFGQLTNSNQQLQSIQMELFGLIDQTKANQLAYLWVLNFIAKALVHQSETE
                     VRVKPESALPLAKLTLALMTRYPDLKELLMARLVKKCPFVIGYTCKIDTEKGRSNMGW
                     KRNSDDKWEEDTSYDERMGGMVTLFAVITRLPLSVEVINQQQHPLPISYSWRLLARIA
                     NTSQDLLTNSHFVVLGSWWDAAALQFYQAYGKQAQKLLQLVGDNLTSAVAQQKYVGAA
                     RLRILMEEWQTSGIKSFPEMID"
     gene            <824470..>825357
                     /locus_tag="ZYRO0A10208g"
                     /db_xref="GeneID:8202074"
     mRNA            <824470..>825357
                     /locus_tag="ZYRO0A10208g"
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /transcript_id="XM_002494766.1"
                     /db_xref="GeneID:8202074"
     CDS             824470..825357
                     /locus_tag="ZYRO0A10208g"
                     /note="similar to uniprot|P36519 Saccharomyces cerevisiae
                     YDR237W MRPL7 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL7/YmL5"
                     /protein_id="XP_002494811.1"
                     /db_xref="GeneID:8202074"
                     /db_xref="GOA:C5DQB7"
                     /db_xref="InterPro:IPR002132"
                     /db_xref="InterPro:IPR022803"
                     /db_xref="UniProtKB/TrEMBL:C5DQB7"
                     /translation="MQKFSCSKRCFSSSSVAYKSHCSLVNPVHHRVRIDKSRLSPRFP
                     ELNLDKNDIRNPGFNPVTTHQDRVHEHYLNTLKSDMLLINYAHNAQTKAGLKKRSWDG
                     SSPYHINRPLRKPQGSTSQLPDLHPVKWHNIPEVTSVVLNCYVREAKENKLLAISAAL
                     QLQQITGCKPHPIFSKSDVPSWKLRRGNQMGAKIELKGRPMSQFLSTLTEIVMPRIRE
                     YKGISNKSGNGLGSLSFGLTSEDVKFFPEIDSNQDLWPKTFGMHININTSAQTDVQAR
                     TLVSGFQIPFHGVEKKRIA"
     gene            <825679..>826005
                     /locus_tag="ZYRO0A10230g"
                     /db_xref="GeneID:8202075"
     mRNA            <825679..>826005
                     /locus_tag="ZYRO0A10230g"
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /transcript_id="XM_002494767.1"
                     /db_xref="GeneID:8202075"
     CDS             825679..826005
                     /locus_tag="ZYRO0A10230g"
                     /note="similar to uniprot|P53305 Saccharomyces cerevisiae
                     YGR215W RSM27 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM27"
                     /protein_id="XP_002494812.1"
                     /db_xref="GeneID:8202075"
                     /db_xref="InterPro:IPR013219"
                     /db_xref="UniProtKB/TrEMBL:C5DQB8"
                     /translation="MTVSKDRLLKVAELSAKIFDQNFNPSGVRTGSQILAKRLKGPAV
                     ASYYGDPDLLRFRHLRTLYPGFKFADLDEEYRLTMLEARKRRGKGAPKKKKEATSGGG
                     KAKKRK"
     gene            complement(<826106..>827953)
                     /locus_tag="ZYRO0A10252g"
                     /db_xref="GeneID:8202076"
     mRNA            complement(<826106..>827953)
                     /locus_tag="ZYRO0A10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494768.1"
                     /db_xref="GeneID:8202076"
     CDS             complement(826106..827953)
                     /locus_tag="ZYRO0A10252g"
                     /note="similar to uniprot|P53306 Saccharomyces cerevisiae
                     YGR216C GPI1 Membrane protein involved in the synthesis of
                     N-acetylglucosaminyl phosphatidylinositol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494813.1"
                     /db_xref="GeneID:8202076"
                     /db_xref="GOA:C5DQB9"
                     /db_xref="InterPro:IPR007720"
                     /db_xref="UniProtKB/TrEMBL:C5DQB9"
                     /translation="MNLNRYIFWPQELNSRSLRLPSEELAAIAIALRGTDYVVLDAVP
                     NQLIDDKELESPYAIVGKRKAYSNQWEFSIKQTCIIEFRAPRIELLQFFSLEPISLSL
                     PEKEYDANDSCKEARSLCQIWDHPRYQAHDRRLRQSLKLLNLFSTHLAALYHRYPHYS
                     RKSVKTYNRRIALWNRLKPVRNFLASICFYVTIFACHLATCIYLILNNGLLPLVNLSV
                     TARQIDLRCQQICYFPVQYLRINVNVSIRKALPRFRTYSEASANLRKDLPSKYYPDYI
                     RFYNTLWLMLNDVSFGLIFGSILLEKCDEIAPVLHRVITYCLYHCINTVTLVLAQNPV
                     GIKLNEELALFLSDMFLWTIDFSNLMFIKPLADVGTLKFFINGLAKMSCVFGGTFALS
                     MILDYFSILSIHIYLFYRISSKIYHWQLNIMISLFYLFCGKKKNILRNRVDNNFFQLD
                     ELLLGTLFFIILVFLTPTVLAFYFSYTVLRMAAITIEIILESIIALLNHFPLFALLLR
                     IKDPRRIPGGISLKLKKNEDVPHFELKNKPLSIYFMFKPFVVLMDHIRDNFYSIKTLK
                     QITLGLPVTIKRNRLYQILYSSLPKRPIDIHTLYDKWEQFTNTKDRKLD"
     gene            <828154..>834159
                     /locus_tag="ZYRO0A10274g"
                     /db_xref="GeneID:8202077"
     mRNA            <828154..>834159
                     /locus_tag="ZYRO0A10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494769.1"
                     /db_xref="GeneID:8202077"
     CDS             828154..834159
                     /locus_tag="ZYRO0A10274g"
                     /note="similar to uniprot|P50077 Saccharomyces cerevisiae
                     YGR217W CCH1 Voltage-gated calcium channel involved in
                     calcium influx in response to mating pheromones"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494814.1"
                     /db_xref="GeneID:8202077"
                     /db_xref="GOA:C5DQC0"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR005821"
                     /db_xref="InterPro:IPR027359"
                     /db_xref="UniProtKB/TrEMBL:C5DQC0"
                     /translation="MVNTKRRLTQLFEPGNNDEDDQGDTSGGHDTNIPLVKPSVNVVP
                     PQTDDEDNYEADNDENEIGLSDKEDNETPKKESTLGNMFKNQSTSKLGKARPKLTLRT
                     GSFNNDSNKNVGHSKSFSSLSGDLFKGKGRRRSNSSNPQDQGTSPDSNTYSDRPPKSA
                     RILSYIAAEDMDEFHDIEKDFQSAMDTDGLSWLPQLGQMRSKSSANLLVDNGPDSGKS
                     QGYIEDADHLGDKFGESESLQPDVGHSNAPEHGKSSILGLALHSPSRKDDAGSFFDKS
                     SHVEVSSFEVEVANFDEEQEEGSWQLYGNSLGLISPTNPVRLKLAALQMSEKYRFFMV
                     VMLSLFTCLMAYRTYEPHSNILFSFSNWADVINFLLCVLFTLSDVSKIIAFGFWDDSE
                     MFAAYGKKYVSLLEKFGVIKLYLYLRNKYGPQIINTIIPFRIATDEEEGKFQRKSLGD
                     SWSEEEIKRRSKRKNFEVPRAFARSSWNRIDLTSTICFWIALFLTINDYDRKNGIRIF
                     KTLAILRILRLVNTDTGLSSILRGIKQAVPQLINVGTMLVYFWVLFGVLGVQSFRGSF
                     RRQCVWTNPNDPTDTYTYDNQFCGGYLDPKTGAPKNYVFADGSEGPISKGFLCPRNSK
                     CVSDTNPYNGRVSFDNIVNAMELVFVIMSANTFTDLMYYTMDSDEMAASLFFIIAIFV
                     LTIWMMNLLIAVLVSSFQLANERFKKKKLDLNTVESWPLRITKGYWRYFQVKARNKKF
                     PAWARKGLFFFNKINPIFVALIVVDAILRCLLDAKVSESFTQTFFKIDVSICSVLFVE
                     SIFRLIFHLPNIWKFLTEFSYVYDLVISLLTLIISSLKVQGYLGHSYYWLSILHISRL
                     YRVIFFFGFTSNLWRRVLGNGIMIWNLSAFYFFFTFLVSIIMSVFFEGVLPDSEEDNQ
                     SFGMYSLPNSFLSLFIIGSTENWTDILYELQSHAFNMSSSFLSSVLLIVWFILSNSVI
                     LNIFIALISETMEVKEEEKRPLQIKHYLKYVYPQKIKDYTHATLLRRVRKKFFGNRTN
                     EDSKDFKQFLIRGTAIMNIAQNMGDLANEFRKDQNPGGLPNWLAAGLGKVTEGFSFMQ
                     KLKMYTDNPFYKNPKVIFNEGDDRTRKTFSLELDEYEDEKLEYLKMHPSFNYSYFILP
                     PRHKFRRFCQRLVPPSVGRRTDGVQFYDDGTDEYGQKFYFRHIERDIFVLFLSIITLL
                     LIVFSCYVTPLRRMQENMGVWGWSTYIDVGFVCILSLEFLVKTVADGVLYTPNAYLRN
                     PWNIIDFIVLVSMWINFIAFVKNNGDLSRIFRGLTALRALRCLTISNMARQTFNMVVF
                     DGIRKIFEATFVSLTLLFPFAIWGMNIFRGRLGTCTDNNMGRDDCYNEFTNSVFQWDV
                     MMPRVYQQPYLYLDSFGSALRSMYEIVSLEGWVDLLENLMNSTGVGTVTSTFASPGNA
                     VFLVLFNFLSMVFILNLFVSFIINNHAKTTGSAYYTLEEKSWLESQKLLSQAKPKVTP
                     SLIELPRSRQFFYMLAIEKGNFYYASFLQLTLYLHIIVLLCRSYKEPHATTTFEDTYF
                     MVSATIFFMQEIFHLYGEGFRLYIRSKWNVLRFGIVVTSFVLTAIGLKLSSDQIWFSN
                     IKELFHLVMFLLIIPQNDTLSELAETAVASWPPILSLTYTWAILFLVYAIALNQIFGT
                     TRLGANTTDNINFRTVIKSLIVLFRCSFGEGWNYIMDDLTVSEPYCSSTKEGSFASDC
                     GSRTYAYILLMSWNIVSMYIFLNMFISLIIGNFSYVYRRGGSNSAIDRREVLKYSDAW
                     AKYDSDGTGYLEFSHLPRLMHSFNGPLSFKIWEGRHTVPNLVKNYMTVNPEDPYDVKI
                     DFPGLNKELNSIDWTEVAHRRLQYRRFVHEVLYTNSYWGAIRFSSLLQLIPLYTTYNP
                     RECLGIDEYVRYLYNMGKVDKILDTERNLDILNMVVTSWKYCVKSKKRLPKVEDDISR
                     QTIEVPTNPFTDEFESDSGDVNFANTPSMDFGVDNFMWSPRKR"
     gene            complement(<834376..>838395)
                     /locus_tag="ZYRO0A10296g"
                     /db_xref="GeneID:8202078"
     mRNA            complement(<834376..>838395)
                     /locus_tag="ZYRO0A10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494770.1"
                     /db_xref="GeneID:8202078"
     CDS             complement(834376..838395)
                     /locus_tag="ZYRO0A10296g"
                     /note="similar to uniprot|Q02979 Saccharomyces cerevisiae
                     YPL110C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494815.1"
                     /db_xref="GeneID:8202078"
                     /db_xref="GOA:C5DQC1"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DQC1"
                     /translation="MKFGKTFPNHQVPSWSHQYVNYKGLKKLIKEITEQQEKLYREEH
                     ANLKDNNQPPTKVRDSSKVEQNYMDNEEVKKLLAFFFFALDRDIEKVDNFYNMQFSEY
                     ERRLRKLTSSAQFADINNSLMIQSGISLVPRDLQHPQPKINGLNPNYSNTSQPMMPSV
                     SHTPEDISEDLVEVLGILVELRSHFRNLKWYGELNKRAFTKILKKLDKKVGTHQQHAY
                     LQARILPLDFSNDSGISKSLNAINDFLDKVSYKVQDKVSNGTKLSEEEISGVESKNGG
                     LPNDVISLLIEKNDGIGLINELTAIYRSLVLIPTRILVNLLNKSALSQSFQCMDELLK
                     IIPTLRDPTDMNARNFFHHHVIALGKNHKKLSESTAKGAGSPTFATVNTHLNRSHDSS
                     VENEENLDEINNLNSLLKETLDLEAAELPDHNSKLIGAFGPDGINSNDSPASLIHILE
                     KLPAHLRPCLLQKDNYKRTPLHYSAQYGLVEITRIIIENLANWGAWNPDVSIDDTSYW
                     GDSESLTPLHLAVIGSHPQTVRTLLSYVNSNQVVTCPHLLHLATRLNSGSLVESLLSA
                     EGFDLNFCDEESHETPLYLASKLNLYDAAACLLKHGANTELREKLFGWTPIFVAATEG
                     YERIVQLLRDHGAEYVVFDDSGWTPMEHAALRGHLNITKMLKITDHPEICHPKMPSDD
                     MESATNGNNGNLQSPSPDSTTSLATQSDTSTIHSNSNGIVNGSNGSVYGKSDNQSSIE
                     HKPKSSNTKINHRALLKSSTPGGHHKSHSNNGVLQPVKSFGHRYLNSDESLLMITLGG
                     NDSRNTKPAISLNKVPVSKVSSTQLDTALSLVISCADDLSKTPHVLDLPLDDNLDAIT
                     FKVPSKSDHSHVVFFDIVPTYGSLPPRSSESPFSYHGDFNTHSYYRNPGMLGSEASLS
                     SSNNTFRNNGSPRVLGRAVALLSKTGAFVGINRRSLNDLITVPIVANETMDVLGTVSF
                     EHFMVTAFNHPKMSLGRTETYWKSLVSTRVIGHRGLGKNFNSKKSLQLGENTVESFIA
                     AASLGASYVEFDVQLTKDNIPVVYHDFLVAETGVDVPMHELTLEQFLDLNNVDGHMDV
                     VNRKDRRRSVDDLESGVHKTRFDDTNAKGGAHEDVSKLLENRMRLTRTYKKDNFKGNF
                     RGHSIASSFVTLKELFKKIPQNVGFNIECKYPMADEAEQEDIGQIAVEMNHWVDTVLQ
                     VVYDNANGRDIMFSSFHPDVCVLLSLKQPSIPILFLTEAGTAQMADVRASSLQNAVRF
                     ARSWNLLGIVAAAAPIIQAPRLAQVVKSSGLVCVTYGVENNDPENANIEMDAGVDAVI
                     VDSVLAIRKELTKANANAR"
     gene            complement(<839096..>840907)
                     /locus_tag="ZYRO0A10318g"
                     /db_xref="GeneID:8202079"
     mRNA            complement(<839096..>840907)
                     /locus_tag="ZYRO0A10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494771.1"
                     /db_xref="GeneID:8202079"
     CDS             complement(839096..840907)
                     /locus_tag="ZYRO0A10318g"
                     /note="similar to uniprot|Q02981 Saccharomyces cerevisiae
                     YPL109C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494816.1"
                     /db_xref="GeneID:8202079"
                     /db_xref="GOA:C5DQC2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DQC2"
                     /translation="MFRILNRSWTFLRTPAIRNLVIPTSIALFYSQKQTCYYKLWNES
                     LKPLPGGDTFEMGLYLASQHELRQEVIQKRSNRLRTSSNSIIRQLKRLWFEVKDHLVE
                     PIYTMLRFIEIFAIFAPVLICYPITFFGRRHKLDRDEVHILETSGSLIWYRLLRKALE
                     LAGPSFIKLGQWAGSRTDMFSPGLCHELSNLHSNSKPHSLKYSKQRICQSLDNQFEFD
