GenomeNet

Database: RefSeq
Entry: NC_012991
LinkDB: NC_012991
Original site: NC_012991 
LOCUS       NC_012991            1388208 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Zygosaccharomyces rouxii strain CBS732 chromosome B complete
            sequence.
ACCESSION   NC_012991
VERSION     NC_012991.1
DBLINK      BioProject: PRJNA39573
            BioSample: SAMEA3138235
            Assembly: GCF_000026365.1
KEYWORDS    RefSeq; genomic DNA.
SOURCE      Zygosaccharomyces rouxii
  ORGANISM  Zygosaccharomyces rouxii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygosaccharomyces.
REFERENCE   1  (bases 1 to 1388208)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1388208)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1388208)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928174.
            The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A
            to G). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1388208
                     /organism="Zygosaccharomyces rouxii"
                     /mol_type="genomic DNA"
                     /strain="CBS 732"
                     /db_xref="taxon:4956"
                     /chromosome="B"
     gene            complement(<463..>1326)
                     /locus_tag="ZYRO0B00110g"
                     /db_xref="GeneID:8202857"
     mRNA            complement(<463..>1326)
                     /locus_tag="ZYRO0B00110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494918.1"
                     /db_xref="GeneID:8202857"
     CDS             complement(463..1326)
                     /locus_tag="ZYRO0B00110g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494963.1"
                     /db_xref="GeneID:8202857"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DQG9"
                     /translation="MSVISDEGEMDLEKCVQTFEKEEIELPEDSPGGKLTYFLAPYFF
                     EKTWIDDIIASLLGAFLSPSLVRFPYFILRDFYGNKIETTLSDVFSPLLMIIHCFLCF
                     TFSFWNFIDNRKNVDIEKKVLQKLLKEVAEMDLTGDPVAWQRVASRVNHFSEEGGHHY
                     PLFYSGEHCKRFFVREIVKPIERQTYDIRCYFGGEICSNFWKNPSNKALTERALANYN
                     KSVENFGELSHTAEKDEFRDGIFEKFHSIFNTSMFYLVMTELGSFMIMMLTFIISMIS
                     CAIFNSFATPQ"
     gene            <1640..>2317
                     /locus_tag="ZYRO0B00132g"
                     /db_xref="GeneID:8202095"
     mRNA            <1640..>2317
                     /locus_tag="ZYRO0B00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494919.1"
                     /db_xref="GeneID:8202095"
     CDS             1640..2317
                     /locus_tag="ZYRO0B00132g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494964.1"
                     /db_xref="GeneID:8202095"
                     /db_xref="UniProtKB/TrEMBL:C5DQH0"
                     /translation="MSNKKKSKSKASESHKRGGRENSPRGQHNSPSPQRNNSITDQQR
                     SENGGTDSRTNGIKLAARLFRNPLLSKRGFKHAKEGLKIRSSDKSMSGVRCGGSICLF
                     VYPFFLIGYSIAGFIYGDKNNSTHVFVYGGPLFIAVPYCIRYLDNVDRLLSSIFEIGE
                     KSLVEYFADPGIRELLLTVFEIVGFIYQCVKGRQNSLIISLGILGFFFYLAGNISLML
                     RRKGQNR"
     gene            <3082..>4164
                     /locus_tag="ZYRO0B00154g"
                     /db_xref="GeneID:8202096"
     mRNA            <3082..>4164
                     /locus_tag="ZYRO0B00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494920.1"
                     /db_xref="GeneID:8202096"
     CDS             3082..4164
                     /locus_tag="ZYRO0B00154g"
                     /note="weakly similar to uniprot|P47187 Saccharomyces
                     cerevisiae YJR161C COS5 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494965.1"
                     /db_xref="GeneID:8202096"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DQH1"
                     /translation="MEFDKESQRPVLPKDLFRNGLTWMFYEISKHRFPWVVSCLCLVA
                     GWVVLYGSNYIYKDVSLGSMISTLLWMLALLLPFSWLHNSKLHPKIMTELVQQVLESN
                     PGVDIEKWDEIANRLNSSFYQEHFWNTPYFFYDGQGLQLLFKANVLRPYLEGKLDDIT
                     DTDKTQSARCYLQSLNEKFELLLKNNLPETGLNSKLPRDTHRYKLFFYPQSLIFGFFI
                     CCFQGLTWFMILPEIKRKTLFALIMIMYYQYMSLICYWSLYRFMDPQMDIIQTMKCLA
                     IIAKVNPGKELDKWDQISKYMNQYLTEEEKNGLFKNRFFDGKHCLDFYKTCFEPLSFS
                     DSSLAYGELKEIVEIVQPNVSGETNQ"
     gene            complement(<5271..>7394)
                     /locus_tag="ZYRO0B00176g"
                     /db_xref="GeneID:8202097"
     mRNA            complement(<5271..>7394)
                     /locus_tag="ZYRO0B00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494921.1"
                     /db_xref="GeneID:8202097"
     CDS             complement(5271..7394)
                     /locus_tag="ZYRO0B00176g"
                     /note="some similarities with uniprot|P32319 Saccharomyces
                     cerevisiae YBL017C PEP1 Type I transmembrane sorting
                     receptor for multiple vacuolar hydrolases cycles between
                     the late-Golgi and prevacuolar endosome-like compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494966.1"
                     /db_xref="GeneID:8202097"
                     /db_xref="GOA:C5DQH2"
                     /db_xref="InterPro:IPR006581"
                     /db_xref="UniProtKB/TrEMBL:C5DQH2"
                     /translation="MQMYLFLIFCALWALGTAQEFVPGVWRSHVERSHEPNYVNYGGL
                     SAFSDSHTSLLYFEDSLHITFDNSKSWQTVDVFGEDISWVIVDQFHKERAFVTTKSGG
                     IHVTEDQGRNWKQISLPEEIEDKERCSLQTHPFNTNFLLLHCSIMHGNFQLGTNSKKR
                     PDSSSFMERIAYASDDAGKSFRRIGEPVHEYEATPDLQYHGTTCQFATSSRDSTLDRD
                     IIYCIHKVEVMTNMREWFSHTYGMDIEKKTFFKKKSFDPVSNTMSTLFYTTDFGQSTK
                     LVDELKDFSTEEIWIFPSHILGISSEGNELDHTAERIWVTTGGPFKHAHLPKGAVFSP
                     NSIPELLSYDPELILLYADVEENEGHGKSKHLLVSDPSGLEFSFFDSITQEPSNHVNL
                     EKLDKLKGTIWGRFSFDVDLNRSKVENMYETYFHEKTNWFQKIVKFIRNNLFYKNSCP
                     HMESFPFIGYKRFSKSKISFDYGKTWNNLKVVDPSGKHKQRFHCDIDDVEHCSFQETS
                     YFSSVENEPTAGILMKTGVVGENVLSLDDDDEMTFISRDGGASWEVVFEFPVYAAFLD
                     FGNIIVSIPKTSPQDWSLKKFFYSVDQGNNWREYHLEEPTDAFHIKIVSRGSNVEVGL
                     GHKTKQSTEYTFYTIDFSEVFGGSTCTDRDWETWYLSDGKCIDGIKYSFNRKKADAQC
                     LMRKTFENLTLNEESCEPKDIQSSI"
     gene            <9638..>10384
                     /locus_tag="ZYRO0B00198g"
                     /db_xref="GeneID:8202098"
     mRNA            <9638..>10384
                     /locus_tag="ZYRO0B00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494922.1"
                     /db_xref="GeneID:8202098"
     CDS             9638..10384
                     /locus_tag="ZYRO0B00198g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494967.1"
                     /db_xref="GeneID:8202098"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DQH3"
                     /translation="MSLTGKTALITGGTKNLGKTTAIELASKHKCNLFLHHNSTQGDE
                     ETLAKELRDKYGVKVELYQGKLGNQASLTKLFDTAVEKLGKIDIAVNNVGKVLKKPVV
                     EVTEEEFDQMDIINNKIAFFFISEAGKKVSDGGRIISLVTSLLAVYTPFYPTYQGTKA
                     PVEYYSKAASKELMARNVTVNCVAPGPMDTPFFYTQETPEAVEFYKSSALQQRLTKIE
                     DIAPIISFLATEGGWMTGQVLFANGGLAAK"
     gene            <11108..>11986
                     /locus_tag="ZYRO0B00220g"
                     /db_xref="GeneID:8202099"
     mRNA            <11108..>11986
                     /locus_tag="ZYRO0B00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494923.1"
                     /db_xref="GeneID:8202099"
     CDS             11108..11986
                     /locus_tag="ZYRO0B00220g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494968.1"
                     /db_xref="GeneID:8202099"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="UniProtKB/TrEMBL:C5DQH4"
                     /translation="MLAAERRQDKMTANSEVVVSEKSHKVHNLAFGNLSFSNERPVFE
                     DKMLERQHIKEHMAGAFRIFGRRGYNEGPAGHMSVRDPVDKHTFWINPLGVHFSAIKV
                     SDLVHVDADGQILSDGNQSPINAAGFRIHGELHKARPDVNAACHAHTVYGKAWAAFGK
                     KLDMINQDACIFYNCHAVYDNFGGVVFEGEEGKRLAQALGNNKAMILQNHGLLTVGET
                     IDEAGYLFDLLERTCQVQLQVEMVAKACGFDKKIIGEDEAAFTYYNTSHPAELYSAFQ
                     SDYNLEVDLTGKQFLQ"
     gene            <12202..>14118
                     /locus_tag="ZYRO0B00242g"
                     /db_xref="GeneID:8202100"
     mRNA            <12202..>14118
                     /locus_tag="ZYRO0B00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494924.1"
                     /db_xref="GeneID:8202100"
     CDS             12202..14118
                     /locus_tag="ZYRO0B00242g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494969.1"
                     /db_xref="GeneID:8202100"
                     /db_xref="GOA:C5DQH5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DQH5"
                     /translation="MPSKRRTQNQYNGIPTKRRSVTGCLSCRRRRKKCDETRPNCKAC
                     IRNFLECMWPQDHNVKQSLPFALSNKKKLSPPCQQDKLESGSVEFNLFLLKDAKFLKL
                     KSSSVRIFDVLIADTSKGVIFRYDSPDCNHSTLSAFESDDDVYGLSTNSQGSEGSNDA
                     FTEDFDPPKGDVSCEHLDLQVDPFPQIEVPRNALIHHPHDSNSFHEVLDNTNFATEKT
                     FDSLFRRCKNKEIIPDNEFNNIDLENFAFYACIKGYIPKMTTQYTHQNLTTAAAFIPQ
                     LEKNPIMREVFLCCGATYLAWNNLRRFQNMSDELYINCKILIQNFIDKNDNYADEDWL
                     FGALQLLCNRDKNALTATEEDAKWHLMRAFDIIRLRYYGKEAKNFELSIIDIISNSNL
                     ILRPEERTLIESFIFQYSVSILFIEKVDELPNPFTIFKILNVVLKCRVYNCEHTADWM
                     SNPILGPSLDSFELLAKLSYIGHMQLPLNRELSERVASLRKMCDYYTPAAPSKKMTDI
                     QWQNFQINSKAGIITSRACWLFACKLLDFDSFDIKAPDIQNAVKKVLDGCRKIPTGNR
                     VWGILPWALFVTGIFAVDIDDRTFILGLNDMMAERAHSYNGFRISTFLRRAWASDNAP
                     NFLFDRSTLTRVNM"
     gene            <14925..>16511
                     /locus_tag="ZYRO0B00264g"
                     /db_xref="GeneID:8202101"
     mRNA            <14925..>16511
                     /locus_tag="ZYRO0B00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494925.1"
                     /db_xref="GeneID:8202101"
     CDS             14925..16511
                     /locus_tag="ZYRO0B00264g"
                     /note="similar to uniprot|P15365 Saccharomyces cerevisiae
                     YJR152W DAL5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494970.1"
                     /db_xref="GeneID:8202101"
                     /db_xref="GOA:C5DQH6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DQH6"
                     /translation="MVSDMSYSVNDMDKKENLEITHGPGDHELGDVVTIDSFDGIDKS
                     RAVGAELFEELSETELNAEDAGYAKIRRKIDIWLLPVLCITYMLQFLDKLSLNYASSY
                     SLKEDLKLTGNDYGNIAAIFNAGYMVGTIPGNWLIQRVPVAKFTGISLVLWSAMLIGH
                     IGARNYNDMMALRFLLGLMEAAISPSNMMICGMFYDKQEQPFRMCTFLSMNGVATMVG
                     ALLAYGLGHATNAALKPWKLIFLVIGLINFAWSFVFLYLTPDSPANARFLSHDERLKV
                     IKRVSRNQMGIKDTKFKFHQAFEALKDVNCWILSLIGLGCGVINGGTSNFISSLIKGF
                     GFSGLNATALQLPTGGIEFVCVFISGMVAVTTKKNIRTILLFLLCIPTLAGLIGIHVI
                     PLDKKWALVGCSWLLYIIGGPVIMCWILINVTVAGSSKISTVKMVWFLLYTAGNIVGS
                     EIFYAREAPKYATGMKGLISSYACMMFLSIVYYALMFYRNKSRDSHYGKLTAELEREG
                     IVNGFKDMTDFENKHFRYAY"
     gene            <18003..>18254
                     /locus_tag="ZYRO0B00286g"
                     /db_xref="GeneID:8202102"
     mRNA            <18003..>18254
                     /locus_tag="ZYRO0B00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494926.1"
                     /db_xref="GeneID:8202102"
     CDS             18003..18254
                     /locus_tag="ZYRO0B00286g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494971.1"
                     /db_xref="GeneID:8202102"
                     /db_xref="UniProtKB/TrEMBL:C5DQH7"
                     /translation="MCISYVTSCQFNEENTRESSFDVGHGFCSTSKHNDTGMIFIPSL
                     IGLSHKYNECSFPEKIKNAFKILLKSVAKQDDLRRKKGF"
     gene            <18691..>20001
                     /locus_tag="ZYRO0B00308g"
                     /db_xref="GeneID:8202103"
     mRNA            <18691..>20001
                     /locus_tag="ZYRO0B00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494927.1"
                     /db_xref="GeneID:8202103"
     CDS             18691..20001
                     /locus_tag="ZYRO0B00308g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494972.1"
                     /db_xref="GeneID:8202103"
                     /db_xref="GOA:C5DQH8"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:C5DQH8"
                     /translation="MVIPIVDTLCIQSGRLNQKIIETGKLFGSIARWGTEEHQFGMRR
                     LAGTAVDGEMRNWFVEQCKSLGCKVNIDEIGNIFAIFAGKNKGKPTAMGSHLDTQPEA
                     GKYDGILGVLAGLEVLRTFKENNYVPNYDVCDICWFNEEGARFSRYCMGSSVWAHNLS
                     LKEAYKIKSITDTVPETVYESLNNIGYLGSAPASYLENEIDAHFELHIEQGPVLEDEK
                     KKVGIVTGVQACYWELFTVKGDASHAGTTPRRLRRDAMLMASRMILKAEEIAEKRGGL
                     FTCGVIDAKPYSVNIIPNEVSFTLDFRHVSDQILAEMLSETKAEFDILVEDNRNGPLS
                     WTSKVLVSTPVVKFNEKCIECVTKATQSLFETNDVREIWSGAGHDSCQVNFRVPTSMI
                     FIPSKDGVSHNYYEFSSPQEIENGFKVLLKTLMNYDSYRSERGY"
     gene            complement(<20989..>21990)
                     /locus_tag="ZYRO0B00330g"
                     /db_xref="GeneID:8202104"
     mRNA            complement(<20989..>21990)
                     /locus_tag="ZYRO0B00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494928.1"
                     /db_xref="GeneID:8202104"
     CDS             complement(20989..21990)
                     /locus_tag="ZYRO0B00330g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|P53111 Saccharomyces
                     cerevisiae YGL157W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494973.1"
                     /db_xref="GeneID:8202104"
                     /db_xref="GOA:C5DQH9"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DQH9"
                     /translation="MAVLVTGATGFIAQWVVDYLLKENYQVIGTVRSQEKGDKLHKQF
                     GSPSNLSFEIVKDISETEAFEPLFEKRGKEIDIVLHTASPFHFNTKDYEKDLLIPALN
                     GTRGVLNAIKKYGDVKKVVVTSSYASIVDVSKFADGSCVFTEKDWNPATWEGCQTDPM
                     SAYCASKKFAEEAAWEFAKETGVSMTTVNPVFVFGPQKFDEDVKAQLNTSNEILNGLI
                     HSKPGDKIEPDYHAAFVDVRDVAKAHLVAFQKETNGERLGLSNGGFGSQTILDILNEK
                     FPQLEFAKGPEPGKGDTKPAAKFDNSHSNKVLGFPLISLEQSVYDTVAQVLKKEGRL"
     gene            complement(22497..22596)
                     /locus_tag="ZYRO0B00352r"
                     /db_xref="GeneID:8202105"
     tRNA            complement(join(22497..22541,22560..22596))
                     /locus_tag="ZYRO0B00352r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (GCT) cove"
                     /db_xref="GeneID:8202105"
     gene            23350..23421
                     /locus_tag="ZYRO0B00374r"
                     /db_xref="GeneID:8202106"
     tRNA            23350..23421
                     /locus_tag="ZYRO0B00374r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=60.45"
                     /db_xref="GeneID:8202106"
     gene            <24056..>24967
                     /locus_tag="ZYRO0B00396g"
                     /db_xref="GeneID:8202107"
     mRNA            <24056..>24967
                     /locus_tag="ZYRO0B00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494929.1"
                     /db_xref="GeneID:8202107"
     CDS             24056..24967
                     /locus_tag="ZYRO0B00396g"
                     /note="similar to uniprot|P32331 Saccharomyces cerevisiae
                     YPR058W YMC1 Putative mitochondrial inner membrane
                     transporter member of the mitochondrial carrier (MCF)
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494974.1"
                     /db_xref="GeneID:8202107"
                     /db_xref="GOA:C5DQI0"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DQI0"
                     /translation="MSEEIPAPQILDELDRSQKFQRVFKDVLAGTFSGVAQVLVGQPF
                     DITKVRLQTHRGHTTAFNVIKDLIKNEGFAGFYKGTLAPLAGVGACVSCQFGVNEAMK
                     RYFHARNGSKTQPLTLDQYYACGAVSGAANAFLATPIEHVRIRLQLQKRALASSEYRG
                     AIDCTKKLIKQGKLMRGLPATLLRTSHGFGIYFLTYEYLCNLEAARGIKKPDIPTWRV
                     CGFGAIAGALFWSLTYPFDVVKSVMQADRLTNPQHGNTIWQVTKTLYKEGGARVFVKG
                     FTPTILRSLPVNGATFAAFEVAMRILN"
     gene            <25486..>26430
                     /locus_tag="ZYRO0B00418g"
                     /db_xref="GeneID:8202108"
     mRNA            <25486..>26430
                     /locus_tag="ZYRO0B00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494930.1"
                     /db_xref="GeneID:8202108"
     CDS             25486..26430
                     /locus_tag="ZYRO0B00418g"
                     /note="highly similar to uniprot|P23641 Saccharomyces
                     cerevisiae YJR077C MIR1 Mitochondrial phosphate carrier
                     imports inorganic phosphate into mitochondria functionally
                     redundant with Pic2p but more abundant than Pic2 under
                     normal conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494975.1"
                     /db_xref="GeneID:8202108"
                     /db_xref="GOA:C5DQI1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DQI1"
                     /translation="MSAQSSAPKPVVIPQYSLTDYAKFALAGAIGCGSTHSAMVPIDV
                     VKTRIQLSPEVYRGGMISSFRKIISEEGAGALLTGFGPTLLGYSIQGAFKFGGYEVFK
                     KMFIDVLGFENAANYKNSVYMGSAAIAEFFADIALCPLEATRIRLVSQPNFASGLVGG
                     FSRMLKEEGVGTFYNGFTPILFKQIPYNIAKFWVFERASAVYYGLAGGKDKLSETAST
                     AINLGSGLTAGLAAAVVSQPADTLLSKVNKTPKAPGQSTLNLLGQLAKQLGFFGSFAG
                     LPTRLVMVGTLTSLQFGIYGSLKTALHCPPAINLGGGH"
     gene            complement(26675..26747)
                     /locus_tag="ZYRO0B00440r"
                     /db_xref="GeneID:8202109"
     tRNA            complement(26675..26747)
                     /locus_tag="ZYRO0B00440r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8202109"
     gene            <27528..>28430
                     /locus_tag="ZYRO0B00462g"
                     /db_xref="GeneID:8202110"
     mRNA            <27528..>28430
                     /locus_tag="ZYRO0B00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494931.1"
                     /db_xref="GeneID:8202110"
     CDS             27528..28430
                     /locus_tag="ZYRO0B00462g"
                     /note="highly similar to uniprot|Q06703 Saccharomyces
                     cerevisiae YLR308W CDA2 Chitin deacetylase together with
                     Cda1p involved in the biosynthesis ascospore wall
                     component chitosan required for proper rigidity of the
                     ascospore wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494976.1"
                     /db_xref="GeneID:8202110"
                     /db_xref="GOA:C5DQI2"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="UniProtKB/TrEMBL:C5DQI2"
                     /translation="MRLLCVTLLFFQMKVLMAFPKRDGAEIQFNATLVQTPFPKWLTS
                     FTGLTQWPGLDPPYIPLDFIDMSKIPPYKQYPSGVCNANPPEACAFDCDGCTAHDDVK
                     TCSKLSQTFDDGPSFATQKLLDTLKHKATFFNLGFNIVNNPDMYRKVLEKGHLIGTHT
                     WSHPYLPSLSNEKIIAQIEWSIWAMNATGNHTPKWFRPPYGGIDNRVRAITRQFGLQA
                     VLWDHDTFDWQLVTPDNTLPPRSEQQIYLDVKKWKQEGKGLILEHDGSQRTVDVGVNV
                     YHLLGEDQLNVAQCVGGIDYIRKF"
     gene            complement(<28527..>31286)
                     /locus_tag="ZYRO0B00484g"
                     /db_xref="GeneID:8202111"
     mRNA            complement(<28527..>31286)
                     /locus_tag="ZYRO0B00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494932.1"
                     /db_xref="GeneID:8202111"
     CDS             complement(28527..31286)
                     /locus_tag="ZYRO0B00484g"
                     /note="similar to uniprot|Q06704 Saccharomyces cerevisiae
                     YLR309C IMH1 Protein involved in vesicular transport
                     mediates transport between an endosomal compartment and
                     the Golgi contains a Golgi-localization (GRIP) domain that
                     interacts with activated Arl1p-GTP to localize Imh1p to
                     the Golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494977.1"
                     /db_xref="GeneID:8202111"
                     /db_xref="GOA:C5DQI3"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="UniProtKB/TrEMBL:C5DQI3"
                     /translation="MFKQLSQIGKNLSDEFARGVSEDLHPSQDHHSNDDSGLPPDVVL
                     KLRKFEKYEDKYPKLLSAYKGERLKLERAAEIEKVLTEYTPISSFDDAESLAAFFKDM
                     NEKQNLLNNEIKRLLTEGSKKNQIQQEEQSTDQSLNKEGYEEHISKLKDEITQSGTKH
                     GDELKKLNEKLETTNKDFEKLKSEKDSLVNSYEMNVSKIKEELHGLKDESESREKSYN
                     ETIENLETENKSSQKKIEELEQNLAERESTIKELRNQIEQNLQKIESLEKEISSSANE
                     IPISNTENLPSSTSKSSAKRKKKNNKKKSAPNGSNTTEETPVADGGEEEHLEAKYKEV
                     CAKLESTKASLNADWQGRYDALKAKLKTSVHSKDDFKEKLEKLEKEYGQLEEELSKSK
                     DVIKEKQSEIEETRDMMKIIGNELVDAKDKLKESSGVDKEDMAHLEDELRKARTELSS
                     LTEKLAEKENELTSTLSSMNQELDSLRTSSSSNEKQQKQLTESLNKLKTENSTLAEQV
                     KEFENLKRTHSSLRTSMIQKEKTIVYLEQQVKTYSENVETTKKTTEGIRRENKRLLDS
                     LESLKKDYEILKADAKGKSGSFEKYVKENGQLSERLAMLQDKYETLQSLKSNSSEQTD
                     SIKRQCEELTVKLKEANKKIFSLEDEVAEYSNTIHDKTREINNMRRHISENSNGETAK
                     ERELKEKLTYETDEKLKLQNELTLQATRKSRDLQDWKQANAELKSELHRLQLREKELQ
                     ADIETLKSLNKNLQNHTGSSEEDSNELEKLAVSLKESLSKADQKIRELQETNENLMHT
                     NDDVNEKLSRLSKNYKTLSKQLSELKETNRSGARSSRASSITSNGENQPAGHLSRQSS
                     FSSNRTILPPETVSEMNDKVAYIKNVLLGFLEHKDQRVQLLPVVSTLLRFDSNDEKRL
                     MMSLK"
     gene            complement(<31949..>36781)
                     /locus_tag="ZYRO0B00506g"
                     /db_xref="GeneID:8202112"
     mRNA            complement(<31949..>36781)
                     /locus_tag="ZYRO0B00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494933.1"
                     /db_xref="GeneID:8202112"
     CDS             complement(31949..36781)
                     /locus_tag="ZYRO0B00506g"
                     /note="similar to uniprot|P04821 Saccharomyces cerevisiae
                     YLR310C CDC25 Membrane bound guanine nucleotide exchange
                     factor (GEF or GDP-release factor) indirectly regulates
                     adenylate cyclase through activation of Ras1p and Ras2p by
                     stimulating the exchange of GDP for GTP required for
                     progression through G1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494978.1"
                     /db_xref="GeneID:8202112"
                     /db_xref="GOA:C5DQI4"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001497"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR019804"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:C5DQI4"
                     /translation="MPYSDPAIKDERTPLRAPALHSTKSSTSLGPSGGAGSTGGMGTT
                     GLGSNISEESYPIQDVSPLDVVVVLFDFPPKRSSSSKSLLPLLQGDTVYVLGKTDNGW
                     WDGIVIDSLGRVSRGWFPRNYARSLQHFPGHPSNAQVTAGGGSSSGMLQSQTQSQPMQ
                     GPSGRTAAAAALGSRVKKGPTTAVAMRQSTSSGSSRRDSLPAQAQAQTQASQAHAAQS
                     RRPSVPVSVRPQIQNHTPSNSTAGSSSMSPTTSNLGIGNEDKISKPPQPKQRQKDKRS
                     GSQQDHSETNEVTVLPLQEIEMIFNSLNVDFVPLWTPVPSTTGDRVLYYNKQLDIYCD
                     QLPLLSNPPLENTTNFTSDDHLVDLNPKTVVGPASHNEKTFKVVSYSGRSTAASISNN
                     KSSSLSSSSFKNDSSRPSIDSTNNNRNGSFSTPNYIPCHRVVSEGSGLQQQVGKPAGI
                     PTVSQSMTSSALRKKPQFTQPAFQHGSHKRNARAILSEPELFYHHTMDVKVWPELRDT
                     MLYYARKAHEMFLKDNRVDFGRYFQLVSTYTAYTQIACRLCSIQSQHKQHLKELKRLL
                     KKIILSLSRLSINSSLYFLHSQRNSIRTQSTPRTSQSQTQLSDVAEKIMQRPSTSSSL
                     SKDVTPYIHSINASSSEELPFPTSASYPMTNTQRNNSAATARTSIPSSADDGALERES
                     SALMSNMFTGIDLEFSHFIRTLQMLYHLLQFSVARTDWIPQMFPRFFRGSFNGGSWTN
                     PFSHPATSTTNGPVDVKRGGNEGGTNNSATTSTASAMGGFPQKVAEAIARAGGYDLNE
                     MIDGAIWDSRSAPNRTFIKNQRVLQRSVFNRPSHHRTFSRAKAPKIVQYALNENTVNL
                     MKKRFTALTSKFQTTELGNEEFYPEEEVKTKRKTLEIISQVYEEVSSTGMLEILENLN
                     INIFVNLKNLLGDNKSDSEGEEFLKHQLSSISTLLTEFFDIKQAFHDIVISLVMSTQQ
                     ITLSDPYVFCPMKSNFPVGYFEPGLSFAQVSKADKMAIDFYKYLVNQDVEVNGMKYLR
                     ATDDLNDASNNYREVAYLSCVIVEQLTRERENLLNYATRMMKSDLTAALLEGEQDKWF
                     EDYSLFGLHGEDGESSVAAHSEDESEGTTVNSTEKDMPWFLMSDHEQELIYDQKGRIK
                     GGTKDALIEYLTNPEVVDAWFNVTMLLTFKSMFSTREFLYTLIYRYNSYPPEGLSYDE
                     YNLWIEKKLQPIKLRVISIMKSLFSHYWNPSYYDPGLASVLNFAQNACNEQVPGANEL
                     RIVIKDIMANNGRPKGDFEDLGEQIRSSPVSDTSSVRSALLSSSVAGSTSHSLHNFRK
                     IKLLDIDPRTYASQLTIMEHNNYLRISIFECLDRAWGTKYGELGGSSNITKFIASANN
                     LTNYVSYTIVKQPDAKMRARLIMYFITVAQYCRELHNFSSMTAIVSALCSSPIFRLKK
                     TWPLVNKECKEFLDEMNTLMDSTKNFINYRELLRSLRDVACVPFFGVFLSDLTFICGG
                     NPDFLFGSSDIVNFGKRARTVDILEGSMSFKKVYYKLKRYEDIQEILEESLCNVPHIE
                     KQYETSLQIEPREEPSNRSTGHHDGSAKTGYGSHSINDNSSGKLLKLGKKKQSSRLFG
                     "
     gene            complement(<37177..>38250)
                     /locus_tag="ZYRO0B00528g"
                     /db_xref="GeneID:8202113"
     mRNA            complement(<37177..>38250)
                     /locus_tag="ZYRO0B00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494934.1"
                     /db_xref="GeneID:8202113"
     CDS             complement(37177..38250)
                     /locus_tag="ZYRO0B00528g"
                     /note="highly similar to uniprot|P29055 Saccharomyces
                     cerevisiae YPR086W SUA7 Transcription factor TFIIB a
                     general transcription factor required for transcription
                     initiation and start site selection by RNA polymerase II"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494979.1"
                     /db_xref="GeneID:8202113"
                     /db_xref="GOA:C5DQI5"
                     /db_xref="InterPro:IPR000812"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR013150"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR023486"
                     /db_xref="UniProtKB/TrEMBL:C5DQI5"
                     /translation="MSAPAPVLARERNIRKGPNLNIVLTCPECKVYPPKIVERFSEGD
                     VVCALCGLVLSDRLVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGNSLSTRIGSAE
                     GSDARTTRDLNRAQGKNVMDKKDNELQAVFAKLTMLCDAAELPKIVKDCAKEAYKLCY
                     DEKALKGKSTESIMASAILIGCRRAEVARTLREIQSIIHVKTKEFGKSLGIMKGILRE
                     KSSDGIIKIDTNNMSGAQNLPYIPRFCSHLGLPMQVTTASEYTARKCKEIEEIAGKSP
                     ITIAVVSIYLNILLFKLPVSAAKVGQILQVTEGTIKSGYKILYEYKERVVDPQLIKNG
                     VVSLDNLPKVDKDKNTKTEKKRE"
     gene            <39621..>41285
                     /locus_tag="ZYRO0B00550g"
                     /db_xref="GeneID:8202114"
     mRNA            <39621..>41285
                     /locus_tag="ZYRO0B00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494935.1"
                     /db_xref="GeneID:8202114"
     CDS             39621..41285
                     /locus_tag="ZYRO0B00550g"
                     /note="highly similar to uniprot|P04802 Saccharomyces
                     cerevisiae YLL018C DPS1 Cytoplasmic aspartyl-tRNA
                     synthetase homodimeric enzyme that catalyzes the specific
                     aspartylation of tRNA(Asp) class II aminoacyl tRNA
                     synthetase binding to its own mRNA may confer
                     autoregulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494980.1"
                     /db_xref="GeneID:8202114"
                     /db_xref="GOA:C5DQI6"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004523"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5DQI6"
                     /translation="MAEETKPVETKPAENAEPVILGEDGQPLSKKALKKLQKEQEKQK
                     KKDERAQQLQQEKEERERKAASEDTASEHYGKLPLIQSQSRTGEPRIKFDELDESKDD
                     GRHVLFRARVHNTRQQGATLAFLTLRQQSELIQALVKANPDGSVSKNMVKWAGSLNLE
                     SIVLVRGVVHKVAEPIKSATVSHLEVHVTDLHIISETPSELPILLEDASRSEAEAEAA
                     GLPVVNLDTRLDNRVIDLRTLTNQAIFRIQAGVCALFREFLSNRKFTEIHTPKLLGAA
                     SEGGASVFEVGYFKSKAYLAQSPQFHKQQLIIADFERVFEIGPVFRAENSNTHRHMTE
                     FTGLDLEMAFEEHYHEVVDLLSDLFVFIFTELTKRYTKEIELVRKQYPVEEFRLPKDG
                     KMVRLAYKEAVALLRADGKEIGDFEDLSTENERHLGKIVREKYDTDFYILDKFPLEVR
                     PFYAMPDPEDPRYSNSYDFFVRGEEILSGAQRIHDYDLLLERMKAHGLSSEEVGLKDY
                     CDAFKSGCAPHAGGGIGLERVVMFFLDLKNIRRASLFPRDPKRTRP"
     gene            <41443..>41709
                     /locus_tag="ZYRO0B00572g"
                     /db_xref="GeneID:8202115"
     mRNA            <41443..>41709
                     /locus_tag="ZYRO0B00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494936.1"
                     /db_xref="GeneID:8202115"
     CDS             41443..41709
                     /locus_tag="ZYRO0B00572g"
                     /note="highly similar to uniprot|Q3E731 Saccharomyces
                     cerevisiae YLL018C-A COX19 Cytochrome c oxidase assembly
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494981.1"
                     /db_xref="GeneID:8202115"
                     /db_xref="UniProtKB/TrEMBL:C5DQI7"
                     /translation="MSGNPGGAMKALSPTPPERGSFPLDHEGECSRQMQEYVECLKLV
                     KGENAPNCRLLAKEYLKCRMNHDLMDKDDWKNLGLPEDSPAKKE"
     gene            42107..42178
                     /locus_tag="ZYRO0B00594r"
                     /db_xref="GeneID:8202116"
     tRNA            42107..42178
                     /locus_tag="ZYRO0B00594r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=60.45"
                     /db_xref="GeneID:8202116"
     gene            complement(42331..42434)
                     /locus_tag="ZYRO0B00616r"
                     /db_xref="GeneID:8202117"
     tRNA            complement(join(42331..42374,42397..42434))
                     /locus_tag="ZYRO0B00616r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAG) cove"
                     /db_xref="GeneID:8202117"
     gene            <42738..>44930
                     /locus_tag="ZYRO0B00638g"
                     /db_xref="GeneID:8202118"
     mRNA            <42738..>44930
                     /locus_tag="ZYRO0B00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494937.1"
                     /db_xref="GeneID:8202118"
     CDS             42738..44930
                     /locus_tag="ZYRO0B00638g"
                     /note="similar to uniprot|P32350 Saccharomyces cerevisiae
                     YLL019C KNS1 Nonessential putative protein kinase of
                     unknown cellular role member of the LAMMER family of
                     protein kinases which are serine/threonine kinases also
                     capable of phosphorylating tyrosine residues"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494982.1"
                     /db_xref="GeneID:8202118"
                     /db_xref="GOA:C5DQI8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DQI8"
                     /translation="MRSFMSSHIGRKRNRNTSVNNNNNTAIGNIDSTTQMESLMQGML
                     AKQDSILNGNLSDGLMYDQQPFIDNENLQQPIDENENDTSNVADDEDDDVIFVKEQPV
                     YLASPTVPGGDPNYDSNNHYTSTTSKKFKKQRTISLPQLPHARLLYQNGNHKEFRGQN
                     NDELLHLTGSSSRTLDGNRALSLRVVHSTSPDDVTLSERFYSSVSPAESAAISGESSE
                     SSSSNSVKGNGIGVEGATASGASLKGGNNPHKRTLHRLSAPKLAARLVGKKPKTRKRE
                     NFKTDKDGHYVYRQEDVFGGGRFVVKGLLGQGTFGKVLKCTDSGDFIMNSNPFKLNTN
                     LVAVKVIRAIDRYREAAKTELRVLQAIRENDIPGQYQCLMLQECFEYRNHVCIVTDLL
                     GRSVYDFMCSNGVARFPGSQVQAMAKQLIRSVCFLHDLGIIHTDLKPENVVLCDESYV
                     EKDLPPSVVRSLSSRRRDASGGKRKLLTNPEIKVIDFGSAVFHREYHPPVISTRHYRA
                     PEIVLGLGWSFPCDIWSIACVLVELVTGESLYPTHENLEHMAMMQRVNGEPFPPKIVG
                     KMFYKASHNLGNAPADLNATVVKHFDKKTFALQWPEKNKRGDYLTKDRSIRRVMDNCD
                     RLDFLISNKLKADYGDWLSIDWNLSPEKNWALIKSRILTERRTTGTTAGDLNKETFLF
                     WYWFIDLCRKMFEFDPTKRITAKEALDHKWFNLGILDEGITSFGELQY"
     gene            complement(<46853..>47857)
                     /locus_tag="ZYRO0B00682g"
                     /db_xref="GeneID:8202120"
     mRNA            complement(<46853..>47857)
                     /locus_tag="ZYRO0B00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494938.1"
                     /db_xref="GeneID:8202120"
     CDS             complement(46853..47857)
                     /locus_tag="ZYRO0B00682g"
                     /note="weakly similar to uniprot|Q06159 Saccharomyces
                     cerevisiae YLR312C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494983.1"
                     /db_xref="GeneID:8202120"
                     /db_xref="UniProtKB/TrEMBL:C5DQI9"
                     /translation="MTGGDNSWNLIKLQEGQKVSSKSLTIDFLSEESHVDDDILSNTS
                     SSDELAEFSFRSANEDYQAGIGSISDSLATLTGPKGVGEKRDSSWKIKTWQIIVLTSL
                     VSVSFSLVVQKFWNLWMFSDFPRDVTALTNSGISSGEAAVLYSDFNFWSTPSQTQDQS
                     LTSTQSGPQWKPSGKFYVDFDNRIAYPMPDEDVVGWKRFKADSMILWYTSKSKVKSLL
                     RNDTIKSLQDSCRELLALVADEAAWIRGRFSIASDKALQSTSSIWQSCRDRTDKSVKL
                     FHQWLSSQSKFLPKWKQLGPRLHNTFEGLHNYNHKLHKKAWMWHRRTYKVLEGIHRRH
                     "
     gene            <49049..>49783
                     /locus_tag="ZYRO0B00704g"
                     /db_xref="GeneID:8202121"
     mRNA            <49049..>49783
                     /locus_tag="ZYRO0B00704g"
                     /product="mitochondrial 54S ribosomal protein YmL15"
                     /transcript_id="XM_002494939.1"
                     /db_xref="GeneID:8202121"
     CDS             49049..49783
                     /locus_tag="ZYRO0B00704g"
                     /note="similar to uniprot|P36523 Saccharomyces cerevisiae
                     YLR312W-A MRPL15 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL15"
                     /protein_id="XP_002494984.1"
                     /db_xref="GeneID:8202121"
                     /db_xref="GOA:C5DQJ0"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ0"
                     /translation="MVVINLSQNLLRSCCHHQQGVRLITYLHSGPRVRGLKRDPVSYL
                     KSPNGISYTDVKLSEYKSKVQNALQFERCGIDLPEGLVLQCFTHKSFAHGSKPYNEKL
                     NVLGSQFLKYQAAIHSLRHKDQLSPVPSDNVQQPLNGLNFTNLGTAVAKLIISKISTA
                     QYIKEKQLDSLIFWKMRDATKDGRYNGENTVFTSALNALVGAILISNGPEKAANFVQQ
                     VLLNGENDVNLVKIANQQSQVLSAKS"
     gene            complement(<50044..>55824)
                     /locus_tag="ZYRO0B00726g"
                     /db_xref="GeneID:8202122"
     mRNA            complement(<50044..>55824)
                     /locus_tag="ZYRO0B00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494940.1"
                     /db_xref="GeneID:8202122"
     CDS             complement(50044..55824)
                     /locus_tag="ZYRO0B00726g"
                     /note="weakly similar to uniprot|P23201 Saccharomyces
                     cerevisiae YLL021W SPA2 Component of the polarisome which
                     functions in actin cytoskeletal organization during
                     polarized growth acts as a scaffold for Mkk1p and Mpk1p
                     cell wall integrity signaling components potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494985.1"
                     /db_xref="GeneID:8202122"
                     /db_xref="InterPro:IPR013724"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ1"
                     /translation="MMDSGTEVSTAHHREIHSYYLALQKYFNNAETKHDRSNSPRAQK
                     ARAKLLKLSASQFYELSTDVYDELQRRISDDQSQPEYLLPKATFHMKRNQARQKLANL
                     SHTRFNDLVDDILFEITRRGYNTPPDPEVDENTNSKSTVAAGSSTPNSKKTNMSHFKN
                     DPNISVGSDGSNSQVPPTATIQTSKVIPQKASIDWSSDEEQDTKKSDKNTNNINTNTP
                     KTNNHTQGSRDLGSNEAAPPSNINALQQPNTTPILHPTDSYHHYGDVIDSPALTETGN
                     NHGGDETLTVNPPKNRNSSTFDFEGVSKDVSNEPRSVQSLGESQNKVKLDQLHSEVEA
                     LKKENASLRQSRSSGGTSSSENFEKDFRSLSAEVESLTVENEKLRAKVSELEARARNP
                     QPQNKSSLPLSSDNDKNELEKLALDRESVTRYAAQDGSIPFESVQEFHQYIQKLFTDL
                     QTDVDDIGHTLFEDLARLSNTVAQLFVLVDVPDYKEEVILLKASLSHTITSIRYFSVY
                     GALLPRITVQAAISELAFAFCNLVRSCKIKGDGRGGAALGRSKIALNGDKSPIDPPTP
                     SNHNMANSEFRSPFDHPTVITKFEDDFGKDEMSPVKPLKITQKAGMSPSAKTPSSARK
                     QSSGFPFGPMVDTRSPASRGKGSSAGLAFEKTRKLNEASPTSSQSSSIDPGLLAARVK
                     DSTHDKGFSKKSNGWFTDSHDRNDPSRTFNGNTTPEKSTATSRATTAEGTTTLSTPLS
                     TASPSDDHQRKLGENSLKETNSKPQENKGLDIQGNRSQDDNDSMKPRDILNKKDNNES
                     AVDSMKKNNAPSAVNDPYRGDDSMSSRDLPDVKNKTLDISDSVESKDISNLGNKNRNA
                     SGDSVKNKDSYDSINPFRNKDLETDEEQGFISKPTPDNTPKELLNPKDSKNTDTPQFS
                     TGNIESTSPEEIRRTPEAIKDAISRLEGNSTPDSQERTEPEAHKNAAKSERVQEKTES
                     KNIQEESEPKEQEQEQQPQLQEEKPRKNSGKSFTEKLRTFATHAGIGLKVDKEQKDKQ
                     AAATQPKGHESSDGSSDDRKRDITVTDHDKNANLPETGSSTPISKIAATGFNKESTPS
                     SASPKENDSSNGPRKEYNGSEKTSPSFNKDSDDNSNVASSSTTQNKGLEAAYRENKKP
                     TPLEKSLEKSSENSDDSNPNFNGVNSRDANSNSPPHANNYEKDRESGAAPAPVGSTSS
                     RDDKSMEVGSSSKDEPFGKSAAGTMIGDGLRDAPFNENAPDVMKGGIPQNNNATPFVT
                     LNDGNGETDITPRGGSGSLENSSVGQDKEVPSKLPNFYFSNIPQPPTNSNLTDKLKKT
                     FADIPSEDENEEGSDFNNSPYMSDDGSVFRAFKQSLKEENGASRGSPLIQQENFHGSN
                     SEAREKPAGLGLSEKTDLKLNNRPFGIPSGSNQSSNFSVPEQMRDRGHNQDKQRQPAS
                     YDASSQNHPKEEFSRKVQDGAPPHKEGDQDISHNSRDTRGNKSDLTGFEDVDDSMTNP
                     GEYFKDHNEASTGQGKSSSASSKNTPKPDHDSFPLGNNVKDDKYKETHRPWDSTDEED
                     DYDADSFKDAFTENGFDRLEQNSNNSKSKPEEKDINNSKGIENRNNDYSHSKDDSRSL
                     SENTYNKSKGRGASDLSVLPGTAEETNQQHLTSIDEPSDDLNAGPSFSEEKDVTDASA
                     PKSARSVAPQFQPVKLFSSNSQTHDPSNGKAEFSKNDDVTKSPNVPKTPVMRSSVFRP
                     QVVKTPSGKTPSLNSPVGRSPGTRSLASTRTDDGDYIFDVDAFDIENPDNTLSELLLY
                     LEHQSLQVIATIQSLLTSIKEPHATKGNLRKESNAISQVIRQMVDATSISMNQSRNAS
                     LKEHGSWVVKSLEDCYLRMTTLCQLNRSGGFNDNPEDENYANKHFKQRLAGIAFDIAK
                     CTKELVKTVEEASLKEEIEFLNSRLN"
     gene            complement(<56195..>59824)
                     /locus_tag="ZYRO0B00748g"
                     /db_xref="GeneID:8202123"
     mRNA            complement(<56195..>59824)
                     /locus_tag="ZYRO0B00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494941.1"
                     /db_xref="GeneID:8202123"
     CDS             complement(56195..59824)
                     /locus_tag="ZYRO0B00748g"
                     /note="weakly similar to uniprot|P38995 Saccharomyces
                     cerevisiae YDR270w CCC2 probable copper-transporting
                     ATPase P16.2.f2.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494986.1"
                     /db_xref="GeneID:8202123"
                     /db_xref="GOA:C5DQJ2"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="InterPro:IPR027256"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ2"
                     /translation="MSTINIQIENIHCEQCELFLNSLLSQIFNLPPNANGVNDPSNPS
                     LQDSSFTLRPPSSSIISKIKFNKIDAAEFIVDRDAGLCTIGFAQEVNSIQLCQKIREA
                     LEDAGFFVLDIYALKDLESLRAPAIGRASQLSIKYWLEKLLLHRKTDAPSKKLRIHKE
                     HCEYCRSHDDKEHSQEENDNSEVVAYDITLAIEGMTCASCSSRIEQVISDQLSEGEDV
                     GVDLMTGMAKVILKDKKSLQPMIESIRDSGYDAEIIGIVNVAKNSKFKMVAAIGGITC
                     AACASTINHAVQDLPFIDEVAINVVSKTGIFILNSKSKNELDQLRETIEDTGYDFEPI
                     GNIEPVNYGPSKSIRRSIMLRIDGIYCSHCPERVYNALKQFKGSEIVIDKPMSLNDPI
                     VKFTYTPNVGQGITIRSIVNAIMKEVSVNPDNNFKISIVEELTLEEHLKIMAKKNTRQ
                     ILIKLAITTAVTIPTFVFGVVGMSLLKKSNGFRRWLEEPLWRGNVAKIVWILFILSTP
                     VYFFIDDIFHRKAIKEVRALWLQKNNWQRRIFKFGSMNLLMSLGTSVAYFASIILLAL
                     SASKKSHTDKMPDTTTYFDSVVFLSFFLLIGRLLEGFSKSKSAAAITNLSSMKQHSAK
                     LLENYKSDMSTERTVDVKYLEVGDYIKISSGESPPADCIIVQGETQFDESALTGESIP
                     VTHYPGEQIFTGTVNIGRGTVVAKLIAPEGDSLLDKIIGTVRDGQLKRAPVEKLADAL
                     TGYFVPIITFLAVMTWIIWLSLGYSHRLPRSYLDKDVGGWAVWSLEFAISVFVVACPC
                     GLGLAAPTALFVGSGLAAKYGILVKGGGAAFQEGSQISVVCFDKTGTLTKGGAPKISD
                     YAIISNPKMRAVTAHLVRDLEANSKHPLALGVTNFISENFAPEGKTRVPETEEVAGKG
                     MKGRVDLTTENNDIWNELSPEGIILGNERFMSSNGVSLTSHHLQLLHDWKVEGKSVII
                     VAIESPKFFQKPGYFPVMLLAARDEIRPESSSVIKGLQEMGIECWMISGDNELTARSI
                     AKDLGIDQVVAEVLPQEKADKVEWIQQTYRRKNGKPAVVAMVGDGINDTPAMAKADVG
                     IALASGSDLAMISCDFVLLSSTYTLKSLLILFQLSKKVFRRVRFNFAWAICYNVITVP
                     IAAGVIYPHKHARLSPVWASAAMAFSSVSVLLSSLALRFYKPKEVSLTEDTVLPSVSQ
                     EHKFN"
     gene            complement(<60190..>61791)
                     /locus_tag="ZYRO0B00770g"
                     /db_xref="GeneID:8202124"
     mRNA            complement(<60190..>61791)
                     /locus_tag="ZYRO0B00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494942.1"
                     /db_xref="GeneID:8202124"
     CDS             complement(60190..61791)
                     /locus_tag="ZYRO0B00770g"
                     /note="similar to uniprot|P32457 Saccharomyces cerevisiae
                     YLR314C CDC3 Component of the septin ring of the
                     mother-bud neck that is required for cytokinesis septins
                     recruit proteins to the neck and can act as a barrier to
                     diffusion at the membrane and they comprise the 10nm
                     filaments seen with EM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494987.1"
                     /db_xref="GeneID:8202124"
                     /db_xref="GOA:C5DQJ3"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ3"
                     /translation="MSVREERVPIKKEESSYSMGAGIPNAGPTEQVPGSQANAAESNL
                     GRAESSSLSESQTPANMYSGGIGAEYPATGNDTPQVGQVLPEQPELKILRRKIPGFVG
                     FANLPKQWHRKSIRRGFNFNLLVVSQRGLGKSTLINTLFNKDLDSISGKSPANSQALA
                     EKLEGVNLEDGEHGENGTNGGIGNNESNNNDSSGLHASVKINAATTTIEENGVNLRLT
                     VVDTPGFGDAIDNTDSWKPIVDEINLRFDQYLDSENKINRSFEDDNRIHACLYFIEPT
                     AHYLKPLDIEFCKQVHEKCNLIPIIAKSDILTEEEITVFKRRIKKQLDEAHIQLFQPP
                     QYGFDDEEAIQASHELFDNMPYAVVGSTDVVVSKDGRQVRGRSYPWGVIEVDNSKHCD
                     FVYLRDLLISQYLEELREKTSKVLYERYRSEKLSKLGIKQDNSVFREFDPDMRQKEEK
                     QLHEAKLAKLESEMKTVFHQKVAEKEKKLQKSEAELFSRHKEMKEKLSKQLKALEEKK
                     RQLESSANAPAPPSPAQPKKKGFLR"
     gene            <62763..>63920
                     /locus_tag="ZYRO0B00792g"