                     EIFDEFREKPLGVGAIAQVYMGKLSDKFIRSMQNQNTDFDGNDSDGWVAVKVIHPNCG
                     KKINRDLKIMQFIANVIDELPTMVWLSLPAEVEQFSILMRLQLDLRIESLNLTRFNKN
                     FENSLQTKFPRGFPQFSSREVLFEEYIHGFPMETFLQVKDKLRSTELCKKVSDLFIDA
                     FLQMLILDDFIHADLHPGNVMIRFLKTDKYGTHVTSTEREHFSIVHKLRQLAHENNSD
                     ELVKELKYALQEYTPQICFIDAGLITELNKQNRINFIALFNALARFDGYQAGELMIER
                     SRTPETAVDKELFAFKVEKLVTKVKKRTFTLGTVSIGDLLDQMLTMVRSHHVRMEGDF
                     VSVVVAILLLEGIGRQLDPELDLFARFVSFFFIYGFH"
     gene            complement(<841263..>841814)
                     /locus_tag="ZYRO0A10340g"
                     /db_xref="GeneID:8202080"
     mRNA            complement(<841263..>841814)
                     /locus_tag="ZYRO0A10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494772.1"
                     /db_xref="GeneID:8202080"
     CDS             complement(841263..841814)
                     /locus_tag="ZYRO0A10340g"
                     /note="highly similar to uniprot|P38116 Saccharomyces
                     cerevisiae YBR164C ARL1 Soluble GTPase with a role in
                     regulation of membrane traffic; regulates potassium
                     influx; G protein of the Ras superfamily, similar to
                     ADP-ribosylation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494817.1"
                     /db_xref="GeneID:8202080"
                     /db_xref="GOA:C5DQC3"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQC3"
                     /translation="MGNFFSSMFDRLWGVNKELRILILGLDGAGKTTILYRLQIGEVV
                     TTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMA
                     TAAKELHLMLQEEELQDSALLVFANKQDQPGALTASEVSKELNLVELKDRSWSIVASS
                     AVKGEGITEGLDWLIDVVKEEQL"
     gene            <842988..>843692
                     /locus_tag="ZYRO0A10362g"
                     /db_xref="GeneID:8202081"
     mRNA            <842988..>843692
                     /locus_tag="ZYRO0A10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494773.1"
                     /db_xref="GeneID:8202081"
     CDS             842988..843692
                     /locus_tag="ZYRO0A10362g"
                     /note="similar to gnl|GLV|CAGL0I10813g Candida glabrata
                     CAGL0I10813g and some similarities with uniprot|P38290
                     Saccharomyces cerevisiae YBR165W UBS1
                     Ubiquitin-conjugating enzyme suppressor that functions as
                     a general positive regulator of Cdc34p activity nuclear
                     protein that may represent a link between
                     nucleocytoplasmic transport and ubiquitin ligase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494818.1"
                     /db_xref="GeneID:8202081"
                     /db_xref="UniProtKB/TrEMBL:C5DQC4"
                     /translation="MVVLTRKLLRDWKSLNRHYSHFSARENALFCIRPQDSNLHIWHL
                     VIFNPVTKVEVYLKLYIGDEDEPSIILKCLTPNTLFPIGRSVSLTHLNYFLVEDGFLP
                     LLQQIWRLFFDNCEQMGNSRLTFAWNRIMCKEFKIHFPELLGNLVSGDYSMVKNYYNA
                     SGVANPNDVMDDTQPVLTTPIQCHSSNGDTTNTIACDDFPRSQKRQRSTGESVDFITP
                     GSDDDDGTPLRKRLRR"
     gene            complement(<843877..>845199)
                     /locus_tag="ZYRO0A10384g"
                     /db_xref="GeneID:8202082"
     mRNA            complement(<843877..>845199)
                     /locus_tag="ZYRO0A10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494774.1"
                     /db_xref="GeneID:8202082"
     CDS             complement(843877..845199)
                     /locus_tag="ZYRO0A10384g"
                     /note="similar to uniprot|P20049 Saccharomyces cerevisiae
                     YBR166C TYR1 Step of tyrosine biosynthesis pathway
                     Prephenate dehydrogenase (NADP)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494819.1"
                     /db_xref="GeneID:8202082"
                     /db_xref="GOA:C5DQC5"
                     /db_xref="InterPro:IPR003099"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012385"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DQC5"
                     /translation="MVSEDQIKQWKSSKTIGIIGLGDMGLLYAKEFSKAGWKVVACDK
                     EEHYQALKTLHADLPFEIVANGHLVSRVSDFIIYSVEAESIEKIVSLYGPSSKVGAIV
                     GGQTSCKNPEIAAFERHLPLDTEIITVHSLHGPKVSTEGQPLVLIKHRCQHEESFQFV
                     QTVMSCLKSKFVYLDYEEHDKITADTQAVTHAAFLSMGAAWAKLKVYPWNMGLEKWYG
                     GLENVKVNISLRIYSNKWHVYAGLAITNPAAHQQILQYATSATELFTIMLAHDKAKLV
                     ERLQKAKEFVFGSHKGLLLLDDKLLDKFSFSGSLDNAQGEPIPNSHLSLLAIVDSWYQ
                     LGINPYDHMICSTPLFRVFLGVSEYLFLTPELFEKTIDAAINCESFRRDDLEFVVSAR
                     EWSSIVGFANFELYRKQFEQVQKFFEPMFPKANKVGNEMLKTIASHSQ"
     gene            <845321..>845932
                     /locus_tag="ZYRO0A10406g"
                     /db_xref="GeneID:8202083"
     mRNA            <845321..>845932
                     /locus_tag="ZYRO0A10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494775.1"
                     /db_xref="GeneID:8202083"
     CDS             845321..845932
                     /locus_tag="ZYRO0A10406g"
                     /note="similar to uniprot|P32459 Saccharomyces cerevisiae
                     YIR032C DAL3 Ureidoglycolate hydrolase converts
                     ureidoglycolate to glyoxylate and urea in the third step
                     of allantoin degradation expression sensitive to nitrogen
                     catabolite repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494820.1"
                     /db_xref="GeneID:8202083"
                     /db_xref="GOA:C5DQC6"
                     /db_xref="InterPro:IPR007247"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR024060"
                     /db_xref="UniProtKB/TrEMBL:C5DQC6"
                     /translation="MTSMIAEALTIESFAPYGSIISPDEEISKLDESAKNANQGTAIK
                     LLKRSKVENPLTQQVPNWNLFRCFSQPHLKISLHAKDSTKAATINHSIRVLEKHPYSS
                     QTFLPMGCSSQEFGYLVVVALENPETKKPDISTARAFLCKGNQAVTYGAGVWHAPMIV
                     VGAREYIDFGVLIYELLDPNAPEKDCMECFYGASDLLVTMYTS"
     gene            <846010..>846507
                     /locus_tag="ZYRO0A10428g"
                     /db_xref="GeneID:8202063"
     mRNA            <846010..>846507
                     /locus_tag="ZYRO0A10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494776.1"
                     /db_xref="GeneID:8202063"
     CDS             846010..846507
                     /locus_tag="ZYRO0A10428g"
                     /note="similar to uniprot|Q02872 Saccharomyces cerevisiae
                     YPL108W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494821.1"
                     /db_xref="GeneID:8202063"
                     /db_xref="UniProtKB/TrEMBL:C5DQC7"
                     /translation="MLWGRLIRMAMSDSEVVGSMEAVPVPAPVTTGPATSTISVDGIT
                     GEVTVRKASGKVKVRKGQSKEEYENQLHDYFQLNGGPRKTEEKWMDEVDPLRLLQEKD
                     LTIKLNRQSLSNFCERLYYQRRYDECLTLGEELLRRYQEVNKKNKMQREIEELEYMVK
                     RSKGK"
     gene            complement(<846539..>846907)
                     /locus_tag="ZYRO0A10450g"
                     /db_xref="GeneID:8202064"
     mRNA            complement(<846539..>846907)
                     /locus_tag="ZYRO0A10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494777.1"
                     /db_xref="GeneID:8202064"
     CDS             complement(846539..846907)
                     /locus_tag="ZYRO0A10450g"
                     /note="similar to uniprot|P38291 Saccharomyces cerevisiae
                     YBR167C POP7 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494822.1"
                     /db_xref="GeneID:8202064"
                     /db_xref="GOA:C5DQC8"
                     /db_xref="InterPro:IPR002775"
                     /db_xref="InterPro:IPR020241"
                     /db_xref="UniProtKB/TrEMBL:C5DQC8"
                     /translation="MAKLIKKHPTVKSISHKQVHSTLYLKSKTPYVSALKRINKFLAN
                     VNRTGSTYVIVLGMGKAVEKALSLACHFQDQLQKRVEILTKSVDVMDELSNDDDDDPP
                     DVDTELRKRTISGVEIRIYP"
     gene            <846938..>848161
                     /locus_tag="ZYRO0A10472g"
                     /db_xref="GeneID:8202065"
     mRNA            <846938..>848161
                     /locus_tag="ZYRO0A10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494778.1"
                     /db_xref="GeneID:8202065"
     CDS             846938..848161
                     /locus_tag="ZYRO0A10472g"
                     /note="similar to uniprot|P38292 Saccharomyces cerevisiae
                     YBR168W PEX32 Peroxisomal integral membrane protein
                     involved in negative regulation of peroxisome size
                     partially functionally redundant with Pex31p genetic
                     interactions suggest action at a step downstream of steps
                     mediated by Pex28p and Pex29p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494823.1"
                     /db_xref="GeneID:8202065"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:C5DQC9"
                     /translation="MSTCVSLKVRKVNLHYKTVHQPKSDMAKEASDYYCRAHFIYHHG
                     QKPSLTLVTPATMSSVLHRIYPLLLIADATLSNLMWICEDLCLPFIHLVMVLMVVNFL
                     CEDLQVDISHIAQLWLGLMSLFFLAFSVAYYILTLYQDLLYESEPPTVDDIVIVLESV
                     VDKLETIQHEGLSVNKRRALQLAVLLTPLHWGLIKLVSMKNYCMGFTLMCILYHSNWF
                     QCTLKLFWRILLTRKVYYGLERLFNGHGPFPKKPVDFFRAISSSEYIYRMALPHDVKA
                     LHSHKLQLRLQQLFPWDKPLHNDENGSDLMVIEFKINENQRKWQADGWTARMLPYERT
                     KYSIELGGKINTCHSPWQFQESDLKNWSWLDDCWRPTDWIYSDTNWDFKGVHDSLDCC
                     TRTRAWKRRVYRLME"
     gene            <848539..>849303
                     /locus_tag="ZYRO0A10494g"
                     /db_xref="GeneID:8202066"
     mRNA            <848539..>849303
                     /locus_tag="ZYRO0A10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494779.1"
                     /db_xref="GeneID:8202066"
     CDS             848539..849303
                     /locus_tag="ZYRO0A10494g"
                     /note="similar to uniprot|Q02873 Saccharomyces cerevisiae
                     YPL107W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494824.1"
                     /db_xref="GeneID:8202066"
                     /db_xref="InterPro:IPR019180"
                     /db_xref="UniProtKB/TrEMBL:C5DQD0"
                     /translation="MRCVESIAMQGIMFSQVSRRFLSVSPRLNMTFEGNKEGLAGTAE
                     ERMSHIFGAGRLRGEPPKSSSRRIRGESRLIAGVQVPSRPVEPDNCCMSGCINCVWEL
                     FNDDIREWRRRRKEAAQRIKDTEDIWPRDWSPPLPYLSLKNVPESLKTEKIHMDRQRK
                     NQKQKNISTASLFPQREGPLPKTVQEAKRRNLQEREKEPEKQEATDTSKGSSSEEPIY
                     DDDDGWQNVPVYIRAFAEFERTKKLQRLQAQEQNQT"
     gene            complement(<849541..>851625)
                     /locus_tag="ZYRO0A10516g"
                     /db_xref="GeneID:8202067"
     mRNA            complement(<849541..>851625)
                     /locus_tag="ZYRO0A10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494780.1"
                     /db_xref="GeneID:8202067"
     CDS             complement(849541..851625)
                     /locus_tag="ZYRO0A10516g"
                     /note="highly similar to uniprot|P32589 Saccharomyces
                     cerevisiae YPL106C SSE1 HSP70 family member highly
                     homologous to Ssa1p and Sse2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494825.1"
                     /db_xref="GeneID:8202067"
                     /db_xref="GOA:C5DQD1"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DQD1"
                     /translation="MSTPFGLDLGNHNSVLAVARNRGIDIVVNEVSNRSTPSIVGFGQ
                     RNRFLGEAGKNKQTSNVKNTVENLKRIIGLGYDDKEFPEEAKYFSNKLVKLEDGKVGA
                     QVKFVNKDHVFSAPQLAGMFFDRVKDTVQTETKANISDVCLAVPSWYTEEQRYVVADA
                     ARIAGLNPVRVVNDVTAAAVSYGVFKPDLPDVDQKPRVVALVDIGHSSYTCSVIGFKK
                     GEFKVLGTAWDKHFGGRNFDRAITEHFAQEFKTKYKIDINENPKAYSRVVAAAEKLKK
                     VLSANSSAPFNIESVMNDIDVSSQFSRVELEELMKPLLERVHEPIYKALAQAKLSVED
                     VDFVELIGGTSRIPVLKETISKAFNKQLSTTLNQDEAIAKGAAFICAIHSPTLRVKPF
                     KFEDMHAYSVSYSWDKQVEDEDHLEVFPAGSTFPSTKMITLHRTGDFVMEAYYTHKEE
                     LPEDVPTHIAKWEITGVQLPEGATSVPVKLKLRCDPSGLHIIEEAYTLEDITVKEEIP
                     LPEDAPEGAEPEYKEVTKTVKKDTLNIVEHTFGLKPEELNLLVEKENEMTSQDKLVAE
                     TEDRKNALEEYIYTLRGKLDEEYAPFASDQEKTKLRDQLAKAEDWLYEDGYDSTKAKY
                     VAKYEELASTGNIIRGRYLSKQEEQKQALRQKDEAKKMAELSEKLSAQRKSEAENKES
                     SKKDAEGDVNLD"
     gene            <852296..>854122
                     /locus_tag="ZYRO0A10538g"
                     /db_xref="GeneID:8202068"
     mRNA            <852296..>854122
                     /locus_tag="ZYRO0A10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494781.1"
                     /db_xref="GeneID:8202068"
     CDS             852296..854122
                     /locus_tag="ZYRO0A10538g"
                     /note="similar to uniprot|P36062 Saccharomyces cerevisiae
                     YKL146W AVT3 Vacuolar transporter exports large neutral
                     amino acids from the vacuole member of a family of seven
                     S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494826.1"
                     /db_xref="GeneID:8202068"
                     /db_xref="GOA:C5DQD2"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DQD2"
                     /translation="MDTSSTSPSVSKGKPNDKDHSLVDIHNPDPQVVDIVNRHLVHSP
                     NNLQLQGADVTRDLYKWSTDQQQLPLETATGTVPTSPRDDIHSPIPLSQRRRSISFSG
                     MSIQSSSPNNYLSADVPGTTMTHEEIRAPGGFRRSFILRQHERKYGATAPPPNFFTRN
                     FIEFLTLYGHFAGQDLGEDEDEDEYEDGRGHEDEESVLLERVPTRDSKKQQRKATTFK
                     AILLLLKSFVGTGVLFLPRAFHNGGWAFSTGCLLFCAIASSLAFVLLIKTKDKVGVSG
                     YGDLGKALYGPKVEFSILFSIALSQLGFSAAYTVFTATNLKVFFENAFNFPADSVPLS
                     AYIILQALIFIPLSLTRNITKLSGTALIADLFILLGLLYVYYYPALYIAKHGIATDSV
                     LFFNRSDWSLFIGTAIFTFEGIGLLIPIQESMKKPEHFYPSLGFVMSIVTFIFVSSGL
                     LCYLAFGAKVETVVLLNFPQDSIATISVQLIYSLAILLSTPLQLFPAIRIFETWTFPS
                     NASGKHNHRVKWLKNYFRTGVVIFTALLAWVGANDLDKFVSLVGSFACIPLIYIYPPL
                     LHLKSSDTQTSKFIILGDLLIFFFGVGVMAYTSYQNIVLWGN"
     gene            <854410..>855816
                     /locus_tag="ZYRO0A10560g"
                     /db_xref="GeneID:8202069"
     mRNA            <854410..>855816
                     /locus_tag="ZYRO0A10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494782.1"
                     /db_xref="GeneID:8202069"
     CDS             854410..855816
                     /locus_tag="ZYRO0A10560g"
                     /note="highly similar to uniprot|P33299 Saccharomyces
                     cerevisiae YKL145W RPT1 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates required for
                     optimal CDC20 transcription interacts with Rpn12p and the
                     E3 ubiquitin-protein ligase Ubr1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494827.1"
                     /db_xref="GeneID:8202069"
                     /db_xref="GOA:C5DQD3"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQD3"
                     /translation="MPPREDWEKYKAPIEGTGDENAEDTKGSPLSEGDIQVLKTYGAA
                     PYATKLKETEKDLKDIEQRIKEKSGIKESDTGLAPSHLWDIMGDRQRLSEEHPLQVAR
                     CTKIIKSTSDSNENGEGLDGAAGPGATSENRDADDAEEDEDAKYVINLKQIAKFVVGL
                     GERVSPTDIEEGMRVGVDRSKYHIELPLPPRIDPSVTMMTVEEKPDVTYSDVGGSKDQ
                     IEKLREVVELPLLSPERFAKLGIDPPKGILLYGPPGTGKTLCARAVANRTDATFIRVI
                     GSELVQKYVGEGARMVRELFEMARSKKACIVFFDEIDAIGGARFDDGAGGDNEVQRTM
                     LELITQLDGFDPRGNIKVMFATNRPNTLDPALLRPGRIDRKVEFSLPDLEGRANVFRI
                     HSKSMSVERGIRWELISRLCPNSTGAELRSVCTEAGMFAIRARRKVATEKDFLQAVEK
                     VINGYKKFSSTSRYMQYN"
     gene            complement(<855900..>856529)
                     /locus_tag="ZYRO0A10582g"
                     /db_xref="GeneID:8202070"
     mRNA            complement(<855900..>856529)
                     /locus_tag="ZYRO0A10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494783.1"
                     /db_xref="GeneID:8202070"
     CDS             complement(855900..856529)
                     /locus_tag="ZYRO0A10582g"
                     /note="highly similar to uniprot|P35718 Saccharomyces
                     cerevisiae YKL144C RPC25 RNA polymerase III subunit C25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494828.1"
                     /db_xref="GeneID:8202070"
                     /db_xref="GOA:C5DQD4"
                     /db_xref="InterPro:IPR004519"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013238"
                     /db_xref="UniProtKB/TrEMBL:C5DQD4"
                     /translation="MFTLSKISELVRIPPDQFHRDTISSITHELNNAYANKVIPHIGL
                     CITVYDILEVDEGQLRPGDGASYINVTFRALVFKPFVGEVITGWISKCTAEGIKVSLL
                     GLFNDIFIPQNMLFEGCSYSPDENAWIWPMDESNQLYFDVNEKIRFRVEQEVFVDVKP
                     KSPKEREHEEQERQQAEEAGVAYNETKSPAYALLGSCQTDGMGVVSWWE"
     gene            <856725..>858101
                     /locus_tag="ZYRO0A10604g"
                     /db_xref="GeneID:8202071"
     mRNA            <856725..>858101
                     /locus_tag="ZYRO0A10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494784.1"
                     /db_xref="GeneID:8202071"
     CDS             856725..858101
                     /locus_tag="ZYRO0A10604g"
                     /note="similar to uniprot|P34078 Saccharomyces cerevisiae
                     YKL143W LTV1 Protein required for growth at low
                     temperature"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494829.1"
                     /db_xref="GeneID:8202071"
                     /db_xref="InterPro:IPR007307"
                     /db_xref="UniProtKB/TrEMBL:C5DQD5"
                     /translation="MSKRFNKKNSQKYVVVHRPHDDPEYYDNDASEHVLVPASNPNTA
                     KTAERPPPLVEDPVQTAGKKENEHVGEAMLYGINFDDSKYDYTQHLKPIGTDPENSLY
                     IPAKKPVDKTKSKKSIDDLFVEPKYQNADPSKNEPLFARGVAKPEYLERQQNVADELT
                     GFRPDMNPALREALEALEDEAYVVNKDRELRKAQENTDENDEDDIFQQLLEGGQAADD
                     EEFEDNLDEWDIDNLDEYEDEHYQKEMEELDNVENLEDLKNIDYQADVQRFKKEKKRD
                     IFEDEVSSTGPQSVEPEDEVEEEEEEEEIDGLGELPSIKQTKGKKRKDRQKMGTKSDL
                     TGFSMTSSAIARTETMTILDDKYDNVISGYENYQDEQEDLEEKQSKPFDMSQERSDFE
                     SMLDDFLDNYELGKGGREFHKKDEEEQNMKNAADEVSKGKLSQRRNKERKAKSTKGIT
                     NSLSSLHI"
     gene            <858296..>858946
                     /locus_tag="ZYRO0A10626g"
                     /db_xref="GeneID:8202072"
     mRNA            <858296..>858946
                     /locus_tag="ZYRO0A10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494785.1"
                     /db_xref="GeneID:8202072"
     CDS             858296..858946
                     /locus_tag="ZYRO0A10626g"
                     /note="similar to uniprot|P35719 Saccharomyces cerevisiae
                     YKL142W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494830.1"
                     /db_xref="GeneID:8202072"
                     /db_xref="InterPro:IPR012917"
                     /db_xref="UniProtKB/TrEMBL:C5DQD6"
                     /translation="MSSELNQIKQQVADLQRLVKKQSLIISKTGQNVLEMQVSKQRSD
                     VNAIGSKSSESKHGIPQLEANDVVTNEDLVQLVGELQGQLDTIEERNVRRLVNCVKSQ
                     PDDILAPLPNADGEIPKGGSEGVFPTTLNDFEKIDDVALFKLAKFYELLPPSLKEQEK
                     FEDFMEGKVEEFHISEMPDEEVQKELKNYSSGQLEDTFNELARYLGLRARRGTATW"
     gene            complement(<859035..>861005)
                     /locus_tag="ZYRO0A10648g"
                     /db_xref="GeneID:8201794"
     mRNA            complement(<859035..>861005)
                     /locus_tag="ZYRO0A10648g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494786.1"
                     /db_xref="GeneID:8201794"
     CDS             complement(859035..861005)
                     /locus_tag="ZYRO0A10648g"
                     /note="highly similar to uniprot|P47077 Saccharomyces
                     cerevisiae YJL010C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494831.1"
                     /db_xref="GeneID:8201794"
                     /db_xref="GOA:C5DQD7"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /translation="MGKPRGRKLLKQQEKDQFKPAKEFDVPDEQDNFDGSNGTDSDPQ
                     MFFGVLDREELEYFKHAEATLSMDAFDNAEEKKQFVTNVIEETRGKELKLVISQICSK
                     LMERLILDCDDQQLKSIFKAFNGVFYNLSCHKYASHVLETLLVRGAALVEKELLTPSF
                     DGETDEESFITMENVYLYMLNEVKPHLKAMINHRYASHVLRLLILILASKNLPKTTQN
                     NSTLRSKKSKIARKMIDIKDNDDFDRVHQTPESFKLELKDFLKNLYAGFTNGAASRSD
                     ISPTYVTKFRELCVDPVASPVIQLIIQVEGIFDRERSFWRLVFNTTDETDAKEEAFLE
                     YLLSDPVGSHFLENVISFARTKFVERLYNLYMKPKITKLAQRDTTGAFVVQALLRHLK
                     DKEVKEILEELVPQLSMLLNSNIDFGTSIIEASIKEDNYLRDEVINQLLVKYYPEQNE
                     NRNILESCLLLSSSTLGNTRDDWPTAEERRRSLFLEQLIGYDSKFVDVTIESMLKLPE
                     ERFLQMAYHGVFSHVVEHVLKPTIVDAIKRKLLLNVLCKDVVNMSCNAYGSHIVDKLW
                     EFTAKLTLYKERIANSLLKESDKVKNSSYGKRVWRNWHLDQYVRKPMDWRRIVKEQDV
                     AIFPNAQPLQPKNPLKRPKHTDLPPSKRKGVK"
     gene            complement(<861234..>862949)
                     /locus_tag="ZYRO0A10670g"
                     /db_xref="GeneID:8201795"
     mRNA            complement(<861234..>862949)
                     /locus_tag="ZYRO0A10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494787.1"
                     /db_xref="GeneID:8201795"
     CDS             complement(861234..862949)
                     /locus_tag="ZYRO0A10670g"
                     /note="highly similar to uniprot|P47079 Saccharomyces
                     cerevisiae YJL008C CCT8 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494832.1"
                     /db_xref="GeneID:8201795"
                     /db_xref="GOA:C5DQD8"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012721"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DQD8"
                     /translation="MSLKLPQNLNSGLFKQGYNSYSNSDGQINKSIAAIREIHQMCLT
                     SMGPCGRNKIIVNHLGKIIVTNDAATMLRELDIIHPAVKVLVMATEQQKMDMGDNTNL
                     VMVLAGELLIVSEKLIALGLSAVEIIQGFNMAKNFTLEELDKLVVGDVIDKSNPQELI
                     KVIKPVIASKKYGSEDLLSQLVAEAVSHVLPQSSQGTIPYFNVDSIRVVKIMGGSLVN
                     STVIKGMVFNREPEGHIKSLPEGGKHKVAVFTCPIDIANTETKGTVLLHNAQEMLDFS
                     KGEEKQIDAMMKEIADMGVTCVVAGAGVGELALHYLNRYNILVLKVPSKFELRRICRV
                     CGATPLPRLGAPTPEEIGVVETVKTMEIGGDRVTVFKQESEEATRTSTIILRGATQNN
                     LDDIERAINDGVAAIKGLMTPNGGKLLPGAGATEIELVSRITKYGERTPGLLQLAIKQ
                     FALAFEVVPRTLADTAGLEVNEVLPNLYAAHTVVSGEKDEEAARKECLFKGVDILKDT
                     SDGLTDIREDSVYDLLAPKKFAINVATEAATTVLSVDQIIMAKRAGGPAPPQAKRPGN
                     WDQDD"
     gene            863275..863347
                     /locus_tag="ZYRO0A10692r"
                     /db_xref="GeneID:8201796"
     tRNA            863275..863347
                     /locus_tag="ZYRO0A10692r"
                     /product="tRNA-Met"
                     /note="tRNA-Met (CAT) cove score=71.12"
                     /db_xref="GeneID:8201796"
     gene            <863919..>866423
                     /locus_tag="ZYRO0A10714g"
                     /db_xref="GeneID:8201797"
     mRNA            <863919..>866423
                     /locus_tag="ZYRO0A10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494788.1"