                     /db_xref="GeneID:8202125"
     mRNA            <62763..>63920
                     /locus_tag="ZYRO0B00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494943.1"
                     /db_xref="GeneID:8202125"
     CDS             62763..63920
                     /locus_tag="ZYRO0B00792g"
                     /note="weakly similar to uniprot|Q12373 Saccharomyces
                     cerevisiae YLL022C HIF1 Non-essential component of the
                     HAT-B histone acetyltransferase complex
                     (Hat1p-Hat2p-Hif1p) localized to the nucleus has a role in
                     telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494988.1"
                     /db_xref="GeneID:8202125"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019544"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ4"
                     /translation="MSNATHKDITTQEVQTLLIEGAKYSASDDAEKAAKCYARILDLE
                     SQNAEIYLLLARCLYRLGLKRNDVFGGADDGEDSENDEDEDESDADDEDGEENGDDGE
                     KKQKLNSKLYQFDHEEEDIDESTLQNFEDATNASAYVDARGESILQGGNGQDESKQQD
                     EDEEEEQEADMSIGDTFEDFLQGNLFENGLELLYRARIMYMEPHGEDKEDSEALSKDT
                     QLKLAQLYDLLGDIDQELEDFTQAVRDYEGSLKFYDKSLAPEEREILVDVYLKLTDAL
                     RWSDFDDKDSLNKEQRQRHLQELEKLIRSRIDENRSKDVEADQSHLERLKEDQESLKL
                     DKPKAGKSLVPELMAQAILRQALGGSQGKVNDLSKMVKKKKTKSSKGSRRK"
     gene            <64186..>65013
                     /locus_tag="ZYRO0B00814g"
                     /db_xref="GeneID:8202126"
     mRNA            <64186..>65013
                     /locus_tag="ZYRO0B00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494944.1"
                     /db_xref="GeneID:8202126"
     CDS             64186..65013
                     /locus_tag="ZYRO0B00814g"
                     /note="similar to uniprot|Q12164 Saccharomyces cerevisiae
                     YLL023C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494989.1"
                     /db_xref="GeneID:8202126"
                     /db_xref="GOA:C5DQJ5"
                     /db_xref="InterPro:IPR005344"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ5"
                     /translation="MSAAPSSVPNQTIKPQTRIEKLFQLTKTLQFAWFCGHAITLVFS
                     TLYFITYCPKIYRVAYAGVLESFGIITYQHYYLKQSSLQDRSLTPSALLLNDDLLYFG
                     MAFVWFITPRFALSLVPYAVFSLFHVLIYCKSVLLPQVFDMSPGSKCVGAISNFIHQY
                     NERSMYWMGSVEIFTWVWLTLRALLFRRRSWIVWLSYSFFLKVRFENSKYIKSSFAQW
                     RVRLDGIVSHSSVPPMVKQWYHRFEVLLLKVSRYRLSKDTTTANPSPTTQAPRPHYQ"
     gene            <65436..>67361
                     /locus_tag="ZYRO0B00836g"
                     /db_xref="GeneID:8202127"
     mRNA            <65436..>67361
                     /locus_tag="ZYRO0B00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494945.1"
                     /db_xref="GeneID:8202127"
     CDS             65436..67361
                     /locus_tag="ZYRO0B00836g"
                     /note="highly similar to uniprot|P10592 Saccharomyces
                     cerevisiae YLL024C SSA2 member of 70 kDa heat shock
                     protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494990.1"
                     /db_xref="GeneID:8202127"
                     /db_xref="GOA:C5DQJ6"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ6"
                     /translation="MTKAVGIDLGTTYSCVAHFQNDRVEIIANDQGNRTTPSFVAFTD
                     TERLIGDAAKNQAAMNPSNTVFDAKRLIGRNFADPEVQGDMKHFPFQIVDVDGKPQIQ
                     VEYKGETKKFTPEQISSMVLGKMKDTAEGYLGSGITDAVVTVPAYFNDSQRQATKDAG
                     TISGLNVLRIINEPTAAAIAYGLDKRGQEENVLIFDLGGGTFDVSLLSIEDGIFEVKS
                     TAGDTHLGGEDFDNRLVTHLANEFKRKNKKDLTTNQRALRRLRTACERAKRTLSSSAQ
                     TSVEIDSLFEGIDFYTSLTRARFEELCGDLFRSTLDPVEKVLRDAKLDKSAVHEIVLV
                     GGSTRIPKIQKLVSDFFNGKQPNKSINPDEAVAYGAAVQAAILTGDESSKTQDLLLLD
                     VAPLSLGIETAGGVMTKLITRNSTIPTKKSETFSTYSDNQPGVLIQVFEGERARTKDN
                     NLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKTNKITITNDKGRLS
                     KEDIERMVAEAEKFKEEDEKETSRIQSKNQLESIAYSLKSTVSEAGDKLEAADKETVS
                     KKAEETIAWLDSNTTAAKDEYDDKLKELQEVANPIMSKLYQAGGAPEGAAPGGFPGAG
                     GAPPAPEAEGPTVEEVD"
     gene            complement(67651..67722)
                     /locus_tag="ZYRO0B00858r"
                     /db_xref="GeneID:8202128"
     tRNA            complement(67651..67722)
                     /locus_tag="ZYRO0B00858r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove score=66.07"
                     /db_xref="GeneID:8202128"
     gene            complement(68342..68413)
                     /locus_tag="ZYRO0B00880r"
                     /db_xref="GeneID:8202129"
     tRNA            complement(68342..68413)
                     /locus_tag="ZYRO0B00880r"
                     /product="tRNA-His"
                     /note="tRNA-His (GTG) cove score=64.94"
                     /db_xref="GeneID:8202129"
     gene            <68798..>71578
                     /locus_tag="ZYRO0B00902g"
                     /db_xref="GeneID:8202130"
     mRNA            <68798..>71578
                     /locus_tag="ZYRO0B00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494946.1"
                     /db_xref="GeneID:8202130"
     CDS             68798..71578
                     /locus_tag="ZYRO0B00902g"
                     /note="similar to gnl|GLV|CAGL0E03608g Candida glabrata
                     CAGL0E03608g and some similarites with YHL023C
                     uniprot|P38742 Saccharomyces cerevisiae YHL023C RMD11
                     Protein required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494991.1"
                     /db_xref="GeneID:8202130"
                     /db_xref="InterPro:IPR005365"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ7"
                     /translation="MHELLPNSCLLGIHLTISTHSGPQVVYHYPPASEDYISGKQRQS
                     RQDSTGVDDGESNGKIYAGNLRKKPSMGASLTGQSLFSSDQKFNDEDNIKTPSIRSGG
                     TGSIRRRRTHSIDSGKVRHGVETESASSDTDPSSSGLSDSELSTDYADESSDSSSSLE
                     NERNDEPEDISNEPRLSNSVTRNNTSANTTNLEPTRMLRPKSSQVSASKLLDIFNKEG
                     PDRRPSAISKISNTRTPESSEDEADDDQKSELDFSELHERGKIMLDKQYFAENVFQDI
                     NKIFGLDAEFVAEFCSPEREMCNTRYEFTVDTLCFLGLPVHVDQHGNWRKSKRKKHTT
                     RSKRSSSTTTRLSKQRSSLSQNGDGESGENDMDSSQLRSSSHNLQDDNGEINEDNDEC
                     ENSNNQNIKEDLEKNMNMFHVCFVMNPSLVEYNERIDDMFHYAVARLSMLLRYAQEKS
                     QYVSKECSIIMKEKEHVLKHSKTYRAIKGANQRGKYLYQCILSKSSLARALTLCVEKL
                     QQNDIACLEIGEDKVIALQIPIQNEFAVLPNFKLHPVLRGSFLSSVLNSQFLSAGPLA
                     KEESLGGYTDSDHEDLTDLLNFALLLDEPTNIIKELETFSYHDDIGNIVLSHIVKHIQ
                     PNVPLGSYQYLIDELFGDTSDDVRGSFQTNMLRSCALHLLYRRHARLIIPISSRNTYI
                     VSPLAPIRGYSKNDYDGLQNSSMPLIYQNQTIFKERFPTLPSLPSFLHLLSNGKPKPY
                     GNIIPSKEHKSIYLGALAWLLKYGYVTQLLTFVCIRVDRQIKMAVDEDLEKEGFKAKT
                     HSVDRDHDAMDNVAKNAKDLQTSQKNRTSSNEEEEEDIARFAYDDPDIGRDYTIILEP
                     ERATAIEKRWMFKCVQDQPTDIQKLFGKLLKYFNGRTPMELIILKEGISRHDIRKLIG
                     TLDRYVIEFDHW"
     gene            complement(<71856..>74432)
                     /locus_tag="ZYRO0B00924g"
                     /db_xref="GeneID:8202131"
     mRNA            complement(<71856..>74432)
                     /locus_tag="ZYRO0B00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494947.1"
                     /db_xref="GeneID:8202131"
     CDS             complement(71856..74432)
                     /locus_tag="ZYRO0B00924g"
                     /note="some similarities with uniprot|P38741 Saccharomyces
                     cerevisiae YHL024W RIM4 Putative RNA-binding protein
                     required for the expression of early and middle
                     sporulation genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494992.1"
                     /db_xref="GeneID:8202131"
                     /db_xref="GOA:C5DQJ8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ8"
                     /translation="MTISSVMDPVAGGEDASMEQDIGGAINNSKVDTEISEDIGQLLP
                     TEVSSAESDNLDDDDDDNDLDQENENLLDEITEEDIKRSSDGNGNNNEDGKNCFSVNQ
                     ERKPLSVINNATNKKGNTKPLNQEQVAPTAEKSQGDSGETELQAQARAQARTQAQEKE
                     DYVPKTESNGDANDTSDTGTTTSFRGRPSSCVFVASLAASLSDDELCISVTESFKQYG
                     QLARVKVLRDPANRPYAFVQYTNDRDAKRALKMARGSMLNGRTLRCESARVNRTLFVT
                     HVTPVYYLEVADLCGKFGELEQLVPSSDQNQFGRRYNYPSSNTSSWFVQFAYRDDAIR
                     AFANLRTNSDWDVEWVQNIEVPKYYNLLNKKDKQQTTNSRGKSTVTENDLDEESEFGD
                     NHDSFSSSNTTSSDDRIVIDKKSIFVGQLDQSVTKEKLLERFSTHGKISDLNLINKTN
                     KVFTFIQFETEEAAAAALERENHAIFLNKTMHVQYKEVGGHRSRRNFRRDGFYGNVRN
                     PGPGGAPNNGGSGGSNSTTTASAAAAAVVAAAAGHGGQGGQGRVFTGPQVNLAPPPIN
                     MYRRRAQENDTSNVVPPYMAQQMSTPTSEFDMNYIPYMNAGFRRKSSFVNNGWSSSRS
                     HSMKSEMDTVCGDGATDATSDAPSESGGQTNSPTTYNNSSAGSMGQNNNNSTSHNGSD
                     NNDGDDDDDDDENTNNSNNNNNNNNNNNNGNTNGNNGHHNSHHNYNVGNFNTGGNGKR
                     KYGKRGGNNRFHDTPKPYYFQPYYYHPMHYPMGPLGPVAHAHPSQAAAAAAGNHPYMM
                     IYPMPPPPPTGVDGNLLAQSLPLGPPGPMLHGSPPTSQSQDARSEANEFVPNTKSCQL
                     DY"
     gene            complement(<76350..>79085)
                     /locus_tag="ZYRO0B00946g"
                     /db_xref="GeneID:8202132"
     mRNA            complement(<76350..>79085)
                     /locus_tag="ZYRO0B00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494948.1"
                     /db_xref="GeneID:8202132"
     CDS             complement(76350..79085)
                     /locus_tag="ZYRO0B00946g"
                     /note="highly similar to uniprot|P31539 Saccharomyces
                     cerevisiae YLL026W HSP104 Heat shock protein that
                     cooperates with Ydj1p (Hsp40) and Ssa1p (Hsp70) to refold
                     and reactivate previously denatured aggregated proteins
                     responsive to stresses including: heat ethanol and sodium
                     arsenite involved in [PSI ] propagation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494993.1"
                     /db_xref="GeneID:8202132"
                     /db_xref="GOA:C5DQJ9"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR002078"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028299"
                     /db_xref="UniProtKB/TrEMBL:C5DQJ9"
                     /translation="MNDETQFTDRALSILTLAQKLAQDHQHAQLQPIHLLAAFVDTPE
                     DGSVPFLQNLVEKARYDYSTFNRTVNRHLVRVPSQHPAPQQISPSYALAQVLQDAAKI
                     QKQQKDSFIAQDHLLFALFNDSSIQQVFKEAGVDVEAIKQQALEMRGNQRIDSRGSDT
                     NTPLEYLSKYALDMTEQARKGKLDPVIGREEEIRSTIRVLARRIKSNPCLIGEPGIGK
                     TAIIEGVAQRIIDDDVPTILQGSRLFSLDLAALTAGAKYKGDYEERLKGVLKEVEESK
                     TLIVLFIDEIHMVMGNGKDDAANILKPALSRGQLKVIGATTNNEYRAIVEKDGAFERR
                     FQTIEVLEPTIRQTVAILRGLQPKYEIHHGVRILDSALVTASQLAKRYLPYRRLPDSA
                     LDLVDISCAGVAVARDSKPEELDSKERELQLLQVEIKALERDIDSDSTTKERLQQARQ
                     KEASVQEELEPLRKRYEEERHGHEELTQAKKKLDELENKALDAERRYDNATAADLRYF
                     AIPDIRKRIEQLEQEVAEEERRAGNTSMIQNVVDSDTIAETAARLTGIPVKKLTESEN
                     DKLIHMERELSSEVVGQMEAIKSVSNAVRLARSGLGNPRQPASFLFLGLSGSGKTELA
                     KKVAGFLFNDEDMMIRVDCSELSEKHSVSKLLGTTAGYIGYEEGGFLTNLVQRKPYSV
                     LLFDEVEKAHPDVLTVLLQMLDDGRVTAGNGKTIDCSNCIVIMTSNLGAEIINAQPGS
                     RIQDATKGQVMSIVGTHFRPEFLNRISSVVIFNKLSRKAIHKIVDIRLEEIQKRFEEN
                     DKNYKLEVSQEAKDFLARYGYSSDLGARPLNRLIQNEILNKLALRILKGEIQDKETVR
                     VVFRKGTARGTGRYEDEEEGLEVLPNREAANKSNPETVEMDVDEEDQDYQDDDLD"
     gene            complement(<79525..>80292)
                     /locus_tag="ZYRO0B00968g"
                     /db_xref="GeneID:8202133"
     mRNA            complement(<79525..>80292)
                     /locus_tag="ZYRO0B00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494949.1"
                     /db_xref="GeneID:8202133"
     CDS             complement(79525..80292)
                     /locus_tag="ZYRO0B00968g"
                     /note="some similarities with uniprot|Q07821 Saccharomyces
                     cerevisiae YLL027W ISA1 Mitochondrial matrix protein
                     involved in biogenesis of the iron-sulfur (Fe/S) cluster
                     of Fe/S proteins isa1 deletion causes loss of
                     mitochondrial DNA and respiratory deficiency depletion
                     reduces growth on nonfermentable carbon sources"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494994.1"
                     /db_xref="GeneID:8202133"
                     /db_xref="GOA:C5DQK0"
                     /db_xref="InterPro:IPR000361"
                     /db_xref="InterPro:IPR016092"
                     /db_xref="InterPro:IPR017870"
                     /db_xref="UniProtKB/TrEMBL:C5DQK0"
                     /translation="MIAQCVRNDSMLLLGQSQRLFSRCTVLKEKGASSYHFTPHSRGF
                     LRTSLPDDKPPVLSQLFFSVGQKEQGQHRNKARQLPQPQLQERDNVRSKWSSYTMPSK
                     EVLKEQEEKQKQEEKHAAAPTEAPSKEAENPARLRRRKNRRTLRPRKALISLSPRAMT
                     HLRSLLDQPEPKLIRIGVTNRGCSGLSYDLQYITEPGKYDEIVEQDGIKVIVDSKALF
                     SVVGSEMDWIDDRLSSRFVFRNPNSKGTCGCGESFMV"
     gene            complement(<81433..>83211)
                     /locus_tag="ZYRO0B00990g"
                     /db_xref="GeneID:8202134"
     mRNA            complement(<81433..>83211)
                     /locus_tag="ZYRO0B00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494950.1"
                     /db_xref="GeneID:8202134"
     CDS             complement(81433..83211)
                     /locus_tag="ZYRO0B00990g"
                     /note="similar to uniprot|Q07824 Saccharomyces cerevisiae
                     YLL028W TPO1 Proton-motive-force-dependent multidrug
                     transporter of the major facilitator superfamily able to
                     transport eight different compounds including polyamines
                     quinidine cycloheximide and nystatin involved in excess
                     spermidine detoxification"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494995.1"
                     /db_xref="GeneID:8202134"
                     /db_xref="GOA:C5DQK1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DQK1"
                     /translation="MSAYEKQPSPVSPPSSNSFSSTSSRSVPESEPAAFGGTSPDTHA
                     RTDIPSNEKRYNDHGEHGAVDESHASFQSGHASLAPEGEVDATRKLSRIYTGTQQDLE
                     KISVDYTGCPTMGGGRPYPPALPSKDAYEVTYDGPDDPTHPFNWSIKKKVWLCCWLCL
                     DCIAIAMGSSIFASGVEQICEIYHVIPVVAILGIALYVLGFAASPIIYAPLSELYGRR
                     GVLVISSFGFAIFHFAVATAKDLQTIMICRFFAGFIGAAPMAVVPAAFTDMFDTNFRG
                     KVMALFALGVFVGPIIGPVMGSYIVQHTTWRWLEYVTACFSSLVFVGIILFYDETHHA
                     TILVSKASELRKKSGNWGIRASHEDVELSIAEIAKKTITRPIYMLFVEPILFFITLYN
                     SFVYGILYLLLEAYPIIFVEGYGLKKNGELPYLALIVGMFVCAGYIWYCETAYLRKCK
                     QHGGLVPEARLYPMVGAGIVFPIGILWFCWTGNYPHKIHWSCPTVAGGLIGFGLLGIF
                     LPCLNYIIESYLMLAASAVAANTFMRSAFGACFPLFAGYMFHNMGTNWAGLLIGLFAV
                     ALIPVPFLFLKYGKKIRLRSKFAYSG"
     gene            complement(<83965..>86151)
                     /locus_tag="ZYRO0B01012g"
                     /db_xref="GeneID:8202135"
     mRNA            complement(<83965..>86151)
                     /locus_tag="ZYRO0B01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494951.1"
                     /db_xref="GeneID:8202135"
     CDS             complement(83965..86151)
                     /locus_tag="ZYRO0B01012g"
                     /note="similar to uniprot|Q07825 Saccharomyces cerevisiae
                     YLL029W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494996.1"
                     /db_xref="GeneID:8202135"
                     /db_xref="GOA:C5DQK2"
                     /db_xref="InterPro:IPR000587"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C5DQK2"
                     /translation="MTTRSANLNPKPSMQSLAVGTSRGTPGLTTQTVQGRQFRPCADC
                     TCSPGLLSRQGRRSSLFLRRLENTRRRSSRDCSTAIGGGSGQESVYSSDSLCQSTREV
                     NTTERLLALRREMVKHELCCYIVPSEDEHQSEYVSSADQRRAFISGFNGSAGIACITR
                     DLLNFNTEQPEGRSILSTDGRYFNQASQELDYNWTLLRQGEDTFTWQDWCVKEAAEMS
                     RGLGGKTAKIGVDPRLVSHELVVAFNRLITQKAGEGADVQLVPVEENLIDAIWPKFER
                     PPKKQLQSVIALSEDYSGENFKSKRSRLQKHLTKNYRNSGPLAIVALDEICWLLNLRG
                     SDIAYNPVFFAYAIADSDSVTLFTDNALHAEVQRYCADNEIQLEPYDQFWNRLSEKSQ
                     KLDQQQKFLIPDNSSWQLVRHVHCNYKSVHSPIDIFKSIKNETEIRNARRAQVKDAVC
                     LTQYFAWLEDQLINKGALIDEYRAAQKLTEIRRTQKNYKGDSFETISSTGANAAVIHY
                     APPKDGSSMINPDKVYLCDSGSQYLEGTTDITRTVHYGNPSQEEKDRYTLVLKGHLAL
                     ERLVFPEGTTGFQIDSIARQPLWSQGLDYRHGTGHGIGSFLNVHEGPIGIGARPSLLQ
                     YPLQSGNIISNEPGYYKDGEYGLRIESDMLVTHSGLKFGEKRFLQFENLTLVPYCRKL
                     INVKLLTKEERQQVNDYHARIWSSIVQFTQPQSITFKWLKRETSEL"
     gene            <87543..>90572
                     /locus_tag="ZYRO0B01034g"
                     /db_xref="GeneID:8202136"
     mRNA            <87543..>90572
                     /locus_tag="ZYRO0B01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494952.1"
                     /db_xref="GeneID:8202136"
     CDS             87543..90572
                     /locus_tag="ZYRO0B01034g"
                     /note="similar to uniprot|Q07830 Saccharomyces cerevisiae
                     YLL031C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494997.1"
                     /db_xref="GeneID:8202136"
                     /db_xref="GOA:C5DQK3"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:C5DQK3"
                     /translation="MDERSIRKSLLGTSVEEKRLYRSRIQKFRKCHTLYVILLASLAA
                     LQFIAIAFFTRGFLLTRQVLDNVSSPFPNQYGKFDKAVVLVIDALRFDFVIPVDESHP
                     QHNPNYHNNIKALWNDESLKGSSLLFKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNF
                     DGSVIEEDNLIKQLYLAQKNVYFAGDDTWSALFHPFLSAQSEPYPSLNVWDLDTVDNG
                     VMSYFERHLLEGGQTRHRDWDVLVGHMLGVDHVGHKYGPNHFTMREKQLQVDEFIRKI
                     IAAIDKDTLLIVMGDHGMDHTGNHGGDSIDELESTLFLYSKRPDMWQPNEDPNVYDVS
                     DLGKNYKQVNQIDLVPTLSLLLNLPIPFNSLGWPLEEIATSKKEFDFNVRLTLQQLSN
                     YKNVSGMVTNSERQAELDHLWNLAMENPKLGFDFQRNLLETCKDLWARFDFWSIGVGI
                     TLLVFSLILLLTITKLIPSIVVSQMVFEFVPWIIVMIFISNACFQGVFFVFQQPAFVS
                     DTLWCSLLATAVGIVIGTFIPIFDRYNIKWMVVRFVEDLSEYWTRIGVLLLTVHALLF
                     TSNSFTIWEDRIVAFLLITLGMLTLYEFVFVPKRQSTSALLTATISEKQGTASGASQS
                     TANSDSFPLTRFARLLGAYHSIVLVVCTRIASTITICREEQGEYCTPTFTTETNYSLW
                     CMGLCLVIVAMIPSCIKGYYNLSSSYQAAAPIWIDIFLKSFLFTNFIYWTLAALENSV
                     SDWSWNITVLKFTISRIIAGFALIASNIGWMMGPLCIKLNLHNADTKSHRATILGYSN
                     IYGAQYFLLVINALMGIFLFNKPLAQVSLYLMCNQMLSIIEIFHLLKLKENIVGPFAL
                     ALLSYSQFFSTGHQATIPAIQWDVGFILSETITFPLTHLAIVLNTFGPLIITALTVAL
                     LTLWEQPPDVLKPQTLLGRLVSNCGLLLVYHTVLCLSSFVWVTFFRRHLMVWKIFCPR
                     YLFAGMSLIVVQLVVTFGAVALASGRLIRQINDIFWK"
     gene            complement(<90616..>91647)
                     /locus_tag="ZYRO0B01056g"
                     /db_xref="GeneID:8202137"
     mRNA            complement(<90616..>91647)
                     /locus_tag="ZYRO0B01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494953.1"
                     /db_xref="GeneID:8202137"
     CDS             complement(90616..91647)
                     /locus_tag="ZYRO0B01056g"
                     /note="weakly similar to uniprot|P18888 Saccharomyces
                     cerevisiae YHL025W SNF6 Involved in global regulation of
                     transcription subunit of the chromatin remodeling Snf/Swi
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494998.1"
                     /db_xref="GeneID:8202137"
                     /db_xref="UniProtKB/TrEMBL:C5DQK4"
                     /translation="MPVVKKRRTHHGKSSRIHHQLQLQQQQQLQVKQRFENSRLRPEH
                     VSAVSHDESDTISYRSHLLKNFIKSGEFIDVLTTQLVPLDKIKPPEIFKGITPSQLEG
                     KLQVQKESLSQLQEVLNGFKWELDDNSSFLKDKLWSAELNLQEPDEILKLYESKFELR
                     SQENSVVTHKGKFTHLQKDQSRAPDGYWSNHAKLKKELREKKLQIQWEQEQERQRREQ
                     ERRAQEEEELRRKEEEQHQQRQREREQLEQEHFQRQQLEQQQEQQQEQQLQPAQDENQ
                     DQQFQEGPNDSQQDEQSPDDDSKAQVPPSQQQNSNPNMMDSIFGDFGNEPFNNGFEDE
                     FGDIDTAFF"
     gene            complement(<91817..>92560)
                     /locus_tag="ZYRO0B01078g"
                     /db_xref="GeneID:8202138"
     mRNA            complement(<91817..>92560)
                     /locus_tag="ZYRO0B01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494954.1"
                     /db_xref="GeneID:8202138"
     CDS             complement(91817..92560)
                     /locus_tag="ZYRO0B01078g"
                     /note="similar to uniprot|P28320 Saccharomyces cerevisiae
                     YKL095W YJU2 Essential nuclear protein putative
                     spliceosomal component involved in mRNA splicing based on
                     computational analysis of large-scale protein-protein
                     interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002494999.1"
                     /db_xref="GeneID:8202138"
                     /db_xref="InterPro:IPR007590"
                     /db_xref="UniProtKB/TrEMBL:C5DQK5"
                     /translation="MSERKVINKYYPPDFDPLKAERDLKKANKSLKKRNNGVVTVRLM
                     TPFSIRCLKCDEYIPQSKKFNGKKEILDEKYLDTFKMYRLNIRCPRCSNCIAFRTDPQ
                     SADYVMEFGGTRNYAGRLKENKNVETADQALERLVKEHDDDRHRGEDKMQALEERLSK
                     LQREQEGDQQLVALKNSRAQQQRKVDSLSHESEEDQDDELDKLAERAFESRKGRADTL
                     KVSKPAKKIRRATGAHTGAPNPLGIRIKR"
     gene            <92729..>93499
                     /locus_tag="ZYRO0B01100g"
                     /db_xref="GeneID:8202139"
     mRNA            <92729..>93499
                     /locus_tag="ZYRO0B01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494955.1"
                     /db_xref="GeneID:8202139"
     CDS             92729..93499
                     /locus_tag="ZYRO0B01100g"
                     /note="some similarities with uniprot|P38749 Saccharomyces
                     cerevisiae YHL009C YAP3 bZIP transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495000.1"
                     /db_xref="GeneID:8202139"
                     /db_xref="GOA:C5DQK6"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C5DQK6"
                     /translation="MGINEYAMDMRGYSIDPFDTLDSLKVSVPSPLSEYILNSNGSES
                     GDGVLTPTDNATAAKSDVTVSSNGNSSGELTEEKLKQIKRAQNRAAQRAFRERKETRL
                     KELEQELRQSEARRKQLDEELERLCRANLEMNAENKILLEQGEVGDYGTQGGRFTFPH
                     EIAHENSGSLQESREYSSKIFKTEGHYLDESGKEILTVPATWDYLHQLSEQVQFNVTG
                     VLDSLKGNEVCHGLGAAYPRVLVDQQVREQLVRDASRA"
     gene            <93637..>94983
                     /locus_tag="ZYRO0B01122g"
                     /db_xref="GeneID:8202140"
     mRNA            <93637..>94983
                     /locus_tag="ZYRO0B01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494956.1"
                     /db_xref="GeneID:8202140"
     CDS             93637..94983
                     /locus_tag="ZYRO0B01122g"
                     /note="similar to uniprot|Q75DK5 Ashbya gossypii ABR016C
                     ABR016Cp and weakly similar to YKL090W uniprot|P36075
                     Saccharomyces cerevisiae YKL090W CUE2 Protein of unknown
                     function has two CUE domains that bind ubiquitin which may
                     facilitate intramolecular monoubiquitination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495001.1"
                     /db_xref="GeneID:8202140"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR003892"
                     /db_xref="UniProtKB/TrEMBL:C5DQK7"
                     /translation="MHYYAIIIQSTLYIVLFLNVKYIKFQEAEAVERINMDESVALLV
                     EMFPDKPVDELNSALKSSNGILDDACVMLVSEDSSRENVNPHEQLKSMFPLVHQPTIE
                     KVWHDQNGDFDNTVVELLNHHMLLEENDSRDPEPSPQPESKSTVDIVQEYTGVTSSIA
                     RHFSYRSSFNVVKAIVSILDSYREPPQEKKTPAAPLPKHRTGGRVQGPKGAAHADKLA
                     SSSTREASPVTQDRPPYVYSIESAEAQELEDAIKSNLNLRSIHPKFLHRALEYYRGDL
                     LKTLQLASLIIEQNGTRYTYKDAHEESYDLSGFTEYKPRGKRRSPRDFNGNSNFSLQD
                     DSYAPIARSMWSNVLTNPRLDFHGFLCPDAIQVLQKCLEKWWKHELDQRELNNQKLSM
                     TQVANVDPLRVITGRGIHSDNGVSKLKTQVRRFLERNQYKFVEETAYFVIVGKKVR"
     gene            <95128..>96918
                     /locus_tag="ZYRO0B01144g"
                     /db_xref="GeneID:8202141"
     mRNA            <95128..>96918
                     /locus_tag="ZYRO0B01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494957.1"
                     /db_xref="GeneID:8202141"
     CDS             95128..96918
                     /locus_tag="ZYRO0B01144g"
                     /note="weakly similar to uniprot|P35201 Saccharomyces
                     cerevisiae YKL089W MIF2 Kinetochore protein with homology
                     to human CENP-C required for structural integrity of the
                     spindle during anaphase spindle elongation interacts with
                     histones H2A H2B and H4 phosphorylated by Ipl1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495002.1"
                     /db_xref="GeneID:8202141"
                     /db_xref="GOA:C5DQK8"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR025974"
                     /db_xref="InterPro:IPR028386"
                     /db_xref="InterPro:IPR028929"
                     /db_xref="UniProtKB/TrEMBL:C5DQK8"
                     /translation="MDYMHLGVRSRKTGINARQGLEKDEYSMERIDDFFSEDSTSHIS
                     GDRRKSRRSSMLSLLSSGGPSGSFVSDSDHQQSTSPSRRSSRVYRFSLPENDTIQEEE
                     PVDNNNNVPIDYDLPPPPTPSLSDKMEQPLDGPSIRLTPEKSTNGDVPDLIQDDEDTR
                     DYTSFNTSENALLEDEMDDDYEAISEEDRDYVEGESSLEQTLSADDSDSSSSSGSGSD
                     AGDTTMAKSEEEEEEDLATVPSRRTYGYDNVPPEIYDSDEEYIQKQAPELDQDPHATD
                     DQSLRRSNRVKIAPLEWWRNEKVVYKRKTSKPVLEIDKIVTYDKNDEEDDEEELSIGR
                     RKGRNKKKTATTTRTRPYNYIPTGKPRGRPRKHKAFGMSGGLVENPNTDLLEEINQGK
                     IPQGEWLQHGILEANVNVTMDRQGDEIIAFAPNLSQSEQIKETEDEHFSLEVMFDAHK
                     DHFASGMLKIPRYGKKKLSDSYNVFITFFVVQGVLEVTLAGNTFLTTEGSSFQVPAFN
                     EYALENRGNNEVKMFFTQVTISIDELQNGHSTHQSSDEEDMQSQSLDAGVNDSGSSSQ
                     DEDTLTTTRKSNEIASAKRSSLSSMSISDI"
     gene            complement(<97168..>100059)
                     /locus_tag="ZYRO0B01166g"
                     /db_xref="GeneID:8202142"
     mRNA            complement(<97168..>100059)
                     /locus_tag="ZYRO0B01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494958.1"
                     /db_xref="GeneID:8202142"
     CDS             complement(97168..100059)
                     /locus_tag="ZYRO0B01166g"
                     /note="weakly similar to uniprot|Q03497 Saccharomyces
                     cerevisiae YHL007C STE20 Signal transducing kinase of the
                     PAK (p21-activated kinase) family involved in pheromone
                     response and pseudohyphal/invasive growth pathways
                     activated by Cdc42p binds Ste4p at a GBB motif present in
                     noncatalytic domains of PAK kinases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495003.1"
                     /db_xref="GeneID:8202142"
                     /db_xref="GOA:C5DQK9"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DQK9"
                     /translation="MEHSNTTGVKDSLDLDNTNLKEDVESFDLPRVQGTLNVNALQES
                     ENIDASDAGNSPRLRNISEYRSMDPGRSHEPAMEHSTSLDDPIQFTRVSSSSVLSGLS
                     SSEGEKEVPSEEPQEVERNEQRHDPSDDTTKGSITLDKSGFADNTNSTIHASESEPQF
                     NGYSRNLNQSNESSYLDSSVERGNSSSKSGSVGTQGSSSGIPNNQNNNSFTSNNNNSN
                     RQIMTPPIAAHHATVPLPVRGSSPVNISKSSSFSPFGASKKLSTNSNVMSPRSQSASS
                     STQKLEQSKKKNNGSGSSRMKGVFTSFVNNMKRTSGGEKNKQQPGTSVVKISTPYNAK
                     HLHHVGIDSRTGEYTGLPTEWEKLLTSSGISKREQEQNIQAVVDIVKFYQDVTESSGE
                     DKTFKTFNVTNPSPLEASSPTFKTPSTSSVNRFKSNNLPQDSTTPERGVQTPQLQQYQ
                     SFSSPQNGVSRNSPAHVYSPEKINQLPTPAPPLANGISMGNESDPNAGGIGGSHQKFI
                     PTRPAPKPPTAGKTSVSPVLEPSRSNSSPQVPQIPHSQSSTSLPSRKPSSKREDQPLP
                     PLPQHKEEENVDKLDKMEDRTDQKDGKTAPSPSTPTARHNKSKTPSREVSKKNNVALA
                     EKKREERERRTKQLYAQLGEICAEGDPSKLYLNLTKIGQGASGGVYTAYELGTNASVA
                     IKQMNLEKQPKKELIINEIMVMKGSKHRNIVNFIDSYLLKGDLWVVMEYMEGGSLTDV
                     VTHCILTEGQIGAVCRETLAGLQFLHSKGVIHRDIKSDNILLSMTGEIKLTDFGFCAQ
                     INEINLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLR
                     ALYLIATNGTPKLKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENS
                     SLAPLVKLARMKKIAEKMEHDDDDDDDDDEDDGGGEEGVEEQEVTTAQG"
     gene            complement(<100607..>104977)
                     /locus_tag="ZYRO0B01188g"
                     /db_xref="GeneID:8202143"
     mRNA            complement(<100607..>104977)
                     /locus_tag="ZYRO0B01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494959.1"
                     /db_xref="GeneID:8202143"
     CDS             complement(100607..104977)
                     /locus_tag="ZYRO0B01188g"
                     /note="similar to uniprot|P33202 Saccharomyces cerevisiae
                     YKL010C UFD4 Ubiquitin-protein ligase (E3) that interacts
                     with Rpt4p and Rpt6p two subunits of the 19S particle of
                     the 26S proteasome cytoplasmic E3 involved in the
                     degradation of ubiquitin fusion proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495004.1"
                     /db_xref="GeneID:8202143"
                     /db_xref="GOA:C5DQL0"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DQL0"
                     /translation="MDDHDLHSGSSDYMVDEHSSMEGQDEYEYPDGSPSDRGHDTSSD
                     RYHDGDEEDQDVFIDYDAVEQEDEDHHDDDADDEGDHSGRPDARSFTMQDILGNLVQG
                     MEGRPQVGGERSSSGPFSRGSGPMNLADVFPEILSLLNDGGHRGGSGLGGGGRNNRIS
                     KLVKNVLNADEDPYFAMESLRELSEHLLMMNQVVVDRVFPVEKLLRGILNILSNPMLK
                     GELELQLVSCRCLYNLFEVNPESISMAVDENLVPILQEMLQDISYIDLAEQILETLEL
                     VSRLRGREVLQSGTLASCLQYLDFFTIHAQRKAVSIVANSCTKVRMDSFETIQTLFVL
                     LKPIFANASDQPIISKLLNALYGVCGGLRDSNMLESLFTFEVVERLLKLVSAADSQLE
                     DRLKCLDILSVLVNLSSEISRELLESCDIIGTLEECFACYSKNPNASLHETLMFVPKP
                     LLHAIARTVALLLPTENEQLLSVDSPKQVSLTDDNERVNKTLTNLTPLLIEIFINTVD
                     FDVRRCVLIALARIVSFLKSPLTGEVDRHIIHLVGTTLAQNETNLEQGKSQAIVSGGL
                     VIGVLSLLDIITARFASDFLPGIRREGIVDLVDKLYEFLKQKGQDDKFTIDEDVTAIE
                     TSGAASGGTGGELSDDEEMAEDDEDNEYDIQFGAIDIPEQVKPKKIKFEVLKPLNYNY
                     IRIKTYELSKHLSELFSENEGTVVEELKEIEKLVTDLRELDAQGFTEQDWFQLWNRVK
                     SSIFNGNFEISSFELISSGLASVLSQLIERYGVLSFEPERTFVQVFGEQLPNFVNILQ
                     SALTRLESFHIVECGLQGSEGRVASLGRQMKIKLVYNGDAQEDNIAPHLTTITLSIHC
                     IASLKTLSEFLRHRIGQTRFLNSLLPGLTRSSSAGQDDMEDLKNWQFEFSINDNQLNP
                     SDTIFGALFKSMKRSDKDPADVWRDAQVIKFKRVKDSSANHELGLANVYAQRSFHKDD
                     ALRPAEDILNLLKFAKTNNLPNDLFVNAKLSAKISRQLEEPLIVAGGVLPDWSLYLTK
                     NYPFLFPFETRMFFLQCTSFGYGRLIQIWRNRMGNIKETNADDPLQQLGRVTRHKLRI
                     SRSTMFLSGLKILNKYGSSPSVLEIEYQDEVGTGLGPTLEFYASMSREFSKKSLGMWR
                     YDTLGSTTTQESDYVNALLFPAPLTSSQDEPKVLELFHHLGTFVARSMLDNRILDLNF
                     NKVFFELTHRISDRASVKARDTRDMLHLLSLVDPQLERSLKTLYNETDLESLTLTFTL
                     PGYDVELVENGKSILVNSANLSDYVERVLDYVLGAGIERQLNSFIEGFSKVFPYTSLL
                     LLTPEEIVHMCGRIQEDWSSETLYGSLVADHGYTMDSSTIHDLIYVMSTFNDQERRLF
                     LQFLTGSPKLPIGGFKALRPRLTVVLKHPDEGMNPDAYLPSVMTCANYFKLPKYTSQQ
                     TMRSRITQAMQEGSGAFLLS"
     gene            <105377..>106087
                     /locus_tag="ZYRO0B01210g"
                     /db_xref="GeneID:8202144"
     mRNA            <105377..>106087
                     /locus_tag="ZYRO0B01210g"
                     /product="mRNA turnover protein MRT4"
                     /transcript_id="XM_002494960.1"
                     /db_xref="GeneID:8202144"
     CDS             105377..106087
                     /locus_tag="ZYRO0B01210g"
                     /note="highly similar to uniprot|P33201 Saccharomyces
                     cerevisiae YKL009W MRT4 Protein involved in mRNA turnover
                     and ribosome assembly localizes to the nucleolus"
                     /codon_start=1
                     /product="mRNA turnover protein MRT4"
                     /protein_id="XP_002495005.1"
                     /db_xref="GeneID:8202144"
                     /db_xref="GOA:C5DQL1"
                     /db_xref="InterPro:IPR001790"
                     /db_xref="UniProtKB/TrEMBL:C5DQL1"
                     /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYKYVWVLK
                     LDDVRTPVLQEIRTSWAGSKLIMGRRKVLEKALGTTKEEEYRDNLHKLTSHCQGVTGL
                     LFTDESVDTVKGFFETYQRLDYSRPNSAAPLTFVIPAGVVYSRGGQIPEDEDVPMVHS
                     LEPTMRNKFNIPTRIQKGKITLDSPYKVCEEGEKLDVRQALILKQFGIALAEFKVKVA
                     AYFDSESSKVEEVGINMD"
     gene            complement(<106143..>106613)
                     /locus_tag="ZYRO0B01232g"
                     /db_xref="GeneID:8202145"
     mRNA            complement(<106143..>106613)
                     /locus_tag="ZYRO0B01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494961.1"
                     /db_xref="GeneID:8202145"
     CDS             complement(106143..106613)
                     /locus_tag="ZYRO0B01232g"
                     /note="weakly similar to uniprot|P38751 Saccharomyces
                     cerevisiae YHL006C SHU1 Protein involved in recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495006.1"
                     /db_xref="GeneID:8202145"
                     /db_xref="UniProtKB/TrEMBL:C5DQL2"
                     /translation="MKLQSLVEDLLQEDENYQRRSKALIFVLGDEARLYIERDLSASP
                     GRLSSVNAIIRSRRDVEVLFLNRLQYLFMYLMKWEAEDVGYNRLVLYGLDELIFLNRD
                     DSENLTNSQLRLANLVFSAAFRIKRKHCLKDVSVINLRDHVRLKQIEDYWRHVC"
     gene            <106790..>107989
                     /locus_tag="ZYRO0B01254g"
                     /db_xref="GeneID:8202146"
     mRNA            <106790..>107989
                     /locus_tag="ZYRO0B01254g"
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /transcript_id="XM_002494962.1"
                     /db_xref="GeneID:8202146"
     CDS             106790..107989
                     /locus_tag="ZYRO0B01254g"
                     /note="similar to uniprot|P32902 Saccharomyces cerevisiae
                     YHL004W MRP4 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP4"
                     /protein_id="XP_002495007.1"
                     /db_xref="GeneID:8202146"
                     /db_xref="GOA:C5DQL3"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005706"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="UniProtKB/TrEMBL:C5DQL3"
                     /translation="MSALRIHRCVSATRKPLSRVFPRFASTNNTPETTQSEDSHQDEV
                     FVMRQKHFNDQIVSQLKALSETPLDKIDGLQNVTDQPLTEKEKQLDEELTDFLTKYSQ
                     LNKLINNEDVNAGDAATSINGKIASHHKKYPYLVPSSRDKPYTSQELFLRQMKHSSHT
                     ARLGANIEQVYSPHKDVHNPLPAEKVSVNKLLEAGVHLGQSTSIWRPSTQPFIYGEYK
                     GIHLIDLNKTLSSLKRAAKVVEGISERGGVILYVGTREGQKRALEEAAKRTNGYYIST
                     RWIPGTLTNSTEISGVWERHEVDFADKPTNRELTPAETSGICKPDLIVVLNPTENRNA
                     LRESMQARVPTIGIIDTDSEPSMVTYPIPGNDDSLRSVNLILGVLSRAGQRGRQNRLA
                     KFSTDLE"
     gene            complement(<108095..>109360)
                     /locus_tag="ZYRO0B01276g"
                     /db_xref="GeneID:8202147"
     mRNA            complement(<108095..>109360)
                     /locus_tag="ZYRO0B01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494963.1"
                     /db_xref="GeneID:8202147"
     CDS             complement(108095..109360)
                     /locus_tag="ZYRO0B01276g"
                     /note="similar to uniprot|P38703 Saccharomyces cerevisiae
                     YHL003C LAG1 Ceramide synthase component involved in
                     synthesis of ceramide from C26(acyl)-coenzyme A and
                     dihydrosphingosine or phytosphingosine functionally
                     equivalent to Lac1p and similar to YKL008C uniprot|P28496
                     Saccharomyces cerevisiae YKL008C LAC1 Ceramide synthase
                     component involved in synthesis of ceramide from
                     C26(acyl)-coenzyme A and dihydrosphingosine or
                     phytosphingosine functionally equivalent to Lag1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495008.1"
                     /db_xref="GeneID:8202147"
                     /db_xref="GOA:C5DQL4"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="InterPro:IPR013599"
                     /db_xref="InterPro:IPR016439"
                     /db_xref="UniProtKB/TrEMBL:C5DQL4"
                     /translation="MTGHLKPINQADKLKPTSRTRRTSSVGKIDLGDTVPGLSASSNS
                     KEARHASKERVRRLSSSNASEINIWQRFWLNYRELSYQHTWVTPLVIMSVVYAGYLVS
                     GDYTPNNPLHMFVTISYQVGETNEYGKGIKDLCFILFYMVFFTFLREFLMDVVIRPLT
                     LKLGVRSNHRIKRMMEQVYAIIYYGVSGPIGLYLMYDSDLWFFETAPMYLTYPDFTNS
                     YKYKWFYLGQASFWAQQAAVLVLQLEKPRKDYPELVFHHIVTLLLIWSSYVFHFTKMG
                     LFVYVTMDISDFWLSLSKTVNYLDHPSTPTVFITFIFHWVYLRHWVNMRILWSVLTEF
                     RTVGDFVLNFATQQYKCWISLPIVFSLIAALQLVNLYWLFLILRILYRLLKDNVRKDE
                     RSESESDEEELAQTPTNDESNEAKKEKAL"
     gene            <110004..>111239
                     /locus_tag="ZYRO0B01298g"
                     /db_xref="GeneID:8202148"
     mRNA            <110004..>111239
                     /locus_tag="ZYRO0B01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494964.1"
                     /db_xref="GeneID:8202148"
     CDS             110004..111239
                     /locus_tag="ZYRO0B01298g"
                     /note="similar to uniprot|P38753 Saccharomyces cerevisiae
                     YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p complex
                     required for sorting of ubiquitinated membrane proteins
                     into intralumenal vesicles prior to vacuolar degradation
                     as well as for recycling of Golgi proteins and formation
                     of lumenal membranes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495009.1"
                     /db_xref="GeneID:8202148"
                     /db_xref="GOA:C5DQL5"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="UniProtKB/TrEMBL:C5DQL5"
                     /translation="MGSIEKAVLKATDPKLKGDNWQYILDVCDLVSEDPEDGGKEAME
                     LVESRLSQRDANVILRALSLITSLAENCGSRLQQLIASKDFTSKLYGLIKGKSVHVTV
                     KMEVAKVVKQLSLSFKSDPSLKYMNDLYVKISKNYPQLLQDDQPNVPGKYEMSYQSKV
                     KEDKDLEEALRLSLLSHQEQEKQKQLKEEQTEAPSTSTMTSVAPTVPQIPQQQVQQRQ
                     QSPPLASAAPPKRVKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIF
                     PLNYVTPVAEPTQQELWQEQAKEEELLAQKRKVDQLYHKMTESNSRGEDPTQDPNINE
                     LYGSVTPLRPEVAKLIGKHARKREELLSLRQVLANAEATYNQLLDRATNVYANPLSIQ
                     PPPRSNQRPSSDHIMPYPQ"
     gene            <111463..>112269
                     /locus_tag="ZYRO0B01320g"
                     /db_xref="GeneID:8202149"
     mRNA            <111463..>112269
                     /locus_tag="ZYRO0B01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494965.1"
                     /db_xref="GeneID:8202149"
     CDS             111463..112269
                     /locus_tag="ZYRO0B01320g"
                     /note="highly similar to gnl|GLV|CAGL0K02783g Candida
                     glabrata CAGL0K02783g and similar to YKL007W
                     uniprot|P28495 Saccharomyces cerevisiae YKL007W CAP1 Alpha
                     subunit of the capping protein (CP) heterodimer (Cap1p and
                     Cap2p) which binds to the barbed ends of actin filaments
                     preventing further polymerization localized predominantly
                     to cortical actin patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495010.1"
                     /db_xref="GeneID:8202149"
                     /db_xref="GOA:C5DQL6"
                     /db_xref="InterPro:IPR002189"
                     /db_xref="InterPro:IPR017865"
                     /db_xref="UniProtKB/TrEMBL:C5DQL6"
                     /translation="MSSAFESIISQIVSDTPSGEVKEVYQDLITIAGENSKDVIIEAI
                     EQYNVKNTIPVDVNGKNVILSPYNKEGSKFFDPAQAIEFSVDHLNRKGLDVAPFQGSK
                     LNETQQEYLKELNKYVEKDFTGQVSVAVYPVPQEESKTAIIIVSTKYNPGNFWNGAWK
                     SEYVYDSHLKQLKGFIDVQVHYYEDGNVGFKSKKDVEITDSESPIKSIQQVETSFEND
                     LDVSFTELNEKQFKQLRRRLPITRSRVNWGKAIGNYRLGRDAAQGKPPQA"
     gene            complement(<112296..>112678)
                     /locus_tag="ZYRO0B01342g"
                     /db_xref="GeneID:8202150"
     mRNA            complement(join(<112296..112553,112643..>112678))
                     /locus_tag="ZYRO0B01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494966.1"
                     /db_xref="GeneID:8202150"
     CDS             complement(join(112296..112553,112643..112678))
                     /locus_tag="ZYRO0B01342g"
                     /note="highly similar to uniprot|P43682 Saccharomyces
                     cerevisiae YKL006C-A SFT1 Intra-Golgi v-SNARE required for
                     transport of proteins between an early and a later Golgi
                     compartment"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495011.1"
                     /db_xref="GeneID:8202150"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C5DQL7"
                     /translation="MSNSRYHQLENRNDERLNSLANKLQTFRGINQDIGDQAVADNSV
                     MNQISDSFDSLLHGVKNTSQRLTRSLNAGGSVWRMVALALLIFFILYTLFKVF"
     gene            <113515..>113931
                     /locus_tag="ZYRO0B01364g"
                     /db_xref="GeneID:8202151"
     mRNA            <113515..>113931
                     /locus_tag="ZYRO0B01364g"
                     /product="60S ribosomal protein L14"
                     /transcript_id="XM_002494967.1"
                     /db_xref="GeneID:8202151"
     CDS             113515..113931
                     /locus_tag="ZYRO0B01364g"