                     /db_xref="GeneID:8201797"
     CDS             863919..866423
                     /locus_tag="ZYRO0A10714g"
                     /note="similar to uniprot|P47061 Saccharomyces cerevisiae
                     YJL029C VPS53 Required for Vacuolar Protein Sorting Vps53p
                     is a hydrophilic protein that is peripherally associated
                     with the late Golgi and forms a stable complex with Vps52p
                     and Vps54p."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494833.1"
                     /db_xref="GeneID:8201797"
                     /db_xref="InterPro:IPR007234"
                     /db_xref="UniProtKB/TrEMBL:C5DQD9"
                     /translation="MISNSVDYNPFEDITTILSAKESLNDIDRLICATRRYKLQLADE
                     IKESEGQEESDKVGRSSDERRFDFGKVFREIEETKNFASGTQSTISQLTEGISHLDNA
                     KRNLTQCMTLFQNLQILTDSYFHCKELIGRSAYKEMASSYKMMCSLAENTFKPYKSVD
                     EINKLLASISRLRADTFEKIKHSYSRVLSGKVAESEAIEAELREGACDILDSDSSGKA
                     QIIDTCLKKLLNEIGEIFRVDDEAGSLENLSRRYIFFKKVLNNFNSKFARYFLAEWEM
                     PLRLTSTFFKMTAKDLEILLKKEFQGKDASIDLFMGALQETLDFEKYIDVRFSNKLRE
                     TKLSQHFESYLSLWVSHQDKMMNEKFLSYMSGGDLGSNLGDSLIIPSSADLFRTYRSV
                     LTQTFELIENNSNNGILVSLANFFTKWLIAYSNKILQPLILPDSEEMQNKEETIKYTV
                     TMINTADYCSVTIGQLEEKLAELSPDPVKIEQSFAMVRDTYDGLSAKGNSILLNRVLS
                     VDLAFVAREFNNLDWARVVVENYSRYMTTLKEILCFDPSPGRKSTLQLILSQFNRDVY
                     SWNFLDKVIDQVTQEFSGYIIRLLQPMPPFATSTSTRKFDPIKVVSIGEQLLLDTELL
                     KEILYSLPGSVSDEANSAQTTAFKRVKKHIDTNLSQLLQFIKILVAPLSSVDDYHEAY
                     QKLTDYNTSSVVWAYLLSLKGIPWDFNLWKQHWSAFDMDRDSHGSNDGNKDLFIFKWN
                     TKLLTQFEYNLLRIQDPTWSKFVKEELEVKPTPRNPSKIRVHTNPRAYQYQTPPSDGP
                     ESHQQQQQQSPQGTPTSPLANVKNLMTSNRFFDIGG"
     gene            complement(<866467..>867066)
                     /locus_tag="ZYRO0A10736g"
                     /db_xref="GeneID:8201798"
     mRNA            complement(<866467..>867066)
                     /locus_tag="ZYRO0A10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494789.1"
                     /db_xref="GeneID:8201798"
     CDS             complement(866467..867066)
                     /locus_tag="ZYRO0A10736g"
                     /note="highly similar to uniprot|P40958 Saccharomyces
                     cerevisiae YJL030W MAD2 Component of the spindle-assembly
                     checkpoint complex which delays the onset of anaphase in
                     cells with defects in mitotic spindle assembly forms a
                     complex with Mad1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494834.1"
                     /db_xref="GeneID:8201798"
                     /db_xref="GOA:C5DQE0"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="InterPro:IPR027097"
                     /db_xref="UniProtKB/TrEMBL:C5DQE0"
                     /translation="MSNSISLRGSTRTITEFFEYSINSILYQRGVYPQEDFTTIRKYG
                     LTLLKTHDEELKAYIRRILAQVHKWLVGGKCNKLVLCIVDKDEGDKVEEWSFDVVQFS
                     KLDQNQVELPQEVDDNETQNQIRSLIRQITASVTFLPELNNEGNYTFNVLAYTDANAK
                     VPLEWSDSDNKPINNGETVQFKSFRTNDHQVGAQVSYRY"
     gene            <867206..>868257
                     /locus_tag="ZYRO0A10758g"
                     /db_xref="GeneID:8201799"
     mRNA            join(<867206..867208,867280..>868257)
                     /locus_tag="ZYRO0A10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494790.1"
                     /db_xref="GeneID:8201799"
     CDS             join(867206..867208,867280..868257)
                     /locus_tag="ZYRO0A10758g"
                     /note="highly similar to uniprot|Q00618 Saccharomyces
                     cerevisiae YJL031C BET4 Alpha subunit of Type II
                     geranylgeranyltransferase required for vesicular transport
                     between the endoplasmic reticulum and the Golgi provides a
                     membrane attachment moiety to Rab-like proteins Ypt1p and
                     Sec4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494835.1"
                     /db_xref="GeneID:8201799"
                     /db_xref="GOA:C5DQE1"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:C5DQE1"
                     /translation="MHGVKRKQWTQELLKQKKEQDRKRITQYRGLVDKLLDSRDSKTY
                     NMEVFKETTQLLRINPEYNAGWNYRRDIIEHLSPELKHEFWEDELAFSMALLKDYPKV
                     YWIWNHRKWTLENHIDKSVKIWLRELAIVSKLLQMDPRNFHGWHYRRILVAEIEGRTG
                     QSRDGEELQYAIDNTNKNISNYSAWHQKATLIPKMFEKDEIKDKKKFIQDEFTYITNA
                     IYTDAEDQSVWFYIEWFVKNHIVIDALGRDELIQKLQELQENILAINEDDLQFSGKQN
                     NWCLKVLIVLEDVQRNLKVQFTPHSHEYLAQLIEADPMRKNRYLHLLHRK"
     gene            complement(<868275..>869261)
                     /locus_tag="ZYRO0A10780g"
                     /db_xref="GeneID:8201800"
     mRNA            complement(<868275..>869261)
                     /locus_tag="ZYRO0A10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494791.1"
                     /db_xref="GeneID:8201800"
     CDS             complement(868275..869261)
                     /locus_tag="ZYRO0A10780g"
                     /note="similar to uniprot|P46962 Saccharomyces cerevisiae
                     YJL006C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494836.1"
                     /db_xref="GeneID:8201800"
                     /db_xref="GOA:C5DQE2"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR015429"
                     /db_xref="UniProtKB/TrEMBL:C5DQE2"
                     /translation="MSTKFDTQLLLSRPYLTKRELTRLQRDSITDRRTYNQKKLAVIK
                     FMSEICLQLNFPRRTLETAIYFYQRYHVFNRFETELCYTVATSSLLLSCKQVETIKKV
                     NELCSVSLRLRNVPKPSSEMLDNFKKGVFQIELRILESCSFDYRTNNFLHIDECVVKF
                     GKTFNLDYQVCLLAWVIGYDVLKLDTLLTIPQHTIALAVLKIAYQILTPGSDWFQLVA
                     RRNLETDKYSLNEAYFDILNFYINSFDICDLKNNIPPGISYFGLEKFIELKKNAGPEF
                     GLHDFNEKDIEMDPYFTSHRDYSVRERRYVLSPKLVQDEIKTNSSNTVGGRV"
     gene            complement(<869465..>871780)
                     /locus_tag="ZYRO0A10802g"
                     /db_xref="GeneID:8201801"
     mRNA            complement(<869465..>871780)
                     /locus_tag="ZYRO0A10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494792.1"
                     /db_xref="GeneID:8201801"
     CDS             complement(869465..871780)
                     /locus_tag="ZYRO0A10802g"
                     /note="similar to uniprot|P20448 Saccharomyces cerevisiae
                     YJL033W HCA4 Putative nucleolar DEAD box RNA helicase
                     high-copy number suppression of a U14 snoRNA processing
                     mutant suggests an involvement in 18S rRNA synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494837.1"
                     /db_xref="GeneID:8201801"
                     /db_xref="GOA:C5DQE3"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQE3"
                     /translation="MPRKQHLTTSQRKQIRKREDQYIEELHTKTQEFNNPKATYFQDL
                     PLSNAVLRGLKDASYVKLTDIQRDSIPVSLKGNDVLGAAKTGSGKTLAFLIPVLEKLY
                     RERWTEYDGVGALIISPTRELAMQIYEVLIKIGTHCSFSAGLVIGGKDVKFEAERISK
                     INILIGTPGRLLQHLDQSVGLNIDNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPIRQ
                     TLLFSATQSQSLNDLARLSLTDYKTVGTPANVSGSQPETPETLQQHYIVVELADKLDT
                     LFSFIKTHLKCKMIVFFSSSKQVHFVYETFRKLQPGISLMHLHGRQKQRARTETLDKF
                     SRAQQVCLIATDVVSRGIDFPAVDWVVQVDCPENVDTYIHRVGRSARYGKQGKSLIML
                     TPQENEPFLQRLKGRRIEPNMLNIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYV
                     RSIYIQKDHEVFKFDQLPTEEFAQSLGLPGAPKIKLRGMGAIERSKDLKNAPRQLLKL
                     NKADENGEFEDKPKEARTKFDKMFERKNQTVLSEHYLNITKSQAQADEDDGDFISLKR
                     GDHQLKEEDLPPLIAPQSKRAVRKALSKKASLASKGNASKMVFDEDGQAHPVYELEDE
                     EQFHEKGDAMSQKQEFLTKEAEIMAQKDVEDKQLAKEKRQEKKRKQLEALRREMEENE
                     SYYSEDEEPTVLLGTGNLSDDMDEHSEGEDKEEENESQEQDEQESDFEEPPRKKHAAH
                     REQKQDDGLLEVEEPETLEDLESLTSRLINQ"
     gene            <871927..>872439
                     /locus_tag="ZYRO0A10824g"
                     /db_xref="GeneID:8201802"
     mRNA            <871927..>872439
                     /locus_tag="ZYRO0A10824g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494793.1"
                     /db_xref="GeneID:8201802"
     CDS             871927..872439
                     /locus_tag="ZYRO0A10824g"
                     /note="similar to uniprot|Q07930 Saccharomyces cerevisiae
                     YLR016C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494838.1"
                     /db_xref="GeneID:8201802"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:C5DQE4"
                     /translation="MKNTAIPQKRFRPTVLPDFRPSGLLELESNNKEGVLLKHVEPAD
                     ACEPNTFYAKTSIGQRPLYKLMVYRDDSLVQEFELMEKSSYIVGRASGETVVADIPIE
                     EDTCSKQHCVIQFRQQNGQLKAYLMDLESSNSTTLNGDEIPSSHYVQLRPGDIISSLD
                     SQYDLVFMNS"
     gene            complement(<872490..>874511)
                     /locus_tag="ZYRO0A10846g"
                     /db_xref="GeneID:8201803"
     mRNA            complement(<872490..>874511)
                     /locus_tag="ZYRO0A10846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494794.1"
                     /db_xref="GeneID:8201803"
     CDS             complement(872490..874511)
                     /locus_tag="ZYRO0A10846g"
                     /note="highly similar to uniprot|P16474 Saccharomyces
                     cerevisiae YJL034W KAR2 ATPase involved in protein import
                     into the ER also acts as a chaperone to mediate protein
                     folding in the ER and may play a role in ER export of
                     soluble proteins regulates the unfolded protein response
                     via interaction with Ire1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494839.1"
                     /db_xref="GeneID:8201803"
                     /db_xref="GOA:C5DQE5"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DQE5"
                     /translation="MLSNRWLAPLAVILYTLFLVVLPLGPRTNSVLVRGEEESYGTVI
                     GIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDEERLIGDAAKNQVAANPKN
                     TVFDIKRLIGLRYSDKSVQRDVKHLPYDIVDNKGKPGVRVTVKGEERVFTPEEISGMV
                     LSKMKQIAEDYLGKKVTHAVVTVPAYFNDAQRQATKDAGTIAGLNVLRIVNEPTAAAI
                     AYGLDKSSDEHQIIVYDLGGGTFDVSLLSIENGVFEVQATAGDTHLGGEDFDYKIVRQ
                     LIKQFKKKHGIDVSDNNKALAKLKREAEKAKRALSSQMSTRIEIDSFVDGIDLSETLT
                     RAKFEELNLDLFKKTLKPVEKVLEDAGLGKKDIDDIVLVGGSTRIPKVQQLLESFFDG
                     KKTSKGINPDEAVAFGAAVQAGVLSGEEGVEDIVLLDVNALTLGIETSGGVMTPLIKR
                     NTAIPTKKSQIFSTAVDNQPTVMIQVYEGERAMAKDNNLLGKFELTGIPPAPRGIPQI
                     EVTFALDANGILKVSATDKGTGKMETITITNDKGRLTPDEIEKMVEDAEKFASEDAAV
                     KKKIEARNKVENYAHSLKNQVNGDLGEKLEEKDRETLLDAASDVLEWLEDNFDSAMAE
                     DFEEKFNSLSKAAYPITSKLYGGAGEGASPDDEEDEEDDDGDYFEHDEL"
     gene            <875479..>877044
                     /locus_tag="ZYRO0A10868g"
                     /db_xref="GeneID:8201712"
     mRNA            <875479..>877044
                     /locus_tag="ZYRO0A10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494795.1"
                     /db_xref="GeneID:8201712"
     CDS             875479..877044
                     /locus_tag="ZYRO0A10868g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494840.1"
                     /db_xref="GeneID:8201712"
                     /db_xref="UniProtKB/TrEMBL:C5DQE6"
                     /translation="MTSKGTVLIYYGFRSGKSVAGDTGISSEAWTSYYYHDIGKSFRV