                     /note="highly similar to uniprot|P36105 Saccharomyces
                     cerevisiae YKL006W RPL14A and to uniprot|P38754
                     Saccharomyces cerevisiae YHL001W RPL14B Protein component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L14"
                     /protein_id="XP_002495012.1"
                     /db_xref="GeneID:8202151"
                     /db_xref="GOA:C5DQL8"
                     /db_xref="InterPro:IPR002784"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="UniProtKB/TrEMBL:C5DQL8"
                     /translation="MSSESVVKTANWRLVEVGRIVLVKNGQGAGKLAAIVEIISQRKV
                     LVDGPETGVDRQAISLTQVVLTPLTFNLPRGARSATVAKKWNAAQVSQKWSTTSWAKK
                     IAQRETRSNLSDFERFQVMVLKKQQRFAEKKALAKA"
     gene            complement(<114080..>115618)
                     /locus_tag="ZYRO0B01386g"
                     /db_xref="GeneID:8202152"
     mRNA            complement(<114080..>115618)
                     /locus_tag="ZYRO0B01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494968.1"
                     /db_xref="GeneID:8202152"
     CDS             complement(114080..115618)
                     /locus_tag="ZYRO0B01386g"
                     /note="similar to uniprot|P36106 Saccharomyces cerevisiae
                     YKL005C BYE1 Negative regulator of transcription
                     elongation contains a TFIIS-like domain and a PHD finger
                     multicopy suppressor of temperature-sensitive ess1
                     mutations probably binds RNA polymerase II large subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495013.1"
                     /db_xref="GeneID:8202152"
                     /db_xref="GOA:C5DQL9"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DQL9"
                     /translation="MSVRTSGRSNKGHNKYIQRILEEEKGSGNSGGNESDDSVRCPVC
                     RTFDYNYDANEDTHGDMVQCDGCNTWQHIECMSDGKGMDSLLDSDGKYHCERCKPENY
                     QNAKWLTKEQEQNPESNDYDNDNYLSESDSEAESVRAPRKRRKTHGSVSGKSGTEPKG
                     SAGSTTGGSSGDARLRENAQKMLHQLFDKYIIPATVEAKLYALPDDQDDEKDIALEKS
                     QELERELYNVYPDHRNYTERIRTIFSNLKDAKNLSLKAHVIKGQITTSQLVRMSATEL
                     ANPDLQEFREKIDEQALTQLVVEQPGRPRWVKTHKGEELIENPEENNNGGDLEPDIFT
                     REIVHREETAVKEPSPTPEKSVSPGPPPVRINVKYPELAIELSGTIDYIGSSSELVKN
                     PYREALGDGKLLVEGRLSKAKVLKYLSEMQSTRTFLLYRIRPDENCNSEFKQVYEFLW
                     ENEKISGIQIKRSYQKNIYLIPSFGYDHHVIKDIAMAAGEFDREADNPILFLLTVIKP
                     ELVR"
     gene            <116428..>117678
                     /locus_tag="ZYRO0B01408g"
                     /db_xref="GeneID:8202153"
     mRNA            <116428..>117678
                     /locus_tag="ZYRO0B01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494969.1"
                     /db_xref="GeneID:8202153"
     CDS             116428..117678
                     /locus_tag="ZYRO0B01408g"
                     /note="similar to uniprot|P36107 Saccharomyces cerevisiae
                     YKL004W AUR1 Phosphatidylinositol:ceramide phosphoinositol
                     transferase (IPC synthase) required for sphingolipid
                     synthesis can mutate to confer aureobasidin A resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495014.1"
                     /db_xref="GeneID:8202153"
                     /db_xref="GOA:C5DQM0"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C5DQM0"
                     /translation="MSSFLHRVFLSERPVYSHIADLETSFDPRISLKRLRRYRPGLSE
                     AAHYAFMAAISLYVFIEFPANFFLKTLCCSFLGLLFLMPATSQFFFNGLPILVWLSLY
                     FMSSYIPDSHRPKITVKVLPAAETILYGDNLSDILATSTNPVLDVLAWLPYGLFHFGA
                     PFVAAAILFVFGPPTCLRGYAHAFGYVNLIGVILQNGFPTAPPWYKSLNGLKAANYSM
                     LASPGGLVRIDELFNMSLYREGFKHSSVVFGAFPSLHSGCATLEALFFSYCFPKLKPL
                     FFVYVCWLWWSTMYLTHHYFVDLVAGSVLSFVMFTYTKYTQLPVDTSLWCRWSYAQVD
                     RYDITKLDPLRANSNDIENVPLRGVEVDFELNSMDETSSRTPSIFDGPTSVSRSSATS
                     NTSLVEYPTEVTVPSPRVNKQRFE"
     gene            complement(<118166..>118555)
                     /locus_tag="ZYRO0B01430g"
                     /db_xref="GeneID:8202154"
     mRNA            complement(<118166..>118555)
                     /locus_tag="ZYRO0B01430g"
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /transcript_id="XM_002494970.1"
                     /db_xref="GeneID:8202154"
     CDS             complement(118166..118555)
                     /locus_tag="ZYRO0B01430g"
                     /note="highly similar to uniprot|P28778 Saccharomyces
                     cerevisiae YKL003C MRP17 Mitochondrial ribosomal protein
                     of the small subunit MRP17 exhibits genetic interactions
                     with PET122 encoding a COX3-specific translational
                     activator"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS16"
                     /protein_id="XP_002495015.1"
                     /db_xref="GeneID:8202154"
                     /db_xref="GOA:C5DQM1"
                     /db_xref="InterPro:IPR000529"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="UniProtKB/TrEMBL:C5DQM1"
                     /translation="MLYELVGIVRVMNPLAANAEAKDLATTIGKLVIQNRGVVRKIVP
                     MGNKLLPKIMKKDQEKHFQGYHFLMMFDSSASVQSEILRTLKNDPRVIRSSIAKMNTA
                     KQLDVASSIERASGYNSTLEKISKNYM"
     gene            <118805..>119568
                     /locus_tag="ZYRO0B01452g"
                     /db_xref="GeneID:8202155"
     mRNA            join(<118805..118864,118930..>119568)
                     /locus_tag="ZYRO0B01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494971.1"
                     /db_xref="GeneID:8202155"
     CDS             join(118805..118864,118930..119568)
                     /locus_tag="ZYRO0B01452g"
                     /note="highly similar to uniprot|P36108 Saccharomyces
                     cerevisiae YKL002W DID4 Class E Vps protein of the
                     ESCRT-III complex required for sorting of integral
                     membrane proteins into lumenal vesicles of multivesicular
                     bodies and for delivery of newly synthesized vacuolar
                     enzymes to the vacuole involved in endocytosis[INTRON]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495016.1"
                     /db_xref="GeneID:8202155"
                     /db_xref="GOA:C5DQM2"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DQM2"
                     /translation="MSLFNWVFGKSLTPQERLKKNQRALERTQRELEREKRKLEIQEK
                     KLVTEIKKSAKNGQVSAARVQAKDLVRTKSYVTKFDNMKAQLQAISLRIQAVRSSDQM
                     TRSMRDATVLLAGMNRSMNLPQLQHISMEFERQSDLMDQRQEFMDEAVDNVMGDEVDE
                     DEEADEIVNKVLDEIGVDLNSQMQQAPQNTISNDAQTESKQPVAEAVGGAPDNHANPD
                     DELQARLDSLKRQS"
     gene            complement(<119622..>120227)
                     /locus_tag="ZYRO0B01474g"
                     /db_xref="GeneID:8202156"
     mRNA            complement(<119622..>120227)
                     /locus_tag="ZYRO0B01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494972.1"
                     /db_xref="GeneID:8202156"
     CDS             complement(119622..120227)
                     /locus_tag="ZYRO0B01474g"
                     /note="highly similar to uniprot|Q02196 Saccharomyces
                     cerevisiae YKL001C MET14 Adenylylsulfate kinase required
                     for sulfate assimilation and involved in methionine
                     metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495017.1"
                     /db_xref="GeneID:8202156"
                     /db_xref="GOA:C5DQM3"
                     /db_xref="InterPro:IPR002891"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQM3"
                     /translation="MATNLTWHHNLNYQERKELRKQDGCTIWLTGLSASGKSTIACAL
                     EQLLLQKQLAAYRLDGDNIRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCTISVTS
                     FISPYKADRERARELHKESGLKFIEVFVDVPLEVAEQRDPKGLYKKAREGIIKEFTGI
                     SAPYEAPENPELHLRTDQKSVEECAQIIFDYLVTQNIVLSS"
     gene            complement(<121061..>123163)
                     /locus_tag="ZYRO0B01496g"
                     /db_xref="GeneID:8202157"
     mRNA            complement(<121061..>123163)
                     /locus_tag="ZYRO0B01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494973.1"
                     /db_xref="GeneID:8202157"
     CDS             complement(121061..123163)
                     /locus_tag="ZYRO0B01496g"
                     /note="highly similar to uniprot|P21576 Saccharomyces
                     cerevisiae YKR001C VPS1 GTPase required for vacuolar
                     protein sorting, functions in actin cytoskeleton
                     organization via its interaction with Sla1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495018.1"
                     /db_xref="GeneID:8202157"
                     /db_xref="GOA:C5DQM4"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQM4"
                     /translation="MDEHLISTINKLQDALAPLGGGSQSPIDLPQIMVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLVLQLINRRQKKDSNVSKDLSDLKIGSEDDSKKADT
                     GGQSEDNVEEWGEFLHVPGKKFFNFDEIRQEIVRETDKVTGGNLGISSVPINLRIYSP
                     YVLTLTLVDLPGLTKVPVGDQPPDIEKRIKDMLLKYISKPNAIILSVNAANTDLANSD
                     GLKLAREVDPEGTRTIGVLTKVDLMDQGTDVIDILAGRIIPLRYGYIPVINRGQKDIE
                     KKKTIRDALSDEKAYFENHPSYGSKAHYCGTPYLAKKLNSILLHHIRQTLPEIKAKIE
                     ATLKKYQTELYNLGPETMDSSSSVVLSTITDFTNEYAGILNGEARELSSQELSGGARV
                     SFVFHEVFKNGIDALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRF
                     EEPSLRLVGLVFDELVRMLKQIISQSKYSRYPSLREAISNQFVEFLKDAIIPTNKFVA
                     DIISAEQTYINTAHPDLLKGSQAMAMVEEKLHPRQVAVDPKTGKPLPPSQSAAAAATA
                     QKPAFEEKSGFFGGFFSTKNKKKLAALESPPPVLKATGQMTERETMETEVIKLLISSY
                     FNIVKRTIADIIPKALMLKLIVKSKTDIQKVLLEKLYGNQDIEELTKENDITIQRRKE
                     CKKMVEILRHASDIVSSV"
     gene            <123658..>125361
                     /locus_tag="ZYRO0B01518g"
                     /db_xref="GeneID:8202158"
     mRNA            <123658..>125361
                     /locus_tag="ZYRO0B01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494974.1"
                     /db_xref="GeneID:8202158"
     CDS             123658..125361
                     /locus_tag="ZYRO0B01518g"
                     /note="highly similar to uniprot|P29468 Saccharomyces
                     cerevisiae YKR002W PAP1 Poly(A) polymerase one of three
                     factors required for mRNA 3'-end polyadenylation forms
                     multiprotein complex with polyadenylation factor I (PF I)
                     also required for mRNA nuclear export may also
                     polyadenylate rRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495019.1"
                     /db_xref="GeneID:8202158"
                     /db_xref="GOA:C5DQM5"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="InterPro:IPR007010"
                     /db_xref="InterPro:IPR007012"
                     /db_xref="InterPro:IPR011068"
                     /db_xref="InterPro:IPR014492"
                     /db_xref="UniProtKB/TrEMBL:C5DQM5"
                     /translation="MNYQKVYGITGPVSTAGPTAAENKLNDELIQELKKEGSFESEQE
                     TANRIKVLKILQELAQEFVYRVSKKKNMSDGMARDAGGKIFTFGSYRLGVHGPGSDID
                     TLVVVPKHVMREDFFTVLDEILRSRPELEEIAPVPDAFVPIIKIKFSGISIDLICAKL
                     DLAQIPQSLTLSDKNLLRNLDEKDLRALNGTRVTDEILELVPKPIVFRIALRAIKLWA
                     NRRAIYANVFGFPGGVAWAMLVARICQLYPNATSAVILNRFFKILSEWKWPQPVVLKP
                     IEDGPLQVRVWNPKIYAQDRSHRMPVITPAYPSMCATHNITESTKRVILQELENGISI
                     TNDIFSNKKTWSDLFTKHNFFYKYKFYLTVMASTRGTDEENLKWSGMVESKVRLLVLK
                     LEALPGIKLAHPFIKPFEAAFAYSNETESKEILDNYGSFKTEEQLSKYKRITEENSQD
                     TKDEKKCYITTMYIGLDVNVEEKKEKIDIHVPCNEFFNLCRNFNEEYQNSDIYSLIIK
                     YVKQYDLPSEVYEPGETRPVKKKSKRRKQDKSAEFTKKAKSEAPSGTSQGSSIAEATQ
                     A"
     gene            <125878..>127218
                     /locus_tag="ZYRO0B01540g"
                     /db_xref="GeneID:8202159"
     mRNA            <125878..>127218
                     /locus_tag="ZYRO0B01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494975.1"
                     /db_xref="GeneID:8202159"
     CDS             125878..127218
                     /locus_tag="ZYRO0B01540g"
                     /note="highly similar to uniprot|P38755 Saccharomyces
                     cerevisiae YHR001W OSH7 Member of an oxysterol-binding
                     protein family with seven members in S. cerevisiae family
                     members have overlapping redundant functions in sterol
                     metabolism and collectively perform a function essential
                     for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495020.1"
                     /db_xref="GeneID:8202159"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="UniProtKB/TrEMBL:C5DQM6"
                     /translation="MPLNKFIGKGHQHGGSGPSRDVSDSNSTVSGGEPADSDDIEETD
                     ESGQSILLNIISQLKPGSDLSRITLPTFILEKRSMLERITNQLQHPEIVLDAKADPDE
                     LSRFVKICKWYLSGWHIAPKAVKKPLNPVLGEHFTCYWNLPNKQQAFYIAEQVRHHPP
                     ESAYFYMIPESGIRVDGTCIPKSRFLGNSTAAIMEGSSVLQFLDLLDKNGKPEKYVLT
                     QPNMYARGILFGKMKLEMGDHMVIKSPTFVVDVEFKTKGFISGTYDAIHGVIKDHRGN
                     EYYEISGKWNDIIYIKDLREKNASKRVLFDTHKELPSKPLVRSLSEQGEYESRRLWKK
                     VTDALARRDHDTATREKLGIEDYQRELAKKRAEDGVEFHPKLFKPAKQDRDLNYYIYK
                     DIPADASHEDQIRMILELAPILPGQKFTDKFTIPAYKKSEIAEGRSTSGTPRSK"
     gene            complement(<127387..>128510)
                     /locus_tag="ZYRO0B01562g"
                     /db_xref="GeneID:8202160"
     mRNA            complement(join(<127387..128237,128300..>128510))
                     /locus_tag="ZYRO0B01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494976.1"
                     /db_xref="GeneID:8202160"
     CDS             complement(join(127387..128237,128300..128510))
                     /locus_tag="ZYRO0B01562g"
                     /note="similar to uniprot|Q02202 Saccharomyces cerevisiae
                     YKR004C ECM9 Non-essential protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495021.1"
                     /db_xref="GeneID:8202160"
                     /db_xref="UniProtKB/TrEMBL:C5DQM7"
                     /translation="MLCKKLYQVLSSDSTTKTCRLTFAPNQPDINDPFFISEEPKNIE
                     IVCFKNTYLSIFKEAHDYFQNYPSISVAASPKDWNTYYSSLGYLLTTPENKTNFNVHY
                     DTFLKMWEIDDSKELLNRELKIVQRLLTSSNNRLNKSSSLWQMYRKLYTLSMDYNNGT
                     NHNYIFTFLESGSKHLSNYYCWNASRWFFDVFPINEKKLMIDNVKQFCFKNFKDSSSW
                     DALAYMLCQQRKKIGYNIKNYYHPNEPDQREHQWLEFEVDEIFAEIIHLIDSFAVTEL
                     PPFLCCRTIAVSFPELKVITKVLKKWRSDIQKFEQQYGPLQFIRNNPIPASKYTDDII
                     ISGLSRHIGYKKRFVEQNL"
     gene            complement(<128746..>130659)
                     /locus_tag="ZYRO0B01584g"
                     /db_xref="GeneID:8202161"
     mRNA            complement(<128746..>130659)
                     /locus_tag="ZYRO0B01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494977.1"
                     /db_xref="GeneID:8202161"
     CDS             complement(128746..130659)
                     /locus_tag="ZYRO0B01584g"
                     /note="some similarities with uniprot|Q02203 Saccharomyces
                     cerevisiae YKR005C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495022.1"
                     /db_xref="GeneID:8202161"
                     /db_xref="UniProtKB/TrEMBL:C5DQM8"
                     /translation="MESSFDDQYSFCRSCLAVDEQNLDDANNCLCVQCALSALESSCY
                     KQYCARSKDSQKELLLINRLIQKFNSDIKSDYEFDSDVKLSEVNYFVDPSSKVYRNLL
                     PQEKKVLVDAVVNELRQNGNTGNNAKAEELEAFGLWRKKRTSTLPPPTPPPKKVPRTD
                     RFPIPKPVPVPGDDRDYYDEDRDGYGYDDDRGGYDDNDDDDEPRRPKPRPKPKYKPKP
                     PLMYTKTKVYTTYKPKKKTLTKWNPRIISKTIVIDRCSDKRTTTTVLATETDTDYETI
                     YKPIYKVITTTDYDTVWWGTTKTKVKHDVKTKTETDYEVFTKTKYKNDLVTKTETEVE
                     ETTRYIKVGKVTVTDIETEWDVKWKTKTKTKTLCDYPPATKTKTDYETETTTDYATKT
                     KTDYATKTTTDLTTKTRTKFSIITNHDRTRTKIKTKTRTRTKKIWNPRHTTTISASAR
                     ALAFGHEYEFEDEVEKKGFGMLNIPDDPAPLLASKRVVRNYHANGSNFTTTTIGGFNS
                     SNHAKGKPKITGISNGTNATSGAIIGVSGAPQATTAMIVYTTLVVSVATSMMLAFSYH
                     TNLNLTNNGSEDSMDRSSSDGENNDWSDADAVELTNDETRSLADQVPNSGLLPDEMAR
                     KLSGDNSINLLVD"
     gene            complement(<131244..>131963)
                     /locus_tag="ZYRO0B01606g"
                     /db_xref="GeneID:8202162"
     mRNA            complement(<131244..>131963)
                     /locus_tag="ZYRO0B01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494978.1"
                     /db_xref="GeneID:8202162"
     CDS             complement(131244..131963)
                     /locus_tag="ZYRO0B01606g"
                     /note="similar to uniprot|Q02204 Saccharomyces cerevisiae
                     YKR006C MRPL13 Mitochondrial ribosomal protein of the
                     large subunit not essential for mitochondrial translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495023.1"
                     /db_xref="GeneID:8202162"
                     /db_xref="GOA:C5DQM9"
                     /db_xref="InterPro:IPR018305"
                     /db_xref="UniProtKB/TrEMBL:C5DQM9"
                     /translation="MSRVQFQCVRRLHFTSRRNNFFSWFKSKKQQEVQVQDTKDVIKD
                     IESGKAQTDSGNSNDKLRLIPSNFIGEDSEKLEKRMREQQVKDVAFNRWLSSEKVNTE
                     EQLDTILNESWTLATGSGTPSLDQPFPDLVSKFKFTKNLQSKTGYMVPDFQITVSTTP
                     KQFKDYYVKEILSGKLLRFKESEPNAIDLSEKDYGSPNVHIVNDVSTKKQNKKFGKII
                     QEVHALEQENLRKAVEEAKRG"
     gene            <132204..>132668
                     /locus_tag="ZYRO0B01628g"
                     /db_xref="GeneID:8202163"
     mRNA            <132204..>132668
                     /locus_tag="ZYRO0B01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494979.1"
                     /db_xref="GeneID:8202163"
     CDS             132204..132668
                     /locus_tag="ZYRO0B01628g"
                     /note="weakly similar to uniprot|Q02205 Saccharomyces
                     cerevisiae YKR007W MEH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495024.1"
                     /db_xref="GeneID:8202163"
                     /db_xref="GOA:C5DQN0"
                     /db_xref="InterPro:IPR028209"
                     /db_xref="UniProtKB/TrEMBL:C5DQN0"
                     /translation="MGIIFSCCRNGDVDENEALLAGQQNGYGADNEQDYNEMQRQLKE
                     QEERALAREAQLREIVTNTNDKLIDISMISNSGIVVPGSDIKSMNSENMQRSTELGND
                     NEANKRNWIKLDSKKHMSRVMKEQLKTMHGVVFGQLEQDLKLEPPGNLTVTL"
     gene            <132841..>134505
                     /locus_tag="ZYRO0B01650g"
                     /db_xref="GeneID:8202164"
     mRNA            <132841..>134505
                     /locus_tag="ZYRO0B01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494980.1"
                     /db_xref="GeneID:8202164"
     CDS             132841..134505
                     /locus_tag="ZYRO0B01650g"
                     /note="similar to uniprot|Q02206 Saccharomyces cerevisiae
                     YKR008W RSC4 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex found in close
                     proximity to nucleosomal DNA displaced from the surface of
                     nucleosomal DNA after chromatin remodeling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495025.1"
                     /db_xref="GeneID:8202164"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR018359"
                     /db_xref="UniProtKB/TrEMBL:C5DQN1"
                     /translation="MAPKKKKSSEEEEVPVPSKYLPGKQPRTGEPPEVHYTQSLDPEA
                     ELQVDKWSIPKFNLFISFTLDNLVESYKNVFKDFIKLPSRKFHPQYYYRIQQPISINE
                     IKSRDYEYHNGPQTFLLDIQLLYKNCLSYNEPDSLIVKNSLQVLHYIEYEVLKAKNVT
                     RNYLITDNVKNRLLNYLQKVLGATDKSIESEISPPPSKDADDSMQVSQPFMELVDKDE
                     LPEYYEVIHRPMALNTVKQSLEVGYYSKIYDFIIDVLLVFRNALVFNDKNTLIHQDAL
                     KLLKYFNHLVQNKFFPELQDASERGEVKLEYDKIEYEQYLANGGNENSGEALDDEDEG
                     DYDFNHFEGLGNGYNRAILSEDYLLGPQGKNDQPLKKPKLSSPSLDNQPKVFKYNIVK
                     SLLKEKEHTSREYTMEKKPYNLINQVCIYSSRNLYQQATNPVPGSRPSCNQNWVEYVF
                     NGKDLSQNENMYSFTLQPVQTYLTLIADVDGKQLETSLMVNSENVKAHQQQTDSTQDE
                     KEPEPRIVGTERYDIRLNEGLNFVEYRCEDQEGGKELMKFWVNVLP"
     gene            <134775..>136004
                     /locus_tag="ZYRO0B01672g"
                     /db_xref="GeneID:8202165"
     mRNA            <134775..>136004
                     /locus_tag="ZYRO0B01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494981.1"
                     /db_xref="GeneID:8202165"
     CDS             134775..136004
                     /locus_tag="ZYRO0B01672g"
                     /note="similar to uniprot|P27810 Saccharomyces cerevisiae
                     YOR099w KTR1 mannosyltransferase involved in n-linked and
                     o-linked glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495026.1"
                     /db_xref="GeneID:8202165"
                     /db_xref="GOA:C5DQN2"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DQN2"
                     /translation="MRIRIPLTLSKPRNLKIVITTLALCTLLLIGYNYTHLLLPLRFN
                     GGETSVKGIQSPLPQDAPTTKLYNDQRKGNDVLLTLVRNSEINQLVGTIESFEESFNS
                     KYHYDWWFMNDEDFTQEFQERVKEVVSGRTRFIKIPKELWSYPDYIDREKADASRQAY
                     KKARIMYGESESYRFMCRFNSGMFYRLPELKDIEYYWRIEPSTRFNCEITYDVFQYMR
                     NHNKLYAFNMALQEDVRTIPTLWNSTMEFLRENPQAVDKDNLAGFVSDDGGNSYNLCH
                     FWSNFEIANMQFFRSPVYESYFEFLDRKGGFFYERWGDAPVHTLAVSLMLPADQIHFV
                     ANTGYFHKPNQDCPPNEELRDALHCQCSPRSDFTWHKYSCVHKFFHLQKMVRPDTLEH
                     ISMIYPTIYDTIMNAKD"
     gene            <136321..>136645
                     /locus_tag="ZYRO0B01694g"
                     /db_xref="GeneID:8202166"
     mRNA            join(<136321..136329,136418..>136645)
                     /locus_tag="ZYRO0B01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494982.1"
                     /db_xref="GeneID:8202166"
     CDS             join(136321..136329,136418..136645)
                     /locus_tag="ZYRO0B01694g"
                     /note="similar to uniprot|P37299 Saccharomyces cerevisiae
                     YHR001W-A QCR10 8.5 kDa subunit of the ubiqunol-cytochrome
                     c oxidoreductase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495027.1"
                     /db_xref="GeneID:8202166"
                     /db_xref="InterPro:IPR019182"
                     /db_xref="UniProtKB/TrEMBL:C5DQN3"
                     /translation="MVSYVSRLAGKTAPHFGRITPYNLLTYAPNLMLWGGAWWAGVFV
                     FTEAWPKFQETFYQKIPLFGGHWINEIPPEDKIN"
     gene            complement(<136910..>139627)
                     /locus_tag="ZYRO0B01716g"
                     /db_xref="GeneID:8202167"
     mRNA            complement(<136910..>139627)
                     /locus_tag="ZYRO0B01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494983.1"
                     /db_xref="GeneID:8202167"
     CDS             complement(136910..139627)
                     /locus_tag="ZYRO0B01716g"
                     /note="similar to uniprot|Q02207 Saccharomyces cerevisiae
                     YKR009C FOX2 Multifunctional enzyme of the peroxisomal
                     fatty acid beta-oxidation pathway has 3-hydroxyacyl-CoA
                     dehydrogenase and enoyl-CoA hydratase activities"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495028.1"
                     /db_xref="GeneID:8202167"
                     /db_xref="GOA:C5DQN4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5DQN4"
                     /translation="MSGLSFKGRVVIITGAGGGLGRVYALEYAKRGAKVVVNDLGGSL
                     GGSGSDNRAADVVVEEIIQLGGTAVANYDSVSDNGVGIVKTAIDNFGRVDILVNNAGI
                     LRDASFARMNEKQFTQVIDVHLNGAYKLSHAAWPYMVQQKFGRIVNTSSPAGLYGNFG
                     QANYSAAKLGLVGLAETLSKEGFKYNIKANAIAPLANSRMTEDLLPAHILKQLGPEKI
                     APLVLYLTHESSQVTNSIFEVAGGWYGQVRWERSSGQIFNPNEETFTPESILNKWSSV
                     NDFADKPFNKTQHPIQLSDYNDLITKGKRLPHDNPQGSIKITSLKGKVVIVTGSGGGL
                     GGTHSNWFARYGAKLVINDIKDPHSVVKELNDKYGSGTAIADTHNIITEAPQIVENAI
                     KNFGRVDVLVNNAGILRDRSFKKMTEDEWFAVLQVHLFATYSMCKAVWSVFVKQKSGY
                     IINVTSTSGIYGNFGQANYAAAKSAILGFSKTIAIEGAKKGIVVNIIAPHAETAMTKT
                     IFGKEELQNHFEPSQVSPFIVLLSSEELQRQAGKAGVRGQLFEVGGGWVGKTRFQRSS
                     GFVAIGDDANLDTLAANWDKVVDFSKPQYPATFTDASILILRAVQAAQYLASSRSDND
                     IFNYSDRDSIIYNMGLGAKSNEQQYVYENDLKFQVLPSFAVIPFMEGVTGGLKMHELV
                     DNYDYAKLLHGEQYFRIAQNGSLATNGTLKTVVKPLQVSDKRGKGAVIVGGSETYDIK
                     TNRLVSVNEGTFFVRGASAPGTKNRSFAPRAKFATTAFKAPSNTPPTAELDVTTTTDQ
                     ATFYRLSGDYNPLHIDPKAARAVGFPKPILHGLGTLGVTVKALYENFGAFGELKVRFT
                     APVFPGDKLKVKAWKRADGTVIFQTLDVTTNAVVLDNAAIKLIGSSSRF"
     gene            complement(<139975..>141453)
                     /locus_tag="ZYRO0B01738g"
                     /db_xref="GeneID:8202168"
     mRNA            complement(<139975..>141453)
                     /locus_tag="ZYRO0B01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494984.1"
                     /db_xref="GeneID:8202168"
     CDS             complement(139975..141453)
                     /locus_tag="ZYRO0B01738g"
                     /note="similar to uniprot|P38153 Saccharomyces cerevisiae
                     YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
                     which functions in transport of alkaline phosphatase to
                     the vacuole via the alternate pathway clathrin associated
                     protein medium chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495029.1"
                     /db_xref="GeneID:8202168"
                     /db_xref="GOA:C5DQN5"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5DQN5"
                     /translation="MFIAFYITDSKNSLVFQYLLGSNSPLFSHLLARIRAVCPGLLSK
                     DDENDNTPLFHCCIAKDLEVYKYHSQVNNLNYYCLASGADSRPQTDTFTFLQLLDQTL
                     LEYFDKDKLTVTKIVNNYDRITMIFYMSIDSGEPCVGSLNSNRIRRVIPVKSDLSKMI
                     NNTAHTLQRAVRQPRQGILAATPEILESEEVVPWRSGHLKYTSDEIYVDIIETVHVIY
                     QTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEMDMDLAGNEMYAPSMHQCVEMPQGS
                     PSSLCFIPPDGNCNLLNYTIDLDMNPKVKVTSPVGLVSVIYKDGLGLNRDEFEVHVNI
                     SNSPSVPHIQDLKLQIELQPRIQELEEQEEEAQRDAEMDTEAKKERSQLEDGKIKVLR
                     NTHGRFDNSVHPGRGTWIFDSETPVGSLPVLRGCVEDSKHPVRIQRVGVSYANEGMLP
                     SGIGLRRINVRSTTNLRENNRGKRLFKGVKYVCRTGDYEIRS"
     gene            <141627..>144473
                     /locus_tag="ZYRO0B01760g"
                     /db_xref="GeneID:8202169"
     mRNA            <141627..>144473
                     /locus_tag="ZYRO0B01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494985.1"
                     /db_xref="GeneID:8202169"
     CDS             141627..144473
                     /locus_tag="ZYRO0B01760g"
                     /note="some similarities with uniprot|P18480 Saccharomyces
                     cerevisiae YBR289W SNF5 Involved in global regulation of
                     transcription subunit of the chromatin remodeling Snf/Swi
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495030.1"
                     /db_xref="GeneID:8202169"
                     /db_xref="GOA:C5DQN6"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="UniProtKB/TrEMBL:C5DQN6"
                     /translation="MNGNGNGGSPSNSFGNGGTPRGNPPNPFSNIGTPSFNLSQIPRQ
                     ILQNLAPAQIQLIQQRHQQLLMARIQQQQQQQQQQQQQQHQQHQQHQQQNMMRQQPLD
                     PQQQAKLQQAQAQLAQQKQAQVQAQAQLAQQKQAQVQARLAQQQQQQQHQQHQQQVPN
                     PNASTNTMQGTNLARRAAQLNQSAGGAAAAAAAAGGQQQQPQTNQPQFVRSSGTPPVP
                     INLPPQIAQLPLPMQQQVLNILKQQAIARDNPAVVAAITMAQQQVQQRVQQPQPEQSQ
                     QPQPQPQQPHSQPQPPQQPHSQPQPPQQPQPQQPSLQRQQARQPPQSQQGSPLPQPQP
                     QPGPGSNVGTPKFVHSPQSAPVRGTPQPIRQQMAGVTMPLGGGAQSVPPAQSRIPPVR
                     TDLPVPPAPSAAHLPKMDLPPFQTINYEPPETRLPHPNFWSERDPKTDTLLYEQIIQR
                     DKQHRKDLIKETNGYEPFSIYGFSNKEYLGRLWHNLQYCQDLKSTRMKSITSTSQNVP
                     AASIWGSGYSGYGNGITNKVTQVVPEFKIADRSHIYQNRFQVYQQAMNETHEDLVPVR
                     LEFDQERDRFCLRDTLLWNKNDTLVNIEEFVDDMMKDYRYSPQLRDQFAETVVNSIRE
                     QILEYQPNPFQELSQERSGGDDMRIKIKLDIVVGQNQLIDQFEWDISNTENSPEEFAE
                     CMCQELSLPGEFMTAIVHSIHEQVHMYHKSLALLGYNFDGSPVEDDDIRSRILPVITL
                     DDVYRTPSESKNYNPNLLQISAAELERLDRDKDRDTRRKRRQGRFNRRGVVQSNGLNN
                     QASSSMGPGVNGAEVSLPDVSDIPRTFRTPVPSTILPGGVDLGPSVGSYDLRTTTEYR
                     QRPPKPVVEEPPCQIVDNIPGQCLLLSINLSPRTRYLINSSRNFNADTQNLSQGQLQD
                     TTNNDNDSSYEQEPLSATEQFPSTNDAVQEDLQD"
     gene            <144806..>145720
                     /locus_tag="ZYRO0B01782g"
                     /db_xref="GeneID:8202170"
     mRNA            <144806..>145720
                     /locus_tag="ZYRO0B01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494986.1"
                     /db_xref="GeneID:8202170"
     CDS             144806..145720
                     /locus_tag="ZYRO0B01782g"
                     /note="similar to uniprot|P38356 Saccharomyces cerevisiae
                     YBR290W BSD2 Heavy metal ion homeostasis protein
                     facilitates trafficking of Smf1p and Smf2p metal
                     transporters to the vacuole where they are degraded
                     controls metal ion transport prevents metal
                     hyperaccumulation functions in copper detoxification"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495031.1"
                     /db_xref="GeneID:8202170"
                     /db_xref="InterPro:IPR019325"
                     /db_xref="UniProtKB/TrEMBL:C5DQN7"
                     /translation="MSSDNLIQSQQVGSSRDVVEAPPPVPQLSEGMTSTEGLQERGHD
                     LESGVEGESIGGPRSLRERVTREVKTIGRHFNLLDKLFRRNIQRTSHLQHGASFDGVF
                     SNLSAKPDTGSRDVVEDDNPPTYEEAAIDMAPSYYGVDDDGSGLYYNEICIEGLPTGN
                     IANFVWNMVVSTCFQFVGFLITYILHTSHAAKQGSRFGLGLTMLGYSYSMIPNDVRSK
                     VGKDNVLDRVEVPDPTDYDDLHLYTRPTSQDEFQSSLSRGNTEDQQKLPALAIFVGLF
                     GAFISIKGIYDYVMVKRMESKYMTQERA"
     gene            complement(<145944..>146834)
                     /locus_tag="ZYRO0B01804g"
                     /db_xref="GeneID:8202171"
     mRNA            complement(<145944..>146834)
                     /locus_tag="ZYRO0B01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494987.1"
                     /db_xref="GeneID:8202171"
     CDS             complement(145944..146834)
                     /locus_tag="ZYRO0B01804g"
                     /note="highly similar to uniprot|P38152 Saccharomyces
                     cerevisiae YBR291C CTP1 Mitochondrial inner membrane
                     citrate transporter member of the mitochondrial carrier
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495032.1"
                     /db_xref="GeneID:8202171"
                     /db_xref="GOA:C5DQN8"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DQN8"
                     /translation="MVDKKQVDPLNSFIAGALAGAVEGAITYPFEFAKTRLQLRDKNA
                     KSSKNPLVLIYNTARTQGVSALYVGCPAFIVGNTAKAGVRFLGYGAIQNLLRDPHTGQ
                     LSGPRGVLAGLGAGLLESVVAVTPFEAIKTALIDDKQAAKPKYHSNGRGLFMNHVYLA
                     RDMGFKGLYNGILPVSMRQGANSAVRLGCYNKIKTMVQNYSNLPKDKPLSSGLTFLVG
                     AFAGVVTVYSTMPIDTVKTRMQSLDAKRYTSTLNCFVRVFKDEGLRTFWKGATPRLGR
                     LMLSGGIVFTVYEKVLYILS"
     gene            <147594..>148691
                     /locus_tag="ZYRO0B01826g"
                     /db_xref="GeneID:8202172"
     mRNA            <147594..>148691
                     /locus_tag="ZYRO0B01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494988.1"
                     /db_xref="GeneID:8202172"
     CDS             147594..148691
                     /locus_tag="ZYRO0B01826g"
                     /note="highly similar to gnl|GLV|CAGL0K02915g Candida
                     glabrata CAGL0K02915g and similar to YHR002W
                     uniprot|P38702 Saccharomyces cerevisiae YHR002W LEU5
                     Mitochondrial carrier protein involved in the accumulation
                     of CoA in the mitochondrial matrix homolog of human Graves
                     disease protein does not encode an isozyme of Leu4p as
                     first hypothesized"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495033.1"
                     /db_xref="GeneID:8202172"
                     /db_xref="GOA:C5DQN9"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DQN9"
                     /translation="MGEGTGSSVVREPNNYKKGEVPPTTTAQSQAINKYSVEYIVRSG
                     IAGGVSGSCAKTLIAPLDRIKILFQTSNPHYTKYTGSLVGLVEAAKHIWINDGIRGFY
                     QGHSVTLIRIFPYAAIKFVAYEQVRNLLIPSSNYEVPWRRILSGSLAGLCSVFVTYPL
                     DLLRVRLAYVTEHKSKVRLIDFIRAIYHEPASTTLTSRRYIPKWFAHWCNFYRGYCPT
                     VLGMIPYAGVSFFAHDCLHDLLRIPLCAPYTVIKISEQEKDRRSQQNQRTPLTTWAEL
                     GAGGLAGMASQTAAYPFEIIRRRLQVSTLTATNAHEHKFQSIGGIARIIYKERGWRGF
                     FVGLSIGYIKVTPMVACSFFVYERMKWHLGI"
     gene            complement(<148803..>150110)
                     /locus_tag="ZYRO0B01848g"
                     /db_xref="GeneID:8202173"
     mRNA            complement(<148803..>150110)
                     /locus_tag="ZYRO0B01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494989.1"
                     /db_xref="GeneID:8202173"
     CDS             complement(148803..150110)
                     /locus_tag="ZYRO0B01848g"
                     /note="highly similar to gnl|GLV|CAGL0K02937g Candida
                     glabrata CAGL0K02937g and similar to YKL027W
                     uniprot|P36101 Saccharomyces cerevisiae YKL027W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495034.1"
                     /db_xref="GeneID:8202173"
                     /db_xref="GOA:C5DQP0"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DQP0"
                     /translation="MAQDTWRIVAATVAFTVTATKCAEYLWNCRQARLPQSKPHKNLQ
                     AEQYDDDLFREQLARNYAFLGEEGMQKLKEQYVVVVGAGGVGSWVVTMLVRSGCCRIR
                     VIDFDQISLSSLNRHSCAVLKDVGTPKVECLKMHMQEIAPWCKVEAINQLWTKDSAEE
                     LLLSGGEPSIVVDCIDNIDTKVDLLEFTYKRNLPVISSMGASTKSDPTRINIADITAT
                     EEDPLARTVRRLLKKRGINTGIPVVFSAEKPDPRKAKLLPLPDEEYEKGSVGELSALK
                     DFRVRILPVLGTMPGIFGLAIATWILTKASGYPMSPIEGKNRIKVYDGIYQSLAGQMS
                     RIGMPDQRVPVSVFEIGYILEEVFRGKSPVSGYSTRLTLSKWDPSKPVSLQNVVILTK
                     EEQNVHERRVLNGGEKIEDVYPPEVLELINKRFQEEKYYSQYR"
     gene            complement(<150328..>151701)
                     /locus_tag="ZYRO0B01870g"
                     /db_xref="GeneID:8202174"
     mRNA            complement(<150328..>151701)
                     /locus_tag="ZYRO0B01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494990.1"
                     /db_xref="GeneID:8202174"
     CDS             complement(150328..151701)
                     /locus_tag="ZYRO0B01870g"
                     /note="some similarities with uniprot|P36100 Saccharomyces
                     cerevisiae YKL028W TFA1 TFIIE large subunit involved in
                     recruitment of RNA polymerase II to the promoter
                     activation of TFIIH and promoter opening"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495035.1"
                     /db_xref="GeneID:8202174"
                     /db_xref="GOA:C5DQP1"
                     /db_xref="InterPro:IPR002853"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013137"
                     /db_xref="InterPro:IPR017919"
                     /db_xref="InterPro:IPR024550"
                     /db_xref="UniProtKB/TrEMBL:C5DQP1"
                     /translation="MDRPIDEIVKNLLKFVVRGFYGGSYILVLDAILFHSVLAEEDLK
                     QLLGINKTDLGPLVARLRSDGLLSMHKQREYPPNSKSVERVYFYIKYPHAIDAIKWKV
                     HQVVQRLKDDFDKNSEPNGYMCPVCLTKYTQLEAVQLLNFDRTEFLCSLCDEPLVEDD
                     SGKKNKEKQDRLNRLMDQVQPIIDYLKKIDDSRIEENTFDVALAKLIPPQNQSRAAYT
                     YNPKKGSTMFRPGDSDGNLLGNDSSRRAGANSQATLHVNITTASDEMAQKALAERQAE
                     EKRKQNAVPEWHKQSTVGKSALGRLDEDEEFDPRTTQQAKMSLEETGGIPGGVDPAAA
                     NGLEREVDETYHTGALTEKELEERENERTLNEYYATWARKQAEAGEEDEEDEDEEEGF
                     NAYGEDEEMNEDEFEDVEPKEEETGNQGSKSTAEPNAELNTNAVPKQEDNDDDDDDDV
                     DIEFEDV"
     gene            complement(<151888..>152991)
                     /locus_tag="ZYRO0B01892g"
                     /db_xref="GeneID:8202175"
     mRNA            complement(<151888..>152991)
                     /locus_tag="ZYRO0B01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494991.1"
                     /db_xref="GeneID:8202175"
     CDS             complement(151888..152991)
                     /locus_tag="ZYRO0B01892g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495036.1"
                     /db_xref="GeneID:8202175"
                     /db_xref="GOA:C5DQP2"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:C5DQP2"
                     /translation="MSKVVVLGGGVSGLTSALCLLAQFKDTIEELTVLASEYPGDYHA
                     PDYTSPWAGANWCSFVRDGDKLQIQRDKLTYDVLLQLADREQSCGVKKYCLKTFMSRN
                     SAVPWYIKDGFVKGLKELSNEEVKSRKLDPSQVRGFEFTTVSINPTRYNNYLISQIVK
                     AGGAVRRVKRLDTIDQVVDVMGYVPSLVVNCTGVNAGKLLREVDPNEQDRVYPVKGHI
                     LQIYEDLPYQVIIEDLPKEDNALPNQFLNVFPRPEGGCIVGGLAAKGDYSKDIDPELS
                     SSILRVMKRHIPELSTATVYNSYVAFRPGRKGGVRIDFSEYPLAKHVSTLKVVHNYGI
                     GGSGYQSSYGIAMEVCGYAERAFLQRPKCPFKL"
     gene            <154562..>156484
                     /locus_tag="ZYRO0B01914g"
                     /db_xref="GeneID:8202176"
     mRNA            <154562..>156484
                     /locus_tag="ZYRO0B01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494992.1"
                     /db_xref="GeneID:8202176"
     CDS             154562..156484
                     /locus_tag="ZYRO0B01914g"
                     /note="highly similar to uniprot|P36013 Saccharomyces
                     cerevisiae YKL029C MAE1 Mitochondrial malic enzyme
                     catalyzes the oxidative decarboxylation of malate to
                     pyruvate which is a key intermediate in sugar metabolism
                     and a precursor for synthesis of several amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495037.1"
                     /db_xref="GeneID:8202176"
                     /db_xref="GOA:C5DQP3"
                     /db_xref="InterPro:IPR001891"
                     /db_xref="InterPro:IPR012301"
                     /db_xref="InterPro:IPR012302"
                     /db_xref="InterPro:IPR015884"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DQP3"
                     /translation="MIRLSSRSVARYSSLTKPLKATTTRDTVFNQNAHGQVQKTPVGP
                     RAKKMLAEGKPRMTRLSVDGPIECPLDSFQLLNSPLFNKGSAFTQEERTAFGLDALLP
                     PQVNSLDEQVERAYQQLCYLKTPLAKNDFMTSLRVQNKVLFFALVSRHIRELVPIIYT
                     PTEGDAIAAYSHRFRKPEGIFLDITEPDSVERRISTYGEDKDVDYIVVTDSEGILGIG
                     DQGIGGIRIAISKLALMTLCAGIHPGRVMPVCLDVGTNNKKLARDELYMGNRFSRVRG
                     KQYDEFVDKFIQAVKKRFPSAVLHFEDFGVSNARRVLDTYRDELPCFNDDIQGTGAVV
                     MASLLAALKHTKRELKDTVVLVHGAGSAGLGIADQIVNHMVTRGLTLEDARSKIYLMD
                     RRGLITNYLKDFTTPEQQAYAKDGQAWSDVNTTSLLEVVSRVKPTCLVGCSTQAGAFN
                     KTIVQEMYKHNRRPIIFPLSNPTRLHEAVPEDLLRWTDYNALVATGSPFPPVDGFRIS
                     ENNNCFSFPGIGLGAVLSRSTVITNTMISAAVDELADLSPLEDGNSKPGLLPPMEVIR
                     DTSNKVATAVILQALKEGHARVEEEDVPDSPGTKVQVPRDFDGCLEWVKDQMWKPIYR
                     PMVKVEHDPKFHSHQY"
     gene            complement(<156676..>159150)
                     /locus_tag="ZYRO0B01936g"
                     /db_xref="GeneID:8202177"
     mRNA            complement(<156676..>159150)
                     /locus_tag="ZYRO0B01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494993.1"
                     /db_xref="GeneID:8202177"
     CDS             complement(156676..159150)
                     /locus_tag="ZYRO0B01936g"
                     /note="weakly similar to uniprot|P25386 Saccharomyces
                     cerevisiae YDL058W USO1 involved intracellular protein
                     transport, coiled-coil protein necessary for protein
                     transport from ER to Golgi; Integrin analogue gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495038.1"
                     /db_xref="GeneID:8202177"
                     /db_xref="UniProtKB/TrEMBL:C5DQP4"
                     /translation="MNIATLNVAKQPIVTSVSLETTEFSTNAEGIAAQEAVKKLVVTP
                     AYGVKNSNPIIDEAIDNFSFLYSEPKSKSNKIQFGESRTITFDVDEEVDRLASKTKNT
                     ENQSKDSKPLKTILKPGPVFVHDSELLETEDFAYLDESDEETQVKTSNQDVITLLQRI
                     FTLHGIPPCEIKEDLLGTLQRLARGVVASFKQREQCYKYVGRKQSIEELDELEYVNDK
                     LKCEVAGLNKKLSQEKVRWEVVDEVFIENDSLKAKVEELITAKQHLLKELQLAPKWED
                     VDGLLEEDKELKSRVKQLTFLNDDLKKKYAQIEITTSKRADELVSSKEKSDIELRKTD
                     IKLNETTEQVIELRREKEVLNAKLYTYKKNAETTSIKLEETEERVQELSKIVEDYRTK
                     NGELGSSCGQLVEKAEQTAIKLRNTELVNVELVSTRADLTSKLHGVKRTVDYLTSENI
                     EMTKKMKLMKKKAYNRFFDQNVSLGSKNEELAEKLGQALNKLEEFGNLQKDYEKLDSK
                     NNELAANQDELTLTNKNLSQRLEAETKRVKQLENDFTMAQDKVISFDISLRRVGQWYE
                     ALSQEKHDTDVKVCQLESLYREINSRSVSLDDELESAKTCSIKSVQKVEQSEHRIERD
                     EQLVQDSERWKMEGQSCFQEFSILRNEHSTLLQKCSKLEFEKSKLQTENVELSGYKEG
                     YSLFDEKYEWLESIALSLKQEKKCSDDKIKDLQRELKYARKTIDSMEKAKSQYERRPQ
                     ELQIQLDRLRLQNFELSQRFGKKNKELQESFDKMREMAVMLRSTMSLAKTLSPSDEVT
                     LVEQPNNNAGNTLKTFLPLKWWKTST"
     gene            complement(<159965..>160975)
                     /locus_tag="ZYRO0B01958g"
                     /db_xref="GeneID:8202178"
     mRNA            complement(<159965..>160975)
                     /locus_tag="ZYRO0B01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494994.1"
                     /db_xref="GeneID:8202178"
     CDS             complement(159965..160975)
                     /locus_tag="ZYRO0B01958g"
                     /note="similar to uniprot|P38757 Saccharomyces cerevisiae
                     YHR004C NEM1 Protein of the nuclear envelope required for
                     the spherical shape of the nucleus required for normal
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495039.1"
                     /db_xref="GeneID:8202178"
                     /db_xref="GOA:C5DQP5"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DQP5"
                     /translation="MNAISYLSNLSSTPSNPISSSSSSSSSSSHGVLVESEEEQEDND
                     EVNQFQNENDEGESIFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKE
                     VDDDLAEDEMFLQRDTVKGGLRGKAFGTKKMGRFLFPKKLVPQSILFAERKKRLVVDL
                     DETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSKWYDLI
                     IFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEVLDEVVL
                     IDNSPTSYARNEDNAIQVEGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKA
                     LG"
     gene            <160995..>161561
                     /locus_tag="ZYRO0B01980g"
                     /db_xref="GeneID:8202179"
     mRNA            <160995..>161561
                     /locus_tag="ZYRO0B01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494995.1"
                     /db_xref="GeneID:8202179"
     CDS             160995..161561
                     /locus_tag="ZYRO0B01980g"
                     /note="some similarities with uniprot|Q04751 Saccharomyces
                     cerevisiae YMR069W NAT4 N alpha-acetyl-transferase
                     involved in acetylation of the N-terminal residues of
                     histones H4 and H2A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495040.1"
                     /db_xref="GeneID:8202179"
                     /db_xref="GOA:C5DQP6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DQP6"
                     /translation="MPNWPGFKREICISNSNDKILEKQLQLIEINLGSYYNKYNKTIY
                     KNNKRWQSNKWQEMCSENLFHVSYWNVESNELVCFCSIMPCEESIVEGEMSNIIYLYE
                     IHVAPEWRNQKFGKSILNALKEKLCPKAHLSGIELTVFSSNERAINFYRNNGFTLSYD
                     SPSDKRRRTRTGIRIIRPTYYIMCYVLR"
     gene            <162068..>162952
                     /locus_tag="ZYRO0B02002g"
                     /db_xref="GeneID:8202180"
     mRNA            <162068..>162952
                     /locus_tag="ZYRO0B02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494996.1"
                     /db_xref="GeneID:8202180"
     CDS             162068..162952
                     /locus_tag="ZYRO0B02002g"
                     /note="some similarities with uniprot|P54785 Saccharomyces
                     cerevisiae YMR070W MOT3 Nuclear transcription factor with
                     two Cys2-His2 zinc fingers involved in repression of a
                     subset of hypoxic genes by Rox1p repression of several
                     DAN/TIR genes during aerobic growth and repression of
                     ergosterol biosynthetic genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495041.1"
                     /db_xref="GeneID:8202180"
                     /db_xref="GOA:C5DQP7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DQP7"
                     /translation="MDIYESERLPLPQPLYYRNPAAGAADAATRAMPGELPTMNWKIP
                     SITRQNHQHNHAPIITRFPITPSGHQTPSAFTARSVVPPHATPMVQINSAFALPGDSA
                     GGRNDRSNGTAATSNIPSMMPTVAGTTAGHQGPSLPLPHVAATMGQAGAGVMAASVGA
                     MRIAAVNATQQQQAQQQQQQKMQLPRLNGLSHLCPMCDKSFKRKSWLRRHLLSHSPER
                     HFGCPWCLSKHKRKDNLLQHMKLKHTEYVLEKLRNQNVGIDGEVRNDNIRTLLCEGRL
                     NKEDVKKVLNGLIDSYNG"
     gene            complement(<163601..>164101)
                     /locus_tag="ZYRO0B02024g"
                     /db_xref="GeneID:8202181"
     mRNA            complement(<163601..>164101)
                     /locus_tag="ZYRO0B02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494997.1"
                     /db_xref="GeneID:8202181"
     CDS             complement(163601..164101)
                     /locus_tag="ZYRO0B02024g"
                     /note="similar to uniprot|Q04767 Saccharomyces cerevisiae
                     YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
                     membrane vesicle protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495042.1"
                     /db_xref="GeneID:8202181"
                     /db_xref="GOA:C5DQP8"
                     /db_xref="InterPro:IPR019365"
                     /db_xref="UniProtKB/TrEMBL:C5DQP8"
                     /translation="MDLAQIKILGSLVQGLKSYNFSLYGKYVAYLNIIFCIAFGIANL
                     FHVNAVIAFGVISIVQGAIILFLEVPFLLRICPLSDNFIEFVSRFETNGWRTIFYIFN
                     AVLQWASLALKITSLIVVAVGLTISAAFYGVAYFKHQNFQNSSHIKEPVGEGVEANEQ
                     NVREML"
     gene            <164680..>166017
                     /locus_tag="ZYRO0B02046g"
                     /db_xref="GeneID:8202182"
     mRNA            <164680..>166017
                     /locus_tag="ZYRO0B02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494998.1"
                     /db_xref="GeneID:8202182"
     CDS             164680..166017
                     /locus_tag="ZYRO0B02046g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495043.1"
                     /db_xref="GeneID:8202182"
                     /db_xref="GOA:C5DQP9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017921"
                     /db_xref="UniProtKB/TrEMBL:C5DQP9"
                     /translation="MQLESLTVMSPEEMGDQGSLRSRIKQISQLSLDSRAKAILMQRL
                     MMGRFNKVEQKLIPKGENTLAEAIASVKEEDWLPTYHSESALGCPHYQRACKLQCYQC
                     NEWVGCRFCHDEQQHEPAHTFIRNKTRWIMCMRCQNVQPPSRECNRCEEEFALYYCEN
                     CRLYDNDEAKDIYHCDKCELCRLGLGLGIDFFHCDGCHACLSIELQGNHKCIEGATMS
                     NCPICGDYMFTSTRPVVYMSPCGHAIHQHCFEEHTRHSYKCPHCQVTVLNMDAQFRVL
                     DVEIEEQPLPEPYCHWMCIVSCNDCKGRSKCSYHILGLKCGHCLSYNTAQLKLIKPEL
                     SSDVGADVAAFEQFDHTMNHTLREDLLRDHLQTEDVSPLINMDSTMLTNIDQYMDAYF
                     KEEGLEKGKESRNVNDFINTSALFDEEPGKVSLAERVRSSIDKWRNGSQDSLD"
     gene            <166020..>169186
                     /locus_tag="ZYRO0B02068g"
                     /db_xref="GeneID:8202183"
     mRNA            join(<166020..166022,167756..>169186)
                     /locus_tag="ZYRO0B02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002494999.1"
                     /db_xref="GeneID:8202183"
     CDS             join(166020..166022,167756..169186)
                     /locus_tag="ZYRO0B02068g"
                     /note="similar to uniprot|P33417 Saccharomyces cerevisiae
                     YKL032C IXR1 Protein that binds DNA containing intrastrand
                     cross-links formed by cisplatin contains two HMG (high
                     mobility group box) domains which confer the ability to
                     bend cisplatin-modified DNA mediates aerobic
                     transcriptional repression of COX5b"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495044.1"
                     /db_xref="GeneID:8202183"
                     /db_xref="InterPro:IPR009071"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ0"
                     /translation="MVPTINTGDSPKQEDTGASANSLLGIPQDPSLQYPPLDNPEIQY
                     REFHPQQNFNHFQNQGFPIQFQPKQQQQQQQQQQQQQLQQQQLQQQQQQLQQQQQQLQ
                     QQFHSQYQPQQTFQQLFQQSQQLPRQHNSEQQRPHQHHQQQQEQQQRFAQFSQAGLIS
                     QTQQPQTQQPQPQQQQQQQQQQQQQQHHQHQTQQQQQLSSQDLGYIQQGNQGLQALNQ
                     QQLSELMYNSFLSHLAQKQVSSALTSALGNASHINPATAAAAAAGSSFLTQPVQRYFH
                     NNVSNSPVMMEATHPSSIQSSPQLHLQNTQSMAKKLSSTQSRIEKRKQLKKQGPKRPS
                     SAYFLFSMSIRNELLQQYPEAKVPELSKLASARWKELNEDQKKPFYEEFRTNWDKYRV
                     ERDQYEKTLPPKRPSGPFIQFTQEIRPIVVKENPEKNLIEITKIIGERWRSLDVGKKN
                     EYTETYKKRLKEWESCYPEEAEEAKKK"
     gene            complement(<169589..>170173)
                     /locus_tag="ZYRO0B02090g"
                     /db_xref="GeneID:8202184"
     mRNA            complement(<169589..>170173)
                     /locus_tag="ZYRO0B02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495000.1"
                     /db_xref="GeneID:8202184"
     CDS             complement(169589..170173)
                     /locus_tag="ZYRO0B02090g"
                     /note="similar to gnl|GLV|KLLA0E18535g Kluyveromyces
                     lactis KLLA0E18535g and weakly similar to YMR073C
                     uniprot|Q04772 Saccharomyces cerevisiae YMR073C
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495045.1"
                     /db_xref="GeneID:8202184"
                     /db_xref="GOA:C5DQQ1"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ1"
                     /translation="MDDSRFKRPSSFREERSLKNNTLSVPNSNNWLNPSKSQAGCSTL
                     RAGGYRNKVALKPGHSSLDWHELTTTKGKKFGLVTNVDRLLTLDLDHLKSTNYPQTLV
                     QISRKVPLYLIRPPLRVDKELLRRHNTKDDCWCVIQGKVYCLTNYFDFHPGGVDILLR
                     YCAGKDATKMFNEYHRWVSYDKLLETCFVGVYVE"
     gene            complement(<170440..>172473)
                     /locus_tag="ZYRO0B02112g"
                     /db_xref="GeneID:8202185"
     mRNA            complement(<170440..>172473)
                     /locus_tag="ZYRO0B02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495001.1"
                     /db_xref="GeneID:8202185"
     CDS             complement(170440..172473)
                     /locus_tag="ZYRO0B02112g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495046.1"
                     /db_xref="GeneID:8202185"
                     /db_xref="GOA:C5DQQ2"
                     /db_xref="InterPro:IPR000269"
                     /db_xref="InterPro:IPR015798"
                     /db_xref="InterPro:IPR015800"
                     /db_xref="InterPro:IPR015801"
                     /db_xref="InterPro:IPR016182"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ2"
                     /translation="MLHPFDPVTDEEIVVTSKLLKQMHGDASLFFSQVDRLEPIKSEA
                     IKYLEVERYGGKLPYIPRRTYAYYYVNSQMPLYKAIVNASEKHVESSKPVPGGAIGPL
                     QPDGMGDIEVAAMEHPIVKAEIAKLQLDKISFNHPQLGKLNYKVICEPWMYGTDSPND
                     KVPLIQCYMYMGVDHSDSNHYSIPLKFSPVFEYLTKKFVRMDYLPSGADEKFIKETLP
                     ARKVDPIVEYHPELIENWKPRDSLKPLQVVQPEGPSFKVEGTKVSWQGWEFRVATNVR
                     EGFALYDVHFKGRSLFYRIALNEMTVPYGDGRPPFHRKQAFDLGDCGFGNSANSLALG
                     CHCLGVIKYLDTRRSDARGNPVLIPSTVCMHEQDYGILYLHKNYRNDRSVVTRRREFV
                     VQTIATVANYEYIVNLVFDQAGAITVQVRATGILSTMPNDPNCVTDFGTIVGPGVTAA
                     FHQHLLNFRFDTRLDGDKNTVVYDDYLPMDENLPHNQYNVGFRQKRTFVDKSGSVDQS
                     PFTNRTYKVINENSINPVTMKPVGYKFEMPAKQMILASPNSFNVKRAHYATKQFWATK
                     YHDHQLYAAGEFTNQSTRDTGLSVWADGSEDVRNTDTVVWATLALTHPPVTEQFPVMP
                     SDFLQFLVTPASFFDRNPALDVPLADNNFNKSVYYDDSQNAASNTSSCCQSKV"
     gene            complement(<172851..>173285)
                     /locus_tag="ZYRO0B02134g"
                     /db_xref="GeneID:8202186"
     mRNA            complement(<172851..>173285)
                     /locus_tag="ZYRO0B02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495002.1"
                     /db_xref="GeneID:8202186"
     CDS             complement(172851..173285)
                     /locus_tag="ZYRO0B02134g"
                     /note="similar to uniprot|Q04773 Saccharomyces cerevisiae
                     YMR074C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495047.1"
                     /db_xref="GeneID:8202186"
                     /db_xref="GOA:C5DQQ3"
                     /db_xref="InterPro:IPR002836"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ3"
                     /translation="MDPELQALREARLSELKGSSGSAPANGGKPSAPSPGADSRPAVG
                     TAIAPFLQPQALERLTRVDMVRPDRAQAVEAYLTKLISSGHVTRKISEEEIVQILHGV
                     ARQENKNKDTTIIFNRRDDDWENDLSTEKQNGNESDEDDFFE"
     gene            <174227..>176317
                     /locus_tag="ZYRO0B02156g"
                     /db_xref="GeneID:8202187"
     mRNA            <174227..>176317
                     /locus_tag="ZYRO0B02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495003.1"
                     /db_xref="GeneID:8202187"
     CDS             174227..176317
                     /locus_tag="ZYRO0B02156g"
                     /note="similar to uniprot|Q04779 Saccharomyces cerevisiae
                     YMR075W RCO1 Nuclear protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495048.1"
                     /db_xref="GeneID:8202187"
                     /db_xref="GOA:C5DQQ4"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ4"
                     /translation="MQNSRRPGSSGRGPGRPPKRGRKGGKMSGVSRPVPRPTTSSNQN
                     GNNSNNNSFDSGDTKSRSVSTPATPLPDAAPALSRQLRNSTSYTQVDYNLKKRKIIPS
                     EDFAVRSRRHKSNGNGILLQENDRNLELDPISNPDDDAKELIERDANGKIVNINEPNS
                     IRDAINGATGLPLNQGPPEKVKKEYMWSYKKNSFVDVQDNQDEGFPQLTSRDSEFNIE
                     QSDMRNKLEPCDVHADERDVLIKGKNNDKKITDYHHGHIKIKATVSEESKSKLFGQNS
                     VANLPGNGAHGELAGSTTQEIENDDFCSACLQSGSFLCCDTCPKSFHFLCLNPPVDPD
                     ELPDGDWSCPQCVFKMRCPNGSQAKKYEKDFLQEQVPRNCKLFGKLLFQLEITNPRQF
                     SLPQSLKDTFQNVKSGPHGVYNDGREKEPLSEKQLFGAPYGQSLTMLDCYNPDIHVDQ
                     DTGKFLTCYKCRTTKMGTWDSPEDSRLIMRCDYCKTPWHLDCIPHAPRASLKNLGTKW
                     KCPLHAPEVTKGNEMRRLSKFQKFIEPTQTCGFKNNGEVDIVLDEITSPGSKAMIEAY
                     KKKGDFPPVALLSERSVKLDFMDKVFRAKKVQRDRDLKYEEHLIDKLLTSSSQSKGDK
                     PLEDLLSFIYFQVGNNPYLKKLWDFKGLCKVAQDELARESISRQELNDLLMIRKLLES
                     KPKEEIMNFFNLKE"
     gene            complement(<176432..>180280)
                     /locus_tag="ZYRO0B02178g"
                     /db_xref="GeneID:8202188"
     mRNA            complement(<176432..>180280)
                     /locus_tag="ZYRO0B02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495004.1"
                     /db_xref="GeneID:8202188"
     CDS             complement(176432..180280)
                     /locus_tag="ZYRO0B02178g"
                     /note="similar to uniprot|Q04264 Saccharomyces cerevisiae
                     YMR076C PDS5 Protein required for establishment and
                     maintenance of sister chromatid condensation and cohesion
                     colocalizes with cohesin on chromosomes in an
                     interdependent manner may function as a protein-protein
                     interaction scaffold"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495049.1"
                     /db_xref="GeneID:8202188"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ5"
                     /translation="MAGTSMTKLKTQKPIISTSENLIPTDELLARLGSLHEELSTLVQ
                     GQVDLKKLEAYRVDLLDRKLLKHKDKGIRAFVACCLNDILRLYAPDAPYTDVQLTDIF
                     KLFLAQFEQLGDPENGYYIQQKYLITRLLEYRSIVLLTDLPSAHKLLERLFQIFYDDS
                     KNFEPRMFKVIGGILGEVISEFESVPMDVLRLIFNKFLTYNPEEIPKGLGVVSNCGYE
                     ISLILCDAYSTRMSRHLTKYYSEILYNVTNEEDHSFEARSNAQKVITKLHRLICRLWG
                     SVPDLVSSVIGFIYHELLSDNELLRKQSTKLVGELLTIDSDLNFVTTHQDIYNAWLSK
                     IADISGEVRQQWAEGVPQVLEIRDDISQEVSKGLAKTLIDSDHRVRKRSVLAIKELNV
                     SILWRKVTDKTVYSCLLQLTREKNREVRELSIVTVASFYSESLTCEKHITQNKELWEI
                     VKTIPSVIFNLYYINDLNINEQVDGIIFENLLPVEADDKQRVDRLLTVISHFDKKAFA
                     SFFAFNKRQLQISKAISKYIEFSEKLNDSDGPDDEGGMSIKLQKTIDWLASGMADQLK
                     ATAALEVLKELNDKRVFHLIKTCVGNDVPFATLRNCIKELVNKLQDPTILRKNDARAS
                     STIVPRDLARQVKILLYRASPLNYNVSNVPILLDTGSHASSEEVELKRKLLDHISTVN
                     PTLFKDQVRTLKCMITQGQDFPDVEQGALTLNEALKTLYKICKTMRDQLDFENALFAT
                     KLKDFALEGEPTMAKYATKLFALSPNAEQYLKPIKDCILPLNLKNDKHIASHILVLSE
                     IFRFCPRILNEDSTDIVSYLIKEVLLANQVVGDKENEPDWIEDTSLNKKDYAALSCKV
                     FSLKLFTVKLKSIASEINDDELAKAFTEKTVKLFFYLIASGGELISEYNTEYYPTPSS
                     FQTKLRCYAGLQILKLAHIPHLSDFIKSPDIIKMINLVEDESLPVRKSFLDQLKNGLA
                     GELISIKFLPLIFFTAYEPNGELKSTTKTWINYTFSKESFKKDTFFERALPRLIHAIA
                     HHPDIEEGLDSDGDAYLNVLTTAIGYLLFYFDSIAAQENFSLLYYLSERVKNYQDRIT
                     VEEQQEDEESVASDRGDNINPSRKLYIIGEISQMILLALKEKRNWQHSAYPGKLNLPA
                     DLFMPYSNVQEAQASFKTYLPDSLADKLRANIRSKVGRIAHTSQTQRQKAQKRMLAHE
                     YDGASNSKRKKIRAIRKKVEESEEESQEDVSEADDNVYQPSQKIRNKRAGDNVARRSG
                     RTKKNVDYKEGASESDEDYS"
     gene            complement(<180564..>182366)
                     /locus_tag="ZYRO0B02200g"
                     /db_xref="GeneID:8202189"
     mRNA            complement(<180564..>182366)
                     /locus_tag="ZYRO0B02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495005.1"
                     /db_xref="GeneID:8202189"
     CDS             complement(180564..182366)
                     /locus_tag="ZYRO0B02200g"
                     /note="some similarities with uniprot|P38750 Saccharomyces
                     cerevisiae YHL008C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495050.1"
                     /db_xref="GeneID:8202189"
                     /db_xref="GOA:C5DQQ6"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="InterPro:IPR024002"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ6"
                     /translation="MVVDDSTYITPHEAALAVEATSMKKSRMQIDVLVINSIIAGIVF
                     SSGGILNISVHSDNPGIWEKNPGILKFMAGILYGIGLFYVVILGADLFNSNILYFSVG
                     LLRRSVSIYDVLISWFCSLFGNIGGCLLVCYVFVHLSSLSSSHLWKVGSKQLAEEKAS
                     FSFIQTFLKGIAGNFFACLAIYLQLMAKPLHVKWIMITLPIFTFVSIGFTHVVGDMPL
                     LFIGMLNGANVSVGKYIWKLLVPASVGNILGGFSFSLLIPFYLHLLVVERDRKKLSLP
                     QYEERDEQPELNMDSRVVRVQPEEELYDEDQAREEEEEEEEERNEKNPGVPIRNSVTS
                     SRSNRSAHSSAADQLSMNDSSNYFGRPEALEDSSQLKYPVKRWDSNRSGVSFYSTISN
                     GVRRRSRTTPAGVFPVKGMATPFRDRDLRTQRMTDSATVYGQPLGDVEPVSTGPSRRG
                     SSLRGSLAKSTDTGEDSTENYGVVDSKPGAKLEKAITRFISRVPSKPSKNELPRTTQE
                     SFPYKQPPSFYSTHKPFMSSRNSSGNVTSSTQRRSSTDIPRAKVPSLQRNSKFHQSNT
                     KAIDEIGPAELDIISSWNSGNISHLPELPSKQPD"
     gene            complement(<182793..>185903)
                     /locus_tag="ZYRO0B02222g"
                     /db_xref="GeneID:8202190"
     mRNA            complement(<182793..>185903)
                     /locus_tag="ZYRO0B02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495006.1"
                     /db_xref="GeneID:8202190"
     CDS             complement(182793..185903)
                     /locus_tag="ZYRO0B02222g"
                     /note="similar to uniprot|P36097 Saccharomyces cerevisiae
                     YKL033W Protein of unknown function localized to the
                     cytoplasm."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495051.1"
                     /db_xref="GeneID:8202190"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ7"
                     /translation="MASQSALFQELRPLCVDLSRQAFLPPNTFDPSSLTLLNALKRLE
                     SKLTFYHDESLSQKLAEYVFVPIVSLLKQSGLGDSQTEYVLRIITHLLRLSWRSKGTF
                     AKELAEQLLPLVTFLISQDKENSKISEKPLEYKSAGCGVLLQFFTSLRDQSYKFQFFS
                     SSKPKSLLSLGHCITILLGLLESTSQDPQTQIQALEALRILYQEIIGDGEIISFVLPG
                     NVSSFVKVFLSPGVNVNYKVVVKTLQVLSIILRMVYDDFTLDAHRSRFTDVNELITFK
                     EEHPDVDVNRRIEMHLESPSQHRSLSWLLGTSSQVKRALDSFIPKLLKRQNQEITDAL
                     TDFTSNLLKHSKNSLSNCQYSLVSTLVSLRRDPYSQLPEHLEYLQQLVEGKAGKLNNI
                     IKLENEQELLSLSYALDILVQCDPTKDFSLLKDIGGNILEALESDITSTLSRRRNFKI
                     TEQSSNVILAGDLEAEIVHCQDSVAILPTMSKRLEDTIGKLLMSAGRMAGQESQLSLL
                     IETTLSEQSCSNTIRKTLALWSSAWAIRGLYNGQQSNNEMNAFLDTGEDEEYTYEPCY
                     AILDFCNGLAQELTVVQEGRSMSLQEETVLSVVLFTIESVCQVMHKDFEPELIEYLYT
                     TVENLASPSPIVRHFAQSCSLTISQTLYNGSIQQMLLSNVDYLVDSISTRLNLGMTER
                     VSAVFAVICKIAGYETIETFKDVIETIFKMLDYYHGYDELCIQFFQLFEVIILEMKKR
                     FLQVDEQLTLGSDHLVTNAYSPWGMTNVKQLVSILGKPNPEDEPLVDEYTKEPSSFQE
                     YFDSKIQEADSDDEDEEHAEEEGTEMEPLAPKEKWSSPIPLDSYRILLEVFHYGDRLL
                     THPSKPLRVQILQVMELIVPMLSTQYNSMLPQIANVWESVVQCTLSSDYTIVKPACLC
                     LRKIIHYSGDFVAKRFFELWDRWCQGSSLLKEVRVARSGGSGKAEVGNSQMSTHRKFP
                     PVTKDALVALAGLLLEGITVTELMLPDTTLTDMLYCCIQVIPADTVAETSLLLADVVW
                     TLKDTN"
     gene            <186386..>188077
                     /locus_tag="ZYRO0B02244g"
                     /db_xref="GeneID:8202191"
     mRNA            <186386..>188077
                     /locus_tag="ZYRO0B02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495007.1"
                     /db_xref="GeneID:8202191"
     CDS             186386..188077
                     /locus_tag="ZYRO0B02244g"
                     /note="similar to uniprot|P38748 YHL010C Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495052.1"
                     /db_xref="GeneID:8202191"
                     /db_xref="GOA:C5DQQ8"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR011422"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ8"
                     /translation="MDFEYRIVVELADQEQQQWAYKLFTENSLFQDNNQVNTNDTDFS
                     SDWRIGDLSIGALLRMDFGSESHEKDLVTSKYLGHGIIRLFKINDPKNDQYTEKDLLM
                     VPGDDTMVCILFVPTYFTVHELLHFYIGDDIVNNQVSNFRILRNQKKDLGFNFMVLMK
                     FRNSMDAKRSKDIFNGKRFSQMDPETCHVISIREVVFKRALFDKKEGQKLPYLLTDPF
                     TTSPQPLQSQVELPTCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSKCPVCRYS
                     SLRLSRDSLLRDAGGSASCSTCGSRENLWICLICGNVGCGRYASKHAIEHYEASSHCF
                     SMDMRTQRVWDYAGDNYVHRLVQNEVDGKLVEIGAEGTSIQGDTAGGGSNKDSESTAT
                     FMRNKEYHLEYVQVLISQLESQREYYELKMEQEVQSRNNDSQIDELRKDLEQLKVNFK
                     RQQSDWEAERIKQRKQLEEDQLVLKGLQENLDHATEKENRLIKEKQELQMQKQDLQEQ
                     VQDLMFYLGSQERFKDADESEREGTLVIKEPEKKQSNTKSSNKNKKNKSKMKRKT"
     gene            <188410..>189372
                     /locus_tag="ZYRO0B02266g"
                     /db_xref="GeneID:8202192"
     mRNA            <188410..>189372
                     /locus_tag="ZYRO0B02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495008.1"
                     /db_xref="GeneID:8202192"
     CDS             188410..189372
                     /locus_tag="ZYRO0B02266g"
                     /note="highly similar to uniprot|P38689 Saccharomyces
                     cerevisiae YHL011C PRS3
                     5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase
                     involved in nucleotide histidine and tryptophan
                     biosynthesis one of a five related enzymes which are
                     active as heteromultimeric complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495053.1"
                     /db_xref="GeneID:8202192"
                     /db_xref="GOA:C5DQQ9"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C5DQQ9"
                     /translation="MASNSIKLLAPDVHRNLAELVAKRLGLRLTDADLKRDPTGEVSF
                     SIGESVRDQDIYIIMQIGSGVVNDRVLELLIMINACKTASARRITAVIPNFPYARQDR
                     KDKSRAPITAKLMADMLTTSGCDHVITMDLHASQIQGFFDIPVDNLYAEPSVVRYIKE
                     NVSWKEAAIISPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMVLVGDVTDKIC
                     IIVDDMADTCGTLGKAAEVLLDHGAKSVIAIVTHGVLSGRAIENINNSKLDRVVCTNT
                     VPFEEKMKSCSKLDVVDVSSVLAESIRRLHNGESISYLFKHYPL"
     gene            complement(<189497..>190168)
                     /locus_tag="ZYRO0B02288g"
                     /db_xref="GeneID:8202193"
     mRNA            complement(<189497..>190168)
                     /locus_tag="ZYRO0B02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495009.1"
                     /db_xref="GeneID:8202193"
     CDS             complement(189497..190168)
                     /locus_tag="ZYRO0B02288g"
                     /note="highly similar to uniprot|Q86ZR7 YKL033W-A
                     Saccharomyces cerevisiae YKL033W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495054.1"
                     /db_xref="GeneID:8202193"
                     /db_xref="GOA:C5DQR0"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DQR0"
                     /translation="MDGLLINTEDTYTLTLNEILAQYGKGPLTWDLKIRLQGLPGAKA
                     GQIVIDHYQLPLTVEEYEKLNLEIQSKKWSECGFLPGAMELLQYLHSKGIPIALCTSS
                     TNLKYEQKTSHLKESFKLFDVIITGDDPRIPPGKGKPFPDIWQVGLKELNKKFSSQIK
                     PEECLVFEDGVAGVRAGITFGSYVIWVPHPEAHEFLGNKEEILGGQGTSLYSLEELDK
                     AKLGL"
     gene            <190903..>192062
                     /locus_tag="ZYRO0B02310g"
                     /db_xref="GeneID:8202194"
     mRNA            join(<190903..191163,191646..>192062)
                     /locus_tag="ZYRO0B02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495010.1"
                     /db_xref="GeneID:8202194"
     CDS             join(190903..191163,191646..192062)
                     /locus_tag="ZYRO0B02310g"
                     /note="highly similar to uniprot|Q12159 Saccharomyces
                     cerevisiae YDR381W YRA1 Nuclear protein that binds to RNA
                     and to Mex67p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495055.1"
                     /db_xref="GeneID:8202194"
                     /db_xref="GOA:C5DQR1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DQR1"
                     /translation="MSANLDKSLDEIIGSGKKQARGRINKRSGGPKKAPKQIRRPAGV
                     GKKVRAPADGASVARMAKLLDTSREAKVNVEGLPRDIKQDAVKEFFSSQVGGVSRVLL
                     SYNERGQSTGMANITFRNGEMAKKAVAKFNGAPIDGGRSRLRLNLIIDPNQQPSKSLS
                     ERIKAVPVTNKNRPSAAAAAAKKGPNKRAAILKKARAKQQPKERQPKKSLEDLDKEMT
                     DYFEEKQ"
     gene            complement(<192308..>192684)
                     /locus_tag="ZYRO0B02332g"
                     /db_xref="GeneID:8202195"
     mRNA            complement(join(<192308..192590,192659..>192684))
                     /locus_tag="ZYRO0B02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495011.1"
                     /db_xref="GeneID:8202195"
     CDS             complement(join(192308..192590,192659..192684))
                     /locus_tag="ZYRO0B02332g"
                     /note="similar to Saccharomyces uniprot|Q3E6R5 cerevisiae
                     YDR381C-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495056.1"
                     /db_xref="GeneID:8202195"
                     /db_xref="UniProtKB/TrEMBL:C5DQR2"
                     /translation="MSNPFQNIGRNAACLTAVAIASVIAVKSNVRNKKEANYAPPARV
                     TSNQGKFNEHYDNIAEVRPGFPLQEEGERRERKSVYEGPGLSRETRKKGDKLGFFDRW
                     "
     gene            <193051..>193986
                     /locus_tag="ZYRO0B02354g"
                     /db_xref="GeneID:8202196"
     mRNA            <193051..>193986
                     /locus_tag="ZYRO0B02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495012.1"
                     /db_xref="GeneID:8202196"
     CDS             193051..193986
                     /locus_tag="ZYRO0B02354g"
                     /note="similar to uniprot|Q754C3 Ashbya gossypii AFR147C
                     AFR147Cp"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495057.1"
                     /db_xref="GeneID:8202196"
                     /db_xref="GOA:C5DQR3"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DQR3"
                     /translation="MSKDELEVSELASAIAGAGGGALSMTLTYPLLTITTKLQAEEKV
                     SQQENREKRSATDVIRELFKEHGITGFYNGLESAIYGMTITNFVYYYFYEWATNSVKR
                     ICLHNRLSTLESMFTGAVAGSATVIASNPIWVANTRMTVTKSHKSTLATIMEIVEKDG
                     FFTLFSGVRPALLLVINPIIQYTTFEKLKNLVLSNSKSDREILPPGWAFLFGAIGKLL
                     ATGLTYPYITIKTRRHLEKQNKSGNGDSLFQVAKREGVSGLYNGISYKLTQSILTAAF
                     LFYFKEGLTSWAVRMLKFIRQLLLRRSKITVKLNE"
     gene            complement(<194075..>194959)
                     /locus_tag="ZYRO0B02376g"
                     /db_xref="GeneID:8202197"
     mRNA            complement(<194075..>194959)
                     /locus_tag="ZYRO0B02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495013.1"
                     /db_xref="GeneID:8202197"
     CDS             complement(194075..194959)
                     /locus_tag="ZYRO0B02376g"
                     /note="similar to uniprot|Q12375 Saccharomyces cerevisiae
                     YOR130C ORT1 Ornithine transporter of the mitochondrial
                     inner membrane exports ornithine from mitochondria as part
                     of arginine biosynthesis human ortholog is associated with
                     hyperammonaemia-hyperornithinaemia-homocitrullinuria (HHH)
                     syndrome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495058.1"
                     /db_xref="GeneID:8202197"
                     /db_xref="GOA:C5DQR4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DQR4"
                     /translation="METDSLIISEQSRHQPHNKALADIVNGSIAGALGKIIEYPFDTV
                     KVRLQTQGAHIFPTTWSCIRYTYKNEGVMKGFFQGIGSPICGSALENAVLFVSYNQCA
                     RLLEKHTNCSSLQQIILSGAFAGSCASLVLTPVELIKCKLQVSNLGSGKPVKILPTVK
                     RVLRESGIGGLWQGQSGTFIRESLGGIAWFATYELLKDHLLHRHEDGGADGVNKTWEL
                     LVSGGSAGLAFNASIFPADTLKSTMQTEQRSLISSATKIMKTAGLAGFYRGLGITLVR
                     AVPANAVVFYTFETLSQM"
     gene            <195478..>195804
                     /locus_tag="ZYRO0B02398g"
                     /db_xref="GeneID:8202198"
     mRNA            <195478..>195804
                     /locus_tag="ZYRO0B02398g"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_002495014.1"
                     /db_xref="GeneID:8202198"
     CDS             195478..195804
                     /locus_tag="ZYRO0B02398g"
                     /note="highly similar to uniprot|P02400 Saccharomyces
                     cerevisiae YDR382W RPP2B Ribosomal protein P2 beta a
                     component of the ribosomal stalk which is involved in the
                     interaction between translational elongation factors and
                     the ribosome regulates the accumulation of P1 (Rpp1Ap and
                     Rpp1Bp) in the cytoplasm"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_002495059.1"
                     /db_xref="GeneID:8202198"
                     /db_xref="GOA:C5DQR5"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:C5DQR5"
                     /translation="MKYLAAYLLLVQGGNAAPAAADIKKVVESVGVEAEDARIQALLT
                     SLEGKGSLEEVIAEGEKKLATVPVAGAAPAGGAAAAGGEAEAKEEEKEEEKEESDDDM
                     GMGLFD"
     gene            complement(<195877..>196449)
                     /locus_tag="ZYRO0B02420g"
                     /db_xref="GeneID:8202199"
     mRNA            complement(<195877..>196449)
                     /locus_tag="ZYRO0B02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495015.1"
                     /db_xref="GeneID:8202199"
     CDS             complement(195877..196449)
                     /locus_tag="ZYRO0B02420g"
                     /note="weakly similar to uniprot|Q12493 Saccharomyces
                     cerevisiae YDR383C NKP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495060.1"
                     /db_xref="GeneID:8202199"
                     /db_xref="UniProtKB/TrEMBL:C5DQR6"
                     /translation="MYKTETLWKRAGNLWEKVMVRYDKLLEFIETLNPPSGVRGIPES
                     ITKSLQPKQSRSSVDELCKKVYQVEKEERRQQLLQVLENVGDMPQSMLGYDIREATSI
                     DRLSQQVCQLPRLTTLQDNQEDQNVLQEYNYLRDQIIQKCKAIEVANKVLDQSGKDLK
                     TIESLLQNLPDPERFFSNYHKTLDGELKRI"
     gene            complement(<197140..>198021)
                     /locus_tag="ZYRO0B02442g"
                     /db_xref="GeneID:8202200"
     mRNA            complement(<197140..>198021)
                     /locus_tag="ZYRO0B02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495016.1"
                     /db_xref="GeneID:8202200"
     CDS             complement(197140..198021)
                     /locus_tag="ZYRO0B02442g"
                     /note="similar to uniprot|Q12359 Saccharomyces cerevisiae
                     YDR384C ATO3 Plasma membrane protein regulation pattern
                     suggests a possible role in export of ammonia from the
                     cell member of the TC 9.B.33 YaaH family of putative
                     transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495061.1"
                     /db_xref="GeneID:8202200"
                     /db_xref="GOA:C5DQR7"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:C5DQR7"
                     /translation="MSNHSSASRQLNSFEEKEEAPTEFNDIHRDTTNYDSGYKEDLNE
                     QHLSEGNEPIVHSITQQGDFVEMGGHRYRRKDLANIFAADLDNVAYKTRPRHGVQLGN
                     PVPLGLASFSFCCLILSLVNARVRGVTDSKLLVPAFLFFGGAIELFAGLLCFVIGDTY
                     SMTVFSSFGGFWICWGCINTDQFHVAAAYENDPTMMNNVQGYFLAGWVVFTFLVMVCA
                     MKSTWGLFLLLFFLELTFLLLCIGSFINNAHVLMAGGYFGILSSVCGWYSLYCAIADP
                     AYTYAPLRAYPMPNSQV"
     gene            <198821..>199375
                     /locus_tag="ZYRO0B02464g"
                     /db_xref="GeneID:8202201"
     mRNA            <198821..>199375
                     /locus_tag="ZYRO0B02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495017.1"
                     /db_xref="GeneID:8202201"
     CDS             198821..199375
                     /locus_tag="ZYRO0B02464g"
                     /note="similar to uniprot|P32772 Saccharomyces cerevisiae
                     YDL169C UGX2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495062.1"
                     /db_xref="GeneID:8202201"
                     /db_xref="UniProtKB/TrEMBL:C5DQR8"
                     /translation="MNPLLSPEMLSSEATMVYSTTYNSNLQTTNNFTVSSSESQGFAW
                     NQDLFASQYQQMCKVVYDGHEDTLDGLMEYIRRHSGSSNNAGGNTAAFKYNEDGDEAL
                     TDCENNEEEDAEFEPTRLSEWRFFHPKVCEELNRPRRISERSLSFVSDSKNGSFNRCD
                     TAVIEVDSDTPENNHLKWLLTAGK"
     gene            complement(<199474..>201201)
                     /locus_tag="ZYRO0B02486g"
                     /db_xref="GeneID:8202202"
     mRNA            complement(<199474..>201201)
                     /locus_tag="ZYRO0B02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495018.1"
                     /db_xref="GeneID:8202202"
     CDS             complement(199474..201201)
                     /locus_tag="ZYRO0B02486g"
                     /note="similar to uniprot|P21304 Saccharomyces cerevisiae
                     YLR196W PWP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495063.1"
                     /db_xref="GeneID:8202202"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DQR9"
                     /translation="MISATCWVPRGYASEFPEKYELDNEEMERINQMANLNLNDATAE
                     MEEVAEEEEEGAQEEASEESQPNPSKLQDQLDADDDLKEFDMEHYDDEDSGANGAGVA
                     MFPGLEGEDVRFHEGEEGEDPYISLPNKEEQTEEKQELQVYPTDNMVLATRTEDDVSY
                     LDVYIYDDGAGFHDVEVPQEKGDEADPDVARGLVRDSSLYVHHDLMLPAFPLCVEWLN
                     YRPGSQSDDPANFAAIGSFDPQIEIWNLDCVEKAFPDMILGEPEQGSGASLKNKKNKK
                     KQKNQHITTHHTDAILSLALNKHFRAVLASTSADHTVKLWDLNNGTAARSLASIHSGK
                     NVSSSEWHKTNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADEN
                     IILSGTDSGNVYAFDIRNNSGSKPVWTLNAHDAGISCLCANDYIPGMMTTSAMGDKTV
                     KLWKFPLEQDNTGGLGPSMVLSRDFDVGNVLSVSFANDVEVAGNMAIGGVNTGLKLYD
                     VFSNRTVRKSFGRELSAAQQTAKAEAQQLGKSSRFARKYRGNSQPDTVVTVDADNEED
                     EDDADEDEE"
     gene            <201448..>202845
                     /locus_tag="ZYRO0B02508g"
                     /db_xref="GeneID:8202203"
     mRNA            <201448..>202845
                     /locus_tag="ZYRO0B02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495019.1"
                     /db_xref="GeneID:8202203"
     CDS             201448..202845
                     /locus_tag="ZYRO0B02508g"
                     /note="highly similar to gnl|GLV|CAGL0A04059g Candida
                     glabrata CAGL0A04059g and similar to YLR195C
                     uniprot|P14743 Saccharomyces cerevisiae YLR195C NMT1 N-
                     myristoyl transferase catalyzes the cotranslational
                     covalent attachment of myristic acid to the N-terminal
                     glycine residue of several proteins involved in cellular
                     growth and signal transduction"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495064.1"
                     /db_xref="GeneID:8202203"
                     /db_xref="GOA:C5DQS0"
                     /db_xref="InterPro:IPR000903"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR022676"
                     /db_xref="InterPro:IPR022677"
                     /db_xref="InterPro:IPR022678"
                     /db_xref="UniProtKB/TrEMBL:C5DQS0"
                     /translation="MSGNGSGDGAGEPSGRLAELLKLLKLNGNDVTKLTQSQRKEMKD
                     YKFWKTQPVATFDEPISEEGPIDRKKTPEEISDEPFPLLGEFEWCTLDVTDKSQVEDI
                     FVLLNENYVEDRDASFRFKYTREFFNWSLKPPGWKKEWHVGVRVRSTGKLVAFISAIP
                     VDLKVRGKLVKSVEINFLCVHKQLRGKRLAPVLIKEVTRRVNKCDIWFALYTSGTVLP
                     SPVSVCRYTHRPLNWDKLLDVGFVQLPPGASKPQMVANYTLPKGPTTRGLRPLKPEDV
                     DQAHALFEKYQKRFDLVQDFNKEEFSHWFLGGPEQMSATPDGKVIYSYVVENQEGKIT
                     DFFSFYSLPFTILDNSVHNELGIGYLFYYASDADLKYNDRFDPEATKALKERLSQLIN
                     DACILARNAKMDVFNALTSQDNTLFLEKLKFGPGDGFLNFYLFNYRAFPIAGGIKDDK
                     DYDVEKRSNVGVVML"
     gene            <203167..>203775
                     /locus_tag="ZYRO0B02530g"
                     /db_xref="GeneID:8202204"
     mRNA            <203167..>203775
                     /locus_tag="ZYRO0B02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495020.1"
                     /db_xref="GeneID:8202204"
     CDS             203167..203775
                     /locus_tag="ZYRO0B02530g"
                     /note="weakly similar to uniprot|Q05777 Saccharomyces
                     cerevisiae YLR194C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495065.1"
                     /db_xref="GeneID:8202204"
                     /db_xref="UniProtKB/TrEMBL:C5DQS1"
                     /translation="MQLSYILALCTFSAIAKTTTLAPSESSSSPEYSWDKPASLQATT
                     DDEGRQVTKTLWWLPPSSSAVSHSETSAYPASSSKGGESTSRSQDGPATILTSSNSQG
                     EYTSTIWWLPSTSSQQDSTSSIARTTIISKKHGEKSTSTISNSPLSSSSSSLSSLLTS
                     ANIKSRNLGSDNSTIQVHSNAGGKIVDMSYGIGAIALALMLI"
     gene            <204180..>204707
                     /locus_tag="ZYRO0B02552g"
                     /db_xref="GeneID:8202205"
     mRNA            <204180..>204707
                     /locus_tag="ZYRO0B02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495021.1"
                     /db_xref="GeneID:8202205"
     CDS             204180..204707
                     /locus_tag="ZYRO0B02552g"
                     /note="highly similar to uniprot|Q05776 Saccharomyces
                     cerevisiae YLR193C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495066.1"
                     /db_xref="GeneID:8202205"
                     /db_xref="InterPro:IPR006797"
                     /db_xref="UniProtKB/TrEMBL:C5DQS2"
                     /translation="MVLWHKNAHVFNNDFNTVSLAFFNRYPNPYASHVLSIDTLSREL
                     DNDGKLHTTRLIKKAGKLPRWVKPFLGRISESWIIEFSIVDPRQSTMRTYTRNLDHTK
                     IIQVEEYTTYEQAKQNVRSTSCASQVKFSSGFNVGIRSKIEDWSRSRFDENIKKSRLG
                     MVFVMQELEKRSSLL"
     gene            complement(<204817..>206541)
                     /locus_tag="ZYRO0B02574g"
                     /db_xref="GeneID:8202206"
     mRNA            complement(<204817..>206541)
                     /locus_tag="ZYRO0B02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495022.1"
                     /db_xref="GeneID:8202206"
     CDS             complement(204817..206541)
                     /locus_tag="ZYRO0B02574g"
                     /note="similar to uniprot|P26370 Saccharomyces cerevisiae
                     YDL170W UGA3 Transcriptional activator necessary for
                     gamma-aminobutyrate (GABA)-dependent induction of GABA
                     genes (such as UGA1 UGA2 UGA4) zinc-finger transcription
                     factor of the Zn(2)-Cys(6) binuclear cluster domain type
                     localized to the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495067.1"
                     /db_xref="GeneID:8202206"
                     /db_xref="GOA:C5DQS3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DQS3"
                     /translation="MGIAGQKVSKIPVRKHSKTGCITCKVRKKRCSEDKPVCSDCARL
                     GFTCMYVPRSFDKNAVQKCKDQVEMELFVHKNKKKFVAEFEGIASGGSSSSSNGSNGS
                     DGSDSQVERPSEDVEERALADEFETEGSSLAVVQTKSPSSPYLSQPLSDPINLHLDPV
                     GMHLYDYYRDHLGKIISIAPLKQNYYLQVFLPMAHRHRGILYGLMAWSAHHLSISQEG
                     SETRDDNYCALANRYTLESLRFLRSEIDTNFLWSLAQLLILCGAEICQGDVSKWKILL
                     KYAADLIEKNVGGEISHLMSSFTSQIDTTTRYWLLANFIYHDVMCSRGTHFPIDQYNK
                     VLSSHTDTSPNAISDVNMHVDPLHGVNRPILLLMGDITNLVRRMKNAGSFGKSHPKFR
                     EYMDRAFELQTELFQISPDVRELQLYEESSLMHALCLELFQLMKLSALLHLKTTCLRQ
                     SKHTWEIQHFWLELFEKLDLILGTKLEGCLCFPMFICGINATDQEQKRQIESRFSDIA
                     KRYKCYNFQRARTVMRKVWLQDDSDATSPTSSISHTSLSDIGSLDIGENTDWYDIVDA
                     MGWDISFA"
     gene            <207379..>213795
                     /locus_tag="ZYRO0B02596g"
                     /db_xref="GeneID:8202207"
     mRNA            <207379..>213795
                     /locus_tag="ZYRO0B02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495023.1"
                     /db_xref="GeneID:8202207"
     CDS             207379..213795
                     /locus_tag="ZYRO0B02596g"
                     /note="highly similar to uniprot|Q12680 Saccharomyces
                     cerevisiae YDL171C GLT1 NAD()-dependent glutamate synthase
                     (GOGAT) synthesizes glutamate from glutamine and
                     alpha-ketoglutarate with Gln1p forms the secondary pathway
                     for glutamate biosynthesis from ammonia expression
                     regulated by nitrogen source"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495068.1"
                     /db_xref="GeneID:8202207"
                     /db_xref="GOA:C5DQS4"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006005"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR028261"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DQS4"
                     /translation="MALKSEAYDPLGEAYEGGSPMGGNESRVNKSWAQVIPDKCGLYD
                     PDYEKDACGVGFVANIKGEPSHKIVSDARFLLCNMSHRGAVSSGGNGDGAGILVGIPH
                     DFFAREFKLDLDIDVPPRGQYAVGNVFFKKGEVPALKAAQKVFEDLALEQGLKVLGWR
                     DVPKDSSILGEVALSREPTILQPLIVQSDYQQQQQQQQQHFNEKSFQTKLYILRKLAS
                     NEIGIENWFYVCSLSNKTIVYKGQLTPAQVYSYYHDLTNAHFKSHMAMVHSRFSTNTF
                     PSWDRAQPLRWLAHNGEINTLRGNKNWMRAREGVLLSETFKDQLDKLYPIIEEGGSDS
                     GALDNVLELLTINGALSLPEAVMMMVPEAYHKDMDSNLKAWFDWAACLMEPWDGPALL