                     AAKSKRLNSKGFDRLQSSDGAGLIIDLSPSLQNDNDSATCQEDCLESTLEQNEFIAYS
                     AEAAAFAQFASIDAIILASNELANANCPKVSQVEHHKVRFWRNKRSRNDEMTNSSKDL
                     TERPAKRHHFRKWLNEVRDEVDLGYIYENRNRACAVAAEAARMATIRNNARAAAKVGA
                     TATAQMGTVRSRSRKSIQAGALATVKAVHLGTVSSHAREWMGICALEAASSAQTRLFE
                     QHATSVMHSRISTSDQEPFSNKNVEGEIHHGAQDTEEYVQNISQSTVVDPEDRNIHNH
                     NSQPLQDSSSGEDIKKETTSKIAGVYEQFEAASPAFPKLESGPLIEACGTYSPIESQS
                     EAKSEEEFWDCISPKESTSTESFFIESFDKQPSKLGSGELAQVIEGGDFENKLSSKSN
                     VLGWFSKTANDDTTIAAKTLEENTQECTTAAETNVWKSLGRQLGLFKKEEALNSDMEV
                     VSPFGDNQIGYAF"
     gene            <877423..>878169
                     /locus_tag="ZYRO0A10890g"
                     /db_xref="GeneID:8201713"
     mRNA            <877423..>878169
                     /locus_tag="ZYRO0A10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494796.1"
                     /db_xref="GeneID:8201713"
     CDS             877423..878169
                     /locus_tag="ZYRO0A10890g"
                     /note="similar to uniprot|P47058 Saccharomyces cerevisiae
                     YJL035C TAD2 tRNA-specific adenosine-34 deaminase subunit
                     Tad2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494841.1"
                     /db_xref="GeneID:8201713"
                     /db_xref="GOA:C5DQE7"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C5DQE7"
                     /translation="MALANVHLRHMETALRLGRYALDHGETPVACIFVHIPTDQIVAF
                     GMNDTNRSLTGVAHAEFMGIEQIREFVSPDELVPFFGDIALYVTVEPCIMCASALKQL
                     GIGKVIFGAGNDRFGGNGTVLSINQDSCTLGGKHESIPGVLRREAIMLLRYFYVRSNE
                     KAPKPRTKGERLLDKENFPPMQWQDYIDRDSFAQEFGDDKIACYDEKTDWTKDVKWAL
                     IEQRQDGILEELKQHHYQFGLWLKHKKVRR"
     gene            complement(<878270..>879523)
                     /locus_tag="ZYRO0A10912g"
                     /db_xref="GeneID:8201714"
     mRNA            complement(<878270..>879523)
                     /locus_tag="ZYRO0A10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494797.1"
                     /db_xref="GeneID:8201714"
     CDS             complement(878270..879523)
                     /locus_tag="ZYRO0A10912g"
                     /note="highly similar to uniprot|P47057 Saccharomyces
                     cerevisiae YJL036W SNX4 Sorting NeXin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494842.1"
                     /db_xref="GeneID:8201714"
                     /db_xref="GOA:C5DQE8"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DQE8"
                     /translation="MTSHNVGELPGGEASRKPQYRLEILVSDPQKRYGDQTSTSSYVS
                     YQISTKTDNPAYLKNHKSDDEIIVVHRRYSDLLLLYNILLNDHPTCIIPPLPDKKVFQ
                     YIAGDRFSQSFTQKRCHSLQNFLRRVANHPVLSNSSVLMVFLVSNDWDAYRKSLSGHL
                     QTNKEEVTDAFMNAFKTVHKQSDEFVEIKEKSDKLDHNVAKIDKIFHRVVKKNDSISE
                     DYATLGANLQDLQELCSGENEDLAKKAKVFNEGITQLSYGFRDLSKYLAYEYIVDLKD
                     LEHYIDSMGQLIKLKDQKQIDYEELSEYLTKSVNEKNNLISGYGGSNFFTNKLEELAG
                     INQEAARREKIDKLEGKINSLSGELESAKKIADAFEQETLREVALFEELKTKELKDSL
                     GSLADHHIEFYQKMLDAWVKVDESL"
     gene            complement(<879804..>881165)
                     /locus_tag="ZYRO0A10934g"
                     /db_xref="GeneID:8201715"
     mRNA            complement(<879804..>881165)
                     /locus_tag="ZYRO0A10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494798.1"
                     /db_xref="GeneID:8201715"
     CDS             complement(879804..881165)
                     /locus_tag="ZYRO0A10934g"
                     /note="similar to YLR015W, uniprot|P43132 Saccharomyces
                     cerevisiae YLR015W (BRE2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494843.1"
                     /db_xref="GeneID:8201715"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DQE9"
                     /translation="MKIGILPYQSQDIAYGPSDNQLRPPWPIFQETHEISDGQEKFEK
                     PEDMPLNRRNFVYRPCGANPFFKELGYCCSEYPFAKPGMNLMDRSDGVSLNRGNNECV
                     SVSNSMGWRTARCDVCIKEGLTYWEVEVVQGGTPSGFDTGHSFQKRKDIINETPHVRL
                     GISKREASLESPVGFDSYGYAIRDTSLESIHEGKVAQSLGTHSLKPGDRLGFLLQLPS
                     CQTQVDQAKEYTQRRLDALVQSTKNTYQDHEQPKKRSKTTNKNFQIALLADIDHSNVV
                     RDHIAIRYKNQLFFEATDYVKTTKPEYYSSDKRERQDYYQLEDSFLAVYLNGEPLGEA
                     FRDLKPFLPPFSELQYNEKFYFGYWKNGVDDPGHNAKRTGILLRNKYVNNNKLGYYPT
                     ISCFNGGTARIITTKQDCKYYDQLNKPAKLLEELFDEQIAEDVVWDIIDEIEEEFSDK
                     GSG"
     gene            <881429..>883996
                     /locus_tag="ZYRO0A10956g"
                     /db_xref="GeneID:8201716"
     mRNA            <881429..>883996
                     /locus_tag="ZYRO0A10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494799.1"
                     /db_xref="GeneID:8201716"
     CDS             881429..883996
                     /locus_tag="ZYRO0A10956g"
                     /note="similar to uniprot|P07272 Saccharomyces cerevisiae
                     YLR014C PPR1 Zinc finger transcription factor containing a
                     Zn(2)-Cys(6) binuclear cluster domain positively regulates
                     transcription of genes involved in uracil biosynthesis
                     activity may be modulated by interaction with Tup1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494844.1"
                     /db_xref="GeneID:8201716"
                     /db_xref="GOA:C5DQF0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DQF0"
                     /translation="MKRTIKQVEGEEEVSRKRPSSVVVGITKSISACKRCRTKKIKCD
                     HEFPSCKKCARANKPCVSLDPATGRDVPRSYVIFLEDRLTAMMNKLRECGVDPERVQG
                     NIPMTSEDNPCDIELYEERLRNEHQVPHDNLLAAYLINKGTSMQQGVGIADDEETASN
                     GGGSHISPQSGLTRSAELDESHKSITAIGSIKNNASNSYLGDSSGIPFAKLVFTAVNF
                     RPDSVEDESDEEIKQRESQYVDYSNAETTSAFEPLWLPPREIAESFVSQYFTDSNSQL
                     PVLHREYFLKKYFEPIYGSWNPSVSLASDHTKINTSFKLPRDCEDVQDEEPWYDSWKR
                     RYDREENITLPDKYEIPYFFLNMVFAIGESTQVLRSDTVRVVSFKRRALQFSKALNFS
                     PNRLESLAGTVLVAVYSLMRPNVPGVWYTMGSALRLAVDLGLHAEKLNRNYDPFTREL
                     RRRLFWCVYSLDRQICSYFGRPFGIPEENITARYPSMLDDALITTTNDDIVDYSKMKS
                     SMASPKVVALAMFKVRRLQANIVQVLYAPNGEVPRSFSNLESWKFEMHRSLDNWFRKE
                     VPKTYKKMNSKFNTEFFNLNYWFTKSMLYGLSPKILTLDDYAFDVVYDSTRGSIDVFY
                     KLCHNSKINYTWVTVHMLFMTSMTYLYSIYYSDRGIRDGRKMAENYVSKLLYVLRKLI
                     GTCEAAKNCYNICKVLSAAMIKLRFDGNKTEENSTPRYPQVMSSNSSPVDILEGTLDM
                     PKIKPDSFDVPLDQFFDELERVTLQSDPESTRSKFSSHDSPQLPNVNYPSLEAEDGAD
                     VERDRSANGKDGQRIIDMVTQVTTDSIWSEFFNKARSSNGFTINEDELNKGASNFPL"
     gene            884115..884196
                     /locus_tag="ZYRO0A10978r"
                     /db_xref="GeneID:8201717"
     tRNA            884115..884196
                     /locus_tag="ZYRO0A10978r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=83.48"
                     /db_xref="GeneID:8201717"
     gene            complement(<884402..>885424)
                     /locus_tag="ZYRO0A11000g"
                     /db_xref="GeneID:8201718"
     mRNA            complement(<884402..>885424)
                     /locus_tag="ZYRO0A11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494800.1"
                     /db_xref="GeneID:8201718"
     CDS             complement(884402..885424)
                     /locus_tag="ZYRO0A11000g"
                     /note="highly similar to uniprot|Q07748 Saccharomyces
                     cerevisiae YDL244W THI13 Protein involved in synthesis of
                     the thiamine precursor hydroxymethylpyrimidine (HMP)
                     member of a subtelomeric gene family including THI5 THI11
                     THI12 and THI13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494845.1"
                     /db_xref="GeneID:8201718"
                     /db_xref="GOA:C5DQF1"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="InterPro:IPR027939"
                     /db_xref="UniProtKB/TrEMBL:C5DQF1"
                     /translation="MATEKITFCLNWQAAPYHIPIYLALTKGYFKEQGLDIAVLEPSN
                     PSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGLLYLPDSGITED
                     FQSLRGKKIGYVGEFGKIQLDELTKHYGMTPNDYTAVRCGMNVAKYIIEGKIHAGIGI
                     ECMQQVQLEEFLKEQGRSASEAKMLRIDKLACLGCCCFCTVLYICNDEFLKKNPEKVK
                     KFLKAIKKSTDYVLQNPEAAWNEYIDFKPALNNSLNFKQFQRCYAYFSESLYNVHRDW
                     RKVTGYGKRLEILPPDYVSNYSNEYLTWPEPEEVSDPLEAQRLMGIHQTACREEPSFK
                     RLALPA"
     gene            <885779..>886216
                     /locus_tag="ZYRO0A11022g"
                     /db_xref="GeneID:8201719"
     mRNA            <885779..>886216
                     /locus_tag="ZYRO0A11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494801.1"
                     /db_xref="GeneID:8201719"
     CDS             885779..886216
                     /locus_tag="ZYRO0A11022g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494846.1"
                     /db_xref="GeneID:8201719"
                     /db_xref="UniProtKB/TrEMBL:C5DQF2"
                     /translation="MSQLVVDLNELEGLLPSNGSRFRVVAQLIELEYLEGTSKVILGN
                     LPEFRYSDEGKTLKATIGTSVYESTFLQGNRVPQRGDAVSVWLVVYALGEERCWEVLE
                     LKTITTKELNRLRIFWESSWGHEFRALSSSSRRDDVADHNEKL"
     gene            <886222..>887424
                     /locus_tag="ZYRO0A11044g"
                     /db_xref="GeneID:8201720"
     mRNA            <886222..>887424
                     /locus_tag="ZYRO0A11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494802.1"
                     /db_xref="GeneID:8201720"
     CDS             886222..887424
                     /locus_tag="ZYRO0A11044g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494847.1"
                     /db_xref="GeneID:8201720"
                     /db_xref="GOA:C5DQF3"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DQF3"
                     /translation="MLRLIMDKQRIMIKHVVKRFQHTFQPYETVLARLLSKPNEKFHL
                     SKPLQAGEVINTGNGPIRHEDVIGKPYRSLVTSSTSTSHQYMLCRPSLEEYVVNKRRE
                     AQPIYPLDAGLIVQLSDVHADFPDMELGPSIDVEKPASFQRLNLSERYDRFLHDRWEN
                     RKSQLPQGLRTCAPPKQYLECGTGHGSLTLQICKEIHSGNAYYDGNDSTRGSILHSLD
                     RNDKHLATGVRNLKHYDRGIYWTDVEFHLLTESEQGPSQWLQGPAASYYRDVVGRLAG
                     RPGGFLNGAFLDLPSPQDHLETIAQNLVAESPLIVFVPSITQLWDCLCQIKTVGIPLS
                     MTRVLELMPGSGGGGMREWDLRRTVIRETGKESMVVRPKVGARVVGGGFVGIFKKLPA
                     DSVVRTWR"
     gene            complement(<887519..>888118)
                     /locus_tag="ZYRO0A11066g"
                     /db_xref="GeneID:8201721"
     mRNA            complement(<887519..>888118)
                     /locus_tag="ZYRO0A11066g"
                     /product="ribosome biogenesis protein RLP24"
                     /transcript_id="XM_002494803.1"
                     /db_xref="GeneID:8201721"
     CDS             complement(887519..888118)
                     /locus_tag="ZYRO0A11066g"
                     /note="similar to uniprot|Q07915 Saccharomyces cerevisiae
                     YLR009W RLP24 Ribosomal Like Protein 24"
                     /codon_start=1
                     /product="ribosome biogenesis protein RLP24"
                     /protein_id="XP_002494848.1"
                     /db_xref="GeneID:8201721"
                     /db_xref="GOA:C5DQF4"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="InterPro:IPR024546"
                     /db_xref="UniProtKB/TrEMBL:C5DQF4"
                     /translation="MRIHQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRR
                     NPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVDTTLKAMEKIEDIRKK
                     RERAFYKNRMKGNEEQDFLRDKQLVENNPELLRIREVEMAQILAKEQEKAEAAEEEDE
                     EEEEEEDMEVDEDEEEEEEKEKQKIVLKNKKRNQKKLAF"
     gene            <888349..>888855
                     /locus_tag="ZYRO0A11088g"
                     /db_xref="GeneID:8202048"
     mRNA            <888349..>888855
                     /locus_tag="ZYRO0A11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494804.1"
                     /db_xref="GeneID:8202048"
     CDS             888349..888855
                     /locus_tag="ZYRO0A11088g"
                     /note="similar to uniprot|Q07914 Saccharomyces cerevisiae
                     YLR008C PAM18 Constituent of the mitochondrial import
                     motor associated with the presequence translocase along
                     with Ssc1p Tim44p Mge1p and Pam16p stimulates the ATPase
                     activity of Ssc1p to drive mitochondrial import contains a
                     J domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494849.1"
                     /db_xref="GeneID:8202048"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5DQF5"
                     /translation="MASDPSRNDNLAGLSAPQLPIPGQDNSRIHEDQNVALEAPKPMA
                     PSQKQGMDLYFDQALEKMGQHPVLTGVGTFFALYVAAGAYKSITSKVRGEKGAAAFLK
                     GGFDAKMNQNEALQILNLNESQLNKRKLKEVHRRIMLANHPDKGGSPYLATKINEAKD
                     FLEKKVLK"
     gene            complement(<888913..>889821)
                     /locus_tag="ZYRO0A11110g"
                     /db_xref="GeneID:8202049"
     mRNA            complement(<888913..>889821)
                     /locus_tag="ZYRO0A11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494805.1"
                     /db_xref="GeneID:8202049"
     CDS             complement(888913..889821)
                     /locus_tag="ZYRO0A11110g"
                     /note="similar to uniprot|Q07913 Saccharomyces cerevisiae
                     YLR007W NSE1 Essential nuclear protein required for DNA
                     repair forms a complex with Smc5p and Rhc18p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494850.1"
                     /db_xref="GeneID:8202049"
                     /db_xref="GOA:C5DQF6"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="InterPro:IPR014857"
                     /db_xref="UniProtKB/TrEMBL:C5DQF6"
                     /translation="MTEDIEFTDPNGNTAQPSESGTVIPETDKSITDHDIARYLLQYL
                     LDCRGICHENMLLVVLDKLQKYTQDPTSQVCSTDKLVEIIKGINVKLNPLGYKISRVG
                     HGMGKNNVSSMLKDTGLPSNNRFYVYVNTVTSEESKLATRFSTREIEFIKWCVEKMCV
                     SRDCEVIIDCPIITEVDRIRNDVSWNKCITYSVESSEFFQYKDWSPIEIESLLFKLCG
                     LKWFAKDENGRISMDLRCSVELEEYLIANGISTCENCHRLALQGTRCTSCSRSWHVDC
                     YQHRITHIGKYCPCGESILQNGMYIV"
     gene            complement(<890189..>892285)
                     /locus_tag="ZYRO0A11132g"
                     /db_xref="GeneID:8202050"
     mRNA            complement(<890189..>892285)
                     /locus_tag="ZYRO0A11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494806.1"
                     /db_xref="GeneID:8202050"
     CDS             complement(890189..892285)
                     /locus_tag="ZYRO0A11132g"
                     /note="some similarities with uniprot|Q22X91 Tetrahymena
                     thermophila SB210 TTHERM_00561660 Viral A-type inclusion
                     protein repeat containing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494851.1"
                     /db_xref="GeneID:8202050"
                     /db_xref="UniProtKB/TrEMBL:C5DQF7"
                     /translation="MRTPDHFKIPKERRADYWDYKPSRDELIKEPLITPIHEIKNQNK
                     LINSAMLYFSKPSHRDHGFYPDPKIPYEAYFANETEEREKLRFGENETITFDINEEVG
                     KLVMKEAEYKPASQHGALDQKNTKNKSILKTNPRTVIPYRPHANPYIDACQEVMIKCY
                     NMCGISVDYLDIDKMFDSLGKLMFGISNEFKMKELCFNYVLAAEKRKWFEEKEDLKAS
                     VEQFKTERLGLCELNVELGIKLQQESKRVENLQKLLVKLEQFDKVQQENTGLALVNTD
                     LTSKNDQLTSKLLNLEAKVLQLSDVDRTNVELNDKISALTSKNESLSDDYDKLFKEKQ
                     ELESKNSELLQNNNELRSERERWLERNENLIINSTDFNVKMEERNAKIKFLEAQIENI
                     KAKYDRDTKSDMKYFKNKINDMLRENVNQTSQMEKVIVNLNQANYKVDELLKDNESLR
                     VDNNNMRADLQQKLKDIKDLQLQLKQDKVTFTKYEKLENEKTACDKALVHLRQEYRTL
                     QESFQNLKEVHSNLDDQNKELSQYRKAAHDALCELNEEVGKLEDMNAVLQDGKRIDQI
                     QINDLNCQVKKHIETIELLERSNSKFRKKPQELENKIQTLQCEYERLDKQYKDRETEI
                     QQAKLNMRKMTTSLYNARMNASDHENRCTAADYNGLTSNSAKAPLRKRDMLRSLANRR
                     TVLVTEPSQSLNKNIY"
     gene            <893793..>896123
                     /locus_tag="ZYRO0A11154g"
                     /db_xref="GeneID:8202051"
     mRNA            <893793..>896123
                     /locus_tag="ZYRO0A11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494807.1"
                     /db_xref="GeneID:8202051"
     CDS             893793..896123
                     /locus_tag="ZYRO0A11154g"
                     /note="similar to uniprot|Q07084 Saccharomyces cerevisiae
                     YLR006C SSK1 Cytoplasmic response regulator part of a
                     two-component signal transducer that mediates osmosensing
                     via a phosphorelay mechanism dephosphorylated form is
                     degraded by the ubiquitin-proteasome system potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494852.1"
                     /db_xref="GeneID:8202051"
                     /db_xref="GOA:C5DQF8"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:C5DQF8"
                     /translation="MSESSTLKLRPTSPLSVNRNVALNSALSWKIWLRLEDYEESINQ
                     AFSLQFGELDTIDDLKTKIFENLNTIRWSRVNDNASIALGFYCNRTDWEPDRFSPIQR
                     LPTSPVNTLFGKSKPLQQPSAASTKRSFADNDSKSGSLNTSPRISASGSPKLSAVPRL
                     PTARYGPNIGSPFLSVQNGGVNNNGGSNGVGSTGLARLPGGVAPTLSPLPFSGGRLAL
                     TSWSKKDLKHSVEPVGDSLYRILFEPDELVLTIYNELFGHLGSQAASDALLVFCNDII
                     PKHEMLPASAMDGPNFASNQLTQELLNSQNRKREQEGLRLDTRDPHDLLQPGLETPPT
                     IGALNPGDAPPELVLDDTAAQLAREESEREFQLITNEEQLRKVSQSMLDEDNPDSPKQ
                     AILLLPKNFDGDVNFNESPSKMSSRPSSPLTTVGDTSNENTDSNINIGGFNGDNNNIN
                     ANINTNTHNYKNNDNNNNSQESQLSMPLVDRPRTDDSLMQSHAPLIEKEVGMVHPLLE
                     NDRKKGLSSPTSPLLPRNPPPNFNRLSRSFAPKNGSSREKPFPGEWSATSDKVFPKIN
                     VLIVEDNVINQTILSSFLRKHKIFYKVAKNGQEAIDVWREGGIHLIFMDLQLPVLSGI
                     DAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEAL
                     ISGCNDYLTKPVNLHWLSNKINEWGCMQALINFDSWKEGQSRMTDNVLVKAPSQRSVK
                     AVSGNPDIKYRMNRRRSRSSSTSSQSKISEALRLAP"
     gene            complement(<896333..>897766)
                     /locus_tag="ZYRO0A11176g"
                     /db_xref="GeneID:8202052"
     mRNA            complement(<896333..>897766)
                     /locus_tag="ZYRO0A11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494808.1"
                     /db_xref="GeneID:8202052"
     CDS             complement(896333..897766)
                     /locus_tag="ZYRO0A11176g"
                     /note="highly similar to uniprot|Q04673 YLR005W
                     Saccharomyces cerevisiae SSL1 Component of RNA polymerase
                     transcription factor TFIIH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494853.1"
                     /db_xref="GeneID:8202052"
                     /db_xref="GOA:C5DQF9"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DQF9"
                     /translation="MPPVIDPESDEDEEQVQVSSKETRRHKRELDQDEENDNDDDEGD
                     VKSGSKSSSNPKDRNGKASKDPKRNGRSARRNKTSNKALQGASGGYAWEDEIKRSWDL
                     VPADDEGDMAALAASIVESRKKRTAQKNISPYQRGIIRTLILVLDCSEAMLEKDMRPN
                     RHAMLVQYSIDFVHEFFDQNPISQIGIVSMRNGLAHMISQVSGNPQDHVDALKSIRKQ
                     EPKGNPSLQNALEMTRGLLLPVPPHCTKEVLIVFGSLSSTDPGDIHLTIGSLVQEGIR
                     VKIIGLSAQVAICRELCKATNYGDESFYKVPLDEIHCKELFAEAVTPLPVNKINKGFT
                     LVKMGFPTRIFEEAPTFCACHSKLLYGGYFCPNCQSKVCSLPMVCPCCDLMLILSTHL
                     ARSYHHLMPLKTFSEVPTGQVFPTENCFSCQVRFPTVKNHKTGELLTSSRYRCEDCLK
                     DFCIDCDVFIHEILHNCPGCESKPTIT"
     gene            complement(<899061..>899918)
                     /locus_tag="ZYRO0A11198g"
                     /db_xref="GeneID:8202053"
     mRNA            complement(<899061..>899918)
                     /locus_tag="ZYRO0A11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494809.1"
                     /db_xref="GeneID:8202053"
     CDS             complement(899061..899918)
                     /locus_tag="ZYRO0A11198g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494854.1"
                     /db_xref="GeneID:8202053"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DQG0"
                     /translation="MSMISYEGEMDLEKCVQMYEEEEIELPEDSTSGKLVYFLAPYFF
                     EKTWIYDIIVSLSGAFISSAVLLVYISLRDFYHNPLESELSVEFSPLWTISHYFLCFT
                     FSFLNFIHHRKKVNIETKALQKLLKEVAGVDLTGDPVAWRRIASRVNHFSEETGYRYS
                     LFYSGEHCMRFFVREIVKPIECQTYDIRCYCEGEMYSNFWKNPSNKALTERALAKYNK
                     SVENFGELSHTAERDEFRDGTFERFRNIFNTSILYFWVIELGSFLILLLTFIISMIVW
                     GIFHSFATA"
     gene            complement(<901859..>902716)
                     /locus_tag="ZYRO0A11242g"
                     /db_xref="GeneID:8202054"
     mRNA            complement(<901859..>902716)
                     /locus_tag="ZYRO0A11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494810.1"
                     /db_xref="GeneID:8202054"
     CDS             complement(901859..902716)
                     /locus_tag="ZYRO0A11242g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494855.1"
                     /db_xref="GeneID:8202054"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DQG1"
                     /translation="MSVISYESEMDLEKCVQTFEEEEIQLPEDSSGGKLTYFLAPYFF
                     EKTWISNILASLSAAFMSSAAPLVYFSLRDFYHDPLESELSDFLSPLWMIIHYLLCFT
                     FSIFSFIDDRKKVKIETKVLQKLLKEVAEVDLTGDPVAWQRIASRVNHFSEGTEYRYS
                     LFYSGEHCMRFFVREIVKPIERQTYDIRYYCEGKMYRNFWKNPSNKALVERAVANYNK
                     NVKNFGELSHIAEKDECRDDIFEKFRNIFNISMLYLGVIEFASFMIMILTFIISMIVW
                     GIFHSFATA"
     gene            complement(<905159..>906016)
                     /locus_tag="ZYRO0A11286g"
                     /db_xref="GeneID:8202055"
     mRNA            complement(<905159..>906016)
                     /locus_tag="ZYRO0A11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494811.1"
                     /db_xref="GeneID:8202055"
     CDS             complement(905159..906016)
                     /locus_tag="ZYRO0A11286g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494856.1"
                     /db_xref="GeneID:8202055"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DQG2"
                     /translation="MSMISYEGEMDLEKCVQMYEEEEIELPEDSTSGKLVYFLAPYFF
                     EKTWIYDIIVSLSGAFFSSVAVFVYFSLRDFYHDPLESELSVEFCPLWTISHYFLCFT
                     FSIFGFINDRKKVKIETKVLQKLLKEVAEVDLTGDPVAWQRIASRVNHFSEGTGYRYS
                     LFYSGEHCMRFFVREIVKPIECQTYDIRCYCEGEMYSNFWKNPSNKALTERALAKYNK
                     SVENFGELSHTAERDEFREGIFERFCNIFNTSMLYLGVIEFASFFILLLTFIISMIVW
                     GIFHSFATA"
     gene            complement(<907471..>908328)
                     /locus_tag="ZYRO0A11308g"
                     /db_xref="GeneID:8202056"
     mRNA            complement(<907471..>908328)
                     /locus_tag="ZYRO0A11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494812.1"
                     /db_xref="GeneID:8202056"
     CDS             complement(907471..908328)
                     /locus_tag="ZYRO0A11308g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494857.1"
                     /db_xref="GeneID:8202056"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DQG3"
                     /translation="MSMISDESEMDLEKCEQTCEEEEIELPEDSSGGKLTYFLAPYFF
                     EKTWIEDIIFSLSGAFISSAAVLVYFSLRDFYHNPLESELSDEFCPLWTISHYLLCFT
                     FSIFSFIDGREKVNIETKVLQKLLKEVAEVDLTEDPVAWRRIASRVNHFSEETGYRYS
                     LFYSGEHCMRFFVRQIVKPIECQTYDIRSYYEGEICSNFWKNPPNKALTERALAKYNK
                     SVENFGELSHTAERDEFRDGIFERFRNIFNTSILYFWVIELGSFLILLLTFIISMIVW
                     AIFHSFATA"
     gene            complement(<910040..>910897)
                     /locus_tag="ZYRO0A11352g"
                     /db_xref="GeneID:8202057"
     mRNA            complement(<910040..>910897)
                     /locus_tag="ZYRO0A11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494813.1"
                     /db_xref="GeneID:8202057"
     CDS             complement(910040..910897)
                     /locus_tag="ZYRO0A11352g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494858.1"
                     /db_xref="GeneID:8202057"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DQG4"
                     /translation="MSMISDESEMDLEKCVQMYEEEEIELPEDSTSGKLVYFLAPYFF
                     EKTWIEDILFSLSGAFFSSVAVFVYFSLRDFYHNPLESELSVDFCPLWTISHYFLCFT
                     FSIFSFINDRKTVNIETKVLQKLLREVAGVDLTEDPVAWQRIASRVNHFSEETGYRYS
                     LFYSGEHCMHFFVREIVKPIECQTYDIRCYCEGEMYSNFWKNPSNKALTERALAKYNK
                     SVENFGELSHTAERDEFRDGTFERFCNIFNTSMLYLGVIEFASIFILLLTFIISTIVW
                     AIFHSFATA"
     gene            <911217..>911912
                     /locus_tag="ZYRO0A11374g"
                     /db_xref="GeneID:8201969"
     mRNA            <911217..>911912
                     /locus_tag="ZYRO0A11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494814.1"
                     /db_xref="GeneID:8201969"
     CDS             911217..911912
                     /locus_tag="ZYRO0A11374g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494859.1"
                     /db_xref="GeneID:8201969"
                     /db_xref="UniProtKB/TrEMBL:C5DQG5"
                     /translation="MSNKKKSKSKASESHKRGGRENSPRGQHNSLSPQRDNSISDQQG
                     SENSGTGSGTNGIKLAARLFRNPLFSKRGLKHAKEGLRIKSSDKSISKLRCIGSGFLF
                     LYPFLLIGYCIAGFLAGDINSKHAFLYGIPLCIAVPYFIRCLDDVDTLLSSIFEIGEK
                     SLLGYFADPVIREFLLTVFEIVGHIYKCIEGTQKSRIYIWRILSFICYLLGNICLIMK
                     RREKPESIVGNST"
     gene            <913083..>914654
                     /locus_tag="ZYRO0A11396g"
                     /db_xref="GeneID:8201970"
     mRNA            <913083..>914654
                     /locus_tag="ZYRO0A11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494815.1"
                     /db_xref="GeneID:8201970"
     CDS             913083..914654
                     /locus_tag="ZYRO0A11396g"
                     /note="similar to uniprot|Q07904 Saccharomyces cerevisiae
                     YLR004C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494860.1"
                     /db_xref="GeneID:8201970"
                     /db_xref="GOA:C5DQG6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DQG6"
                     /translation="MNKTSPPEAEKIDEQVDISSTKDDSTFTSGDDDADIALKFLTHK
                     NAKSYVSEEDEELNTTEKNFYGSSALPPKLLRKIDACVLTFLCFAYLLMFLDKTLLNY
                     AASMGIKEHLKGNEFSNLGTIFYASYIFMEPIVSFLIQRYPLSKVMGTFITCWGIVLA
                     CHCACKSYTSLMIVRTLLGVFESSSAVGCITISGMYYTKSEQCARIGYWTSQAGTGYI
                     VGGLISFGFLHYHGKDFTSWQIMFLVVGLFTVLFGLLTLVILPDNVTNAWFLSEEEKI
                     LVVKHIKDNQTGLENKKFKWSHIKELFLHDKLTWPMLVITACSQMTTGAIGTFSVTIT
                     QTFGFDKYVTALLQLPIGAITIIIMIITTQMMSRWGQITLVTTSMYIPTIIGCIVMLS
                     LPLSHKIGNLFSLYLLYSGSSVITNIYVWNSLNTSGYSKRIFRNAATLMVYSLAYILA
                     PQTFREANYPGYVPAKITLLVTQCICVPLQLYVGYVCLTENKKRDKEQEGKDVGKYDF
                     RDLTDIQNRNFRYMY"
     gene            <914813..>915673
                     /locus_tag="ZYRO0A11418g"
                     /db_xref="GeneID:8201971"
     mRNA            <914813..>915673
                     /locus_tag="ZYRO0A11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494816.1"
                     /db_xref="GeneID:8201971"
     CDS             914813..915673
                     /locus_tag="ZYRO0A11418g"
                     /note="similar to Q07897 YLR003C uniprot|Q07897
                     Saccharomyces cerevisiaeCMS1 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494861.1"
                     /db_xref="GeneID:8201971"
                     /db_xref="UniProtKB/TrEMBL:C5DQG7"
                     /translation="MPNADDLDDGLDYNYESDPEAEEVAVEDTGAEESKDSQEDEPEE
                     KPHDDDKKRKAGESSEREGRPLSKRQKKLQNSKLKDKKEEQVKYQLDKKKTIPKSSPE
                     EIVEYLATLIREKNPDLSGLELDEMYLKKSDFLSTEKFQEDRNLTNLPNFMSQFSKSP
                     RTIVLSLTNLRIADIYRSLGGNKACVKLFAKNKLKDDLATVEEILSAKSKKNEHIRYF
                     IATPTRLEKLIESTDLFFQGKEKLDILLDASYMDPKANTLLNCENTTVLCKLLKTFLN
                     KKSSVKVLLY"
     gene            complement(<915716..>917839)
                     /locus_tag="ZYRO0A11440g"
                     /db_xref="GeneID:8201972"
     mRNA            complement(<915716..>917839)
                     /locus_tag="ZYRO0A11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494817.1"
                     /db_xref="GeneID:8201972"
     CDS             complement(915716..917839)
                     /locus_tag="ZYRO0A11440g"
                     /note="similar to uniprot|P27351 Saccharomyces cerevisiae
                     YJR005W APL1 beta-adaptin large subunit of the
                     clathrin-associated protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494862.1"
                     /db_xref="GeneID:8201972"
                     /db_xref="GOA:C5DQG8"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:C5DQG8"
                     /translation="MSDQRIFARYKATEIRAELQNFDAKRSKVSATKRKVALRKIIAN
                     LKMGNYNEMVLLYPEMLKFWQVEDDLEVKRICHEYVRTLGAAKPQSAKEALGAVLGDL
                     ENKNEEVQIMSLRTLSAVTSLEYINEAFKAVGYVLARRGVPQNLLKTAILLLKYMDDL
                     DHDRVSSTLDSLYDIFERQLASPTVQVAALHTIYAIHEKNTDLKPLRLELDVAMGLLD
                     LLPQLNEWDKAMVLESLTTSAVPQTHSDVCAMIELVLPQLQHANTYVALNAFKFIAYL
                     LNYAEHVNEGLIKRFSNSIVSLLNKPPELEFLVLRNIILLLLSRGASLLKLDVSFFFI
                     EYNDPIYIKDTKLECLYLSADHETLPRILEELVQYATDIDIQMSRKAIRAIGNLAVKL
                     NEEAAHDCVDALLDLLEFGVDYVVQEIISVFRNILRKHPKRFESIIGELVKHTESVQE
                     PEAKNAMIWIITNYSYALPNYLEFFQVFSSNLLEETSDVQFSILTSSVKFFIRNPNYQ
                     TEKICIKALKQCTEEINNPDLRDRAFMYWRLLSLAQSPKSHLLSNDSMTKLIDGELPA
                     IQLSTKLDPVILEELELNIGTIASIYLKPVSQVFRNTRTKRLLPSPILNPNKENLKVI
                     NDGSTNLNSGAFERVPEWETIGQSDDVSVASPRRTKTMMNDYDKPAEKVNQLKGKRKS
                     SSAGPSTLSRKPSMLVRKLSMKKPF"
     gene            <919106..>922453
                     /locus_tag="ZYRO0A11462g"
                     /db_xref="GeneID:8201973"
     mRNA            <919106..>922453
                     /locus_tag="ZYRO0A11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494818.1"
                     /db_xref="GeneID:8201973"
     CDS             919106..922453
                     /locus_tag="ZYRO0A11462g"
                     /note="some similarities with uniprot|P20840 Saccharomyces
                     cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
                     binds to Aga1p during agglutination N-terminal half is
                     homologous to the immunoglobulin superfamily and contains
                     binding site for a-agglutinin C-terminal half is highly
                     glycosylated and contains GPI anchor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494863.1"
                     /db_xref="GeneID:8201973"
                     /db_xref="GOA:C5DNT9"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR008966"
                     /db_xref="InterPro:IPR024672"
                     /db_xref="UniProtKB/TrEMBL:C5DNT9"
                     /translation="MYKTFNSIRSILFLLCLAWHTFAKEINGVSFSGLKFTPLSSLHY
                     PHQGWSASFDFEIENGSSVSKGDYFTLNFPTVYRIKFDDNKLTTNATLQDGSEAFECF
                     AAQQAAYKNEDTVFKCVAIQGLSSYSSLSGSLSFGLSFSSGGSSYEYEMQNADKFHSG
                     TMQVSLADQLSASVEFDSANFTKDIYTIGRSTTFNSLESYYLGMSCPNGYLLGGTQTI
                     NYDRENKGYDLDCSSVQVYLSDQFNDWSLPLKGDNANAKVDCSDDTLKVNMNEAKPNQ
                     KLWINALQDVSAGVNTIQHEVHLQYSCSDTEQKTTYSTQFSTVVEYTIYQASDSGTLS
                     GLTATSASSSSPVVTTPTITSTITTGWTGTYNTTYSTGSTELSGSGDVPTEEIIYYVE
                     TPSESSVPQTTTTTTTTGWTGTYTTTYSTGSTELSGSTGAPTEEIIYYVETPSESSVP
                     QTTTTTTTTGWTGTYTTTYSTGSTELSGSTGAPTEEIIYYVETPSETVTPQTTTTTTT
                     NIWSGSYTTTYSTESTSLYFSTGVPMEEVIIYVETPESKVAPSSSTPQSKTTVTSTTT
                     TGWTGKYNSTYSTASTILVGSTGIPTEEIIYYFETPETQLFNTSSTPAPSSSTTIGIV
                     TTTTTTTTGWTGTYTTTYLTASTSLGGNTGTLTEEIIYYVETPNTTVFPPPSTSVTSK
                     ANITSSTSQISSTSWSSKVNLTSSTPHLVTLSTTDLNSTYLTTCDCSESVPTINWSSS
                     STSNTITSVPPSETSYVPQSSSASVSKSSLNITSTSSPSASIQSISTLPSPTSSDVFN
                     STISPSLPVSSFSTLSTSSAQNSINSTHVTTTTPTAETFFSTTANSTGSNYLTSSRPI
                     STSSVETTSVTNSTSVPPAITSNPIITSPWVTATATTLQSRTEASSTSVGNFSSTTSA
                     ATLTPTTEASSTIIADSSTTPVTSVAIPSSTSATLSTDSATTSTSPIIPIAASSSSSS
                     SSSSAPSSGFSSAAAVSTTPSPSSSGGRFSLGLSLDQGSIAQIPIAQSSTPCSTSTKI
                     STATVTVTKNSTTTKHVTAPVTHTVTQKVSDCHCPVESHQSSLEPYFNNNSSDTGPSI
                     APYSGQGLVLKRGNSITALIGVLLFIL"
     gene            <923141..>925120
                     /locus_tag="ZYRO0A11484g"
                     /db_xref="GeneID:8201974"
     mRNA            <923141..>925120
                     /locus_tag="ZYRO0A11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494819.1"
                     /db_xref="GeneID:8201974"
     CDS             923141..925120
                     /locus_tag="ZYRO0A11484g"
                     /note="weakly similar to uniprot|O00026 Saccharomyces
                     cerevisiae YOR066W Protein of unknown function potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494864.1"
                     /db_xref="GeneID:8201974"
                     /db_xref="UniProtKB/TrEMBL:C5DNU0"
                     /translation="MEKPVRKRGRPPITKDYANPLESPMAHSSLRMQRQGAQVFQRPT
                     MKVGSVTPSPKNRSFSNSGIGNGANNNTMGNNSGSTLVESGSQPGSSTKKARYRGVIL
                     STPTKWPAGGKNDNGTGSTGTPTPSSSDSVFCSASKLALKSSPPLSTSPLKDENDENS
                     SNNIKNNFSTAKRAGPNFTNSSSSQQFKFSLTIGENGRASIAGSSSQDSTPCKSNDPQ
                     QLNSDGQDNREDLGLQTFEKRKVLTLLKQMRNDAAPPSPSNTVSRVKKPKHNHKKQNS
                     YGETELPPILESCAGVNSGTNVGGKSPKAPPVWTQSPQPPSTPKTSFSIRTGFTPNIG
                     IDQVLLDVVASPKSAGPTENPLNYGYLSNMISLSPRTKSPEFPQQEQSQRQSQQDHQE
                     SQQQQQQQQQQQQQQQQQQQKDEEQQKQKQQTQQQFVFKFSGADPLLLTDDADGNWSE
                     IIYNHLQNSPRPQICFNTPPSWVNFGSPRAAGFTPQARRDSTSQSALENDPSKSIKGL
                     SQVNRRDSIINLSSSPPRRELFPASPLRRPSLPYSTTLTPRITTNTTTVAGNHNDKLV
                     PEPSTPRGQEVQLPAMIECTPLIQQTMNGSLTTKYLSNVLSNTANGTNANGINDCGAF
                     AEAALPVKDPIRHLSSPGGEQEDARAALKKLIAER"
     gene            complement(<925282..>926952)
                     /locus_tag="ZYRO0A11506g"
                     /db_xref="GeneID:8201975"
     mRNA            complement(<925282..>926952)
                     /locus_tag="ZYRO0A11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494820.1"
                     /db_xref="GeneID:8201975"
     CDS             complement(925282..926952)
                     /locus_tag="ZYRO0A11506g"
                     /note="highly similar to uniprot|P40351 Saccharomyces
                     cerevisiae YOR067C ALG8 adds glucose to the