                     SFTDGRYCGAMLDRNGLRPCRYYVTEDDRVICASEVGVIHLDNSLVVSKGKLKPGDLF
                     LVDTEEGEIVDTKSLKMKFAKRQDFKSWLSKVIKLEDLVKKNQKYIPKQYIPENSDID
                     VQRNPFLLANGYTFEQISLIITPMALGGKEALGSMGNDAPLACLNEDPVLVYDYFKQL
                     FAQVTNPPIDPIREANVMSLECYVGPQGNLLEMHPSQCERLLLKSPILHWDEFSALEN
                     IEKAHPSWSVSKIDITFDKYEGLLGYTATIERITAQASDSIEQGKKILILSDRRVGPE
                     RVAISSLIAVGAIHHHLVRRKQRSHVAIILETGEAKEVHHFCVLLGYGCDGIFPYLIM
                     ETLVRMNHEGLVRNVDDDNLQVEDHTLLENYKHAIDGGILKVMSKMGISTLASYKGAQ
                     IFEALGVDNSVIDLCFAGTASRIKGVTFEYLAQDAFSMHEAAYPTRSVISNSVALPEN
                     GDYHWRDGGYKHVNDPQAIASLQDTVKNKNGDAWDMYVKRETEAIRDCTLRGLLELDL
                     ENSTAIPLEQVEPWTEIVRRFSTGAMSYGSISMEAHSTLAIAMNRLGGKSNCGEGGED
                     AERSIVHKNGDTMRSAIKQVASARFGVTSYYLSDADELQIKIAQGAKPGEGGELPAHK
                     VSKEIARTRHSTPYVGLISPPPHHDIYSIEDLKQLIYDLKCSNPRAGVSVKLVSEVGV
                     GIVASGVAKAKADHILVSGHDGGTGAARWTSIKNAGLPWELGLAETHQTLVLNDLRRN
                     VVVQTDGQIRTGFDVAVAVLLGAEQFTLATVPLIAMGCVMLRKCHLNACAVGIATQDP
                     YLRSKFEGQPEHVINFFYYLIQDLRKIMAKLGFRSIDEMVGHSEKLRKRENVNTKAIN
                     IDLSPILTPAHVIRPGVATKFCKKQDHKLHTRLDNKLIDEAEVTLDRGLPVTIDAEII
                     NTDRALGSTLSYRISKRFGENGLPQDTVVVNIEGSAGQSFGAFLAPGVTFILDGDAND
                     YVGKGLSGGTLVIRPPAGSKFKSDENVIIGNTCFYGATSGTAFIAGCVGERFAVRNSG
                     ATTVVERIRGNNAFEYMTGGRAVILSQLESLNAFSGATGGICYCLTSDYEDFVGKINK
                     GTVELEGLSDPVEIAFVKNLIQEHYNYTKSELAERILGRFNYYLKNFVKVIPSDYKKV
                     LLKEAEEKVKQKQLADAEYLRKFQRSSNSNLDATNGEVDALMSSKRERNAVSFRSAAK
                     EPGVADLEDAVPNHEKSAETVEKLEKVRGFMKYKVRHQSKRPASIRSQDWKEFTNNLN
                     KKDARYQTARCMDCGTPFCQSDTGCPVSNIIPKFNDLVFKNQWRLAWEKLSETNNFPE
                     FTGRVCPAPCEGACTLGIIEDPVGIKSIERLIIDNAFKEGWVQPSPPDSRTGRKVAII
                     GSGPAGLACADQLNRAGHSVTVFERSDRCGGLLMYGIPNMKLEKSIVQRRVNLLADEG
                     VQFVVNTEIGKDIAVSDLRAQFDSVVYAIGSTIPRDLPIEGRELKNIDFAMTLLKSNT
                     SALLKKDMEAVRQALAGKKVIVIGGGDTGNDCLGTSVRHGAASVLNFELLPQPPQKRS
                     RDNPWPQWPRVMRVDYGHAEVKEHYGRDPREYSILAKEFIGNDENEVKAIKTVRVEWK
                     KSESGVWQMVELPGSEEIFEADVVLLSMGFIGPELIEDPNVIKTRRGTIATVNDASYS
                     VDDDKTFAAGDCRRGQSLIVWAIQEGRKCATAIDQVLMGQTGLPGNGGLVKRNFSLLE
                     ELAATV"
     gene            complement(<213939..>214463)
                     /locus_tag="ZYRO0B02618g"
                     /db_xref="GeneID:8202208"
     mRNA            complement(<213939..>214463)
                     /locus_tag="ZYRO0B02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495024.1"
                     /db_xref="GeneID:8202208"
     CDS             complement(213939..214463)
                     /locus_tag="ZYRO0B02618g"
                     /note="weakly similar to uniprot|Q6Q543 Saccharomyces
                     cerevisiae YDL173W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495069.1"
                     /db_xref="GeneID:8202208"
                     /db_xref="InterPro:IPR022024"
                     /db_xref="UniProtKB/TrEMBL:C5DQS5"
                     /translation="MGPRMVSTGRGGSGNIQPAKSNLSPKLVPQGSQTPNILQPVYST
                     GRGGAGNMRRNVNPRVTRKAQDVEQELEKEDAILVSDEDYISPVQEEDPVSATLSGAN
                     SRSHSSGGSKIKLQKSKTRQESNRERPKAIVLGRGGAGNIISPTSSVKDRRKEKNPKD
                     GHKGMWSSIKHFFS"
     gene            <215063..>215899
                     /locus_tag="ZYRO0B02640g"
                     /db_xref="GeneID:8202209"
     mRNA            <215063..>215899
                     /locus_tag="ZYRO0B02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495025.1"
                     /db_xref="GeneID:8202209"
     CDS             215063..215899
                     /locus_tag="ZYRO0B02640g"
                     /note="similar to uniprot|Q05775 Saccharomyces cerevisiae
                     YLR192C HCR1 Dual function protein involved in translation
                     initiation as a substoichiometric component of eukaryotic
                     translation initiation factor 3 (eIF3) and required for
                     processing of 20S pre-rRNA binds to eIF3 subunits Rpg1p
                     and Prt1p and 18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495070.1"
                     /db_xref="GeneID:8202209"
                     /db_xref="GOA:C5DQS6"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="InterPro:IPR023194"
                     /db_xref="UniProtKB/TrEMBL:C5DQS6"
                     /translation="MSWDEDVIGGSATNGDDAVLMESWEDGLDDEPVLDSWDKDEGEE
                     KKPQASSESAKKTAAASNKKKNGGKKEKESSEPPKLAIDELDPKTRQELMKKAELESD
                     LKNASDLLGELELAGEHPRAQAAKRKEEEDLFAKLATPLTKDTPIGDHPLFQQAETKK
                     DYQELRKSLATAITPLNEKSSLNYSSSLAIDLIRDISKPMAIESIRQTVATLNILIKD
                     KEKQERQARLAKVKGGTATGGAGKKKAKAKTNLGGSFKKDQDLDIGGELDLGDFNDDD
                     FM"
     gene            <216049..>217755
                     /locus_tag="ZYRO0B02662g"
                     /db_xref="GeneID:8202210"
     mRNA            <216049..>217755
                     /locus_tag="ZYRO0B02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495026.1"
                     /db_xref="GeneID:8202210"
     CDS             216049..217755
                     /locus_tag="ZYRO0B02662g"
                     /note="similar to uniprot|P32891 Saccharomyces cerevisiae
                     YDL174C DLD1 D-lactate dehydrogenase oxidizes D-lactate to
                     pyruvate transcription is heme-dependent repressed by
                     glucose and derepressed in ethanol or lactate located in
                     the mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495071.1"
                     /db_xref="GeneID:8202210"
                     /db_xref="GOA:C5DQS7"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:C5DQS7"
                     /translation="MFKSSLRKCCRSFRFHRSYSSYDRPSFQLTGKNKKSLETGLKYV
                     LAGGIGYAIADTFEHNRRDRGLGKSVLPLDDLDSPQYCEPGKLPGVINQIKAVVGNDP
                     DNFTQSKTELDSHSDTSFNTHHATPEERPAIVIFPKSTEEVSQIVSICHDNKVPVVPF
                     SGGTSLEGHFLPTRRSDTVVLDFSKYMNKVLKLNKTDLDVEVEAGVPWEDLNDMLGEE
                     GLLFGCDPGPGAQIGGCVANSCSGTNAYRYGTMKENVVNLTVVLPDGTVVKTRRRPRK
                     SSAGYNLNGLFTGNEGTLGIVTKATVKCHVKPKFQTVAVVSFDAVENAAACSSSFTQQ
                     GIQLDAIELLDDNMMKVINSQAATFRTDWKEQPTLFLKIGGRNERIIQELVHEVENIA
                     KTYGSTGFEFAKDDDEKMLLWEARKFALWSVIDAGKSIKGQGSNVWTTDVALPISNFA
                     RVIMETKEEMNSSPLVNATVGHAGDGNFHAFLIYKDDEERKICEKIVANMVRRAIDAD
                     GTCTGEHGVGIGKRQYVLEELGQEPVDLMRRIKLAIDPHRIMNPDKIFKIDPHDNNDN
                     HP"
     gene            <218401..>218622
                     /locus_tag="ZYRO0B02684g"
                     /db_xref="GeneID:8202211"
     mRNA            <218401..>218622
                     /locus_tag="ZYRO0B02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495027.1"
                     /db_xref="GeneID:8202211"
     CDS             218401..218622
                     /locus_tag="ZYRO0B02684g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495072.1"
                     /db_xref="GeneID:8202211"
                     /db_xref="UniProtKB/TrEMBL:C5DQS8"
                     /translation="MLGRPTLISSAPAAIRCRPSRAFAPQIAYTSASIDGSEIHESKN
                     DSRSVKEDTPEEQEWFMKQQDSKDFTLGW"
     gene            complement(<218864..>220054)
                     /locus_tag="ZYRO0B02706g"
                     /db_xref="GeneID:8202212"
     mRNA            complement(<218864..>220054)
                     /locus_tag="ZYRO0B02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495028.1"
                     /db_xref="GeneID:8202212"
     CDS             complement(218864..220054)
                     /locus_tag="ZYRO0B02706g"
                     /note="weakly similar to uniprot|P80667 Saccharomyces
                     cerevisiae YLR191W PEX13 Integral peroxisomal membrane
                     receptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495073.1"
                     /db_xref="GeneID:8202212"
                     /db_xref="GOA:C5DQS9"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="UniProtKB/TrEMBL:C5DQS9"
                     /translation="MSANSKPRPKPWETHPPLDSQESGLDNSSLAKMNSETGNNDMHN
                     GENSQEPPPRPAELASDPYTSSNPLYNNGSPYGVSNGIGGGMYGNSMYGGGGGYGSMY
                     GGGLGSMYGGGLGSMHGGGYGGYGSMYGGGYGGYGGGYMNNGPGGPGGLGESTQATFQ
                     LIESLIGTVTGFAQMLESTYMATHSSFFSMVSVAEQFSYLKEVLGSFFGIFALMKFVR
                     RILFYVTKGRMGTPAPSRAIKNGTNSEMVNEFHNFKKDENSKKIKKISWKPLIFFLAA
                     VFGFPYALNKFITRVQSMQRGKIGTKQMGAEVDPSKLEFARALYDFTPENPQIEAPLK
                     KGELMAIITKQHPSGNNSEWWKVRTKTGNMGYVPFNYVEIIKRQKRIEDIPEKDMGSL
                     QKQI"
     gene            complement(<220732..>222366)
                     /locus_tag="ZYRO0B02728g"
                     /db_xref="GeneID:8202213"
     mRNA            complement(<220732..>222366)
                     /locus_tag="ZYRO0B02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495029.1"
                     /db_xref="GeneID:8202213"
     CDS             complement(220732..222366)
                     /locus_tag="ZYRO0B02728g"
                     /note="some similarities with uniprot|Q06324 Saccharomyces
                     cerevisiae YLR190W MMR1 Phosphorylated protein of the
                     mitochondrial outer membrane localizes only to
                     mitochondria of the bud interacts with Myo2p to mediate
                     mitochondrial distribution to buds mRNA is targeted to the
                     bud via the transport system involving She2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495074.1"
                     /db_xref="GeneID:8202213"
                     /db_xref="InterPro:IPR013712"
                     /db_xref="UniProtKB/TrEMBL:C5DQT0"
                     /translation="MNSPTLRPEQLSPKLSPMTFSLDDPNNTSSSVNNFHHLLASPTK
                     ISLDGSSNGNNSSGAGNSLIYRTSLSKLSELSRRGRSRQRSNSDTFRAASPTRLQFFS
                     NAPKMLKPEYVSQQPSGMPLLSALIGNGTTGSHTSRLGIKETLEMFHRGLSNDSCPPQ
                     EQEKQQRQRHAQQSQSQPSQQSNGSDRQSSEATLNEEADKQFRFQGETDNNNNNSNNN
                     NNSNNDNHANESNNDKLHIQNQNQNQGDITTTATTTTTAADVDGTLKGNPSSPRENPG
                     TRMASNSSVASSTMTVNFNDMSKEMELDSLPTDKNGFVELVDGKSNRCSFISSSSTDI
                     DADWYNHQHIHISEETAKLDYRIKQLEIEIDELKLQNEKLIRSITTSRTVEDKFMLDA
                     LKEIRFSKQKAQRSMERKVEQLERKVENYRKALGTIGDGPLRPQAHPPLPYGQISACL
                     ESPRRQNHKRRIARISSMELRKIEEHSDSSSSPPSSSPASDEDDEAENTFEEQISVDE
                     TMMIPDENDPSNNNIRRIGGLQLNIQLEMQKNNNQN"
     gene            <223474..>223698
                     /locus_tag="ZYRO0B02750g"
                     /db_xref="GeneID:8202214"
     mRNA            <223474..>223698
                     /locus_tag="ZYRO0B02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495030.1"
                     /db_xref="GeneID:8202214"
     CDS             223474..223698
                     /locus_tag="ZYRO0B02750g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495075.1"
                     /db_xref="GeneID:8202214"
                     /db_xref="UniProtKB/TrEMBL:C5DQT1"
                     /translation="MHYTNENLDLRRGKDFKEAYNFSQFNFDTAELNQRYNQLKNVYR
                     FPCREHKSIVQGFHANAKKITRLLSLPIAI"
     gene            <224426..>226135
                     /locus_tag="ZYRO0B02772g"
                     /db_xref="GeneID:8202215"
     mRNA            <224426..>226135
                     /locus_tag="ZYRO0B02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495031.1"
                     /db_xref="GeneID:8202215"
     CDS             224426..226135
                     /locus_tag="ZYRO0B02772g"
                     /note="highly similar to uniprot|P00927 Saccharomyces
                     cerevisiae YER086W ILV1 Threonine deaminase catalyzes the
                     first step in isoleucine biosynthesis expression is under
                     general amino acid control ILV1 locus exhibits highly
                     positioned nucleosomes whose organization is independent
                     of known ILV1 regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495076.1"
                     /db_xref="GeneID:8202215"
                     /db_xref="GOA:C5DQT2"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005787"
                     /db_xref="UniProtKB/TrEMBL:C5DQT2"
                     /translation="MFVRSLKSMSHSGTIARCGSLQLRAQIHNHNLSPNLVKMHSELK
                     LDELQTDNTPDYVRLVLRSPVYDVIDETPVNTAVGLSSRLNTNVQLKREDLLPVFSFK
                     LRGAYNMIAKLDENQKNQGVIACSAGNHAQGVAYAARHMNIPATIVMPVSTPSIKYQN
                     VSRLGSQVVLYGNDFDEAKAECAKLAEERGLTNIPPFDHPYVIAGQGTVAMEILRQVH
                     NSLKIGAVFVPVGGGGLIAGIGAYLKRIAPHIKIVGVETHDAPTLSASMKTGKRELLK
                     TVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTDEICAAVKDIFEDTRSIIEPSGAL
                     SVAGMKKYITQIHPEIDHSKHTYVPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTI
                     PDVPGSFKKLQKVIHPRNVTEFSYRYNEHRHESSSEVPKAYIYTSFSVVDREKEIKQV
                     MQQIHSLGFEAVDISENEMAKSHGRYLVGGASKVPNERVVSFEFPERPGALTKFLLGL
                     GESWNLTLFHYRNHGADLGKVLVGISVPPRENLTFQKFLDDLGYKYAEEGDNAVYQKL
                     LKY"
     gene            <226321..>228015
                     /locus_tag="ZYRO0B02794g"
                     /db_xref="GeneID:8202216"
     mRNA            <226321..>228015
                     /locus_tag="ZYRO0B02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495032.1"
                     /db_xref="GeneID:8202216"
     CDS             226321..228015
                     /locus_tag="ZYRO0B02794g"
                     /note="similar to uniprot|P39965 Saccharomyces cerevisiae
                     YER087W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495077.1"
                     /db_xref="GeneID:8202216"
                     /db_xref="GOA:C5DQT3"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:C5DQT3"
                     /translation="MLRPKVLLRYSHHVFQPKTALDDSIKALPTHELFQTLGFIRQSQ
                     SGLVHWLPMGLRTLNKVESIVRHRMNQDGDALEVSLSALSPRSLWEKTNRWSGTELFK
                     LKDAKKASYCLTPTCEEDITNLMNEYITSYRDMPTTVYQITRKYRDELRPRGGLLRGR
                     EFLMKDAYSFASNEEEALQTFQKMNAVYNKIFQDLKIPFVSAWADTGDIGGDLSKEYH
                     YLHEGGEDTLLTCDQCGDVSNVEKCESFPDEVGLHSGDVNVKYALSKDHSTLICYYYP
                     STRQFSWNLAMDAMEGDVDVNLKNESNEKVLKVFERPDDEIMFSKILRVMDCRLNSRS
                     NFPDFPLQKYLKNNFGQLNEVSLVAAEAGEICGSCEEGHLRGDKSIEVGHTFHLGTKY
                     SEAMGSKFTDSNNNSNSIPQMGCYGIGISRLVGAIAEVARDSKGFKWPTSVSPYLMSI
                     CGKNEQLVQETRQTIESPDVLSQFNSKLGLGARIKLSHALGIPLAIIVGPKSWPKVEV
                     EVRGQRWNGNETWKQSYETHKDEYDWQIIVTDDGTEKHLVPIENLSKICNILLEDL"
     gene            complement(<228106..>228429)
                     /locus_tag="ZYRO0B02816g"
                     /db_xref="GeneID:8202217"
     mRNA            complement(<228106..>228429)
                     /locus_tag="ZYRO0B02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495033.1"
                     /db_xref="GeneID:8202217"
     CDS             complement(228106..228429)
                     /locus_tag="ZYRO0B02816g"
                     /note="highly similar to uniprot|P52871 Saccharomyces
                     cerevisiae YER019C-A SBH2 Ssh1p-Sss1p-Sbh2p complex
                     component involved in protein translocation into the
                     endoplasmic reticulum homologous to Sbh1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495078.1"
                     /db_xref="GeneID:8202217"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:C5DQT4"
                     /translation="MNTNYNNNIYPLNQLRSIMSAATPPGGQRTLQKRRQAQNAKEKQ
                     LKQTPASTRQAGHGGSSNSILKVYTDEANGLRVDPLVVLFLAVGFIFSVVALHVVAKV
                     TGKIF"
     gene            complement(228556..228627)
                     /locus_tag="ZYRO0B02838r"
                     /db_xref="GeneID:8202218"
     tRNA            complement(228556..228627)
                     /locus_tag="ZYRO0B02838r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (CTG) cove score=64.54"
                     /db_xref="GeneID:8202218"
     gene            <229241..>231307
                     /locus_tag="ZYRO0B02860g"
                     /db_xref="GeneID:8202219"
     mRNA            <229241..>231307
                     /locus_tag="ZYRO0B02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495034.1"
                     /db_xref="GeneID:8202219"
     CDS             229241..231307
                     /locus_tag="ZYRO0B02860g"
                     /note="weakly similar to uniprot|P34217 Saccharomyces
                     cerevisiae YBL051C PIN4 Protein involved in G2/M phase
                     progression and response to DNA damage interacts with
                     Rad53p contains an RNA recognition motif a nuclear
                     localization signal and several SQ/TQ cluster domains
                     hyperphosphorylated in response to DNA damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495079.1"
                     /db_xref="GeneID:8202219"
                     /db_xref="GOA:C5DQT5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DQT5"
                     /translation="MSEMEGTGSINNTNTTNTAVEQQQKQQQQQQQRIDVSVKDTKSS
                     TQQQQEEDVIPTAIVIKNIPFAIKKEQLLDVIAKMELPLPYAFNYHFDNGVFRGLAFA
                     NFTNTDETTKVLTSLNGKEIGGRKLRVEYKKMLPQAERERIEREKREKRGQLEEQHKS
                     LSNLSLHSLGQKPNHIFPNFMNENAGAANAAPPAANTASNTPLSNNQVLLSAQSTATS
                     FYQQPGVGIPTRERPTQIPPPPTPQQQQSQQQQQRHPFMQANPNNLGGAPTGGLERYY
                     APLPSSSTLPLPPQQLDFNDPDTLEIYSQLLLFKDRERFYYELAYPVGLSATHKRIIN
                     VLCSFLGLVEVYDPTFIIIRKKLLDRATLQSHLQQQGQVTMSHPLQPSSTGGSMNRSQ
                     SYTSLLQAHAAASVAAAANNGGADATGPNPAAAGSNTPLPSGSASTTPKLQNHTQMPS
                     LSNSGQVPNPSSAAAAAAAAAAAATGAAGSTQGVTLSPSQLLQPIALHQSDSQQQSTP
                     QQQQQSFLRQQAALTPSSRIPSGYSSNHTQLSSVNPLLRSSNGISPPSGNIQPNTPQH
                     RMPPSYYGQPSNLQGGENGPTTAAGGAQLMGPQHTNGSLHSNFSTNSFSENPIGANTG
                     STNDFNPTSNLNGPEMVYTSLGNTGLGNGLEEGLSRSLSGLDLQSNSANNLGNYGANT
                     ARKPIW"
     gene            <232092..>234404
                     /locus_tag="ZYRO0B02882g"
                     /db_xref="GeneID:8202220"
     mRNA            <232092..>234404
                     /locus_tag="ZYRO0B02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495035.1"
                     /db_xref="GeneID:8202220"
     CDS             232092..234404
                     /locus_tag="ZYRO0B02882g"
                     /note="similar to gnl|GLV|KLLA0E20009g Kluyveromyces
                     lactis KLLA0E20009g and weakly similar to YBL052C
                     uniprot|P34218 Saccharomyces cerevisiae YBL052C SAS3
                     Histone acetyltransferase catalytic subunit of NuA3
                     complex that acetylates histone H3 involved in
                     transcriptional silencing homolog of the mammalian MOZ
                     proto-oncogene sas3 gcn5 double mutation confers
                     lethality"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495080.1"
                     /db_xref="GeneID:8202220"
                     /db_xref="GOA:C5DQT6"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DQT6"
                     /translation="MRKGMIDRKKINGDRNGLVHHRANSKNRMLKELELTDNIYSKLA
                     SDIKDHPDDIRIKRGSAALERDLDFWKMPETLEDANSLNPNVQFLSSNDNPSKDVDYK
                     YGKISIRYQPLKLLNFQRLLSDSTPVNSSDWNSERYSHDFDIYESEDLINMLDNDSTI
                     PYRSAIAQKKDYSTTRTIPSIKDREFFQNLLTQSSTARYFDANVFLADHDDEGDVLTT
                     NTKPTKRRFRKNVDRKDARTNSIEYIYLRDFEIKTWYTTPYPEEYNRNKILYVCEYCL
                     KYMNSRYIYHRHELKCTHFRPPGNEIYRDGKISVWEIDGRENVIYCQNLCLLAKLFLN
                     SKTLYYDVEPFIFYVLTEREDVGTGIPKFHLVGYFSKEKLNSTDYNLSCILTLPIYQR
                     KGYGHFLMEFSYLLSRREFKWGTPEKPLSDLGLLSYRNYWKVKCAQVLVDLKILLQNS
                     DFSNLQISLVEMSNLTGMIPTDVVFGLEQLKVLVRRTKSDGKVQYAIKIDSWQRIEKI
                     CQNWNTKDYCKLDPSKLVWKPMIFGPSCGVNAVGTMVETTTGATRNTSGINDHQEDFF
                     KKSMSMLVNFMKDDIGDPRSMEVAARQKIIDRINIKHDDDNYGSNLREIGNWELCYEE
                     PHLQVNGNTNHVKSKWNGNSKQDLRTTNQGLVEDDLQYQSIDDASKPTGDDNGDDYSE
                     KGEESFHSALEEEEDNDDGDVDVDEEDAEAVEDDDDDDDDNDDDDDDEEDEEIMSTRR
                     SHRLRHLRESQSQPIRHHLRGRATSYDKDI"
     gene            complement(<234682..>236775)
                     /locus_tag="ZYRO0B02904g"
                     /db_xref="GeneID:8202221"
     mRNA            complement(<234682..>236775)
                     /locus_tag="ZYRO0B02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495036.1"
                     /db_xref="GeneID:8202221"
     CDS             complement(234682..236775)
                     /locus_tag="ZYRO0B02904g"
                     /note="weakly similar to uniprot|P40059 Saccharomyces
                     cerevisiae YER088C DOT6 Protein of unknown function
                     involved in telomeric gene silencing and filamentation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495081.1"
                     /db_xref="GeneID:8202221"
                     /db_xref="GOA:C5DQT7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C5DQT7"
                     /translation="MTVSKSAIPSLPSANLSIVSSHPHPPLRSHHLKNQSTVSTSVTK
                     ATVDTTSTASNTGSQPVSDGKSDTMAVRELAAATSSAAHSSNGSSESGSPGPDTKSLS
                     SSAKNPSSWDPQDDILLRHLKEIRKLGWKDISQYFNNRTPNACQFRWRRLKSGNLKTT
                     KSSSETDSMAAGVQMDDSNSSPAVAAAAAAAAAAAATAALNASPQVKQEDRLSPAIPI
                     PNGSGSFDLNSANSHTINFGQSPCSQSPFSGVQYTNSTPLNNFHNSNNHTSHENDNGA
                     GSNHQRMRSHSHSFSKPFNNTNNITAVSGKDEHGTSEDENIGFIPKIIVRSRRNSFVH
                     PQSVPSVASQQHHQQQPSLSQSLQQTPSHLSSAFNTTLNTTKSRKNSFASRSRRSSFS
                     VAGSTTPSRRSSIIAAPNSLSGMFGSQTGSSTPKLVRRDSVVKKEFYPHRSASVSASF
                     MDLPPAAASIAPPTHRRLSRTHCKPSLSNQFQQHKWQQPPQLPQYQQHYQTQNNSNGN
                     SQSNNVQRWSTDEDQLLSENSSRNLSLMELSILLPNRSEQEIQWRLDTMFSEKSLTAS
                     NEHSQSPLNSPRKSVTPEDTAIDEDTCDERDQADDDDDEMDNMSIEQVDEDSPPTFTS
                     KEATPASIISSTTTKEEDLSDGSSSRSRNRSEDMAKNTLENNCLPPNGASKPSAYSTT
                     ATTLPSINSILKGTL"
     gene            <237794..>238921
                     /locus_tag="ZYRO0B02926g"
                     /db_xref="GeneID:8202222"
     mRNA            <237794..>238921
                     /locus_tag="ZYRO0B02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495037.1"
                     /db_xref="GeneID:8202222"
     CDS             237794..238921
                     /locus_tag="ZYRO0B02926g"
                     /note="similar to uniprot|P34220 Saccharomyces cerevisiae
                     YBL055C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495082.1"
                     /db_xref="GeneID:8202222"
                     /db_xref="GOA:C5DQT8"
                     /db_xref="InterPro:IPR001130"
                     /db_xref="UniProtKB/TrEMBL:C5DQT8"
                     /translation="MAWKMCKKYYDIGLNLTDGMFQGVYNGKKYHSSDIVQVLNRASK
                     IGVKEALLTGSSIVESQQAAQLAHQYSTEELQLGYTVGVHPCCANEFAQYDATIGNPS
                     NDEESNERIAVKVKENPSIAHKKLDELYRLTKDSLSDGRFRAIGEIGLDYDRLFYASR
                     EMQLMFFEEQLKLSCLVGQHLPLFLHMRTSCSDFINIMQKFINGFQDHEDRFSWSQRC
                     NVEKPIRYQFLPDRKFVTHSFTGTPQELTQLLSISPNSFVGLNGCSLRNEENMQCCKD
                     VPLERLLLETDAPWCDIRRTHESYKYLNNYEIPFKSVKKDKLSKLENIEDTMVKGRNE
                     PCTMEQVARVVASAKGLDLSLVVDRVWENSINVYGNTTGNK"
     gene            complement(<239193..>240614)
                     /locus_tag="ZYRO0B02948g"
                     /db_xref="GeneID:8202223"
     mRNA            complement(<239193..>240614)
                     /locus_tag="ZYRO0B02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495038.1"
                     /db_xref="GeneID:8202223"
     CDS             complement(239193..240614)
                     /locus_tag="ZYRO0B02948g"
                     /note="similar to uniprot|P34221 Saccharomyces cerevisiae
                     YBL056W PTC3 Type 2C protein phosphatase dephosphorylates
                     Hog1p (see also Ptc2p) to limit maximal kinase activity
                     induced by osmotic stress dephosphorylates T169
                     phosphorylated Cdc28p (see also Ptc2p) role in DNA
                     checkpoint inactivation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495083.1"
                     /db_xref="GeneID:8202223"
                     /db_xref="GOA:C5DQT9"
                     /db_xref="InterPro:IPR000222"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:C5DQT9"
                     /translation="MGQILSNPVIDKEHHTGEDQLTGFGLCAMQGWRMSMEDAHVVQL
                     NIAGKNVKDHIAFYSIFDGHGGASVAQFCGEKIGSILQKQPTFDKGQLGQSLIDTYLT
                     ADEDLLKDPVLRNDYSGCTATSILVSQEQQLVVCANAGDSRTVLSTDGRAKALSYDHK
                     PTLASERSRIVAAKGFVEMDRVNGNLALSRAIGDFEFKSNQELPPQEQIVTAFPDIME
                     HKLNYDKDEFVILACDGIWDCLSSQECVDLVHYGINQKKYSLNDISSRIIDVCCSPTT
                     EGTGIGCDNMSITIVALLKPGENLGKWFERIRSKKHQTPVSFESKRRSIFTYYQFPKE
                     DANVFEVTTKRPQDRFTQESVQDLGEDNMEIDDESNEVKRQAASSSGESGGNGPVDLF
                     SLEALLGAGGIQISQGPNNVSYIHGSALSDMLSSLSNAAAGEMVPEDEEDESNNDKGA
                     RNEDSKDKKDDESGGKKIEEVKE"
     gene            <241766..>243280
                     /locus_tag="ZYRO0B02970g"
                     /db_xref="GeneID:8202224"
     mRNA            <241766..>243280
                     /locus_tag="ZYRO0B02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495039.1"
                     /db_xref="GeneID:8202224"
     CDS             241766..243280
                     /locus_tag="ZYRO0B02970g"
                     /note="highly similar to uniprot|P00899 Saccharomyces
                     cerevisiae YER090W TRP2 anthranilate synthase Component I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495084.1"
                     /db_xref="GeneID:8202224"
                     /db_xref="GOA:C5DQU0"
                     /db_xref="InterPro:IPR005256"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR019999"
                     /db_xref="UniProtKB/TrEMBL:C5DQU0"
                     /translation="MPSITIQPEIDTLKELRSQNDDSVNMYPVYAFLPSLDLTPHVAY
                     LKLSHLNDPKRSESFLLESATGDELGRYSFIGISPHKIIKTGPTEGLEVDPLIILEQE
                     MSHHKLAENIPGLPKLSGGAVGYISYDCIRYFEPRTNRPLKDVLKVPEAYLMMCNTII
                     AFDHVFQRIQIIHNIDTRETSLEEGFQAASGLITDIAKVLADTQSPIPYPEQPPIKLN
                     QTFTSNVGQKGYENHVSTLKKHIKCGDIFQAVPSQRVARPTSLHPFNVYRQLRTVNPS
                     PYLFYIDCLDFQIIGASPELLCQSDKKNKVITHPIAGTVKRGATIEEDDQLSDQLSGS
                     LKDRAEHIMLVDLARNDINRICQPTTTKVDKLLTVQRFSHVQHLVSQVSGTLRPEKNR
                     FDAFRSVFPAGTVSGAPKVRAMELVGELEGEKRAIYAGAVGNWSYDGKTMDTCIALRT
                     MVYKDNICYLQAGGGIVYDSDEYEEYIETMNKMMANNATVVKAEEYWARKVGTI"
     gene            <243503..>244138
                     /locus_tag="ZYRO0B02992g"
                     /db_xref="GeneID:8202225"
     mRNA            <243503..>244138
                     /locus_tag="ZYRO0B02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495040.1"
                     /db_xref="GeneID:8202225"
     CDS             243503..244138
                     /locus_tag="ZYRO0B02992g"
                     /note="similar to uniprot|P34222 Saccharomyces cerevisiae
                     YBL057C PTH2 mitochondrially-localized peptidyl-tRNA
                     hydrolase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495085.1"
                     /db_xref="GeneID:8202225"
                     /db_xref="GOA:C5DQU1"
                     /db_xref="InterPro:IPR002833"
                     /db_xref="InterPro:IPR023476"
                     /db_xref="UniProtKB/TrEMBL:C5DQU1"
                     /translation="MLTETMNHLNANFSVYFAVAAASLAAGYYLGQILPSASKKEHVQ
                     EILRQCKQRAESEDDDIEESDEEEEEEDSDEDYEIDSVSLNDVPGEVRMALVIRQDLG
                     MQKGKTAAQCAHAALGCFRMIACDPNRKSYNPSMVNRWLRGGQAKITLKCPDESTMDE
                     LYALAIALGVNACVIHDAGRTQIAAGSATVLGLGPAPKAVLDQITGELKLY"
     gene            complement(<244268..>245473)
                     /locus_tag="ZYRO0B03014g"
                     /db_xref="GeneID:8202226"
     mRNA            complement(<244268..>245473)
                     /locus_tag="ZYRO0B03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495041.1"
                     /db_xref="GeneID:8202226"
     CDS             complement(244268..245473)
                     /locus_tag="ZYRO0B03014g"
                     /note="similar to uniprot|P34223 Saccharomyces cerevisiae
                     YBL058W SHP1 UBX (ubiquitin regulatory X)
                     domain-containing protein that regulates Glc7p phosphatase
                     activity and interacts with Cdc48p interacts with
                     ubiquitylated proteins in vivo and is required for
                     degradation of a ubiquitylated model substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495086.1"
                     /db_xref="GeneID:8202226"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR012989"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DQU2"
                     /translation="MSGVPDENIQQFMALANCPFNTAQEYLQEFGDLGEALNAYYAAE
                     ADSEGGKRAKASDLSGNPPTYESATSSQHRPSSQGQQESLSRPSSSSPVGQKKEKPKF
                     MSFSDMVKDQGDDNEDDENRNTFAGGETSGLEVADPNDPNSLIKDLLEKAKKGGQQVE
                     QESDAEQPKPKPKNFTGKGYRLGSIVDAPNQVVENIPKESAPEKPRKVTRTITFWREG
                     FQVGEGPLYRYDDPANSFYLNELNQGRAPLKLLDVEFGQEVDVNVYKKLDESYKPPKR
                     KLGGFQGQGQRLGSPVPGDSNASSVEPVKIPESPAETKEEKDTHKSDSPRGDSSVQIR
                     YANGKREVLRCNSTDTVQFLYDHVRSNTTDSRAFSLNHAFPVKPIEEYQSTLKDAGLV
                     NAVVVQRWV"
     gene            complement(<245870..>248173)
                     /locus_tag="ZYRO0B03036g"
                     /db_xref="GeneID:8202227"
     mRNA            complement(<245870..>248173)
                     /locus_tag="ZYRO0B03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495042.1"
                     /db_xref="GeneID:8202227"
     CDS             complement(245870..248173)
                     /locus_tag="ZYRO0B03036g"
                     /note="highly similar to uniprot|P05694 Saccharomyces
                     cerevisiae YER091C MET6 Cobalamin-independent methionine
                     synthase involved in amino acid biosynthesis also called
                     N5-methyltetrahydrofolate homocysteine methyltransferase
                     or 5-methyltetrahydropteroyltriglutamate homocysteine
                     methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495087.1"
                     /db_xref="GeneID:8202227"
                     /db_xref="GOA:C5DQU3"
                     /db_xref="InterPro:IPR002629"
                     /db_xref="InterPro:IPR006276"
                     /db_xref="InterPro:IPR013215"
                     /db_xref="UniProtKB/TrEMBL:C5DQU3"
                     /translation="MVQSAVLGFPRIGPNRELKKITESYWKGKASVDELLKVGKDIRV
                     ANWKLQKDAGVDIIPSNDFSYYDQVLDLSLLFNVVPERYTKYDLPLLDTMFAMGRGLQ
                     RKATETSKAVDVTALEMVKWFDSNYHYVRPTFSHSTEFKLNGQKPVDEYLEAKELGIQ
                     TRPVLLGPVSFLLLGKADKGSLDLEPLSLLEQLLPLYKEILSKLQAAGATEVQLDEPV
                     LVLDLEKSAQDAIRKAYEYLGKQSGLPKITLATYFGTTLPNLDSLKNLPIGGLHFDFV
                     RGPEQFDKVLDIVNKDQTLSVGIVDGRNIWKNNFAKSSELVNKAVAKLGSDRVVVATS
                     SSLLHTPVDLENEPKLDPEIKDWFSFATQKVKEVVIITKNVAGEDVEAELEANAKSVA
                     TRAASKRTNDEAVQKRVASINEKLSTRLAPFAQRLAEQKKVFNLPIFPTTTIGSFPQT
                     KDIRINRNKFVKGTISAEEYEKFINSEIESVIRFQEEVGLDVLVHGEPERNDMVQYFG
                     EQIQGYTFTVNGWVQSYGSRYVRPPIIVGDLSRPEAMSVKESVYAQSITTKPVKGMLT
                     GPVTCLRWSFPRDDVDQQTQALQLALALRDEVNDLEAAGIKVIQVDEPAIREGLPLRA
                     GEERSAYLKWAAQAFRVATSGVQNKTQIHSHFCYSDLDPNHIKALDADVVSIEFSKKD
                     DPHYIAEFKEYPNHIGLGLFDIHSPRVPSKEEFISKIENILKSYPADKFWVNPDCGLK
                     TRDWEETRASLTNMVAAAKHFREQHKK"
     gene            <249023..>249373
                     /locus_tag="ZYRO0B03058g"
                     /db_xref="GeneID:8202228"
     mRNA            <249023..>249373
                     /locus_tag="ZYRO0B03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495043.1"
                     /db_xref="GeneID:8202228"
     CDS             249023..249373
                     /locus_tag="ZYRO0B03058g"
                     /note="similar to uniprot|P40060 Saccharomyces cerevisiae
                     YER092W IES5 Protein that associates with the INO80
                     chromatin remodeling complex under low-salt conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495088.1"
                     /db_xref="GeneID:8202228"
                     /db_xref="GOA:C5DQU4"
                     /db_xref="InterPro:IPR020366"
                     /db_xref="UniProtKB/TrEMBL:C5DQU4"
                     /translation="MGKPTGSSETDYKKVLSRNDELVKQETTLKKEYTTLLRKISSIC
                     SVLDQLEGETAETPGLISNRSLKRVPGFQWHNDQINLLEKLSQENQEITIPTELIDSY
                     KLYKDTPLLHRDVQ"
     gene            complement(<249416..>253600)
                     /locus_tag="ZYRO0B03080g"
                     /db_xref="GeneID:8202229"
     mRNA            complement(<249416..>253600)
                     /locus_tag="ZYRO0B03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495044.1"
                     /db_xref="GeneID:8202229"
     CDS             complement(249416..253600)
                     /locus_tag="ZYRO0B03080g"
                     /note="similar to uniprot|P40061 Saccharomyces cerevisiae
                     YER093C TSC11 Binding Protein of TOR Protein required for
                     cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495089.1"
                     /db_xref="GeneID:8202229"
                     /db_xref="GOA:C5DQU5"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR028267"
                     /db_xref="InterPro:IPR028268"
                     /db_xref="InterPro:IPR029451"
                     /db_xref="InterPro:IPR029452"
                     /db_xref="InterPro:IPR029453"
                     /db_xref="UniProtKB/TrEMBL:C5DQU5"
                     /translation="MMNTVPDSLSISSPKDDEGRSRSSTLNTLPTDGSNPTLNGSSSS
                     SGLHHINTNQTISSSNNNSKKQRQKLVLSTSFLSTKRLDNVPPSPASPLQGKRPTTSL
                     NKALQGLKTEINQLQQQLSETRRSKEEAEHIRDSTGSEIYSGAYSTDHLQKHSMRIKA
                     NTQIRELDKFIKKMEKKIADLKLQFEHTKRSRELYCVRDHPRSLPREDIPVGLRSPQE
                     SVKEHSLEQTLMAHDSPVPQEDNFTLRSSHDQHETTLSDDHSSEVPTESDEDEPNAKN
                     IETATWLVSGYMQSLQDKNSPADFVLKKSNGLVTLLKQHPEIRGNLLLDSFIYTIQAM
                     LLNEDRVVVSCGYRICRYLIDGEEFIQEMLRLHIDVCLIMSFAKDFSFQMEREQALRL
                     VRTFLEHRAGITLGIVQAVISCVEKQEDPLRNMAIETLLEFCFVCPEVVSECHGMRVL
                     EGILQDPPFPMASIILDTILQLMSMHATRVHFLNDFDISVLVTSFSDTNTKSALNVEK
                     MQNTCLLITKALKDYNGFMLFSMDNFKPLKELLSFFQVPMCAQYLIDIFLDVLRIKQL
                     SYDKNRAHFKQVSLHFSRESMLINQHIALLILMMYHSNFGGQIWALIDQKKDQGVSST
                     LISKGRLLLAEYINLAANLLDVNVFDVKGLPPTWEPLIYDETYQFGKLTYTMNRNRNK
                     LGVAGIDYGKPVKSFLQNMTVGTLNREVDDIKFRKMVFDSRVLQTKEFNLWNWNVIQE
                     LLEGPLLNDKHLDELARSTKFIRRLLIFYRPLRMRFANVNRGSRLSQRYVQAGCQFFH
                     MLTSSTVGMRIFMDDTKIIPQLASLLFRAMEGHTVGNIFNLRLLSSKMVVGYFKFIGV
                     LTQSGNGIAVLTRWNFFTVIYKMFQPKSKISSTFLLLTLPELDLRYSRHCRTIMSKAL
                     VNSDKHTRIKATEYLGEKLKSLSCLDDTATQDSETSKDNDLLRRYIVEMLTRQLYDLS
                     PQVVAIADQALYEYVVKNESSHKLGSSLHTSLNQLVFIRSPIIFELLGTKNGFQLLNE
                     INFVQEERKSWLATKNKEYVFLVENFLDYNQHGTFSNSSRRMTGIDRLPQHFYESLAK
                     TEDGITLIGQSRDLATFISIIKAFRQTLKYPEDAPVNDIINLKSSLWCVGYIGSTMLG
                     IGLLDEYSVVEDMIQIAYYASITSVRFTALLALGLISKTTEGCEILDEMGWSCCLNVQ
                     GSPMGITFPSRLDKFLSYNEKRWIAQGEYKEPIIEFDTKFGRMLGDIKPINLNLRVLL
                     DEKTMMENPLEDGSLQDLMKTEERFYTKAILNQQRQYSNEEEKIIDEVLTIISQLGNH
                     ILSGNAIKGITELNKKYGSSLFESEIMFYKILDMMAQYRFKPHVRKFLCGLSINKKAL
                     ENVIRVEKRRNSTKQC"
     gene            complement(<253833..>254332)
                     /locus_tag="ZYRO0B03102g"
                     /db_xref="GeneID:8202230"
     mRNA            complement(join(<253833..254116,254179..>254332))
                     /locus_tag="ZYRO0B03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495045.1"
                     /db_xref="GeneID:8202230"
     CDS             complement(join(253833..254116,254179..254332))
                     /locus_tag="ZYRO0B03102g"
                     /note="weakly similar to uniprot|P87275 Saccharomyces
                     cerevisiae YER093C-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495090.1"
                     /db_xref="GeneID:8202230"
                     /db_xref="GOA:C5DQU6"
                     /translation="MNNVQFSERQISAFSHEYKIRRKRQMLRFFCATALTLVSCRVAY
                     RGMLGRKYIPNMFQLNYKPPPFSYKGEAASALVLGTGLATGGLTMMVFGGCWIADIST
                     FPEFSYKLKRLMGQESDSSQLPMDTETSQIVNQLEQLLNNDKK"
     gene            <254475..>254783
                     /locus_tag="ZYRO0B03124g"
                     /db_xref="GeneID:8202231"
     mRNA            <254475..>254783
                     /locus_tag="ZYRO0B03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495046.1"
                     /db_xref="GeneID:8202231"
     CDS             254475..254783
                     /locus_tag="ZYRO0B03124g"
                     /note="highly similar to uniprot|Q3E7A4 Saccharomyces
                     cerevisiae YBL059ca"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495091.1"
                     /db_xref="GeneID:8202231"
                     /db_xref="InterPro:IPR013892"
                     /db_xref="UniProtKB/TrEMBL:C5DQU7"
                     /translation="MHPQLEAKRFDSCIDFIQALDQCHQREYYKRMFGLCDIEKEALS
                     KCLHEARKNGEKEQIAIMREKRKALENKWKKMDEEEYGEDLVLKKLLERHSDKLKGSK
                     "
     gene            complement(<254858..>255475)
                     /locus_tag="ZYRO0B03146g"
                     /db_xref="GeneID:8202232"
     mRNA            complement(<254858..>255475)
                     /locus_tag="ZYRO0B03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495047.1"
                     /db_xref="GeneID:8202232"
     CDS             complement(254858..255475)
                     /locus_tag="ZYRO0B03146g"
                     /note="highly similar to uniprot|P25451 Saccharomyces
                     cerevisiae YER094C PUP3 Beta subunit of the 20S proteasome
                     involved in ubiquitin-dependent catabolism human homolog
                     is subunit C10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495092.1"
                     /db_xref="GeneID:8202232"
                     /db_xref="GOA:C5DQU8"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DQU8"
                     /translation="MSDPSTINGGVCVAMTGKDCVAIACDLRLGMQSLGVSNNFEKIF
                     KYGHVFLGLTGLATDVTTLSETFRYKTNLYNLKEDRPIEPETFTQLVSSSLYERRFGP
                     FFVGPIVAGINSKTGKPFIAGFDMIGCIDEAKDFIVSGTASDQLFGMCESLYEPDLEP
                     EDLFETISQSLLNAVDRDALSGWGAVVYIIQKDKAVKKYLRTRQD"
     gene            complement(<255749..>258250)
                     /locus_tag="ZYRO0B03168g"
                     /db_xref="GeneID:8202233"
     mRNA            complement(<255749..>258250)
                     /locus_tag="ZYRO0B03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495048.1"
                     /db_xref="GeneID:8202233"
     CDS             complement(255749..258250)
                     /locus_tag="ZYRO0B03168g"
                     /note="weakly similar to uniprot|P34225 Saccharomyces
                     cerevisiae YBL060W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495093.1"
                     /db_xref="GeneID:8202233"
                     /db_xref="GOA:C5DQU9"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR023394"
                     /translation="MNNLSSQNIGTSLDFQESPGEFEEEEEREEDDSSEISSLPPLTQ
                     VATASPRMIVSPKMQNIHLIIQNEDNDSSEVNTPHEDWHANLGLGIQSQPLRNERNVE
                     EHYRTRAKRQTILWAENQAEEDTMTQERVRAEAELQVKFEGARAKAEARAEAEASSRA
                     GLSTGVNGANRTVEDTKSTGEQDEMTRKTAERERRLRAEKERLLIEEDARKKAVQVKL
                     EKEKEEEEEGKAAAGRTTAAPETPEDQEAQRIAVEIVQGIYKKISHTEYANFLGTKEN
                     HRILKRFIILLEPLPNSLVLSLYKLVTRIYFIAEAQAIDRILEELSIRWTTTNPATHW
                     GSHYNLCHIVLFSLLILNSDLHNAENNQPKFSKEEFTENTLFAVEKESSKSNFDLAQH
                     EPGIREELGVYYEALKYMSLPLLKKDENKTNVRDSRDSKDTRIRIRRRNSKMSTRSQL
                     NNSTENSSSDDDTSVISSSSPSARREPHYTSNWKFHHNKPLPRLYRKEPLDEVFVFSN
                     GTSWCVDSGIKMNERDLASSSNNKSTAQRTTRSRIPSSAGGIFRWITRSKSKSLLHGN
                     KSPVAFFDGNTKWINVRCRVCEGRIYVFKHYPPSMGPQNSMQDLDGMKKASDVYFVCS
                     LYESLATLVQDNVVVNNNHEPSRRGDLDQRGNFTVIIPASLHRKKTLLEFQTSNVEEA
                     QRFVQCVNFWAARLTPVPTAQFEIVSNEENGWSPRVLSGDLPIETLETLYLSDWRPLL
                     SISHLYSEQENSTEETNMVDKIEVLESFAEYLQRTIDSHNTVKPLMISRWRRTRNFER
                     AMDNWNKKYLYLNELNERTSVYLNALQLAQRSVKH"
     gene            <259230..>260528
                     /locus_tag="ZYRO0B03190g"
                     /db_xref="GeneID:8202234"
     mRNA            <259230..>260528
                     /locus_tag="ZYRO0B03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495049.1"
                     /db_xref="GeneID:8202234"
     CDS             259230..260528
                     /locus_tag="ZYRO0B03190g"
                     /note="highly similar to gnl|GLV|YALI0F15477g Yarrowia
                     lipolytica YALI0F15477g and similar to uniprot|P25454
                     Saccharomyces cerevisiae YER095W RAD51 Strand exchange
                     protein forms a helical filament with DNA that searches
                     for homology involved in the recombinational repair of
                     double-strand breaks in DNA during vegetative growth and
                     meiosis homolog of Dmc1p and bacterial RecA protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495094.1"
                     /db_xref="GeneID:8202234"
                     /db_xref="GOA:C5DQV0"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010995"
                     /db_xref="InterPro:IPR011941"
                     /db_xref="InterPro:IPR013632"
                     /db_xref="InterPro:IPR020587"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DQV0"