                     dolichol-linked oligosaccharide precursor prior to
                     transfer to protein glycosyl transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494865.1"
                     /db_xref="GeneID:8201975"
                     /db_xref="GOA:C5DNU1"
                     /db_xref="InterPro:IPR004856"
                     /db_xref="UniProtKB/TrEMBL:C5DNU1"
                     /translation="MKSGRQLNKQEQLAAMGTRRFSLWNFWIASLVLKILLIPDYFST
                     DFDVHRNWLAITHNLPLRQWYYEATSQWTLDYPPFFAYFEWFLSQFVPGTVKQDGCLE
                     IVDKGQFGWSTLVFQRSTVILSEILLFVVLQVFINTSSVTERTQSFVIASSIVLSPAF
                     LIVDHIHFQYNGFLFAILIASIVAAKRGKYLWCATFYSVALCFKHIFLYLAPCYFVFL
                     LRAYCLNFQDFKFKSYKDLIFIVKWRHLFQLGSIVIGVFALCFGPFVKDLPQVLTRLF
                     PFSRGLTHAYWAPNFWALYSFLDKILTVVMLKLPYVHQFTSKFIQPPLIPSTIDEIKQ
                     RIAQNNNGTKGLVQDVFFVILPQITPKLTFALTAFYQVLAVIPVLFDPSYKRFIGSLT
                     LCGLASYLFGWHVHEKAIMLAIVPFSFLVACDRRLLTSYMLLAASGYVSLFPLLYENQ
                     DFLLKCLYTLVWCMIYFYALRKTTFLSSSVERRVFFLDRLSMIYIYLLLPLVLGVQFL
                     DMMKWRYPLFQKFEFVSLMSYSVYCSLGIIGSWAGLSWLYNFDEPLWE"
     gene            <927139..>929091
                     /locus_tag="ZYRO0A11528g"
                     /db_xref="GeneID:8201976"
     mRNA            <927139..>929091
                     /locus_tag="ZYRO0A11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494821.1"
                     /db_xref="GeneID:8201976"
     CDS             927139..929091
                     /locus_tag="ZYRO0A11528g"
                     /note="similar to uniprot|Q92331 Saccharomyces cerevisiae
                     YOR069W VPS5 Component of the retromer coat that retrieves
                     proteins from late endosomes sorting nexin I homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494866.1"
                     /db_xref="GeneID:8201976"
                     /db_xref="GOA:C5DNU2"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="InterPro:IPR028648"
                     /db_xref="UniProtKB/TrEMBL:C5DNU2"
                     /translation="MDYDDDLNAPVWDDLNPPKQASVPELSDTFADLNTDEANQGEEE
                     EEDEGVNSGEETHTAEHENSDNLLNTLAPQEDPLVDLQTANEASILSSPTKGADDPLF
                     SASTYQPLVFGDTNDQDLSQSTPVLSSAARKSGKPRMLFNSARMRRRPLDKKASNTTT
                     TTTVTNNNANSEVADPLGKIKKETEKKVDEGPISVTSNNTTKSKSIIDQVEEPLFKVP
                     ARRNISENQLESNETQVQKQQEQNQDEEREPVNFYIEVKDPVKVGELTSMHVEYTVVV
                     ESELLETRYAQVNRRYRDFRWLYRQLQSNHWGRIIPPPPEKQSVGRFKQDFIENRRFQ
                     MEKMLQKIASSPVLQSDLDFILFLTSNNFNFESKHREHTTGSNASRDSNDLSEIHISE
                     IELLGAEDAAVVLKNGGLDGESQKRFLSLSFSSLPKYNETDEYFIDQYKLTESLEERL
                     KQLNKSLDLVDSERNELASVTEEFSKTIDSLAELEVTRQNVEILTNFADTHRRIRESL
                     ERSSLQESLTLGVTLDEYIRSLASVKAIFNQRARLGHYLVIVETDFAKKQSLLEKLPQ
                     NSTSQSNIDKINSAKREYQTLQRRCKSVKKRWQEVGDCIKKELANFEIEKVKDFRNSL
                     EIFLESAIESQKECIELWETFYQNNL"
     gene            complement(<929179..>931617)
                     /locus_tag="ZYRO0A11550g"
                     /db_xref="GeneID:8201977"
     mRNA            complement(<929179..>931617)
                     /locus_tag="ZYRO0A11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494822.1"
                     /db_xref="GeneID:8201977"
     CDS             complement(929179..931617)
                     /locus_tag="ZYRO0A11550g"
                     /note="similar to uniprot|P36159 Saccharomyces cerevisiae
                     YKR079C TRZ1 Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494867.1"
                     /db_xref="GeneID:8201977"
                     /db_xref="GOA:C5DNU3"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR027794"
                     /db_xref="UniProtKB/TrEMBL:C5DNU3"
                     /translation="MFYLTTVAHPTSDTSHPLLLLQSHHGDRYFFGKMAEGSQRCLTE
                     SRTRIGKLQDIFLTGELNWNSLGGLPGMILTVADQGKANLKLHHGGDLINYVVSTWRY
                     FVFRFGISLQTDAMKDQEIYSDGLLRVKSIIVPQSGGNDNLVFNERQNMALKSIVANM
                     FPKNGPTSRYDPSSDPFLNVELPTQFSVPRTSTCYEIVFEPVRGKFRPDIAAKLGVPK
                     GPSFGKLASGQSITLDDGSQITPEQVLEKQRQFPRVLILDIPDDSYIEGFREKFKEYD
                     CEDLGIVYFFLGGDVTINDNLIKSMELFGNDVQMFVSHPKVCPNTIVFKGAALTVLKL
                     KALMVQNFNLPQSNSILSKEFYECFSKPTDRGTTLSQSQEEPLRSTIPSENVHPFTQG
                     SVTQIESFTKGEESMRIKIENNCPDWSWDFAYRRHVKPLNLPSTSFEKIVTEQQGVDN
                     FDTPEKKSNVEAITLGTGSALPSKYRNVLSTLLKIPYKTETGNIDSRIILLDAGENTL
                     GTIRRHFPSTTVCKIFKNMKMMYLSHLHADHHLGIISILKEWFKYHQDDDEVIYVITP
                     WQYNRFINEWLLLEDANLLNRIRYISCEHFVNGSYVRRETKPIPLEEYADGLESADKK
                     RRKLEIDSNSSLRDLDTIKKMYKDLRIFNMQTCRAKHCDWAYSNTISFFMSSSSKKLF
                     KMSYSGDTRPNIEHFSKDIGKNSDLLIHEATLDNELIEDAIKKKHCTINEAIEVSNEM
                     NAQKLILTHFSQRYPKAPQVNDNIKILAKEYCYAFDGMIVDYETLGEQESVFDQLNQV
                     FMEEKQEEEDESQS"
     gene            complement(<932133..>933977)
                     /locus_tag="ZYRO0A11572g"
                     /db_xref="GeneID:8201978"
     mRNA            complement(<932133..>933977)
                     /locus_tag="ZYRO0A11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494823.1"
                     /db_xref="GeneID:8201978"
     CDS             complement(932133..933977)
                     /locus_tag="ZYRO0A11572g"
                     /note="similar to uniprot|Q08484 Saccharomyces cerevisiae
                     YOR070C GYP1 Cis-golgi GTPase-activating protein (GAP) for
                     the Rab family members Ypt1p (in vivo) and for Ypt1p Sec4p
                     Ypt7p and Ypt51p (in vitro) involved in vesicle docking
                     and fusion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494868.1"
                     /db_xref="GeneID:8201978"
                     /db_xref="GOA:C5DNU4"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5DNU4"
                     /translation="MGVRSSSKEMHQKDHGSSPYGYGYSLASSGTNLVSSLMKSWRIS
                     SASSPKSNSSYTGDGNFDAMAKQQTTAIKNSSSSSSYSPLKYSTPISSSGGGSASSRR
                     TSTDSSKPYTSANKYNPSYYRDSGGGSGSGSGSSRKSDKYFKDLDEDWSAVIDDYNMP
                     IPIITNGGVASPATPKVTRSSSVKTTPTSSTTAMANQNASSTFSYPQLPQLQKTLTTD
                     LRSQLEVENEREAQELTSMLQRMAKFDCILKNKHIINQQELRQISWNGIPKPQRPVVW
                     KLLIGYLPANTKRQESLLKRKRQEYHDGLDHVFSEQHSRDVPTWHQIEIDVPRTNPHI
                     PLYQFKSVQRSLQRILYLWAIRHPASGYVQGINDLLTPFFQTFLTEYLPQSQIDDVEK
                     LDPESYLTESQLNDVEADTFWCLTKLLEQITDNYIHGQPGILKQVKNLSQLVKRIDRD
                     LFNHFQSEQVEFIQFAFRWMNCLLMREFQMSTVIRMWDTYLSETSLETSSSAAAMMSD
                     TGPPRTPTEPASMTFQSFTSPSTTSKGSSEDLPRLRRSSLNEFHVFVCAAFLIRWSDQ
                     LIDMDFQNIITFLQNPPTRNWKETDIEMLLSEAYIWQSLYKDATSHWQ"
     gene            <935022..>935996
                     /locus_tag="ZYRO0A11594g"
                     /db_xref="GeneID:8201996"
     mRNA            <935022..>935996
                     /locus_tag="ZYRO0A11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494824.1"
                     /db_xref="GeneID:8201996"
     CDS             935022..935996
                     /locus_tag="ZYRO0A11594g"
                     /note="highly similar to uniprot|Q02046 Saccharomyces
                     cerevisiae YKR080W MTD1 NAD-dependent 5
                     10-methylenetetrahydrafolate dehydrogenase plays a
                     catalytic role in oxidation of cytoplasmic one-carbon
                     units expression is regulated by Bas1p and Bas2p repressed
                     by adenine and may be induced by inositol and choline"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494869.1"
                     /db_xref="GeneID:8201996"
                     /db_xref="GOA:C5DNU5"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="UniProtKB/TrEMBL:C5DNU5"
                     /translation="MSDATVSKPGVTVLASKISKIYVEEITSKVKAIQNIRPHGPLLV
                     GFLANDDPAAEMYASWTKKTSEDMGFRYELRRIDEKDFLEEAIIEANRDPQVDGIMVY
                     YPVFGNAQDQYLQQVVAKEKDVEGMNHVYYQNMYHNIRYLDSENTLKSILPCTPLAVV
                     KILEYLKVYNNLLPQGNRLYGKKCVVVNRSEIVGRPLAALLANDGAVVYSVDIDNIQK
                     FTRGEGLKFKKHHVEDLGAFSKDLLKQCCSEADVIITGVPSESYKFPTECIKEGAVCI
                     NFSSNKNFDETVKSKASLYVPMTGKVTISMLLRNMLRLIENSEKFKNP"
     gene            complement(<936104..>937241)
                     /locus_tag="ZYRO0A11616g"
                     /db_xref="GeneID:8201997"
     mRNA            complement(join(<936104..937160,937228..>937241))
                     /locus_tag="ZYRO0A11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494825.1"
                     /db_xref="GeneID:8201997"
     CDS             complement(join(936104..937160,937228..937241))
                     /locus_tag="ZYRO0A11616g"
                     /note="highly similar to uniprot|P36160 Saccharomyces
                     cerevisiae YKR081C RPF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494870.1"
                     /db_xref="GeneID:8201997"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="UniProtKB/TrEMBL:C5DNU6"
                     /translation="MIRTVKPKTAKAKRALKEKEPKLVENVKQALFVPGQTSNKLLHD
                     AMVDLSSLKKPDMKRFDRKNEIRPFEDPAPLEFFSEKNDCSLLVLSTTSKKRRNNLTF
                     VRTFGYKIYDMVELMIVNNYKLLEDFKAKTFAVGLKPMFSFQGSAFDTHPVYKHLKSL
                     FLDFFRGTVTDLYDVAGLQHVISVTLQGDFQDGEPLPNVLFRVYRLRTYRSEQGGRKL
                     PRVELQETGPRFDFKIGRIQSPSPEMEKEARRKPKQLNTKTVKNVDMDPMGDKLGRIH
                     MGKQDLNKLQTRKMKGLKSRFDQDQEDDDVEEYINDEEEELNDGEELNDEAENSEEDT
                     YGEEFVTAEDIDEPSTKRQKKK"
     gene            <937496..>940924
                     /locus_tag="ZYRO0A11638g"
                     /db_xref="GeneID:8201998"
     mRNA            <937496..>940924
                     /locus_tag="ZYRO0A11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494826.1"
                     /db_xref="GeneID:8201998"
     CDS             937496..940924
                     /locus_tag="ZYRO0A11638g"
                     /note="similar to uniprot|P36161 Saccharomyces cerevisiae
                     YKR082W NUP133 Subunit of the Nup84p subcomplex of the
                     nuclear pore complex (NPC) localizes to both sides of the
                     NPC required to establish a normal nucleocytoplasmic
                     concentration gradient of the GTPase Gsp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494871.1"
                     /db_xref="GeneID:8201998"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DNU7"
                     /translation="MSSGQPLFQLRKELSVPLSAGEDDTTNQTTDTNTSYERFQSVDV
                     SLDTHHHEDKQTFNNIKILTENERYVVKRLAPDLSTLPIDSSSSEGLVDTHSGKALVN
                     DNDFLYIWDYYSSQRNTNFCRIPLHEEHVVLKHEPKCLITWPAAMDDTTQMFAENSGG
                     AFGGVCIIHRKNGQLIYYEDIDSINNLHLQLSHSKAHTVNLKLKDNESVTEAINCEPA
                     GIVIATSLGRVLFVTIRDSSGKPSVRVKQQLVKPQQGFFFSTFNPSNEVVSLKMGPIV
                     GRGERLLYIVTRGGNFQMWHLSVSISSYKRLDVQLFEQILDSLQDLYPFAHGSLQVLD
                     SHPLFPDSSSVHLVLSSITNGDEMYYILSTIVLDEKTKSFTIFSTYRLNTYVTSFVDK
                     KPELFIPAALGEQLTDTTTVFVLFNDAVVLTQVSSKLDSSYPLRRKWEDIISFRDDVN
                     LIGSGYDSESIYVMSKEIGVLEISVTGEVNESEKSMEEVRFVKSHVDQAVYFSGISSN
                     PIEFNLPKGISLEVDEIEADLRSCSDEIFHSKGKYIPPMMNTLTQHLSLRVDLFRNLL
                     NFVEQNFNFKVSPNEKLKLLQNFEILNCCLKLCILLKNLPELNEIWKKTLKLRNSNLT
                     TETLFVGQLHEFPKVFSQFLAQLNSKSMPASIPLKTSVVDLLIECVYKGILEEGEKQL
                     RYDLFKLDPLELGIELPWFINYENLESINSSFLDFKFSTQITSDEDKNRLLTLTKTLY
                     YLFNQANLWFKEYSQRQETELFGKFQLLFLNNHLSWNQALLDSNLKQEALQIAEFYQD
                     LEALVETLESLDKSISQEAYFYYFDKFGYQFGSTVFQYYISQNKLDDLFYRFPEQHDM
                     LVEFLGSSDKYGEVAWIQEILDKRYDAATTTLCDIS