                     /translation="MSQVHPLQLQHQQLHEQALQESANAASLLSTAPLDPSSMPQSQI
                     DSLNRQSVEPSGGVESLAKDSGATVNASNTNGTASANGNPSIAAEPDSLPPGAQDEQD
                     MEDDMALASFVPLEKLQVNGITTSDLKKLREFGLHTAEAVAYAPRKQLMEIKGISEAK
                     ADRLLNEAARLVPMGFVTAADFHLRRSEMICLTTGSKNLDTLLGGGMETGSITELFGE
                     FRTGKSQLCHTLAVTCQIPLDVGGGEGKCLYIDTEGTFRPVRLVSIAQRFGLDPDDAL
                     NNVAYARAYNADHQIRLLDAAAQMMSESRFSLVVVDSVMALYRTDFSGRGELSARQMH
                     LAKFMRALQRLADQFGVAVVVTNQVVAQVDGGMSFNPDPKKPIGGNIMAHSSTTRLGF
                     RKGKGCQRLCKVVDSPCLPEADCIFAIYEDGVGDPREEDE"
     gene            <260860..>262905
                     /locus_tag="ZYRO0B03212g"
                     /db_xref="GeneID:8202235"
     mRNA            <260860..>262905
                     /locus_tag="ZYRO0B03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495050.1"
                     /db_xref="GeneID:8202235"
     CDS             260860..262905
                     /locus_tag="ZYRO0B03212g"
                     /note="similar to uniprot|P34226 Saccharomyces cerevisiae
                     YBL061C SKT5 Activator of Chs3p (chitin synthase III),
                     recruits Chs3p to the bud neck via interaction with Bni4p;
                     has similarity to Shc1p, which activates Chs3p during
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495095.1"
                     /db_xref="GeneID:8202235"
                     /db_xref="InterPro:IPR006597"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DQV1"
                     /translation="MSSAAAAASASATQAPTGAGAMHPYKRHFLKSQSYVFEDLKDTP
                     SATNSNDDFLSAKHSPSPVLEASDPPAAKSPSPPSPQFQSYDNTKWLQTVGPPPRPTN
                     TRQPSSLSLGSSDEIQGFISSPSDSSSQFHGSAGGTGAGGFHKNKSLSVDLSHLYMVN
                     GSLDTQLTSTNESAADMSHQLVSRYLGPGSNASLVSRLKTIEMYRQNVKKSKDATVLF
                     NYAQYMLQTALTMESSNTLVGSNSDGESMTQAQLKKKFLKEGQHYLKKLSAKGYSDAQ
                     YLLGDAYASGAFGKVENREAFTLFQAAAKHGHVESAYRTAHCFEEGLGTTRDARKALD
                     FLKFSASRNHPSAMYKLGLYSFYGRMGLGTDVNTKQNGIKWLSRASARANDLTCAAPY
                     ELAKIYQKGFLDIVIPDEKYSMELYIQAASLGHVPSSTLLGQIYETGNEVVPQDTSLS
                     IHYYTQAALRGDPVAMLALCAWYLLGAEPAFEKDENEAFQWALKAATAGYPKAQFTLG
                     YFYEKGKGCEPNEAYALKWYEKAAQNKDNRAISKLKSMGQEDRLTVNKKKNHRKSRSI
                     NTIGLFKNLDSDNGSTYSMRNSSSPGLFTNSTSQRELSNSGESGFKVLSDPPTSTAGV
                     GAHRNTQSVPSQPSSSQGKKSEINRFQTQPAALSLPKANNTPADNDKDRKKKDCIVM"
     gene            complement(<263393..>266809)
                     /locus_tag="ZYRO0B03234g"
                     /db_xref="GeneID:8202236"
     mRNA            complement(<263393..>266809)
                     /locus_tag="ZYRO0B03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495051.1"
                     /db_xref="GeneID:8202236"
     CDS             complement(263393..266809)
                     /locus_tag="ZYRO0B03234g"
                     /note="similar to uniprot|P28742 Saccharomyces cerevisiae
                     YBL063W KIP1 Kinesin-related motor protein required for
                     mitotic spindle assembly and chromosome segregation
                     functionally redundant with Cin8p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495096.1"
                     /db_xref="GeneID:8202236"
                     /db_xref="GOA:C5DQV2"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5DQV2"
                     /translation="MLDQGSGSSWKDTGNGKGLSRPSSGHLSSPISSEPHQRHQIGSN
                     IKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSSPLSHPKKTYMFDEVFGAD
                     SDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKILL
                     GEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADNDSDEDNIRIFDN
                     NNSNAHGASNGMSQVKMNKSKVRAPTLSGATVSSSASNSSTSSSSSSSSITVKGMEER
                     YIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSGEQYVKIG
                     KLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYRGSKLT
                     RLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKDSCI
                     MEYIYEIERLRQELKASRQREGMYITQEQYDLYESNSLLVEEQKVVIQNMGEQIKRFK
                     EKYVEQTKLSKEAHRQFQESQKVCDTLRIQKKFMLETFEKYHTTCKEHAAQIDQIHSD
                     NISLIESLRVERNEMSTSALDNAGLISKILTTIAERSEQLTSLKADLEVRISDFERFS
                     SSMLLDFERNALSRINHSRDDLLSLEITDSLEQIQAMHNSLNVTLQNIRKPWKKETEA
                     IYYTHKNIIENCGNQLYEYVEKLENSLETIWNQLKKTSISEMGELRRYGDQYTDDALA
                     LVHKERERLQFLENELLKKSQALKESNEQLESLQSYFKHHLIKERDEILQETFKALRN
                     SERRHKSLDDQMFEKSSVVLARTKEQMHTEYLSGVGGINRQSSDSLTSIDKSLQSFKK
                     EYALLGQQKTEKLDQLVKYRSVKHSFQEFLDKLSKYCNERSSRNLLQLLKNLNSQISW
                     GAESLGNEVKSIVSETRQKIQRSVERDESQLKAALLNLENLSNYISDVCREEAPQHFK
                     EQANILSSHCNNVNSVISGLDGTNEYLSEVNKPKIKIDVDNKITRELPQLESPGDYNV
                     YRNNNDLPKGETWQNEDPLTQNLVYSPSTPMPVPDQPLPKVLVPKSINSSAKRSHTLP
                     IENKKNLTVGGFGPNNLKRRFTLEPPNRNDKENIGDSRTGKKICNSRNEI"
     gene            <268100..>268864
                     /locus_tag="ZYRO0B03256g"
                     /db_xref="GeneID:8202237"
     mRNA            <268100..>268864
                     /locus_tag="ZYRO0B03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495052.1"
                     /db_xref="GeneID:8202237"
     CDS             268100..268864
                     /locus_tag="ZYRO0B03256g"
                     /note="highly similar to gnl|GLV|KLLA0E20383g
                     Kluyveromyces lactis KLLA0E20383g and similar to YBL064C
                     uniprot|P34227 Saccharomyces cerevisiae YBL064C PRX1
                     Mitochondrial peroxiredoxin (1-Cys Prx) with thioredoxin
                     peroxidase activity has a role in reduction of
                     hydroperoxides induced during respiratory growth and under
                     conditions of oxidative stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495097.1"
                     /db_xref="GeneID:8202237"
                     /db_xref="GOA:C5DQV3"
                     /db_xref="InterPro:IPR000866"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR019479"
                     /db_xref="InterPro:IPR024706"
                     /db_xref="UniProtKB/TrEMBL:C5DQV3"
                     /translation="MLTRTLFQTQKAAFKSFAPAFTLPLRTSVRYTSSFRQEDQPRLR
                     IGSTVPNFDANTTFGKINFYDYLGDSWGVFFSHPADFTPVCTTELGAFSKLKPEFDKR
                     NVKLVGLSVEGVPSHNEWIKDIEEISKLNKFGFPVIADENKEVAFLYNMVDEEGFKNL
                     GKGPVSTIRSVFVIDPSKKLRISFTYPPSVGRNSAEVLRVVDALQKTDAKGVVTPIDW
                     QEGQDVIIPPSVSDAEAEKKFGKFETVKPYLRFTKA"
     gene            <269277..>272996
                     /locus_tag="ZYRO0B03278g"
                     /db_xref="GeneID:8202238"
     mRNA            <269277..>272996
                     /locus_tag="ZYRO0B03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495053.1"
                     /db_xref="GeneID:8202238"
     CDS             269277..272996
                     /locus_tag="ZYRO0B03278g"
                     /note="similar to uniprot|P34228 Saccharomyces cerevisiae
                     YBL066C SEF1 Suppressor of Essential Function putative
                     transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495098.1"
                     /db_xref="GeneID:8202238"
                     /db_xref="GOA:C5DQV4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DQV4"
                     /translation="MNYSPQVKGEERQLEKLPLKRSTSHDQTVPLSEGAKKLQRCKSE
                     EVPFPVTTNSNNSTPTPTPNTSSYLNNPPGLSIHHYNTNGNQSSTGHRPVTSCTHCRQ
                     HKIKCNASDNFPAPCLRCERMGLNCQIDPQFRPKKGSQLQNLRRDVDELKLKIEYLTR
                     NESLIARALQQSSMGQELINTLKAIDVTKANELSNTQPAQKLQQRPLRTTPQHDKVSV
                     QTYLGASKPHLLQKDTKDENGNVNNGTGNIYKKDIPLVLQMALQRNRNITGTDSPSNN
                     DNSNIHHNTNTPGSQRASPSMSPMTNSYSGSKRHDTGSTANSQDDVPLSIESDKNTNG
                     NDTNCNDDNDNCDKNGTNHNSEGDNDAYGKKSPVVATTNAIPLLPSPHAGIDEFVIGD
                     VRISIEKANELHEIFVTRYLPHFPIMCTNNETELYSQSQLLFWTVMLTACLSDPEPSM
                     YIQLAALIKQLAIETCWIRTPRSTYITQALLILCIWPLPNQKVLDDCSYRFVGLAKSL
                     SYQLGLHRGEFISEFTRTQTSMPDAEKWRTRTWLGIFFAELCWASVLGLPPTSQTDYL
                     VEDARMGAEEYESPSQVKEETNTFNDNEFQSGNDNLKINDNYDNKHNKTSDNNKKTKL
                     PQNFRRLICLAHFQAKLCKVMGSSVVSPDGLMEPRDRATLLGNLERELERLDRTLNFG
                     RDSAVCIYYLYVKLMVCCFAFLPGTPTTDQSQYVTEAYLCAIKLVTLLVKLLEKQQLI
                     ELPIYIRQSASYAALILFKLQLTPLLSEKYLDSARQSIVTVHRLFRNQLNAWATGVEN
                     DISRTASVLEKLNFVLITHPTVFVEEEGIISRMRSHLTGSLFYDLVWCVHEARRREMD
                     PQYNEDALKKASAKRKALGDDPPFAAFNRRLYPLPFYNHISKEDFETVIQTTPRGTAV
                     STLVPTETALNNAKNLAEKRRNSDGSILEINGIPLSMLDETGSVNLEYVSGSGANANP
                     VNGSTAAVTENGPSTQPMMGNGSSNFADPLTQSLGLETPLVYKAVRRNAGINGSGIQT
                     MPTYLNESNMQRSNSTPVQPTGGEASAAPSPMAVPHSAGSTVPSSFIYQRPGNANSLF
                     NIHNSSFPSSLSRSLAPVQEKDSTDTNSNTILTNNSSGGDRNAGTKVNLDSYPNLNLF
                     LNGNQPVPASTTNPNPTTNPNPNPNTNTNTHGTVNVNGMSNVPVELNGIGRNPINQLS
                     ELDTFFQQQSTGWLEGNSSNDDFLGWFDMDMEQKF"
     gene            <273903..>276344
                     /locus_tag="ZYRO0B03300g"
                     /db_xref="GeneID:8202239"
     mRNA            <273903..>276344
                     /locus_tag="ZYRO0B03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495054.1"
                     /db_xref="GeneID:8202239"
     CDS             273903..276344
                     /locus_tag="ZYRO0B03300g"
                     /note="similar to uniprot|P39967 Saccharomyces cerevisiae
                     YER098W UBP9 Ubiquitin-specific protease that cleaves
                     ubiquitin-protein fusions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495099.1"
                     /db_xref="GeneID:8202239"
                     /db_xref="GOA:C5DQV5"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DQV5"
                     /translation="MLKRWFSVKKKSKEDSNSSQQSGVSNNVDVSNNQSQTPYHTPRM
                     SPESKPIPKPTPIRTKDRNMVTSPGHSNKLQSPAAERPPPGDTHSGNETLPSLLSTSI
                     ETVMDMDPPILFTTSTENMPYGDGSNKVFGFENFGNTCYCNSVLQCLYNMTEFRIQML
                     QHPERNSNTRRKRKVDMPGRKPRFFNEASFDHRPNNNNNNGVSGNAVNTKRDSEGSNN
                     GHHNPVTNEHTQATSANNIKSVEIGNNHESNDQDDTNSSTVNSKSRSASSNYQNSNKP
                     YIEGDKPPPSNGHQPSAKPSRPNEGTNGSTKDTNVPNIVIAGTQPVHATLTSANSCNE
                     KIHENTQKVIVGRNDDLSSHGPAELHPTAASNHKTGGSDIEKHSTVESHDLSSSTAHT
                     AKLTLQRPQSRQSQHSQHLQQHHSSHNNPLSTEQRKKAALIKGPVLNVDHLLHESGES
                     NLYTGLKDIFECITENLALTGVVSPIKFVDILKKENVLFNTTMHQDAHEFLNFLLNEL
                     SDYLNNGAKSGKDDEEHSLNFIKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPD
                     DSETDIQALLQNFDQREMLSGPNKFYCNVCCGLQEAERSVGLKQLPHTLALHLKRFKY
                     SETKNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSGIVVHMGGGPQHGHYVSLCKN
                     DNFGWLLFDDETVESVSEKTVLDFVGDSSTLTTAYVLFYRELPFYLENTSTGLDSKKH
                     YDENIEKLLKYDEWLRANSSKTTSMSETNPAVEATTKEPPMAPPAVPHVEREASTTSV
                     KTARPKSRLFNFMKS"
     gene            complement(<276543..>277520)
                     /locus_tag="ZYRO0B03322g"
                     /db_xref="GeneID:8202240"
     mRNA            complement(<276543..>277520)
                     /locus_tag="ZYRO0B03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495055.1"
                     /db_xref="GeneID:8202240"
     CDS             complement(276543..277520)
                     /locus_tag="ZYRO0B03322g"
                     /note="highly similar to uniprot|P38620 Saccharomyces
                     cerevisiae YER099C PRS2
                     5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase
                     involved in nucleotide histidine and tryptophan
                     biosynthesis one of a five related enzymes which are
                     active as heteromultimeric complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495100.1"
                     /db_xref="GeneID:8202240"
                     /db_xref="GOA:C5DQV6"
                     /db_xref="InterPro:IPR000842"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C5DQV6"
                     /translation="MSSEVEEMSANSIKLLAGNSHPELAEAISRRLGIQLSKVGVYQY
                     SNKETSVTIGESIRDEDVYIIQTGTGQQEINDFLMELLIMIHACKVASVRRVTAVIPN
                     FPYARQDKKDKSRAPITAKLVANLLQTAGCDHVITMDLHASQIQGFFRIPVDNLYAEP
                     SILNYIKTKTDLKNAILVSPDAGGAKRVAALADKLDLYFALIHKERQKANEVSRMVLV
                     GDVKGKSCLLIDDMADTCGTLVKATSTLMDHGAKEVIAIVSHGIFSGDAREKLKNSRL
                     SRIVSTNTVPVDLDSDIYDQIDISPTLAEAIRRLHNGESVSYLFANAPV"
     gene            <278107..>278859
                     /locus_tag="ZYRO0B03344g"
                     /db_xref="GeneID:8202241"
     mRNA            <278107..>278859
                     /locus_tag="ZYRO0B03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495056.1"
                     /db_xref="GeneID:8202241"
     CDS             278107..278859
                     /locus_tag="ZYRO0B03344g"
                     /note="similar to uniprot|P33296 Saccharomyces cerevisiae
                     YER100W UBC6 Ubiquitin-conjugating enzyme involved in
                     ER-associated protein degradation located at the cytosolic
                     side of the ER membrane tail region contains a
                     transmembrane segment at the C-terminus substrate of the
                     ubiquitin-proteasome pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495101.1"
                     /db_xref="GeneID:8202241"
                     /db_xref="GOA:C5DQV7"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:C5DQV7"
                     /translation="MATRQAQKRLAKEFKAMTEDPPPYIMARPNESNILDWHYIITGP
                     PGTPYENGQYHGTLTFPSDYPFQPPAIRMVTPSGRFQENTRLCLSMSDYHPTTWNPGW
                     SVSTILNGLLSFMTSEEGTTGSITTTEQQKKVFCKRSMEYNTYSNLRFKLVFPDIVEE
                     NIKELARRRASGAAQEEASSQNQPDALAAAAKEKAISVEEISDPEDRIRAEQALGEIG
                     GRKKENGSESGSSSMIYIGLAFLLFLLGISMK"
     gene            complement(<278985..>280298)
                     /locus_tag="ZYRO0B03366g"
                     /db_xref="GeneID:8202242"
     mRNA            complement(<278985..>280298)
                     /locus_tag="ZYRO0B03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495057.1"
                     /db_xref="GeneID:8202242"
     CDS             complement(278985..280298)
                     /locus_tag="ZYRO0B03366g"
                     /note="similar to uniprot|P35183 Saccharomyces cerevisiae
                     YBL069W AST1 peripheral membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495102.1"
                     /db_xref="GeneID:8202242"
                     /db_xref="GOA:C5DQV8"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DQV8"
                     /translation="MNSPRAMAQALAQTDPKLEERNHDPKMEEPEAPPREIKTDEVKL
                     KRVARPIRHVKHIPLKSLIFYSKRGPLEFSYDGKIKLPVPKNKLVVEVHYAGLNPVDM
                     KIKNGYQTGIYGAAGLGREFSGVITHVGENIQSEWNEGDEVYGILFHPHQAVGTLQTS
                     ILVDPRTDPIMLKPLSLSMKEASGALYTLGTAYNILDKLQRKGSLQQNSNICIIGGTT
                     SVGMAAIQLLKKHYNVSTLLTVVTRGNGRSVLKKKFPSIAEEIVFINYLTCRGKISGP
                     IKQMIEAGQITDYDDETNEEHTIKYDQGKYDIILDFVGGYDVLAHSNSLIHKGGYYVT
                     TVGDYVANYKEDVYNSVDNPSANMRKAFGSVLWLYNYMHFQFDPSVSASKKSNWMGKC
                     NELLERKTIKVIIDKTYDWKKHTEAISYMNTQRAQGKIILKVEKF"
     gene            complement(<280677..>280925)
                     /locus_tag="ZYRO0B03388g"
                     /db_xref="GeneID:8202243"
     mRNA            complement(<280677..>280925)
                     /locus_tag="ZYRO0B03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495058.1"
                     /db_xref="GeneID:8202243"
     CDS             complement(280677..280925)
                     /locus_tag="ZYRO0B03388g"
                     /note="highly similar to uniprot|Q3E840 Saccharomyces
                     cerevisiae YBL071W-A KTI11 Protein required along with
                     Dph1p Dph2p Jjj3p and Dph5p for synthesis of diphthamide
                     which is a modified histidine residue of translation
                     elongation factor 2 (Eft1p or Eft2p) may act in a complex
                     with Dph1p and Dph2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495103.1"
                     /db_xref="GeneID:8202243"
                     /db_xref="InterPro:IPR007872"
                     /db_xref="UniProtKB/TrEMBL:C5DQV9"
                     /translation="MSTYDQIEIEDMTFDLETRMFSYPCPCGDRFQVYIDDMFDGENI
                     AVCPSCSLMIEVIFEKEDLQEYYEEAGAQPPEPIAVAA"
     gene            <281919..>282527
                     /locus_tag="ZYRO0B03410g"
                     /db_xref="GeneID:8202244"
     mRNA            <281919..>282527
                     /locus_tag="ZYRO0B03410g"
                     /product="40S ribosomal protein S8"
                     /transcript_id="XM_002495059.1"
                     /db_xref="GeneID:8202244"
     CDS             281919..282527
                     /locus_tag="ZYRO0B03410g"
                     /note="highly similar to uniprot|P05754 Saccharomyces
                     cerevisiae YER102W RPS8B protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S8"
                     /protein_id="XP_002495104.1"
                     /db_xref="GeneID:8202244"
                     /db_xref="GOA:C5DQW0"
                     /db_xref="InterPro:IPR001047"
                     /db_xref="InterPro:IPR018283"
                     /db_xref="InterPro:IPR022309"
                     /db_xref="UniProtKB/TrEMBL:C5DQW0"
                     /translation="MGISRDSRHKRSATGAKRAQFRKKRKFELGRQSANTKIGAKRIH
                     TVRVRGGNKKFRALRIETGNFSWASEGVSKKTRIVGVAYHPSNNELVRTNTLTKAAIV
                     QIDATPFKQWFESHYGQTLGKKKGQAKTDEEVVPASKSAQKKWASRASAAKVEQAVDS
                     QFGAGRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
     gene            complement(282730..282829)
                     /gene="SNR56"
                     /locus_tag="ZYRO0B03432r"
                     /db_xref="GeneID:8202245"
     ncRNA           complement(282730..282829)
                     /ncRNA_class="snoRNA"
                     /gene="SNR56"
                     /locus_tag="ZYRO0B03432r"
                     /product="snR56"
                     /note="C/D snoRNA monocistronic SNR56"
                     /transcript_id="XR_002648383.1"
                     /db_xref="GeneID:8202245"
     gene            <283007..>283990
                     /locus_tag="ZYRO0B03454g"
                     /db_xref="GeneID:8202852"
     mRNA            <283007..>283990
                     /locus_tag="ZYRO0B03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495060.1"
                     /db_xref="GeneID:8202852"
     CDS             283007..283990
                     /locus_tag="ZYRO0B03454g"
                     /note="similar to uniprot|P32357 Saccharomyces cerevisiae
                     YBL074C AAR2 Component of the U5 snRNP required for
                     splicing of U3 precursors originally described as a
                     splicing factor specifically required for splicing
                     pre-mRNA of the MATa1 cistron"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495105.1"
                     /db_xref="GeneID:8202852"
                     /db_xref="InterPro:IPR007946"
                     /db_xref="UniProtKB/TrEMBL:C5DQW1"
                     /translation="MNAVLYGSNSPIDVVVGIDNFTFELKAGQPFGGIKNISPGIHVL
                     HWGDDSMRYGYWFDVKNQYQIVYRERFELVPNTSIEYQQEVASHLQFMVTYPREGPWG
                     ELSRYVSLEQAQMITGDSRAYADSSMTSLEESQMLQRTLSQGSMDIPNSDPVFHFHTI
                     KFKSLEAIREDHKAEDFMDKSYYLNQVLLPEHYGNHFDRLLGELQFAFLNVMVFGNYG
                     SSLQWHSIVELISFSSRVNKDTIRRFDGILSLQIDNLQQEYADFLLNPSVWFRVLNDS
                     HQGHNLSLTRRTFSNRGPDLLEDAGQDANDPDQYSDEYEPTVVGGVYYCRQ"
     gene            <284311..>286245
                     /locus_tag="ZYRO0B03476g"
                     /db_xref="GeneID:8202246"
     mRNA            <284311..>286245
                     /locus_tag="ZYRO0B03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495061.1"
                     /db_xref="GeneID:8202246"
     CDS             284311..286245
                     /locus_tag="ZYRO0B03476g"
                     /note="highly similar to uniprot|P09435 Saccharomyces
                     cerevisiae YBL075C SSA3 heat-inducible cytosolic member of
                     the 70 kDa heat shock protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495106.1"
                     /db_xref="GeneID:8202246"
                     /db_xref="GOA:C5DQW2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DQW2"
                     /translation="MTRAVGIDLGTTYSCVAHFQNDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDSAKNQAAINPRNTVFDAKRLIGRKFEDPEVVNDAKHFPFQVIEKDGKPHIK
                     VEYKGEEKTFTPEEISSMVLGKMKETAENYLGGEVKDAVVTVPAYFNDSQRQATKDAG
                     VIAGMNVLRIINEPTAAAIAYGLDKKHVGEQNILIFDLGGGTFDVSLLTIDEGIFEVK
                     ATAGDTHLGGEDFDNRLVNHLANEFKRKNKKDLMGNQRSLRRLRTAAERAKRALSSAT
                     QTSVEIDSLYEGIDFYTSVTRARFEELCADMFRSTMDPVEKVLTDAKVDKSQVHEIVL
                     VGGSTRIPRIQKLITGFFNGKEPSKSINPDEAVAYGAAVQAAILTGDESSKTQDLLLL
                     DVAPLSLGIETAGGIMTKLIPRNSTIPTKKSETFSTYSDNQPGVLIQVYEGERTKTKD
                     NNLLGKFELTGIPPAPRGVPQIEVTFDVDANGILNVSANEKGTGKTNKITITNDKGRL
                     SKEDIERMVSEAEKYKADDEKEANRVQAKNQLESYAFSLRGSASEANFKEKVGAEEAS
                     KVENAAKETIDWLDSSQSASQDEYEDKQKELEGIANPIMSKFYGAGGAPGGAEAPGGG
                     AAPGGDAGAGGEGPTVEEVD"
     gene            <286640..>289855
                     /locus_tag="ZYRO0B03498g"
                     /db_xref="GeneID:8202247"
     mRNA            <286640..>289855
                     /locus_tag="ZYRO0B03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495062.1"
                     /db_xref="GeneID:8202247"
     CDS             286640..289855
                     /locus_tag="ZYRO0B03498g"
                     /note="highly similar to uniprot|P09436 Saccharomyces
                     cerevisiae YBL076C ILS1 Cytoplasmic isoleucine-tRNA
                     synthetase target of the G1-specific inhibitor reveromycin
                     A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495107.1"
                     /db_xref="GeneID:8202247"
                     /db_xref="GOA:C5DQW3"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023586"
                     /db_xref="UniProtKB/TrEMBL:C5DQW3"
                     /translation="MSESAQFSFAREEEQVLAFWNEIDAFHRVLEITKDKPEFSFFDG
                     PPFATGTPHYGHILASTIKDVVPRYATMTGHHVDRRFGWDTHGLPIEHIIDKELGITG
                     KEDVFRYGLENYNNKCKSIVMTYASEWRKTIGRLGRWIDFDNDYKTMYPSFMESEWWA
                     FKQLYERGQVYRGFRVMPYSVGCTTPLSNFEAQQNYKDVNDPAVTIGFNVLGQEKTQL
                     VAWTTTPWTLPSNLALCVNPNFEYVKIYDENKDRYFILLESLIKTLYKKPNNEKYKFV
                     EKIPAKELVGLKYEPLFPYFTEVYGERAFKVIADEYVTSDSGTGIVHNAPAFGEEDYN
                     VCLKYGVIEKDLELPNPVDDAGKFTKEVVDFQGTFVKDADKEIIKHLTAKGNLLLASQ
                     IRHSYPFCWRSDTPLLYRSVPAWFVRVKEIVPQMLDSVLKSHWVPQAIKEKRFANWIA
                     NARDWNISRNRYWGTPIPLWVSEDYSEIVCIGSVEELEELSGVKGIKDLHRDSIDQIT
                     IPSQKGNGTLRRIEEVFDCWFESGSMPYAQLHYPFENTEEFKYRVPANFISEGLDQTR
                     GWFYTLSVLGVQLFGEVPYKNVIVSGIILAADGRKMSKSLKNYPDPNIVLDKYGADAL
                     RLYLINSPVLKAETLKFKEEGVKEVVSKVLLPWWNSFKFLEGSIALLKKTSNVDFKYN
                     PAATTDNVMDRWILASLQSLVQYIHQEMEVYKLYSVVPRLLNFIDELTNWYIRFNRRR
                     LKGENGVEDSLKALNTLFEALFTFVRAMAPFTPFLSDAIYRRLHQFIPQDVLAKFGKD
                     DRSVHFLSYPEVRKEFFDEAIERSVSRMQTVIELGRNIREKKTISLKTPLKTLVILHN
                     DKQYLEDVEELKGYINEELNVRDIVITSEEQNYGVEYKAVADWPTLGKKLKKDVKKVK
                     DALPSVSTADVRKYLETGTLEVAGIQLVEGDLNVVRGLPENAVEHGQESRSYQDVLII
                     LDTKIYPELKTEGLARELVNRIQKLRKKCGLAATDDVLVEYELINDTIEFENVVKEHL
                     AMLTKTCRSDIVKCDGKKTDAIADEEQTINDTAFKLKIFKL"
     gene            <290066..>290572
                     /locus_tag="ZYRO0B03520g"
                     /db_xref="GeneID:8202248"
     mRNA            <290066..>290572
                     /locus_tag="ZYRO0B03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495063.1"
                     /db_xref="GeneID:8202248"
     CDS             290066..290572
                     /locus_tag="ZYRO0B03520g"
                     /note="similar to uniprot|P40063 Saccharomyces cerevisiae
                     YER104W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495108.1"
                     /db_xref="GeneID:8202248"
                     /db_xref="UniProtKB/TrEMBL:C5DQW4"
                     /translation="MVDPNPNSSPPRFSIGSSPGPLPPTRAVQRWSDSEEGIADDIFS
                     YRKGQYADAFPSYSSSPIRSRRKHNEVQNRKVAQRRVAHRDNSTVKVRGGNEEMEKFV
                     MTSERERELRRLKLQAEEHAIRMDEVEKFEKEQREEIEDEELLDYVEKREQCEKELEQ
                     MLADLLIT"
     gene            <291458..>291814
                     /locus_tag="ZYRO0B03542g"
                     /db_xref="GeneID:8202249"
     mRNA            <291458..>291814
                     /locus_tag="ZYRO0B03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495064.1"
                     /db_xref="GeneID:8202249"
     CDS             291458..291814
                     /locus_tag="ZYRO0B03542g"
                     /note="highly similar to uniprot|P38182 Saccharomyces
                     cerevisiae YBL078C ATG8 Protein required for autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495109.1"
                     /db_xref="GeneID:8202249"
                     /db_xref="GOA:C5DQW5"
                     /db_xref="InterPro:IPR004241"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DQW5"
                     /translation="MKSTFKSEYPFEKRKAESERISQKFQNRIPVICEKAEKSDIPEI
                     DKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQDHKDKD
                     GFLYVTYSGENTFGSV"
     gene            complement(<292045..>296415)
                     /locus_tag="ZYRO0B03564g"
                     /db_xref="GeneID:8202250"
     mRNA            complement(<292045..>296415)
                     /locus_tag="ZYRO0B03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495065.1"
                     /db_xref="GeneID:8202250"
     CDS             complement(292045..296415)
                     /locus_tag="ZYRO0B03564g"
                     /note="similar to uniprot|P38181 Saccharomyces cerevisiae
                     YBL079W NUP170 Abundant subunit of the nuclear pore
                     complex (NPC), required for proper localization of
                     specific nucleoporins within the NPC, involved in nuclear
                     envelope permeability and in chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495110.1"
                     /db_xref="GeneID:8202250"
                     /db_xref="GOA:C5DQW6"
                     /db_xref="InterPro:IPR004870"
                     /db_xref="InterPro:IPR007187"
                     /db_xref="InterPro:IPR014908"
                     /db_xref="UniProtKB/TrEMBL:C5DQW6"
                     /translation="MYSTPLKSRIDYNNSTFAGSQSLSKNSANNETNGTGTGINGNSS
                     TDGIIARGLKTSAALVGSDSASVTSDLSNAKEHLRVNGLGTSNPLELSSQYIDHLQRQ
                     DASTPVLDERSYYNNGVNYNFSKEVGGLGAFTPFERQQVINLPDEILQEASKAEMRSD
                     MGIFPEINRCWIIIDNKLILWNIRDSSDFQTIDEIKHTILKVALVKPKPNMFVDYVQH
                     LLLISTPFDIYILAVSYDASTNELGVFNTGMCVSVHGLDVAEIVCFERTGQIFFSGRT
                     NGLNIWELQYSGSDDWFNSKCNKVCLTQSAWSSLLPGNIISKLPGSRLVQSFFEEDPK
                     YSQETIVQLTVDQSRGIVYSLSSKSNIKAYLITDHSLEGPLTIEPFYIKRIMGTTTAR
                     GAAILGTKYLKISKIETVSQQENNNLFFVAITVGGVRLYFNGSVGRSSIEALRLESIK
                     FPPSSATQETIEHELQQQQLEQQKRALPFYSFLNSSESILLKFQKKSSVLLETSNACS
                     IISPGMFFCPVVKNPTSPEKNTTTTAGDNNNKNDNNKESTAVQHKLYVSVPDYGILKN
                     HGKYVENAVLLDTTGSVKQIVPLTPSFNATQKPEGYANEFATQYSMENMKVAVLTNGA
                     IEIYRYRTPDEVFETLIDNPLPFVLNYGVSEACSTALFVTCKLNKSEMLRSAALTFFT
                     VGIPGVVEIKPKYNKYVMSSMPSFLSTTPQKALSLYGQNFATPNTNLKSNQPGNFDLD
                     DVILSARFYGIAFLIARLFRDIWDKQVFKVNPSAKFDSSNHVVKESLEDRNIIVGTSI
                     STLDVEYYLSSITILNEFFNSYGDSITTISTGVISNGTGTNSVDKSEEVANQAENIAI
                     NSLIKLVKSIMEALSFLNVLYEESEVEGYEHQYLAFKDIIKFLNLDVQTELTKLKFKD
                     LFAPNTEIKRLIREILSSIINRSITRGASIEYTATALQERCGSFCSSSDILGFRAVEH
                     LRRAKEIGLRDYETLSYHLNNAIKLFERIVDDISIEKLKEAVNIMLELHYFPKTIKFL
                     LNMANSMDRGKLAYQYVADGSLEHDERRKYYEKRSAVYELVFETLVKVDELSATDVPT
                     GAGGFTVSNELNALREESYSTVLHYNDKLFHYQLYDWLVSQSCQDKLLQLDTDFILPY
                     LQEKSKSSLEISNLLWIYYSKRSKFLEAAEVLYTLAGSDFKLKLGERIECLSRANGFC
                     NSVCPPSQKQSMVQLADMIQEIFDVAAVQDDLLTLIATDNRVKSDARGELLAHLDGKI
                     LPVSDLFNDFAVPLGYYEICLFIFKVSDFRNEEEIIAKWNELFGSLKQELNPTGKMED
                     SLNFINFLSNVVIKIGRQVHTSEFVFPVALLFPIISNLFYDALPHDHLKPGSVASIFI
                     SAGLTYGKLYYFLKDLIETSDSPKTIFRDEMTWLIKEWYKSDRKLRDIINYESVAQLD
                     DYTLDKDPIEIYMKETGNTI"
     gene            <296759..>297616
                     /locus_tag="ZYRO0B03586g"
                     /db_xref="GeneID:8202251"
     mRNA            <296759..>297616
                     /locus_tag="ZYRO0B03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495066.1"
                     /db_xref="GeneID:8202251"
     CDS             296759..297616
                     /locus_tag="ZYRO0B03586g"
                     /note="weakly similar to uniprot|P40065 Saccharomyces
                     cerevisiae YER106W MAM1 Monopolin kinetochore associated
                     protein involved in chromosome attachment to meiotic
                     spindle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495111.1"
                     /db_xref="GeneID:8202251"
                     /db_xref="InterPro:IPR018847"
                     /db_xref="UniProtKB/TrEMBL:C5DQW7"
                     /translation="MGRISKARLRPLGVKNTNTVNNGNNNISPERSKSVRKLSNKNSV
                     LPSLNMVNYHVENFKENVAPDELLTNEDELTGGLDDIQVQQPLTGGNLKQLQNEIAEL
                     ENVLFPCEHFLCGLENRSQLKSLRLWLLFELEMSPDNGTTNLRNTCYRDHVYEAVCSP
                     WKVQNCIQQIPQDFEPFPLQQLIIPEIELVKEPDLEDGTVQIGDLVEKKKIPPTFLSS
                     QNRQGIFDSASVDTTAIVRQRHTSEVSDVVDEDHEETLRRFRKQPRISTLERKLALIG
                     GMSLPKLTK"
     gene            <297767..>299395
                     /locus_tag="ZYRO0B03608g"
                     /db_xref="GeneID:8202252"
     mRNA            <297767..>299395
                     /locus_tag="ZYRO0B03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495067.1"
                     /db_xref="GeneID:8202252"
     CDS             297767..299395
                     /locus_tag="ZYRO0B03608g"
                     /note="similar to uniprot|P33893 Saccharomyces cerevisiae
                     YBL080C PET112 Protein required for mitochondrial
                     translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495112.1"
                     /db_xref="GeneID:8202252"
                     /db_xref="GOA:C5DQW8"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR004413"
                     /db_xref="InterPro:IPR006075"
                     /db_xref="InterPro:IPR017958"
                     /db_xref="InterPro:IPR017959"
                     /db_xref="InterPro:IPR018027"
                     /translation="MRVFRRFYQVQLPPISKFRLLPQYKLKCGLEIHTQLDTRNKLFS
                     MSTNDPFHSANKPNSHTSFFDIALPGTQPILNHEAVLFATKLAIALNCQINLDSQFDR
                     KHYFYGDQPLGYQITQHFSPFASRGHLPLHKDIDGIDEISKNIHITQLQIEQDTGKSL
                     YRKSDHITLIDLNRSNVPLIEMVTEPDFQDLKQIRAFIKKYQNLVRHLKISTGDLETG
                     AMRVDVNLSINDHARVELKNLPNTSSILNAIKHEYLRQVQIVEDGMADELLSQPETRG
                     WTGSSTVKLRSKETTIDYRYMPDMELPRITLAADVVETLQKTMPPLPDKILNTLMSEP
                     YKLSLKDAKILCLSSNGQDEIYNHEELQQFYLDTFHSYADRVKGNIEANKLSKLPTNW
                     IIHELLGDLNKLELPLSEITKVLTPQIFADFLMLIHNNEISSASGKLLLFHVLKTLKE
                     TNCDTSTTIDFNSLIDEFDIRTINQIDHDELREICNEIIETLNNDKLINDIVTGKKKK
                     SIKFLVGQGMKLSQGRIKAQDFERTFKEVLDVKW"
     gene            complement(<300106..>301107)
                     /locus_tag="ZYRO0B03630g"
                     /db_xref="GeneID:8202253"
     mRNA            complement(<300106..>301107)
                     /locus_tag="ZYRO0B03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495068.1"
                     /db_xref="GeneID:8202253"
     CDS             complement(300106..301107)
                     /locus_tag="ZYRO0B03630g"
                     /note="weakly similar to uniprot|P38180 Saccharomyces
                     cerevisiae YBL081W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495113.1"
                     /db_xref="GeneID:8202253"
                     /db_xref="UniProtKB/TrEMBL:C5DQW9"
                     /translation="MPGKIESTAFLSQLEDMDKYLLEYRSLKLMPQVTNAFGAMRFNN
                     NNFEMDNDLLKNSKKLNGINGGNNNNNNNNNSNNNNNNRKKFMNKQAFRLNSPTAVKF
                     PHTKAVPPTAAPTAAPAGATTPLVNSHNFNKANSATYPLYYNTANNNSNASLAQPPLS
                     SSTSSPSFVPPRVDSSLSGYDPTFDYVVPTPTPTDYTNQFSTPFSSYLNSGINPNMSS
                     SVGATTAGTPVASSANLATSGSSDMVNNLVGTNTFNSGVSAPLAFDQPLPTSSISASM
                     GASGLASTPTTADLSGNNLGSDQLLMNDLSLGWGSNHVSSAGAGNYGIWNNDMSVWS"
     gene            complement(<301728..>302804)
                     /locus_tag="ZYRO0B03652g"
                     /db_xref="GeneID:8202254"
     mRNA            complement(<301728..>302804)
                     /locus_tag="ZYRO0B03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495069.1"
                     /db_xref="GeneID:8202254"
     CDS             complement(301728..302804)
                     /locus_tag="ZYRO0B03652g"
                     /note="highly similar to uniprot|P40066 Saccharomyces
                     cerevisiae YER107C GLE2 Component of the nuclear pore
                     complex required for polyadenylated RNA export but not for
                     protein import homologous to S. pombe Rae1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495114.1"
                     /db_xref="GeneID:8202254"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DQX0"
                     /translation="MAFYSTSVSTTMATDKDMANDIVIPNPAEDSISDISFSPQSDFL
                     FSVSSWDNKVRIWDVQGGIPQGRAQFEHQAPVLCTKWSNDGTKVVAGGADNVVSMFDV
                     ATGQTKQLGLHDGPVKSMSYLQFGGSNTDVLVTGSWDKTLKYWDARQAQPIGTVAMPD
                     RVYTLDSRQMLLVVGTAERHIAVINLGNPMAIFKTTQSPLKWQTRVVACYNEGDGYAL
                     GSVEGRCAIRYVDDEEQRKKGFSFKCHRQTNSNRAPGQPAQSLVYAVNSIAFHPIYGT
                     FATAGGDGSFHFWDKNQRHRLRGFPSLQASIPVCSFNRNGAVLAYALSYDWSQGHMGN
                     RADYPNVIRLHPTSDDEIKEKKRR"
     gene            complement(<302908..>303723)
                     /locus_tag="ZYRO0B03674g"
                     /db_xref="GeneID:8202255"
     mRNA            complement(<302908..>303723)
                     /locus_tag="ZYRO0B03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495070.1"
                     /db_xref="GeneID:8202255"
     CDS             complement(302908..303723)
                     /locus_tag="ZYRO0B03674g"
                     /note="some similarities with uniprot|P40068 Saccharomyces
                     cerevisiae YER109C FLO8 Transcription factor required for
                     flocculation diploid filamentous growth and haploid
                     invasive growth genome reference strain S288C and most
                     laboratory strains have a mutation in this gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495115.1"
                     /db_xref="GeneID:8202255"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR013720"
                     /db_xref="UniProtKB/TrEMBL:C5DQX1"
                     /translation="MKESQGSKQRLNAYIYDFLVKSALHGSAGTFFEEAGLREDSDNG
                     NSNSSVKRGVVVVDSPQGYLYEWWKIFWDLCTVRSKRGGGGTTGLPAMQAYYKLWSEK
                     NAQENALMTQEINAASLQQTSEDAGEYRNEEVDASRLSLVVSSVPLQPSLRKVPPVSS
                     KRVEKQKHYKKRVLREERQYEQNLFMRRSNVSTDRTAHVNTVPHHAGTRASLPSQELP
                     AFDLQSFEYDPDFLLFTSPETAPLPVDFPPTHGEDTSFLDNSSERSFNFLNGM"
     gene            complement(<304077..>305432)
                     /locus_tag="ZYRO0B03696g"
                     /db_xref="GeneID:8202256"
     mRNA            complement(<304077..>305432)
                     /locus_tag="ZYRO0B03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495071.1"
                     /db_xref="GeneID:8202256"
     CDS             complement(304077..305432)
                     /locus_tag="ZYRO0B03696g"
                     /note="similar to uniprot|P38179 Saccharomyces cerevisiae
                     YBL082C RHK1 Dolichol-P-Man dependent alpha(1-3)
                     mannosyltransferase involved in the synthesis of
                     dolichol-linked oligosaccharide donor for N-linked
                     glycosylation of proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495116.1"
                     /db_xref="GeneID:8202256"
                     /db_xref="GOA:C5DQX2"
                     /db_xref="InterPro:IPR007873"
                     /db_xref="UniProtKB/TrEMBL:C5DQX2"
                     /translation="MPPFEPLKDLVNGIRFMIYNPRSTLIWGPMLLAFESALLKLIIW
                     KVPYTEIDYKAYMEQIDIIKSGETDYTKIYGGTGPLVYPAGHVLIYRFMHWLTEGTNF
                     VHRGQHFFRCLYLLTLALQFFLYYRLQLPGWCVVLASLSKRLHSIYVLRLFNDCFTTF
                     FMVVTVLLLQLASDRPRRWLTYVAALTFSFALSIKMNALLYLPGIAVTIFYLQNGNLL
                     HCLICAALAVSLQYSIAIPFLSHWRSYLICAFDFQRKFLYRWTINWHFLDEETFNSNQ
                     FHLALLATHMIVILTLFSLLFPNWRTHLYRACCLHEANIFLSSDLHSSAASPKGNHPA
                     ISGTLPLIVTTNFAGVICARSLHYQFLSWYHWTLPILLCYSGFPAPLGMVWYAIHEWC
                     WNSYPPNSLASAILVSLNGTLLICCGVAFYITRQKNQLQQQHGAVPAKSRSVLSDGKE
                     D"
     gene            complement(<306092..>309439)
                     /locus_tag="ZYRO0B03718g"
                     /db_xref="GeneID:8202257"
     mRNA            complement(<306092..>309439)
                     /locus_tag="ZYRO0B03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495072.1"
                     /db_xref="GeneID:8202257"
     CDS             complement(306092..309439)
                     /locus_tag="ZYRO0B03718g"
                     /note="highly similar to uniprot|P40069 Saccharomyces
                     cerevisiae YER110C KAP123 Karyopherin beta mediates
                     nuclear import of ribosomal proteins prior to assembly
                     into ribosomes and import of histones H3 and H4 localizes
                     to the nuclear pore nucleus and cytoplasm exhibits genetic
                     interactions with RAI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495117.1"
                     /db_xref="GeneID:8202257"
                     /db_xref="GOA:C5DQX3"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C5DQX3"
                     /translation="MDQQTLIQLEQTLGAITQPNSASVKDATKTLQSQFYTKPATLPA
                     LIHILQGSQNDALKQLAGVEARKLVSKHWKTLDTNLQNRIKASLLQTAFSEPKEIVRH
                     ANARVIAAIGTEELEDNKWPDLIPNLIQAASGQDAQTRQTSTFILLSLLEDFTPSLLQ
                     YVDDFLTLFGQLTNDTASLETRSLAAQSLNHVSALIEEQEPINPQQAAKFASLIPSVV
                     NVLDDVIKADDSVNSKLIFNCLNDFLLLDSQLTGNSISELIKLAVHIAVTPEIDEDVR
                     VFSVQFLMSALSYRKSKISQAKLGPEITMAALKVASEEIDINDELNNEDEAAENEENT
                     PSTTAVRLLAFASSELPPSQVASVIVEHLPVMLQSANVFERRAILLAISVAVTGSPDY
                     ILSQFDKIIPATITGLKDNEPVVKLAALKCVHQLTTDLQDEVAKFHDEYLPLIIDIID
                     TAKFVVVYNYATVALDGLLEFIAYDAIAKYLEPLMNKLFYMLDSNKSSKLRCAVVSAI
                     GSAAFAAGAAFIPFFKTSVQYLEQFIQNSSQLEGMTEDDIELRALTFENISTMARAVK
                     SETFAEFAEPLVNAAYEAIKTDSARLRESGYAFIANLAKVYGENFSPFLKTILPEIFK
                     TLELDEYQFNFDGDAEELATFADSANEEELQNKFTVNTGISYEKEVAAAALSELALGT
                     KENFLPYVEQSLKVLTEQVEESYGLKETALNTIWNIVRAVLLASKFEPETYPKGIPAG
                     SYVDANVLAIIKNAREITLTDLADEFETSMVITVFEDMANMIKQFGAIIVSDGGDSTL
                     LESLCVQVLSVLKGSHTCQTIDLEEDVPKDEELDASETEATLQDVALEVLVSLSHALA
                     GDFVKVFENFKPVIFALFESKSKNKRSSSVGGVSEMVLGMKEQNPFIQEMLEALVIRL
                     TTDKSLEVRGNAAYGVGLLCEYASFDVSSIYGVVLKAMYELLSTADQKALVAEDDEVT
                     REIIDRAYANASGCVARMILKHESFVPLEQTVPALLDHLPLKTGFEEYTPIFELIMKL
                     YEANNAVITGATPKIVEIFATVFTKENERIKLEQESTLGREENMERLKQFQTDEMKLK
                     VVQLLKYLNNTYGGIVAQNPVLASVIA"
     gene            complement(<310042..>313455)
                     /locus_tag="ZYRO0B03740g"
                     /db_xref="GeneID:8202258"
     mRNA            complement(<310042..>313455)
                     /locus_tag="ZYRO0B03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495073.1"
                     /db_xref="GeneID:8202258"
     CDS             complement(310042..313455)
                     /locus_tag="ZYRO0B03740g"
                     /note="similar to uniprot|P25302 Saccharomyces cerevisiae
                     YER111C SWI4 Involved in cell cycle dependent gene
                     expression transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495118.1"
                     /db_xref="GeneID:8202258"
                     /db_xref="GOA:C5DQX4"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DQX4"
                     /translation="MAYGAVMMDSFKGNQADDEKSTSTANATGSDLTPAGRPVIEIAT
                     YADTDVYECYIRGYESRIVMRRTQDDWVNITQVFKIAQFSKTQRTKVLEKESNDMRHE
                     KVQGGYGRFQGTWIPLEDAKYMVTKYNIRDPVVTTILAFQLNPNNPPMKRSKNSVLKR
                     TSPDGRITSPSSYNKTPKKRNAIGGSTARKSKKNSMLLQGANPSPLQNLVFQTPQQSH
                     MASQLATNAETTVSATSQANQMSSTKENVIPHLNTEETPLALGYSATQKPLQFYPVPT
                     SLTHPHKMREFTNTTNDTSSFDTSTDMDKSHSQNFLTFIPEGPSSGVFSSQQHQQRVP
                     SILVNGNGNAKKASKRKRKSEDDSIEMMSHDDDSSFASGPPQSSVPPPPQSLPGATPG
                     STVNGSAGKHLKHKLKNRPSLTAKRTSMAQDKAQQNFKMMQKQLMWQNVRQQQKNSSM
                     PFKMHQNGNISSNANHSSSMDMFSTGENPTPLSSRSSTPNTFAGLPTAPATAHGNENN
                     TDNLGPTLNVEEYKEMILQVLSSEDGSDKDYQLPPQMYHPPSNFDINFEIDDQGHTPL
                     HWATAMANVPLIKLLIALNANALQCNLRGFNCITKSAFYNNCYKADTFSEIVSILRIC
                     LITPDNNGRLPLHYLVELSVNKSKDPVVINFYLDTIIHNLGQEDYTLLRMCLNFQDNM
                     GNTVLHLAALNLNLELCNKLCYLGSSMDITNCDNETPASILAKFNLVPAPNPNAGTFL
                     PSAAPAPAPAPTSQGFSQSLEQPNGNSVAATPRPGSQNPSTSVLPEEGQPAANTQQQH
                     KLVPEILPSVEEEDADDNDADDADDADDDDDNEKNEQPVKLTPSISNKKSDVRNFLPG
                     PDSTSLSTLMDDLSNMNSFVTSSAVRDLRTTPSRLLECSPITRKKKNEASAATVSSNL
                     RKTTLADAIQSPLAPIIASPGTMVQEEKEVNNVVKLAGKLGEMSNALKISINTKVNSV
                     ANEIENATEGIKCIKQNVNNITRHEKDLLVQFNDGEGVGSVEQMEGSRNQLREYVRDG
                     RQVFVQCLEKSQALNLATLVQEEESKVDADPGSSPAKEGADDTSLKLAAELALLQFKR
                     RLRIQKVTDARTKVDSNNKISKYRRLIGMTIENIDTKLDDIEGYLKTNS"
     gene            <314249..>314770
                     /locus_tag="ZYRO0B03762g"
                     /db_xref="GeneID:8202259"
     mRNA            <314249..>314770
                     /locus_tag="ZYRO0B03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495074.1"
                     /db_xref="GeneID:8202259"
     CDS             314249..314770
                     /locus_tag="ZYRO0B03762g"
                     /note="weakly similar to uniprot|P40070 Saccharomyces
                     cerevisiae YER112W LSM4 component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing,
                     splicing, and decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495119.1"
                     /db_xref="GeneID:8202259"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:C5DQX5"
                     /translation="MLPLYLLTNAKGQQMSIELKNGEIVEGELINVDNWMNVTLSNAS
                     QFDNIGTTVSVGPSKEVVKAKEVYIRGTYIKYIRLQDEIIDQVKQQINNNSNSNNNYG
                     SGSYRGRRSGFNSPGGGSANYNRRNNPNAGGRRNFNNNSNGQRRPFNNQTRPSTNGMG
                     GYVQQHQQRDVEF"
     gene            complement(<314902..>316878)
                     /locus_tag="ZYRO0B03784g"
                     /db_xref="GeneID:8202260"
     mRNA            complement(<314902..>316878)
                     /locus_tag="ZYRO0B03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495075.1"
                     /db_xref="GeneID:8202260"
     CDS             complement(314902..316878)
                     /locus_tag="ZYRO0B03784g"
                     /note="similar to uniprot|P40071 Saccharomyces cerevisiae
                     YER113C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495120.1"
                     /db_xref="GeneID:8202260"
                     /db_xref="GOA:C5DQX6"
                     /db_xref="InterPro:IPR004240"
                     /db_xref="UniProtKB/TrEMBL:C5DQX6"
                     /translation="MLIRARPLGCFVTVVILLVILLRLIAGGYISIEGYNSDWWLKPN
                     VYSIGDPLELVVNTVESEITDIPFGYYDLPFTCPPTPEKKPLHLSLNEIIKGDRKWES
                     DYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMVQWMIDDDLPAATTYISTTDN
                     LKYYAPGFPLGSVDPRSSRVFFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCP
                     GASKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSST
                     FHWMALANSVGIVLFVTFIVIVNLIMIFRNPNEQLESKENEDSSDIFNVANNWLRARQ
                     GFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMASF
                     VGTWLKMDQNISAYTFYNPVFAVLCGSALPGSIMVLTLSLNCIIWIWDSTKALPFGTM
                     VVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLVVF
                     LAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGC
                     LVLMKLNHKFINDQNWRWRCFVISTGCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYS
                     FIFNVLCGLATGSLGYLTSSWFVKKIHRTRYTRN"
     gene            complement(317385..317456)
                     /locus_tag="ZYRO0B03806r"
                     /db_xref="GeneID:8202261"
     tRNA            complement(317385..317456)
                     /locus_tag="ZYRO0B03806r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=58.36"
                     /db_xref="GeneID:8202261"
     gene            <318153..>320336
                     /locus_tag="ZYRO0B03828g"
                     /db_xref="GeneID:8202262"
     mRNA            <318153..>320336
                     /locus_tag="ZYRO0B03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495076.1"
                     /db_xref="GeneID:8202262"
     CDS             318153..320336
                     /locus_tag="ZYRO0B03828g"
                     /note="similar to uniprot|P38042 Saccharomyces cerevisiae
                     YBL084C CDC27 Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495121.1"
                     /db_xref="GeneID:8202262"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DQX7"
                     /translation="MFFGAAGSASSTNTNTNMASHQEDFSTDVNFLGTIIKLQECIQQ
                     AITQLNHDTAVFLSELLYSECAPLDKTHSYRLESVYLYSLSLFLNAEYHTALDVAQEF
                     KNSSHAGIGYIFARCCLQLSSGLHDAVVALLNLLKKKTVPPSSAMNALIFLPTMATIH
                     CLLGKLYRKLDKTQESALHFSEALNADPYMWEAYVELCNMKATIDLKKLYSVMSRQNH
                     FSTSSARYRARNGVFKSTPYKVPNSSSSSSSSSSSSSVAFPQQHHHQQHQNQQQQQQH
                     SQASMHPQNTPLAPPHTTTAKGQPTNSLLNKANVVVSTLGFSPFTTKQPTASSVGKVN
                     NRGKVLSTPPSKLLSTTNFKTPRNNTNNNPTNSASKRKEQISFSGIKPESSNGILTTN
                     LPSFSSLSSLHELMYNFARVLKASSQYDSYRALRLMETQIPDHIKNVMPWCQARLGKL
                     HFEIVNYEMSLKHFKQLRQMQPTRSEDIEVFSTLLWHIHDKINLSHLSNELLETQPDK
                     PQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCY
                     RKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKM
                     SYQEKALQYYELASELQPSSSLAKFKKAHLLYVMARYSVALENFEELAELAPDEATVH
                     FLLGQLYQIMGRKKDAVKEFTIAMNLDPKGNQLIIDALEKCHLQE"
     gene            complement(<320570..>323839)
                     /locus_tag="ZYRO0B03850g"
                     /db_xref="GeneID:8202263"
     mRNA            complement(<320570..>323839)
                     /locus_tag="ZYRO0B03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495077.1"
                     /db_xref="GeneID:8202263"
     CDS             complement(320570..323839)
                     /locus_tag="ZYRO0B03850g"
                     /note="some similarities with uniprot|P39969 Saccharomyces
                     cerevisiae YER114C BOI2 Protein implicated in polar growth
                     functionally redundant with Boi1p interacts with
                     bud-emergence protein Bem1p contains an SH3 (src homology
                     3) domain and a PH (pleckstrin homology) domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495122.1"
                     /db_xref="GeneID:8202263"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:C5DQX8"
                     /translation="MSFKRMQPSLARLDTAGVASSNDGPVSAFSTGSVKRNSVYIVIN
                     EYTKRMQDELDMKPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLFPVIFTQEMTFNAR
                     PGIIRAKSNRRVGSAGKGNSNLSVNGSTSELSTPQVIETAAPITVEQKRKPVDRQISV
                     KSTMSDIDKALEELKNSSLEDQSMPTPEMNGKRDAMMFTTKHLDFGRVPNSSGLPKSM
                     SKDTSVVTSSINGIETAELDPARAGSWTPQQVTAYFISQGFDVQSATRFQQHRISGAI
                     LLELELAHLKELEISSFGTRFEIYKEIEALREQVNIPNRSGTKQPRPKSMIAGTNSAA
                     ATPASTADTNNANDKTKGLTPPVFFNGGPTYRGHVKKASQSLDDIQNTFEEHQNDDVR
                     LPKHKPTSFGNEFNSAIPSSPMGETDIVTSQLFTSPRRAPKPPSYPSPVAPPKSPIGN
                     MTVAHSGVGYSPPTIFEKNASSVESNYSNSNNKGTDSLNAAQEDLNAVPDSFNESPST
                     LDGQGDIFTAGPKFSFPGEQHISPQERSLPNGNSRMGLGLAVDTSGSVNSPRSADLWS
                     NSDPFSNRKPLTGNSNNNNNNNNNNNNNSKTALSPTGAHKNSLSGASFMDLLNKVSHK
                     NPSYEDVEEEQTSNYTGEPLGRPTSSVYNTHSRNPSLAQGPSGPASSGYFDSRRDSVP
                     LSYFSAKEDDDSSSTPVNPSVGVFPSKGKGISGYGTSVPPRQAVDDGSQITPVEFPRN
                     SQSAVNTPVVARPISPIKPKSAKTEDKRRSASAKASFSPNSKQKGVVLEDDKKKRSVS
                     EAVKGTAMRGKNSKGSSKKRQTSAFMEGIRNITVEEAIMDADCSGWMSKKGSGTMGTW
                     KTRFFTLHGTRLSYFASTSDTRERGLIDITAHCVVPAKEDDKLVSLYAASTGKGRFCF
                     KLIPPHPGSKKGLTFTQPRVHYFAVDNRDDMRAWMAALIKTTIDIDTSVPVISSCTTT
                     TVSLDKAQEMLSKAREETRLREQQYMNEEDEDQLLWEREQGNKDNNEEDAPGSATTNP
                     SSNGSTTMASNGFASPYLLASGVLSPSVHRSGTGKSGKFKENTPEKTRPSEAYVGAER
                     N"
     gene            complement(<324233..>325033)
                     /locus_tag="ZYRO0B03872g"
                     /db_xref="GeneID:8202264"
     mRNA            complement(<324233..>325033)
                     /locus_tag="ZYRO0B03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495078.1"
                     /db_xref="GeneID:8202264"
     CDS             complement(324233..325033)
                     /locus_tag="ZYRO0B03872g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495123.1"
                     /db_xref="GeneID:8202264"
                     /db_xref="UniProtKB/TrEMBL:C5DQX9"
                     /translation="MSRRLELGLVSHIDDIDRLTFLSDVNIEPFDDTSNTSSSRHGNS
                     INALGRIVESFEKDHVLITKCIAMNKRAWEIDLYAEDVAGFPILDVPIKCDVISELVQ
                     LLRSDKSSDDSCLNVIKSLQRIIETSSIGSPRSNQSDSTAETRDPSGTPSRIERHFRR
                     LSIDPYWFSNAFGPSKQHRPPLFSTKSTRSTPDWHGEEEPAQRENYTKFPHYKQLITT
                     LYQELCRRDGYNQQNDPLFAQVSDTICQFILQDCKTLLAGYIERKLMS"
     gene            <325253..>326638
                     /locus_tag="ZYRO0B03894g"
                     /db_xref="GeneID:8202265"
     mRNA            <325253..>326638
                     /locus_tag="ZYRO0B03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495079.1"
                     /db_xref="GeneID:8202265"
     CDS             325253..326638
                     /locus_tag="ZYRO0B03894g"
                     /note="similar to gnl|GLV|KLLA0E20999g Kluyveromyces
                     lactis KLLA0E20999g and some similarites with YBL086C
                     uniprot|P38177 Saccharomyces cerevisiae YBL086C Protein of
                     unknown function green fluorescent protein (GFP)-fusion
                     protein localizes to the cell periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495124.1"
                     /db_xref="GeneID:8202265"
                     /db_xref="InterPro:IPR019448"
                     /db_xref="UniProtKB/TrEMBL:C5DQY0"
                     /translation="MPLLSSKNKSQRPKFLLYLKIDELINIPQSSGYCYVKWNLKDGT
                     GTSNHRLRSSGEDENNMIGHQNHGVTPRVAVEHHRVRWNYQLKKPIEVKLQVDKTRNL
                     EAKRLVLDIYFELLENGNESNNDGSAQKTKRTSLDIPNAVKSPNNVYSPKVSNRSQLG
                     SVILNIAEYVREDEQPITNRFLLKKSKVNSIINLTLQMKLTRGSYDDFLISKASSSQP
                     AGGVRLGIDDILDDASEKSSPASSTFQGSTSGGGSPRSNHHTRSLRSSLRFGSGNHTN
                     NSNGGSGNKAQSYMGMGSPSSPGNTTSSSMNPLVEHLYQKTFQLPWDPRPGEFTPKEC
                     VEDILQGGNGWARNEKGINLIDIQALKLIEMEVEYQDNQRYGANEKMNATKRMELNTS
                     ADEYNSMDKREFLEKMHSWSHTSQNQKRMINNENSRGNALTEGGAGQSEPINADRIRD
                     ARTWTINSILA"
     gene            complement(<326699..>327157)
                     /locus_tag="ZYRO0B03916g"
                     /db_xref="GeneID:8202266"
     mRNA            complement(<326699..>327157)
                     /locus_tag="ZYRO0B03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495080.1"
                     /db_xref="GeneID:8202266"
     CDS             complement(326699..327157)
                     /locus_tag="ZYRO0B03916g"
                     /note="weakly similar to uniprot|Q01684 Saccharomyces
                     cerevisiae YER115C SPR6 sporulation-specific protein
                     involved in sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495125.1"
                     /db_xref="GeneID:8202266"
                     /db_xref="UniProtKB/TrEMBL:C5DQY1"
                     /translation="MNFDLYSPLPYLALDFEFFPGGSDQHYPLQLNWPANLINQCYMP
                     QLAVRRQPLPRVNYQKKTHILKFQQRQKKRKRPMGLDPIYISGCRLVRFGSLAGIRDA
                     RPTRCPLRGLTHGIFIKSSCRCPCQTFTLCPSPLVSLLRTDSLFVMCKSN"
     gene            complement(<327333..>327884)
                     /locus_tag="ZYRO0B03938g"
                     /db_xref="GeneID:8202267"
     mRNA            complement(<327333..>327884)
                     /locus_tag="ZYRO0B03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495081.1"
                     /db_xref="GeneID:8202267"
     CDS             complement(327333..327884)
                     /locus_tag="ZYRO0B03938g"
                     /note="some similarities with uniprot|P40072 Saccharomyces
                     cerevisiae YER116C SLX8 Protein containing a RING finger
                     domain that forms a complex with Hex3p mutant phenotypes
                     and genetic interactions suggest a possible role in
                     resolving recombination intermediates during DNA
                     replication or repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495126.1"
                     /db_xref="GeneID:8202267"
                     /db_xref="GOA:C5DQY2"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:C5DQY2"
                     /translation="MNRLSSEEDTADEEPNKRRRLSRDSRSESESETDVSFEVVGERD
                     ACEDAPSEEVDLMRVLNEVDDETQEEGSRGKTTETIDLEDEAAEQQVKDVPREENEQE
                     NPPKPPANKAVREYHCPICFEPPDTAVMTPCGHIFCVACLFQMVNSSRTHRKSGNCAL
                     CRSEVKLKDIRLVVLRKLRVKKS"
     gene            <328379..>328789
                     /locus_tag="ZYRO0B03960g"
                     /db_xref="GeneID:8202268"
     mRNA            <328379..>328789
                     /locus_tag="ZYRO0B03960g"
                     /product="60S ribosomal protein L23"
                     /transcript_id="XM_002495082.1"
                     /db_xref="GeneID:8202268"
     CDS             328379..328789
                     /locus_tag="ZYRO0B03960g"
                     /note="highly similar to uniprot|P04451 Saccharomyces
                     cerevisiae YER117W"
                     /codon_start=1
                     /product="60S ribosomal protein L23"
                     /protein_id="XP_002495127.1"
                     /db_xref="GeneID:8202268"
                     /db_xref="GOA:C5DQY3"
                     /db_xref="InterPro:IPR000218"
                     /db_xref="InterPro:IPR019972"
                     /db_xref="InterPro:IPR023571"
                     /db_xref="UniProtKB/TrEMBL:C5DQY3"
                     /translation="MSSGAQGTKFRISLGLPVGAVLNCADNTGARNLYVVAVKGSGTR
                     LNRLPAASLGDMVMATVKKGKPELRKKIMPAIVVRQAKPWRRKDGVFLYFEDNAGVIA
                     NPKGEMKGSAITGPVGKECADLWPRVASNSGVVV"
     gene            <328985..>337363
                     /locus_tag="ZYRO0B03982g"
                     /db_xref="GeneID:8202269"
     mRNA            <328985..>337363
                     /locus_tag="ZYRO0B03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495083.1"
                     /db_xref="GeneID:8202269"
     CDS             328985..337363
                     /locus_tag="ZYRO0B03982g"
                     /note="similar to uniprot|P38110 Saccharomyces cerevisiae
                     YBL088C TEL1 Protein kinase primarily involved in telomere
                     length regulation contributes to cell cycle checkpoint
                     control in response to DNA damage functionally redundant
                     with Mec1p homolog of human ataxia telangiectasia (ATM)
                     gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495128.1"
                     /db_xref="GeneID:8202269"
                     /db_xref="GOA:C5DQY4"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR021668"
                     /db_xref="UniProtKB/TrEMBL:C5DQY4"
                     /translation="MENLGIVNTLRDLESNKVKNRSKALDDLTSTLKQSPDLIPTKLL
                     GPTAETLVSQITLEHERYCDLLEKQDSSQSNKLSLQENKFSTLAYVLRLYVEKTCSRF
                     KPKTVNLLLYACQVFISDRSNTVKLLHPISIHFSYTLLALIRCNLFQLKYGSFTWFDV
                     TEKICSILEERFKVSTNDRNVSNLLECLSELISLDTIRLRDVSAATYRVLSGYLQLSQ
                     KETVNTRLILSLVNQFIVKSHIHHVNRCIQLIRATWNHALVIGFAINTDIQRELSYCD
                     IFASELIVNKLPLMVGHEVHEDVTSLLQEYLTQRLVNFKPTSLTLDCLQLNERSEHKV
                     EWFEFYDFQLLESSDPHDWFNLLAIINLMRSYYCIAGPENLAVQLFKRRKIQSGIASF
                     LKDSSKLEDFICNAFEQGEPNVRLLALQICAFHNANNVVDSSYYERLKELLLQGFGDV
                     NLTGWTCLCLISLITQKDFSLGEHDVNRIFKLCLPLVKIPKWCQLSCGLLATAMKYSK
                     HRISDPSTLNQIHDLYELSPINGPYAACNEAFKFWQYLENYGKELQFRQSDSTMIKLL
                     EWLNHKWDQLLPLEQHQDKFYIFVAWLSNRPIQPGKEVDDYFPNCLLYDWKYGSWQEY
                     YNLWIQYKEERAFLLLKDLPSKLPKSKEEATSIAAIAVDRVALHKLLYRLLETIEGNC
                     HFAPLLRFKWIIQILKVINCLVGDLSFLSFIDDFQRSVALFLQSLKFDDRTSFLVFFH
                     QIVSLKMPNVEHLIFNGLDIQDMMVNFRKTLDPVNGRSVSRIDHIDAIVARGSEVSAT
                     HSITCGMNPFYRYDFQTSVEALLHVLEAQSEPVSRRFEALLDFLNGLKTETFVSCLGP
                     VIAFFENSTKGYLDPTLLEQFTQLASEHLLSKEYLTSNLSMYWMSSYLDVIRPHWMIN
                     GGSSLNSDCNDILDWVISRFEDAAFSGVYAITRLSQLLLHMLKFHDISRVCVKGGKQR
                     IFATFIDCLKKLDKATVLTQLPEIIDYMSVVSYKNQKIIFSEIKDLFEPPQQSIEYTA
                     FYTLAMLRFSLLSYSNLILALQSMIVSSRFEHTCVYIMTALEKITIELRLSSLMDLFD
                     LCKFDVFSFWFSQSDNLLEGHNAGGNASKWDISLFGFESLDEFKKSHYSDLAAFLFSR
                     GYQTLPLMQEIKDIVGKSDEQLLWDSYYMAVPLSYVERGAGNLIFTIGKELSNDLTKS
                     CNQLLVYRWVLKYCDFGSLVDTGLILGKLFPNSKFLADLFPPNAHTSRFQFPLHIPPE
                     RWAILLLNFPHRPTFSAGELHFLILWILTDLEISKFHEIRLNCIRQIKFIIVGHEKVL
                     SNCPFFSNILKTLARYLGDVKLHQEVLQLIASFIKLSSQNDLSIVDALSSIYAEVLIF
                     MKDPQREINESFRKLSRSIASRPIQFSKTWKFCDDIVQGMTPSEDIYQTDELLKTEDC
                     GVDKIVLLSLMFSYAKAPDICQLKLEPTNLAVSNLLKYDIPKEFISRNVELWTAYYFD
                     SFGSAQETSELLEKSNLAQQNMSFRDLFSEPGSLNFLFAEFFDTLEDSLMQESCQVQF
                     LWESVLAFLLNSYSYDQENFPRINDTFYEKYRKRCVPMDRDLFTLLHGKINAVHDLEA
                     FITGRFLSTTISYDEWLLEFAGSLLKDLSLILPDIMLFYHLCSASRKFTEGILTILFN
                     LVMFHNPRRGVDWAVRIVSQMEKLLKTDHAAEKTRAILKIISMLRSGYRLNERQCASA
                     YSSLPLKLVCESALRTGQVTFSYMLFEEFSMNDMGTLDTVTLGAIYESLGDVDLMAGL
                     PTPHTLAGALHSINKTEQNTWKSFLINNANFNANYSNQLNSGRMPLLKATESLDFYGL
                     ASFLGEDDCPQQSRDPYKWALQLGNWNIPSPEFIDTKEKGLYYSLKKVLHEDAQPFKS
                     LEDSLVTLVKGRKDFNSQAEWVDTISNVSLLQRLAVSLKTGDDTVIMLKALLAQDEEK
                     LQIFDFEDYKPCLQAKHLLSSIISDEIWKAHPNKSLDIKVMTAIQLANDVKYSIENKS
                     TQDALRYAFLIENLLESVRTLDGRAPILPSLERLGSFVSAEALWECKEFKTPVRILED
                     LLHHQSDPVLNGKISEVNGLLEVPDDYIQAMLVKWTSESRLETASVIFEKYIRNFEAK
                     VKDHDMRAKMFYILGNFLNDQAQRLQASREIEERQRRCDRQVNESNALEMIYKNSNLS
                     ENERKDAKRHYLKVRMQLENDMELLDSLKSQRMQFVSKALHYYLNTLVFTNKFDDDVL
                     DKFCGLWFEYDGVDDVNSLLLKEIGSVPSWKFLPWVNQIASKLSTEQTKFQRPLQLTM
                     KRLLFKLPYDSLYSVMSILFYDKRSANLDQRISQKVEAVENLLKELQGFEKGNYYKKY
                     VIPVKDFCEMSVELANTRVELNSKFPRTLHLSDLKVGQYWLKILPEQKLPLPTMHFPI
                     RSSSDGKMTRPYITSAIETVDISSTGISLPKIVTFQISDGLKRKVLMKGSNDDLRQDA
                     IMEQVFGQVNKILQKDKQMRKLDLNISTYEVIPLGPNAGIIEYVAHSVSLNQILVVLH
                     RNDPVSFDQARKKMKAVQNRSKDERIRTYNKLTEVIKPQLRNFFFDYFSEPQEWLDVK
                     KTYTKGIAASSIVGHILGLGDRHLNNILLDYSTGKPIHIDLGVAFDQGRLLPIPELVP
                     FRLTRDVVDGFGITGIEGLFRRSCETTYSVLRENYEKVMHVLNILKWDPLYSWVMSPV
                     RRHRHLLEEDSQTFGSVNLEEGDSASELEENQESYRALKSVEEKLIGNGLSVEATIQE
                     LIQQATDVENLALIYMGWSPFY"
     gene            complement(<337594..>338709)
                     /locus_tag="ZYRO0B04004g"
                     /db_xref="GeneID:8202270"
     mRNA            complement(<337594..>338709)
                     /locus_tag="ZYRO0B04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495084.1"
                     /db_xref="GeneID:8202270"
     CDS             complement(337594..338709)
                     /locus_tag="ZYRO0B04004g"
                     /note="similar to uniprot|P40073 Saccharomyces cerevisiae
                     YER118C SHO1 Transmembrane osmosensor participates in
                     activation of both the Cdc42p- and MAP kinase-dependent
                     filamentous growth pathway and the high-osmolarity
                     glycerol response pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495129.1"
                     /db_xref="GeneID:8202270"
                     /db_xref="GOA:C5DQY5"
                     /db_xref="InterPro:IPR001452"
                     /translation="MVMDKVPMPSRAKAKAQRKKLHINHSFSLNNLFSDPFALSSISI
                     TLLSWCIAIAGCIATASDTDNFPRFTWWGIAYQFLILFMVIIFYCYDMVDYYKNFIAG
                     ATAVSFVYNTNSATILVYGDGSRKAAASAGVILLSIVNLIWIFYYGSDNASPTSRWID
                     SFSLRGIRPSATQDASMRARRRNRNNLRSQRFTGDNFYPEHQPQNYMSSMALTGFENP
                     DPAYYTGPNVPLDRNGSVAYSDNNMPGAFTQDMNANNQNNLNPNNFNQNNSNQNTFNQ
                     NTFMTETSNGNTDTTMGGTLELYSDAGEESFPYTAQTLYRYQADEDDAYEISFEQGEI
                     LKVSDIEGRWWKAKRSTGETGIIPSNYVKLIEDNIAM"
     gene            complement(<339245..>340555)
                     /locus_tag="ZYRO0B04026g"
                     /db_xref="GeneID:8202271"
     mRNA            complement(<339245..>340555)
                     /locus_tag="ZYRO0B04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495085.1"
                     /db_xref="GeneID:8202271"
     CDS             complement(339245..340555)
                     /locus_tag="ZYRO0B04026g"
                     /note="similar to uniprot|P40074 Saccharomyces cerevisiae
                     YER119C AVT6 Vacuolar transporter exports aspartate and
                     glutamate from the vacuole and to YBL089W uniprot|P38176
                     Saccharomyces cerevisiae YBL089W AVT5 Putative
                     transporter, members of a family of seven S. cerevisiae
                     genes (AVT1-7) related to vesicular GABA-glycine
                     transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495130.1"
                     /db_xref="GeneID:8202271"
                     /db_xref="GOA:C5DQY6"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DQY6"
                     /translation="MSSSVSGGVATLLHTACGAGILAMPYGFKTLGLTFGILALGFCS
                     LCAMTGLLLQAQVARYVPERTASFFSLTQLIHPKLSVVFDLAIAIKCFGVGVSYMIVV
                     GDLIPQIFTTFTSNKILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYL
                     CCLVVVHFIWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQK
                     DTSTRQLNKIGRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYPPSLSTTIGRVAI
                     VLLVMLAFPLQCHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPV
                     PPLQGKRFTVITLVILIASYLLAISVTSLARLLAIVGSTGSTSISFILPGIFGYWLIG
                     SEYTPEELPRNLKFAKFAGLLLAIWGFIVMIASLAASILYGASH"
     gene            complement(<340719..>341222)
                     /locus_tag="ZYRO0B04048g"
                     /db_xref="GeneID:8202272"
     mRNA            complement(<340719..>341222)
                     /locus_tag="ZYRO0B04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495086.1"
                     /db_xref="GeneID:8202272"
     CDS             complement(340719..341222)
                     /locus_tag="ZYRO0B04048g"
                     /note="similar to uniprot|P38175 Saccharomyces cerevisiae
                     YBL090W MRP21 Mitochondrial ribosomal protein of the large
                     subunit MRP21 exhibits genetic interactions with mutations
                     in the COX2 and COX3 mRNA 5'-untranslated leader
                     sequences"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495131.1"
                     /db_xref="GeneID:8202272"
                     /db_xref="GOA:C5DQY7"
                     /db_xref="InterPro:IPR001911"
                     /db_xref="UniProtKB/TrEMBL:C5DQY7"
                     /translation="MLRNLFGLNLRGPALVSRSFHCSPRRLQDPIFDPTQLNPIRLKD
                     SNPKNQEPLINLKPRGFQDKSLSQSRVAAFDLQPKDDALSSRLTGVTAGRTVDVYNND
                     TAAACRQLNSVMLSNKIPQTKKAQRFYLKPGKVAEIKRSQRHRRDFMKGFKRLIEVVK
                     DAKRKGY"
     gene            <341373..>342593
                     /locus_tag="ZYRO0B04070g"
                     /db_xref="GeneID:8202273"
     mRNA            <341373..>342593
                     /locus_tag="ZYRO0B04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495087.1"
                     /db_xref="GeneID:8202273"
     CDS             341373..342593
                     /locus_tag="ZYRO0B04070g"
                     /note="similar to uniprot|P38174 Saccharomyces cerevisiae
                     YBL091C MAP2 Methionine aminopeptidase catalyzes the
                     cotranslational removal of N-terminal methionine from
                     nascent polypeptides function is partially redundant with
                     that of Map1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495132.1"
                     /db_xref="GeneID:8202273"
                     /db_xref="GOA:C5DQY8"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001714"
                     /db_xref="InterPro:IPR002468"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018349"
                     /db_xref="UniProtKB/TrEMBL:C5DQY8"
                     /translation="MSKESAETFESTPLNEAPPASDPAVENSSSANKKKKKKRSKNNI
                     KNISLIYPDEKYPEGQWLDYNLKRTSEAEEKYIAREQQREQEWNDMRKAAEIHRRVRR
                     NVQNKIKADMPLTDIANTIEDATRKFTGAEDLHTMENPKSQGIGFPTGLSLNSCAAHF
                     TPNAGDKTVLRYEDVLKIDVGVQVNGNIVDSAWTHTFDPKYDNLLKAVREATYTGVKE
                     AGIDVRLTDIGEAIQEVMESYEVEIDGKTYPVKPCRNLCGHNIAPYTIHGGKSVPIVK
                     NGDETKMEEGEHFAIETFGSTGRGFVVPGGECSHYARNAGVQVPSSQLGNAKKLLHNI
                     DTYFGTLPFCRRYLDRLGEEKYLFSLNNLVRQGIVQDYPPLNDEPGSYTAQFEHTILL
                     HPHKKEVVSKGDDY"
     gene            <342974..>343777
                     /locus_tag="ZYRO0B04092g"
                     /db_xref="GeneID:8202274"
     mRNA            join(<342974..343016,343122..>343777)
                     /locus_tag="ZYRO0B04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495088.1"
                     /db_xref="GeneID:8202274"
     CDS             join(342974..343016,343122..343777)
                     /locus_tag="ZYRO0B04092g"
                     /note="highly similar to uniprot|P40075 Saccharomyces
                     cerevisiae YER120W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495133.1"
                     /db_xref="GeneID:8202274"
                     /db_xref="GOA:C5DQY9"
                     /db_xref="InterPro:IPR000535"
                     /db_xref="InterPro:IPR008962"
                     /db_xref="InterPro:IPR016763"
                     /db_xref="UniProtKB/TrEMBL:C5DQY9"
                     /translation="MALIDISPDVLEYKPPFTTQSTEYATITNNSAQPVVFKVKTTAP
                     KFYCVRPNAALVQPGESVQVQVILLGLGKEPASDFKCRDKFLVITLPAPYDLGDRQVA
                     DVWHELETEFKHQAVSKKIKVKYVSGGTSADAAGASAASAGAAGGYNEETARGYDGSF
                     AGVDGVPKTAESQDSELLEKPKVDSNVDVDGGEAAVGTKQVDGRSSSSEGSLNSTALV
                     LVALIALVLGWLYY"
     gene            complement(<344035..>344430)
                     /locus_tag="ZYRO0B04114g"
                     /db_xref="GeneID:8202275"
     mRNA            complement(<344035..>344430)
                     /locus_tag="ZYRO0B04114g"
                     /product="60S ribosomal protein L32"
                     /transcript_id="XM_002495089.1"
                     /db_xref="GeneID:8202275"
     CDS             complement(344035..344430)
                     /locus_tag="ZYRO0B04114g"
                     /note="highly similar to uniprot|P38061 Saccharomyces
                     cerevisiae YBL092W RPL32 Protein component of the large
                     (60S) ribosomal subunit has similarity to rat L32
                     ribosomal protein"
                     /codon_start=1
                     /product="60S ribosomal protein L32"
                     /protein_id="XP_002495134.1"
                     /db_xref="GeneID:8202275"
                     /db_xref="GOA:C5DQZ0"
                     /db_xref="InterPro:IPR001515"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ0"
                     /translation="MAPSLPHPKIVKKHAKAFRRYQSDRFKRVPESHRKQRGIDSCVR
                     KKFKGYPAEPKIGYGSNKKTKHLSPSGHKVFLVANVKDLEVLTMHSKSYAAEIAHNVS
                     SRKRVDILARAKALGVKVTNPKGRLSLEA"
     gene            complement(<345085..>346803)
                     /locus_tag="ZYRO0B04136g"
                     /db_xref="GeneID:8202276"
     mRNA            complement(<345085..>346803)
                     /locus_tag="ZYRO0B04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495090.1"
                     /db_xref="GeneID:8202276"
     CDS             complement(345085..346803)
                     /locus_tag="ZYRO0B04136g"
                     /note="highly similar to uniprot|P49089 Saccharomyces
                     cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
                     Asn2p catalyzes the synthesis of L-asparagine from
                     L-aspartate in the asparagine biosynthetic pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495135.1"
                     /db_xref="GeneID:8202276"
                     /db_xref="GOA:C5DQZ1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR006426"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ1"
                     /translation="MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTI
                     LVHERLAIVGLESGSQPIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPII
                     PLYLKYGLDAPKKLDGMFAWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFAS
                     ELKCLIDDCDEIVAFPPGHVYDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEK
                     SVRKRLMAEVPYGVLLSGGLDSSLIASIAARETERANEELDPVNYDSEEKHLAGIDAQ
                     GNLHTGGWSRLHSFAIGLPGAPDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYH
                     LETYDVTTIRASTPMFLLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAE
                     CASRVKNLHLADCLRANKSTMAWGLEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIE
                     KYILRKAFDTTDEPNVKPYLPEDILWRQKEQFSDGVGYSWIDGLKDAAEEAISDEMLA
                     TPRPEWGDDQPTTKEAYWYRLKFDKFFPKSAANTVMRWIPKADWGCHGDPSGRFAKIH
                     EQHIDN"
     gene            complement(347268..347469)
                     /gene="SNR45"
                     /locus_tag="ZYRO0B04158r"
                     /db_xref="GeneID:8202277"
     ncRNA           complement(347268..347469)
                     /ncRNA_class="snoRNA"
                     /gene="SNR45"
                     /locus_tag="ZYRO0B04158r"
                     /product="snR45"
                     /note="C/D snoRNA monocistronic SNR45"
                     /transcript_id="XR_002648384.1"
                     /db_xref="GeneID:8202277"
     gene            <347882..>349474
                     /locus_tag="ZYRO0B04180g"
                     /db_xref="GeneID:8202850"
     mRNA            <347882..>349474
                     /locus_tag="ZYRO0B04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495091.1"
                     /db_xref="GeneID:8202850"
     CDS             347882..349474
                     /locus_tag="ZYRO0B04180g"
                     /note="similar to uniprot|Q06512 Saccharomyces cerevisiae
                     YPR144C NOC4 Nucleolar protein forms a complex with Nop14p
                     that mediates maturation and nuclear export of 40S
                     ribosomal subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495136.1"
                     /db_xref="GeneID:8202850"
                     /db_xref="GOA:C5DQZ2"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR027193"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ2"
                     /translation="MLSFNEIKSSAKLLTTSEDRRNYNQVVQLVNDLKVDDETLKDES
                     RLRFLVVALLQIFKKMFSRGDLRSKDALAEWCRQAYETFKSRLLQIISELPVETSLGL
                     DSVDIYMQLIEQESVYFAAREDAPYFPNNTLRSLIKALWSSPIRSSGTKEMASGQSEN
                     PLLMEFVGKYYKSYGDIQYYFQSEFNYLLEHDQYSTEESMGKWLATVNHDSSCTNEGV
                     DLEIFVPNPPQVVENESKFKTLLEKNWLLMVHGELSLAQYKTTLLILHKRVIPHIHTP
                     TKFMDFLTDAYDLQSKDVSAGMVPVLALNGLFELMLRYNLDYPNFYQKLYGLITANLM
                     HAKYRARFFRLMDTFLASTHLSAHLVASFIKRLSRLTLNAPPGAIVSVIPFVYNLLKK
                     HPSCMIMLHNPAYITDPFMTPEETEHVKSLRGNYVDPFDDKEPNPERTRAMESSLWEL
                     ASLTEHYHPNVATLAKIFSQPFRKMNYNMEDFLDWSYDSLLAAETSRRLKVLPTLEYE
                     NFDQLFGEANTEGTTFLTGVDW"
     gene            complement(349789..349862)
                     /locus_tag="ZYRO0B04202r"
                     /db_xref="GeneID:8202278"
     tRNA            complement(349789..349862)
                     /locus_tag="ZYRO0B04202r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=67.10"
                     /db_xref="GeneID:8202278"
     gene            <350069..>351610
                     /locus_tag="ZYRO0B04224g"
                     /db_xref="GeneID:8202279"
     mRNA            <350069..>351610
                     /locus_tag="ZYRO0B04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495092.1"
                     /db_xref="GeneID:8202279"
     CDS             350069..351610
                     /locus_tag="ZYRO0B04224g"
                     /note="highly similar to uniprot|P53043 Saccharomyces
                     cerevisiae YGR123C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495137.1"
                     /db_xref="GeneID:8202279"
                     /db_xref="GOA:C5DQZ3"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR011236"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013235"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ3"
                     /translation="MSSISAADSAKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDT
                     KSIFFSNRALAHLKQDNFQLSLNDCDKALELDSKNIKAYHRRGLSYVGLLEFKKARTD
                     LKTVLKSKPGDVAADRALQICEKFIREERFKKAIGGDDSYSTINYCQSLSLDTYDASS
                     DLSKYDGPKLELEQLKNDKGEPAGAIVKDISPEFISAMVNDVFKKGKTIPKKYAAAIV
                     SHADRLFREEPTILELSNVKSPASTISVCGDTHGQFYDVLNIFRKYGKVNERHTYLFN
                     GDFVDRGSWSCEVALLFYCLKILYPKNIYLNRGNHESNNMNKIYGFEDECKYKYSQRL
                     FDMFSQSFESLPLGAVINDDYLVMHGGLPSDENCTLEDLKKINRFSQPPKEGAFMELL
                     WSDPFEGKGFGPSQRGLGSAFGYDITENFLRKNQLRKVFRSHEVRMGGVKFEHNGKLV
                     TVFSAPNYCDSQNNKGAIIHVVPGRGKLNQNENDDEDLLVETFEAVEHPPIKPMAYSQ
                     GGLGF"
     gene            complement(351776..351847)
                     /locus_tag="ZYRO0B04246r"
                     /db_xref="GeneID:8202280"
     tRNA            complement(351776..351847)
                     /locus_tag="ZYRO0B04246r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (TCT) cove score=66.58"
                     /db_xref="GeneID:8202280"
     gene            complement(<352185..>352946)
                     /locus_tag="ZYRO0B04268g"
                     /db_xref="GeneID:8202281"
     mRNA            complement(<352185..>352946)
                     /locus_tag="ZYRO0B04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495093.1"
                     /db_xref="GeneID:8202281"
     CDS             complement(352185..352946)
                     /locus_tag="ZYRO0B04268g"
                     /note="similar to gnl|GLV|CAGL0D05016g Candida glabrata
                     CAGL0D05016g and some similarites with YPR143W
                     uniprot|Q06511 Saccharomyces cerevisiae YPR143W RRP15
                     Essential protein involved in pre-rRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495138.1"
                     /db_xref="GeneID:8202281"
                     /db_xref="InterPro:IPR012459"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ4"
                     /translation="MASKRTRSVRFAESEKPEEKSVEEQVEAESPSDNGDNSEDIGDE
                     SADEASGSDNAEIEEPSSEDDNEDDNEDDEEEEAEEEEEEGDDFPRKKKSKMSKHDDG
                     SAGFSSAMSAILSSHLKAYDRDDPIMARNKKILKKSDSDKLERQAKRALLVEKKKKLN
                     KVRRKDVIPKVTDDSGEKTGEEIRDVLEKEARLKKIARKGAVKLFNAILSTQVNTERD
                     SKTVTGFGQQEKKQRLVDLSKEKFLDMVKAAGDDE"
     gene            <353283..>355478
                     /locus_tag="ZYRO0B04290g"
                     /db_xref="GeneID:8202282"
     mRNA            <353283..>355478
                     /locus_tag="ZYRO0B04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495094.1"
                     /db_xref="GeneID:8202282"
     CDS             353283..355478
                     /locus_tag="ZYRO0B04290g"
                     /note="similar to uniprot|P17119 Saccharomyces cerevisiae
                     YPR141C KAR3 Minus-end-directed microtubule motor that
                     functions in mitosis and meiosis localizes to the spindle
                     pole body and localization is dependent on functional
                     Cik1p required for nuclear fusion during mating potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495139.1"
                     /db_xref="GeneID:8202282"
                     /db_xref="GOA:C5DQZ5"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ5"
                     /translation="MNGIPTTPTRVRSSGSSIPSPKLNGSSPKSYKRRNDSTTPPGSY
                     SPVEQQNNHDNNNDNNNNNNSKNQTISRGATGTSYRSNFHLTSFYKENIRDLNQLQDS
                     LFQKKAQMDVLLDELSECNGKYKNIEFKWEDLKEERSLKNQQMNLKNNELARLKEELV
                     TKNGFLEQGHQLHLQQLRAKNDADINKMENEYRVQLERLKFAKVKKFENERNSLLDKV
                     EEVRNNIITNETNLQNMLRECETNHYRAKENWLQDYQKNWKENVQMNENFSNDVTVLG
                     QQIKTVLEPQCNEKMQEVAALRGKLQNLQNSLKQRQDDTQSMKRQIDEIKGKTVQTKR
                     KRQELHDYIHNTKSELQQIDEILIKEETMRRSLHNELQELRGNIRVFCRIRPPLKYEN
                     PNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQNFKFDRIFDQNETNENVFEEIGQL
                     VQSSLDGYNVCIFAYGQTGSGKTYTMLNPRNGIIPATISHIFSWIENLKERGWNYEIN
                     CQFIEIYNENIADLLRSDQDDIQANAKHEIRHNQETNTTTVTNVTLCPLNSEEQVDGL
                     LRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINS
                     SQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSK
                     TLMFVNISACESHLNETLNSLRFASKVNSTKMIARDSYGFRNENAIINV"
     gene            complement(<355581..>356777)
                     /locus_tag="ZYRO0B04312g"
                     /db_xref="GeneID:8202283"
     mRNA            complement(<355581..>356777)
                     /locus_tag="ZYRO0B04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495095.1"
                     /db_xref="GeneID:8202283"
     CDS             complement(355581..356777)
                     /locus_tag="ZYRO0B04312g"
                     /note="similar to uniprot|Q6B2J1 Saccharomyces cerevisiae
                     YPR140W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495140.1"
                     /db_xref="GeneID:8202283"
                     /db_xref="GOA:C5DQZ6"
                     /db_xref="InterPro:IPR000872"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ6"
                     /translation="MSLPDVLSRGDDFLAQYPRRSSAWQFFSHGTCLATIGLSKLILK
                     AFYNVELNHFNKLERAIDRSKDENRGLLTVMNHMSCVDDPFLWAVFPWRIYRDVDTIR
                     WCLGARNVCFQNKVFGTFFSLGKVLSTERFGASPFQGSIDAAVRLLSPDDTMDLEWFP
                     PSEKVSKPAEAVINMAKKAKENYFPPVKRSRPAWMHVYPEGFVLQLHPPFSNSMRYFK
                     WGVSRMILESTVAPIVVPIFTTGFEKVASEETAGTMIKRYLPANFGAEINVTIGDPIE
                     DSIIEGYRQEWKKLVEKYHDPEHPTDLSPELIEGKEAQGLRSAVAAELRNHIAKIRHE
                     QRNFPKEDPRFESPSWWKNYTATEGDSDPDVRFIGLNWAIRRLQSYLPENNNNTNDDT
                     NNKKNS"
     gene            <356998..>357870
                     /locus_tag="ZYRO0B04334g"
                     /db_xref="GeneID:8202284"
     mRNA            <356998..>357870
                     /locus_tag="ZYRO0B04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495096.1"
                     /db_xref="GeneID:8202284"
     CDS             356998..357870
                     /locus_tag="ZYRO0B04334g"
                     /note="similar to uniprot|Q06508 Saccharomyces cerevisiae
                     YPR139C VPS66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495141.1"
                     /db_xref="GeneID:8202284"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ7"
                     /translation="MEKYTSWRDKGTGIAPFLPPPVSNPGFGTLLLQTLLFAVKLVIL
                     LPLLITYGVSNSKSVLGWILGFLFGWKLDVTVQGVKRRDLGNLRNYPQKGKLYLCNST
                     SALDALALDMISQGPSCFLVPQDHTIFKMNKNQYFEFAQTGSLDASRFGHEVGNIRQL
                     KNTVNFMFLEGTCSNGKSVLPFALNETELLEFLQLPETDRSATLQSIQLKINGSLVTP
                     LKVNKFKYLVTMYTRGVHFKIKLNEPQKLVPLEGLRASLNDNNKFKLVSRTLNVESKR
                     RFVQEYSSKSSYRR"
     gene            complement(<357867..>359033)
                     /locus_tag="ZYRO0B04356g"
                     /db_xref="GeneID:8202285"
     mRNA            complement(<357867..>359033)
                     /locus_tag="ZYRO0B04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495097.1"
                     /db_xref="GeneID:8202285"
     CDS             complement(357867..359033)
                     /locus_tag="ZYRO0B04356g"
                     /note="similar to uniprot|P53272 Saccharomyces cerevisiae
                     YGR122W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495142.1"
                     /db_xref="GeneID:8202285"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ8"
                     /translation="MVELPLRFPELETLQNALPPNVLNQRENSVTSVNKLEGHLDFLA
                     RIDVLLDYSSSLCGILYHDDSSEILNQELIICLVDIAFFYREVSLDVMQGAYGSERTD
                     GAWSTGGSYLRKGLGLLQFALNWILSSAAIADEQSMCSLVEDMIAELKLLQQIGIVVL
                     SLSKLRTKMYKDQRDAVLDFQEQDLKDLAANSVLYSKLVIGCLDTALKCNRGTIINNS
                     LFAYLNSLSFLLLSLDEYNKDETGVAIGMIERSVYYISKIVNKSQLSDPLLSRNRKRD
                     RLKNALQKKPFHPGTGSSTVPWFRKDKDQNLLPLLQETLDDFLLPLIFLLRYRYRQTN
                     DKVNFKSVEDEESNLRKLFPQGKAPDIQFENWSFDQRTCKLAPKPESSSGGRYY"
     gene            359957..360075
                     /locus_tag="ZYRO0B04378r"
                     /db_xref="GeneID:8202286"
     tRNA            join(359957..359994,360032..360075)
                     /locus_tag="ZYRO0B04378r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8202286"
     gene            <361427..>362920
                     /locus_tag="ZYRO0B04400g"
                     /db_xref="GeneID:8202287"
     mRNA            <361427..>362920
                     /locus_tag="ZYRO0B04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495098.1"
                     /db_xref="GeneID:8202287"
     CDS             361427..362920
                     /locus_tag="ZYRO0B04400g"
                     /note="highly similar to uniprot|P53390 Saccharomyces
                     cerevisiae YPR138C MEP3 Ammonium permease of high capacity
                     and low affinity belongs to a ubiquitous family of
                     cytoplasmic membrane proteins that transport only ammonium
                     (NH4) expression is under the nitrogen catabolite
                     repression regulation ammonia permease or uniprot|P40260
                     Saccharomyces cerevisiae YGR121C MEP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495143.1"
                     /db_xref="GeneID:8202287"
                     /db_xref="GOA:C5DQZ9"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:C5DQZ9"
                     /translation="MHGLWKETYDGATVAFIVLGAACVFVMIPGLGFLYSGLARRKSA
                     LSLIWGVVMATLVGMVQWYFWGFSLAFSHTAPNSKFIGDLDSFGFRNVYGKTSDDAVY
                     PELAYAIFQGMFMCVTLSIIAGATAERGRLFPHMVFLFVFATVVYCPVAYWVWAPGGW
                     CYQWGVLDWAGGGPVEILSAVGGFVYSIFLGRRKESLLINFRPHNVSLVTLGTVLLWF
                     GWLLFNSATSLSPNLKSVYAFMNTNLSAATGGMTWCLLDFRLERKWSTVGLCSGIICG
                     LVAATPSSGCITLYGSLIQGIVAGLVCNFATKIKYYLKVDDAMDILAEHGIAGVVGLM
                     FNALFAADWVVGLDGSTEHHGGWITHNYKQMYIQFAYIWAVIGYSAACTAIICFVLDL
                     IPFTKLRVSEEAEARGLDEDQIGEFAYDYVEVRRDYWQWGTDTDNSNEIRLEEVNGQH
                     DPEQYTTNTEESGNLNGEKQLGSDDQQTANRNDEEQVLTPTYSKNPT"
     gene            complement(363385..363458)
                     /locus_tag="ZYRO0B04422r"
                     /db_xref="GeneID:8202288"
     tRNA            complement(363385..363458)
                     /locus_tag="ZYRO0B04422r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=74.61"
                     /db_xref="GeneID:8202288"
     gene            complement(<363742..>365469)
                     /locus_tag="ZYRO0B04444g"
                     /db_xref="GeneID:8202289"
     mRNA            complement(<363742..>365469)
                     /locus_tag="ZYRO0B04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495099.1"
                     /db_xref="GeneID:8202289"
     CDS             complement(363742..365469)
                     /locus_tag="ZYRO0B04444g"
                     /note="highly similar to uniprot|Q06506 Saccharomyces
                     cerevisiae YPR137W RRP9 part of small (ribosomal) subunit
                     (SSU) processosome (contains U3 snoRNA) Rrp9p is an
                     ortholog of the human U3-55k protein the human cDNA
                     partially complements a yeast rrp9 null mutant. (Pluk et
                     al. (1998) Mol. Cell. Biol. 18 488-498.) U3 small
                     nucleolar ribonucleoprotein-associated protein involved in
                     pre-ribosomal RNA processing."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495144.1"
                     /db_xref="GeneID:8202289"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DR00"
                     /translation="MSAGEHSRKRTRTESETPTRDVDEEITDPSSEEEDGEHQGAGDG
                     ESDEDLVDSEEEFKGENPADKRRRLAKEYLKNLKEEAHDVIADGEGLQGENKDVESVT
                     VDDYNNFDAAELDRDILASRLKQDVAEQHGRVFRFFAHKLLLSEAKTTFTRVGENNLT
                     CISCFQPAFNKFQIDDERLSSRNKGKIFAYTASKDLQITKYDITDFDRRPQKLAFTKG
                     GPRFFPQGKYEIENTTEGHYDEILTLAASPDGKYVVSGGKDRKLIVWSAESLAPVKVI
                     PTKDRRGEVLGLTFRKNTDQLYASCADYKIRTYSINQASQLETLYGHHDIVVDISALS
                     MERCVTVGSRDKTAMLWKIPDETRLTFRGGEEIDKLEKRWLRQHATEKENGELEYPDA
                     SEMPVFYGEGSIDVVTMVDDSHFITGSDNGNLCLWSLAKKKPVFVERTAHGVIPPPGS
                     EQISGESNEQIRQRQLQDKRISRPYWITAVHAIPYSNVFFSGSWNGSIKVWKILDNLR
                     GFELLGELPNCNGVVNKIQVVEAGKHGKEVFRVLASVGKEHKFGRWINKLPKARNGIY
                     SAVITQGNF"
     gene            complement(<365704..>368367)
                     /locus_tag="ZYRO0B04466g"
                     /db_xref="GeneID:8202290"
     mRNA            complement(<365704..>368367)
                     /locus_tag="ZYRO0B04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495100.1"
                     /db_xref="GeneID:8202290"
     CDS             complement(365704..368367)
                     /locus_tag="ZYRO0B04466g"
                     /note="similar to uniprot|Q01454 Saccharomyces cerevisiae
                     YPR135W CTF4 Chromatin-associated protein required for
                     sister chromatid cohesion interacts with DNA polymerase
                     alpha (Pol1p) and may link DNA synthesis to sister
                     chromatid cohesion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495145.1"
                     /db_xref="GeneID:8202290"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022100"
                     /db_xref="UniProtKB/TrEMBL:C5DR01"
                     /translation="MPEVVDKSAFDFGGKTLIALTPNGNQLCVTNKAGLSKVLQMNNP
                     EEEPEVFEIPENVTSVVCDSNTSFIVTTLKGDCFRYDFSGKDQLLARSMLPMRDCDVV
                     HNGKMVVIGGDDMELSLVELSEGFKRYSIKADEQVAQLSYSSQTNLLSVSYIDGRVCF
                     YSISSTRPNKVKALEGYIPKNSYNDDHRDELLNHGDEEKDDADDDTVRDVEFRVENRI
                     CARAAWHANGLHFALPCHDYTVKIFSIKDYKLMKTLSNPHSSKAFFIDLKFEPLHGLY
                     LAAVDHNNRLTIWNWQTSEVFYKKELGQRITNFVWKVHPDNKTLDIILGTWSGNIINV
                     KRAAESTEENLNKTNQTKGLFVDSEADEEENLNEPNLHSPPGEVFTDDENDTGAKRHH
                     YDDEQDFVDDDDGAGYVSEHPPLKRAKQGRGRILAPSLGANFQASPKPFTYRPLSQGA
                     TPFGNSDRRYLTMNNVGYVCVVRNNEQNSITVSFFDIGRFVEYHFEDVFGFDVCSLNE
                     NGALFAQSKAGQLHYRPHNSLLSPWTKTLPLQRGERITSVSHTPKRVFVGTSLGYVRI
                     FNEHGVPLMVEKMSPIVALTAQDYKVFAIHFHNYHGITYSLFERSPTSSKYYQRESPL
                     PLTLPQDNLQLEDIDSEFVGFNTLGIKNFFFSAYGDPCVFGIDNVLLVLSKWRSATEN
                     RWLPVLDANMEIWKMSGGKETDVKVWPLGLNYDMLNCILVKGRNMWPEFPLPLPSEME
                     MSIPIFVKSKLLEEQNDQERNGGGDDDEMERQELKIPVQWAAEESFLRSKVLSILLSD
                     TLAHEGELYGNENEILASLTGVHDKSLLRLFAGACTEQNNEMALSLAQDLKQDRALNA
                     AIKIAERAELLQLVKRIDTLRESRIQNEIHE"
     gene            <368532..>369293
                     /locus_tag="ZYRO0B04488g"
                     /db_xref="GeneID:8202291"
     mRNA            <368532..>369293
                     /locus_tag="ZYRO0B04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495101.1"
                     /db_xref="GeneID:8202291"
     CDS             368532..369293
                     /locus_tag="ZYRO0B04488g"
                     /note="similar to uniprot|P53271 Saccharomyces cerevisiae
                     YGR120C COG2 Essential component of the conserved
                     oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
                     tethering complex that functions in protein trafficking to
                     mediate fusion of transport vesicles to Golgi
                     compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495146.1"
                     /db_xref="GeneID:8202291"
                     /db_xref="InterPro:IPR024602"
                     /db_xref="UniProtKB/TrEMBL:C5DR02"
                     /translation="MDFLEEDELDLDLPTITEINRDLFIDQTHQEKEFDVDEFLINNN
                     FQYVPLDSLIHDLSGLSKELEHALPEKIAGKYDDYLKFCKPYTDEDSQSILEIQRTKT
                     DLNKFTTQLNQLTHKDLLRTQSTIDETVAYLRKLDSMIQQLQNHSQLPQLIQLAKEMS
                     TCLHAMCGTDPLDPLLITELTIQLHNLMRRIRQLFDTLSDLNSPFLKHQRNGYQGLLQ
                     EFQISLKLLTARCLEDPNGNQKLSKVLVSILNSSR"
     gene            <369440..>370969
                     /locus_tag="ZYRO0B04510g"
                     /db_xref="GeneID:8202292"
     mRNA            <369440..>370969
                     /locus_tag="ZYRO0B04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495102.1"
                     /db_xref="GeneID:8202292"
     CDS             369440..370969
                     /locus_tag="ZYRO0B04510g"
                     /note="some similarities with uniprot|P48837 Saccharomyces
                     cerevisiae YGR119C NUP57 Essential subunit of the nuclear
                     pore complex (NPC)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495147.1"
                     /db_xref="GeneID:8202292"
                     /db_xref="GOA:C5DR03"
                     /db_xref="InterPro:IPR024864"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="InterPro:IPR025712"
                     /db_xref="UniProtKB/TrEMBL:C5DR03"
                     /translation="MFSFGAGNNTSGGSNTSGGLFGNKPAGNTGFTFGGGSNQGSQPG
                     GFAFGQPNTSSGANNNAVGGTSGGGGLFGNKPAGGGLFGGQNNQQSTGGGLFGSQSNQ
                     QSSGGGLFGGQNNQPSGGGLFGSKPAGSGGLFGGQTNQQGGGGLFGGQNNQQQPQQPS
                     LFGASAQQPQPQQPQPQQPQNSLFGSATTQPSFAWSQPQNNQPMFQQQQQQQQQQQQQ
                     QQQQQQQQQFQQQQQQQLQFQQQHSNYPQQVQEQVVKLKDSWDPTSNKTKLKTFVYNK
                     AKETDARLYNKPPDVTQDDWDHAMDNKPSADVIPVQLYGFEGLNQRNQLQRENVAQAR
                     VILNQILEESTQLQQKHELDTAARILKAQTRNVQIERRILRLGTQLAILKGRGLPLSI
                     TEEKMWSQFQSLLQRSNNPAGLGKTNELWARLAVLKERAKNISDQLDSTVVVINENGG
                     DISTNRGGDKEKTAKRSDEDLENRIDVIAEILSNQQRGICYLNEVLEKDHSNLDKLTK
                     K"
     gene            complement(<371028..>371684)
                     /locus_tag="ZYRO0B04532g"
                     /db_xref="GeneID:8202293"
     mRNA            complement(<371028..>371684)
                     /locus_tag="ZYRO0B04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495103.1"
                     /db_xref="GeneID:8202293"
     CDS             complement(371028..371684)
                     /locus_tag="ZYRO0B04532g"
                     /note="weakly similar to uniprot|P08593 Saccharomyces
                     cerevisiae YPR134W MSS18 Protein involved in splicing
                     intron a15beta of COX1 Involved in splicing of
                     mitochondrial COX1 transcript"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495148.1"
                     /db_xref="GeneID:8202293"
                     /db_xref="UniProtKB/TrEMBL:C5DR04"
                     /translation="MIKNCIALNLKFAQPSKYTFNELSCYRYIVSELNRLGKVLYARP
                     YLFNTQSLSRDNRRLDIVVNGQRQLLSQFFYGLKGIQMDQDSLARSSSMVPLDQPIKD
                     EEDHEGLVQLHEAWKTQLDIYERQKRYELHALPDFVKVEPWVLDTKIPNEADYEGNTH
                     QLKSTNEILTLKSQIYPDFEAMPFEMQKWFIGLGLRSESDQLCQDRLDILTHGFKGFV
                     "
     gene            complement(<371808..>371960)
                     /locus_tag="ZYRO0B04554g"
                     /db_xref="GeneID:8202294"
     mRNA            complement(<371808..>371960)
                     /locus_tag="ZYRO0B04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495104.1"
                     /db_xref="GeneID:8202294"
     CDS             complement(371808..371960)
                     /locus_tag="ZYRO0B04554g"
                     /note="similar to uniprot|P80967 Saccharomyces cerevisiae
                     YPR133W-A TOM5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495149.1"
                     /db_xref="GeneID:8202294"
                     /db_xref="InterPro:IPR019603"
                     /db_xref="UniProtKB/TrEMBL:C5DR05"
                     /translation="MFGLPQQEPSEEEKKLHQQSTNKTVMNAVYAGAILWLTPLALHF
                     VKRQWK"
     gene            <372194..>373324
                     /locus_tag="ZYRO0B04576g"
                     /db_xref="GeneID:8202295"
     mRNA            <372194..>373324
                     /locus_tag="ZYRO0B04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495105.1"
                     /db_xref="GeneID:8202295"
     CDS             372194..373324
                     /locus_tag="ZYRO0B04576g"
                     /note="some similarities with uniprot|Q06505 Saccharomyces
                     cerevisiae YPR133C IWS1 Protein that interacts with Spt6p
                     and copurifies with Spt5p and RNA polymerase II probable
                     transcriptional elongation factor metazoan homologs
                     contain an acidic N terminus mutations in the gene confer
                     an Spt-phenotype"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495150.1"
                     /db_xref="GeneID:8202295"
                     /db_xref="GOA:C5DR06"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:C5DR06"
                     /translation="MSSEEPAQVVDSLASPEGPAGVDTNGTAETTTAAETAAAAAADR
                     QRKHIEKSGSDDESDGDADPEAEAAKNARIATNQQLDEIDNTHRNRQELEEKLDKIIK
                     KPKARRSRRDEDDLEQFLDEKILRLKDEMNVAAQIDVDTLNKRLETGDNSLIAMQKVK
                     LLPKVESVLSKAHLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALEKLPIK
                     TEHLKESGLGRVIIFYTKSKRVEPPLARLADRLIAEWTRPIIGASDNYRDKRILQLEF
                     DAEKMRKKAALDSAKSRKKKSGKKITAQGSTSQSLYEQAAARRNRAAAPAPTTTDYKY
                     APTSNLNPTSGPSKIAGVGSSLNNSEMYKRLTSRLQKGKRSK"
     gene            complement(<373472..>373909)
                     /locus_tag="ZYRO0B04598g"
                     /db_xref="GeneID:8202296"
     mRNA            complement(<373472..>373909)
                     /locus_tag="ZYRO0B04598g"
                     /product="40S ribosomal protein S23"
                     /transcript_id="XM_002495106.1"
                     /db_xref="GeneID:8202296"
     CDS             complement(373472..373909)
                     /locus_tag="ZYRO0B04598g"
                     /note="highly similar to uniprot|P32827 Saccharomyces
                     cerevisiae YPR132W"
                     /codon_start=1
                     /product="40S ribosomal protein S23"
                     /protein_id="XP_002495151.1"
                     /db_xref="GeneID:8202296"
                     /db_xref="GOA:C5DR07"
                     /db_xref="InterPro:IPR005680"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5DR07"
                     /translation="MGKGKPRGLNSARKLRVHRRNNRWAENNYKKRLLGTAFKSSPFG
                     GSSHAKGIVLEKIGVESKQPNSAIRKCVRVQLIKNGKKVTAFVPNDGCLNFVDENDEV
                     LLAGFGRKGKAKGDIPGVRFKVVKVSGVSLWALYREKKEKPRS"
     gene            complement(<374347..>374526)
                     /locus_tag="ZYRO0B04620g"
                     /db_xref="GeneID:8202297"
     mRNA            complement(<374347..>374526)
                     /locus_tag="ZYRO0B04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495107.1"
                     /db_xref="GeneID:8202297"
     CDS             complement(374347..374526)
                     /locus_tag="ZYRO0B04620g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495152.1"
                     /db_xref="GeneID:8202297"
                     /db_xref="UniProtKB/TrEMBL:C5DR08"
                     /translation="MKALQILCSAHPFPPSSSSTLFSQVCQQSIRNCRSAPSPSAFLI
                     YITIYFCPVLPGSRP"
     gene            <374835..>376106
                     /locus_tag="ZYRO0B04642g"
                     /db_xref="GeneID:8202298"
     mRNA            <374835..>376106
                     /locus_tag="ZYRO0B04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495108.1"
                     /db_xref="GeneID:8202298"
     CDS             374835..376106
                     /locus_tag="ZYRO0B04642g"
                     /note="similar to uniprot|P53270 Saccharomyces cerevisiae
                     YGR117C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495153.1"
                     /db_xref="GeneID:8202298"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DR09"
                     /translation="MDNKVTTEYAKVLIAQYLDSHGYQESLVNFLKESDLPRKALLQE
                     NGETLETILYERIKFAEHRVANRLARLTLNEPIDVTHLPIPSWDHSLQFKELKLNDRI
                     IDLTVDAGVGSEKLLISTSNREVKVYDTNSLEPSASLEGNKTSGLLKPCGSLGKTGYH
                     YACGLDGMLNVYDSNGGTPVNSYKIHRRVTTHARSCTIDGQSWFFISYGLDNYLKIHR
                     IQFDTLGVELWAECKIPSACTALDIAIVQDRILIYLAQTEFTHVTCYEVTTSIPALNQ
                     KYQLALNGAQFTPHAFQIRDMKYVPSENILLVATSHTPYMRLLVVQIPREEETSGPLY
                     DKVIRDMATEVPQDNYSQPSLGILPSNSGVIVSSNEGIYAIDIAKGDSWHLNAFPKRR
                     VKCLVVNDSNGLIAVGFADRTTHIARGTVKT"
     gene            <376169..>376735
                     /locus_tag="ZYRO0B04664g"
                     /db_xref="GeneID:8202299"
     mRNA            <376169..>376735
                     /locus_tag="ZYRO0B04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495109.1"
                     /db_xref="GeneID:8202299"
     CDS             376169..376735
                     /locus_tag="ZYRO0B04664g"
                     /note="highly similar to gnl|GLV|CAGL0D04796g Candida
                     glabrata CAGL0D04796g and similar to uniprot|Q06504
                     Saccharomyces cerevisiae YPR131C NAT3 Catalytic subunit of
                     the NatB N-terminal acetyltransferase which catalyzes
                     acetylation of the amino-terminal methionine residues of
                     all proteins beginning with Met-Asp or Met-Glu and of some
                     proteins beginning with Met-Asn or Met-Met"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495154.1"
                     /db_xref="GeneID:8202299"
                     /db_xref="GOA:C5DR10"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DR10"
                     /translation="MTSLQPFELTDLFSLNNVNLDTLTENFPLEFYFEYLILWPELFF
                     KSWEQTAVSGYMMAKTEGKAHEWHSHITAVTVAPEFRRVSLASRLCDTLQAITDSEPH
                     QVNFIDLFVKCNNHLAIALYEKLGYSVYRRVIGYYNSAEDGYPESLKIADDDKDAFDM
                     RQSMPRDQGRSLRADGRRHRCYPHDVKF"
     gene            complement(<376796..>377770)
                     /locus_tag="ZYRO0B04686g"
                     /db_xref="GeneID:8202300"
     mRNA            complement(<376796..>377770)
                     /locus_tag="ZYRO0B04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495110.1"
                     /db_xref="GeneID:8202300"
     CDS             complement(376796..377770)
                     /locus_tag="ZYRO0B04686g"
                     /note="some similarities with uniprot|P45978 Saccharomyces
                     cerevisiae YPR129W SCD6 Protein containing an Lsm domain
                     may bind RNA and have a role in RNA processing
                     overproduction suppresses a null mutation in CHC1 which
                     encodes the heavy chain of clathrin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495155.1"
                     /db_xref="GeneID:8202300"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR025609"
                     /db_xref="InterPro:IPR025761"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="InterPro:IPR025768"
                     /db_xref="UniProtKB/TrEMBL:C5DR11"
                     /translation="MSQYIGKTISLVSVTENRYVGLLEGIDSEKGTVTLGDVRCFGTE
                     GRKGWGPEEIYPNATVYRSVKFNGNEVKDLSILDMKLEDVQPVMAPQPQPNQFQNQMP
                     AAVAGYGVYAPAPNTNGDASGAEQPSQQTSPSAPSATTATTVGGSASTTQQQQQQHQQ
                     QQQKQPQQQQIPPQQPPVASTAGPGVPPAQRVPAEDAQSVQGMPEFDFQGNNAKFAAP
                     SAANATSDTFYNKKSSFFDSISTSTEVNTNMRWQEEKVMNMDTFGQASARPRFTGRGG
                     RRGRGGGRGGFRGRGGGYRGKIRQNSNRGNSGDAHLQNQQQQHGSVEF"
     gene            complement(378370..378451)
                     /locus_tag="ZYRO0B04708r"
                     /db_xref="GeneID:8202301"
     tRNA            complement(378370..378451)
                     /locus_tag="ZYRO0B04708r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=83.48"
                     /db_xref="GeneID:8202301"
     gene            <378912..>380648
                     /locus_tag="ZYRO0B04730g"
                     /db_xref="GeneID:8202302"
     mRNA            <378912..>380648
                     /locus_tag="ZYRO0B04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495111.1"
                     /db_xref="GeneID:8202302"
     CDS             378912..380648
                     /locus_tag="ZYRO0B04730g"
                     /note="weakly similar to uniprot|Q12433 Saccharomyces
                     cerevisiae YOR023C AHC1 Ada Histone acetyltransferase
                     complex component protein of the Ada histone
                     acetyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495156.1"
                     /db_xref="GeneID:8202302"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DR12"
                     /translation="MKLKGHSHTGKGDMEISERPDSSGDVPAQVLFMDSSQGMSSKTS
                     THAPSSSTYYQVTTPKSPHELIFADEVNGNGNNDVNYDVTGTASGGGISEGDEDRSSG
                     GTSGLAKSSRESEEVERLKYETAKAEILEKLHLHTLIGNKEVQGIQREICRLDAQMKL
                     MKTLHDDENLLDKIESYHQKETERKKRQVMTEMNYPAITGFNNNSSGYYADSSSVLPP
                     GSPSGFLPLSASSSAHIPVHHYHTRSKSHGNLSEVPPLHPNASAASNTTIPPGTEESS
                     SFRANQMNMHHRRNYSSTCLTSNSGVVGKTEKNEAIFRRYDGVLIVITCSHCDRSGFT
                     SAQGIVNHARLKHNKTYSSQPLAVLNNQILLPNDKQDPEVMEKFKSLNRDPQKEYLPS
                     ELAIPSMAKRETSPKSGLPNSKSSSSIIPQHNVWPHQQDENNAQISDSTKHLKKAYGK
                     EDFKDLVSMVNSTSQDLENVLKESTPPLGSEVSEMEGGHEHEPKSPSSSSQAFSPLSP
                     SRETIKKNNKKRKQDQNEALKDYKERIKPAEKKARPDVLALSAVPEHEKRSSHYNLRA
                     KSKIRSNADRFD"
     gene            <380852..>382777
                     /locus_tag="ZYRO0B04752g"
                     /db_xref="GeneID:8202303"
     mRNA            <380852..>382777
                     /locus_tag="ZYRO0B04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495112.1"
                     /db_xref="GeneID:8202303"
     CDS             380852..382777
                     /locus_tag="ZYRO0B04752g"
                     /note="similar to uniprot|Q12204 Saccharomyces cerevisiae
                     YOR022C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495157.1"
                     /db_xref="GeneID:8202303"
                     /db_xref="GOA:C5DR13"
                     /db_xref="InterPro:IPR004177"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DR13"
                     /translation="MLHLGIRLCQPLGQARWFASHIVSHQLWFYASDVPKRKPYTPDY
                     KPTRSPQKFLAFSQDDCERLEAFYQSWASSQTKKSRVPVNEDLLFNVDLANMELNAAY
                     WDAPTYEVRRGIWFDSQDRPLSAELTEELEKFRSQLDFDSPEELQNDVCKFTRTYEEG
                     NLVVFVDKKTAYILQDMDGGDLQLNLIRANISSPLLLKGTKIFRSDFQDLHHGSKNKV
                     DHRRNQLGKISELITWEVLDLFGINAPKTKELESQRENDILEREIESDYDNQGPSNSR
                     DINHLVLCVHGIGQTLGKKYEYVNFAHTINQLRTHMKKIYDESPSLQELNHQNGFKDW
                     KNNCNVQVLPITWRHEIGFKTDATAKNPEDPSLPTLSNITVNGVLGLRRLLGDVALDI
                     LLYSEPHYKEKIKTQVTRQINETYHRFKERTPGFGGKVHLIGHSLGSLILWDILSEQH
                     KYKLDFDVNNFFCVGSPIGVFKLIQRSKIGSSEPQEMENLRRERPSCDCLYNLFHVCD
                     PIAYRLEPLVDARMAQYEQRYLPHRTGESITSKMLEIGGSLWKEKHEKSKKNMNKRET
                     LDPEIASRLTDLNYTGRLDYSLPPGFLEVDFISAAKAHISYFEDMDIANFLLKEILSN
                     HQRAEEIVVEKLQIETG"
     gene            <383089..>385182
                     /locus_tag="ZYRO0B04774g"
                     /db_xref="GeneID:8202304"
     mRNA            <383089..>385182
                     /locus_tag="ZYRO0B04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495113.1"
                     /db_xref="GeneID:8202304"
     CDS             383089..385182
                     /locus_tag="ZYRO0B04774g"
                     /note="similar to uniprot|Q12296 Saccharomyces cerevisiae
                     YOL060C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495158.1"
                     /db_xref="GeneID:8202304"
                     /db_xref="GOA:C5DR14"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR002550"
                     /db_xref="UniProtKB/TrEMBL:C5DR14"
                     /translation="MSRSRQSVLPVAFLASIIPRIHTLPLVYRATTGGGNAHQPQEPN
                     YGDRTTYMIISSFLVLLGGVFAGLTLGLMGQDEVYLKVISTSGSPKERKLATKVLSLI
                     SRGKHWLLVTLLLSNVITNETLPIVLDRCLGGGWQAVVSSTVLIVIFGEIIPQSVCVK
                     YGLEIGAFFTPFVQVLMYVMLPVAYPVAVLLDNILGEDHGTMYKKSGLKTLVTLHRTM
                     GVERLTHDEVTIISAVLDLKEKEVQEIMTPIENVFTMSADRILDERTVQEIFDSGFSR
                     IPICLPNEPTNFIGMLLVRVLISYDPEDALPVSHFPLATLPETAPTTSCLNILNYFQE
                     GKSHMCVVSRDLGSSTGAIGVLTLEDVIEELIGEEIVDESDVFVDIHQRTIREQPGPL
                     SKRHITSYLHRLYTNSSKRPSSDFQDGESQALLNHAGSIPNSLPHSPTHSYTEGTPHN
                     LHHSSPPQGSNEAGQGPLVLPSNPAANPLDVNKPFVTIKRPNPTLTARSPSTYGTSRR
                     AKPLGKENSDSNSQHEAQQLPEEEETGNDASASESDNSNGNDPIDHHVKASNKAREFT
                     QKTGAPIQVTTSLGPKKEKVYPQFSNINVHEKPDNTLLSSSYQSTKHGIVESIITVKG
                     VPKTIIEPAKNWDEAPRTSEELESLSREGLEARTTNNNDGNHTNGNKSSKKSHSKNKQ
                     SSKGKSGKKKSNRKR"
     gene            <385611..>387683
                     /locus_tag="ZYRO0B04796g"
                     /db_xref="GeneID:8202305"
     mRNA            <385611..>387683
                     /locus_tag="ZYRO0B04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495114.1"
                     /db_xref="GeneID:8202305"
     CDS             385611..387683
                     /locus_tag="ZYRO0B04796g"
                     /note="similar to uniprot|Q12100 Saccharomyces cerevisiae
                     YDL025C Protein of unknown function potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495159.1"
                     /db_xref="GeneID:8202305"
                     /db_xref="GOA:C5DR15"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DR15"
                     /translation="MPQGSEVDRVSTPEAGHDLQSSASNSSLFARRKLGKGFYKLFGN
                     SSRGADDSSISPHRSGSPASPSSNPATPRSPLANSSSGYFAPTPRKTTSLSSTTRGGG
                     CSSTENNENSTPRSSSPPVQVRNDGTIATTSNPFSRHLHNPRNYTDQLSPSSDEFSHM
                     HPVEILQKQIEDHQELSRSRNNSSTSIDRLATAKSSNSTHDLHPKKSLKLKRFFKKIQ
                     GEPAHRKPLQVTQQQQQQQAVAREIHGIYVRTDQSDSRNKAIFQTENAHELIDKYGMP
                     GKQLGEGASGSVSVVERTDGKKFAVKMFRVRESASQHSQASYSKKVTAEFCVGSTLHQ
                     QNIIETLDMLQEGKTFLVVMEFAPFDFFTLVMSDLMSRHEVECYFRQICNGVAYLHTM
                     GLAHRDLKLDNCVVNDKGILKLIDFGSAVVFKYPFEHDVVPARGIVGSDPYLAPELLQ
                     ESTYDPRPADIWSIAIMYYCMVLRRFPWKAPRQNYNSFKMFCEQPEHEKDPARGPYKI
                     LKLLPHASRNLIGSMLVLDPKKRILMDAVLQDKWLQDIEVCEVDPRGTLIKSPETHEH
                     HLITEDELNDLNKIREMKARAKKEEQVRQGGGEVHHHHHHHHHHHHQDQDKKGHDNHH
                     HHHHHENAEDRTLGNSQPKDDLTTQEQPENRAEQGTKKVLDEKQPELTAGPGQVPQVV
                     KTSAGTVE"
     gene            complement(<388012..>389412)
                     /locus_tag="ZYRO0B04818g"
                     /db_xref="GeneID:8202306"
     mRNA            complement(<388012..>389412)
                     /locus_tag="ZYRO0B04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495115.1"
                     /db_xref="GeneID:8202306"
     CDS             complement(388012..389412)
                     /locus_tag="ZYRO0B04818g"
                     /note="similar to uniprot|Q12265 Saccharomyces cerevisiae
                     YOL061W PRS5 5-phospho-ribosyl-1(alpha)-pyrophosphate
                     synthetase involved in nucleotide histidine and tryptophan
                     biosynthesis one of a five related enzymes which are
                     active as heteromultimeric complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495160.1"
                     /db_xref="GeneID:8202306"
                     /db_xref="GOA:C5DR16"
                     /db_xref="InterPro:IPR005946"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="InterPro:IPR029099"
                     /db_xref="UniProtKB/TrEMBL:C5DR16"
                     /translation="MGEIVIFGGDSHPELVKMICDNLAIHSSKVQMGKFSNGETSVSV
                     RESVREKDVYVIQSGCGHVNDTFMELLILISACKTASASRVTAVMPYFCYSRQPDIPY
                     TNKGAPLISRTSEERSDEFNKSLSTGLTTRKPGAESPFEGPESSIRSDGGRSEDSKPS
                     SSSSNSTSNSDGIKKSVSFSRIPVIADGKDAGSTKADAGELFNAQNAGYKLWVAQAGT
                     LIANLLTTAGADHVITMDLHDPQFQGFFDISVDNLYCKPLAQKHIQFGIPNYKEAVIV
                     SPDAGGAKRATSIADALKLSFALIHKERRSQLLKGPPGATLSSGGTFSTNPKPLVSHL
                     HSADMHPSNSASKYVQTTMLVGDVRNKVCIIVDDLVDTSYTITRAAKLLKDQGASKVY
                     ALITHGIFSGDALSRIRQSAIDKLIVSNTVPQHETVAYLGKDKVDVMDVSRIFAEAIR
                     RVHNGESISMLFEHGW"
     gene            <389669..>391099
                     /locus_tag="ZYRO0B04840g"
                     /db_xref="GeneID:8202307"
     mRNA            <389669..>391099
                     /locus_tag="ZYRO0B04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495116.1"
                     /db_xref="GeneID:8202307"
     CDS             389669..391099
                     /locus_tag="ZYRO0B04840g"
                     /note="highly similar to uniprot|Q99186 Saccharomyces
                     cerevisiae YOL062C APM4 Clathrin associated protein medium
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495161.1"
                     /db_xref="GeneID:8202307"
                     /db_xref="GOA:C5DR17"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5DR17"
                     /translation="MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLDVRS
                     PILTLGSTTFHHIRSNGSDSLWIVTVSRTNANSGAIWEFLYKFNAILDAYDLTKEEKL
                     KEDFMICYEILDVVIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGS
                     NLSTSNLSMPKFLTRNNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILV
                     SRDGSILKAYVDGTIDMTTHLSGTPICQFGLNDSPSVEFGDSLWLDTQEFHNKKAVPK
                     AAAGSVMLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLNLPFKITPVV
                     TPCGSTVEYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMV
                     WRFNKYHGLTENTLSAVTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRV
                     SDKDEKYRVVKWIKYISKSGSYEVRY"
     gene            <391162..>392388
                     /locus_tag="ZYRO0B04862g"
                     /db_xref="GeneID:8202308"
     mRNA            <391162..>392388
                     /locus_tag="ZYRO0B04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495117.1"
                     /db_xref="GeneID:8202308"
     CDS             391162..392388
                     /locus_tag="ZYRO0B04862g"
                     /note="weakly similar to uniprot|Q7LHC7 Saccharomyces
                     cerevisiae YDL027C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495162.1"
                     /db_xref="GeneID:8202308"
                     /db_xref="UniProtKB/TrEMBL:C5DR18"
                     /translation="MGDDGTLHLDINSLIHELHISPGFKVEMHSMMLRPGIGLGFIPR
                     ENPFLLAKGLTSLRPAVPVVMTRKLCHLTRSPSPIVPPRYTRLNTIRFNKLSPSIFSR
                     NFHFTSVRRSGRYPFGNRPPLRVFKISPLVIFLASIGALTVFFLILPFMLTFFLPLFV
                     VGISVYQFRKWKNNTLFDQLLNGLKKSEMRLNSQTLNAMYVKSISKFFDAAQNPNAGV
                     FEEIFKGVDAKMKRDGIWPNANNVSEADRLLSFVQSRVMEAIKSDEQGIRTYFLGDDV
                     SNWIKEGYDFELGSSDCRSFVRGFKNEIIFWIVYPIYLKSSTHPKRHLADVSVAVLQG
                     HHAERNNYDFFLVQTNLIRQNAKCNMAISVKSTSSILPKQFVIIDGGESGDFWTKYDV
                     HENSDGHTEYTIRNTD"
     gene            <392545..>395232
                     /locus_tag="ZYRO0B04884g"
                     /db_xref="GeneID:8202309"
     mRNA            <392545..>395232
                     /locus_tag="ZYRO0B04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495118.1"
                     /db_xref="GeneID:8202309"
     CDS             392545..395232
                     /locus_tag="ZYRO0B04884g"
                     /note="similar to uniprot|Q7LGP7 Saccharomyces cerevisiae
                     YOL063C HUS1 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495163.1"
                     /db_xref="GeneID:8202309"
                     /db_xref="InterPro:IPR014839"
                     /db_xref="UniProtKB/TrEMBL:C5DR19"
                     /translation="MPTDPDESFANWLASRRIVARQHKPYLCFDSRVLAARGSAVLGG
                     KFKVKHYLYDQQLNKGEFSNRAIESIEEHLYELEKYSLVKDEGREFVNNIKEGCDKFE
                     PIWSDALYLNPAERLIPPNQKLLADIYLPEAERAFANPFAHQSLSFKNNLACIYGKWL
                     FMAYQDTIEIHNLDCLFLEKLQWKEMSFSIHLKYCKNSAKFAADREMQKENIEYLFSE
                     NNFHVNHMKVSRFFGNDVLCLCLDGGIVLVYEMSTVFTAIGESMKKKDLQYRKHVNVI
                     PLLLLRIPDSCWSVDISDEGPITFLAAGHNGPGVTVFAFDKTRHSLHPADSYEISSFH
                     NVPNLSFIPGSRDKNGFVTLAFCSIYGNVTTVQLRLDPSSKTIRGRIMDSQFFAAFCW
                     TVIPLKKRDFLKVPKFEFLNLNYQTSFKRSILYSVTQDSLILECHPPSVYCSGELGIG
                     ALTTQIPVPVVPLGWGCQNGITNSNLQLRFTSFDKRGVVTRAHLNPDDAESVVPGYGP
                     LFRVTRHSEPNLEERVIKDLPEDNYRHFYMFGEHGTLKNEHLNDDAFKRYENLVFKNA
                     SSHENESSNGINYRVWSDLDDDKEVQEPFDPHSLREMGKRTHLDKKVTVYCPLPLAGY
                     NRMYFPDICEYTLTQAFADPMDRPVEDTPPDSGEGDSPHHDHLFPVDGLLAAGHLEGQ
                     PKWALHNHTRKVRHLLSMVESDSTGSPFGYRLSELDEDFLFVTSAHHIYLVKAHPLIV
                     TSFTKDRIFPVSKISLCSRHEFLMALDRINFVCHIKELNCLVVASQVGLLSLLRLTEY
                     NGIYSFRQEYILGWNPQSPGDPDPQCILTYTTPDGSGNSCRYCGIDDVVLPFYNIVGL
                     DYSYVPEDKLNCRGPYAVLYVLSGTSLRRVKIYPSSGTN"
     gene            <395546..>398089
                     /locus_tag="ZYRO0B04906g"
                     /db_xref="GeneID:8202310"
     mRNA            <395546..>398089
                     /locus_tag="ZYRO0B04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495119.1"
                     /db_xref="GeneID:8202310"
     CDS             395546..398089
                     /locus_tag="ZYRO0B04906g"
                     /note="similar to uniprot|P54199 Saccharomyces cerevisiae
                     YDL028C MPS1 Dual-specificity kinase required for spindle
                     pole body (SPB) duplication and spindle checkpoint
                     function substrates include SPB proteins Spc42p Spc110p
                     and Spc98p mitotic exit network protein Mob1p and
                     checkpoint protein Mad1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495164.1"
                     /db_xref="GeneID:8202310"
                     /db_xref="GOA:C5DR20"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DR20"
                     /translation="MLPRYNSLPGSEQRQPPRNKGTWKYSLFPEHDQKKVSTKTIFTD
                     DSDDEKISIPPKLSNFGSALLSEKEKENINENDLFEMLPKDSVKPSSLNNEPYYNSVN
                     HTPGNTYASIHSGDPSQSTLFAQYRSHQQPSMTTMNSTDVQDKDGNDFENSFQKIKSM
                     QQSMREELTSRHAERRSRRFLNSSRKEFLGPAKRASAIFPEALDRRFSGTTNSNGTND
                     NNNSTDGLLQLNREESPEEKLSLSSQVDLGDLNPVQYLKKHDLPTSELPRISRLYFEK
                     QKPRKMELARLKQEILRESRTSSSGNNGSGVQHIPIRRENSLSAATQPRRKLSDTSSR
                     NIFQRGFSSPVARSVDSQRNILSDKSSLKHNEYDSYPHSNTLLYSHRKREALANIDVN
                     RNNNDQIYEPELKRYKYFDEHHNNNRNNDYEPESKRYDLFEDHRNGNNNKDEKPISLE
                     RLPSEAPPVAIPIHPSVIQENEFHHREAPKPPVVKKVEIVEPEKRTDSKGKSSNGEAL
                     TRRNATTVNDVEYEKIELLGRGGSSKVYKVKDNNNKLYALKRVVFDEFDDSSVNGFKG
                     EIELLNKLKDKTRVVKLFDYEMEHGVLYLIMECGDHDLSQILNQRAGMPLDIEFVRYH
                     AREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRETQIG
                     TPNYMAPEALVAMNYTGQNDGDKYKQQNRWKVGKPSDVWSCGCIIYQMIYGRPPYGGF
                     QGQNRLLAIMNPEVKIIFSEKTANDEAVPRSILDTMKACLLRNPDKRLTVDEVLDSPF
                     LKPVMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLGKLADIRL"
     gene            complement(<398291..>399559)
                     /locus_tag="ZYRO0B04928g"
                     /db_xref="GeneID:8202311"
     mRNA            complement(join(<398291..399444,399538..>399559))
                     /locus_tag="ZYRO0B04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495120.1"
                     /db_xref="GeneID:8202311"
     CDS             complement(join(398291..399444,399538..399559))
                     /locus_tag="ZYRO0B04928g"
                     /note="highly similar to uniprot|P32381 Saccharomyces
                     cerevisiae YDL029W ARP2 Essential component of the Arp2/3
                     complex which is a highly conserved actin nucleation
                     center required for the motility and integrity of actin
                     patches involved in endocytosis and membrane growth and
                     polarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495165.1"
                     /db_xref="GeneID:8202311"
                     /db_xref="GOA:C5DR21"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="InterPro:IPR027306"
                     /db_xref="UniProtKB/TrEMBL:C5DR21"
                     /translation="MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER
                     GSISTPLKDIMIGEEASDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTS
                     GGKILLTEPPMNPLKNRELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGD
                     GVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEK
                     LSYVSYDLNLDTKLARETTVLVENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPG
                     IGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAA
                     RLDKFKVKIEDPPRRKHMVFIGGAVLASIMAEKDHMWLTKEEWHESGPAAMAKFGPR"
     gene            complement(<399973..>401493)
                     /locus_tag="ZYRO0B04950g"
                     /db_xref="GeneID:8202312"
     mRNA            complement(<399973..>401493)
                     /locus_tag="ZYRO0B04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495121.1"
                     /db_xref="GeneID:8202312"
     CDS             complement(399973..401493)
                     /locus_tag="ZYRO0B04950g"
                     /note="similar to uniprot|P19736 Saccharomyces cerevisiae
                     YDL030W PRP9 Subunit of the SF3a splicing factor complex
                     required for spliceosome assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495166.1"
                     /db_xref="GeneID:8202312"
                     /db_xref="GOA:C5DR22"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="InterPro:IPR024598"
                     /db_xref="UniProtKB/TrEMBL:C5DR22"
                     /translation="MTTLETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVLIDG
                     GIELPSTTAMAVNRIYKSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVDV
                     EDYRDEEINFDKFREAVDQINSKYEDQEGLALDINENIVNHEMFSATFSKSTILSESA
                     RDLDLNQIFTRDEQYGDLLDLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLS
                     PPMDRKNERYGQFLIELFQYVEQFFAKVYVLVNSTILSQRMESDFEEYLRMPIYKSNH
                     GLYCVACGKWFKTPTVFQSHLTGKHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTR
                     GFVERKMAFTTEERMEEMSRLARIYEGPDYAPDEKEIEEKEDSVDTPSEKKMNGGIEL
                     PLGLDGLPIPLWLYKLQGLDVTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGIE
                     ASDAFRSITSIEEAQNLWKRISGNNTTSSRDIEVEDEEGNVMTQQVYEELKKQGLV"
     gene            complement(<401735..>404674)
                     /locus_tag="ZYRO0B04972g"
                     /db_xref="GeneID:8202313"
     mRNA            complement(<401735..>404674)
                     /locus_tag="ZYRO0B04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495122.1"
                     /db_xref="GeneID:8202313"
     CDS             complement(401735..404674)
                     /locus_tag="ZYRO0B04972g"
                     /note="similar to uniprot|Q12389 Saccharomyces cerevisiae
                     YDL031W DBP10 Essential protein involved in ribosome
                     biogenesis putative ATP-dependent RNA helicase of the
                     DEAD-box protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495167.1"
                     /db_xref="GeneID:8202313"
                     /db_xref="GOA:C5DR23"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012541"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DR23"
                     /translation="MGSTLKRKLEDEESNSEGEEGFDIAGNIALTSSESEGEDGSDED
                     SEENYQDVIDYSDDDKEKEAGKKKKEPVKKSDKHDFPILELSDNEEDADAKKKKEDGD
                     ADDISEYFTTNNSESKKHKKGSFPSFGFSKFILNNINKKGFRQPTPIQRKTIPLILQN
                     RDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSK
                     GSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEA
                     DRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKI
                     SENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAEN
                     GKKDRRKKGKKNKAKRPKLPSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYI
                     YGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRV
                     GRTARAGNRGWAYSIVSESELPYLLDLELFLGKKILLAPMYEATCNLLKEKWVNEGND
                     EFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMR
                     TRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEFARN
                     PDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYSV
                     PDAVLEEFEDADQVLEDQETEGKKQKQKSKSFKDSNFFMSHYAPAQSVQDSQLNISSG
                     FTTDAAQASYDLNDDDKIQVHKQTATVKWDKKKKKYVNPQGADNVRYITSESGQKIPA
                     SYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNRRFMHKQVKAPKV
                     PDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKN
                     ARVGKKR"
     gene            <404904..>406130
                     /locus_tag="ZYRO0B04994g"
                     /db_xref="GeneID:8202314"
     mRNA            <404904..>406130
                     /locus_tag="ZYRO0B04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495123.1"
                     /db_xref="GeneID:8202314"
     CDS             404904..406130
                     /locus_tag="ZYRO0B04994g"
                     /note="similar to uniprot|Q12093 Saccharomyces cerevisiae
                     YDL033C SLM3 Mitochondrial protein with a potential role
                     in protein synthesis the bacterial homolog is responsible
                     for the 2-thiolation of mnm5s2U34 in tRNALys tRNAGlu and
                     tRNAGln"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495168.1"
                     /db_xref="GeneID:8202314"
                     /db_xref="GOA:C5DR24"
                     /db_xref="InterPro:IPR004506"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023382"
                     /db_xref="UniProtKB/TrEMBL:C5DR24"
                     /translation="MLSRFAQTVGKRAIKGYKPQKLPNRNDNVIIAMSSGVDSSVSAA
                     LFAEQYPNARGIYIQSWGKSQSLTDPQLEPCYERDWKDVGRVAEHLGIPVDKVNFEKE
                     YWLDVFEPMLESYNKGWTPNPDIGCNRFVKFGKLREYLDQQYGANNYWLVTGHYARVL
                     SSSYNDQPHLLRSFYPAKDQSYYLSQVDTDILGQLIFPTGHLTKPEVRELAVAAGLTT
                     TSQKPDSQGICFVNNSQSGKFKHFLEHYLPNSPGNIVTIEEDGNKRVWGRHPGLWSHT
                     IGQKVGLSMPQGDPRYAGSWYISDKLQDSNELVIVRGRDNPALYQDTVTITNTFSLDL
                     NFRRLMKEAIEQGKLFIQYRSLQDPIAVKDCHFDQDETVLKLGSAQRAMAPGQYCCLY
                     LQNRVLGSGTISRVGT"
     gene            <406256..>407326
                     /locus_tag="ZYRO0B05016g"
                     /db_xref="GeneID:8202315"
     mRNA            <406256..>407326
                     /locus_tag="ZYRO0B05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495124.1"
                     /db_xref="GeneID:8202315"
     CDS             406256..407326
                     /locus_tag="ZYRO0B05016g"
                     /note="similar to uniprot|P32179 Saccharomyces cerevisiae
                     YOL064C MET22 Bisphosphate-3'-nucleotidase involved in
                     salt tolerance and methionine biogenesis dephosphorylates
                     3'-phosphoadenosine-5'-phosphate and
                     3'-phosphoadenosine-5'-phosphosulfate intermediates of the
                     sulfate assimilation pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495169.1"
                     /db_xref="GeneID:8202315"
                     /db_xref="GOA:C5DR25"
                     /db_xref="InterPro:IPR000760"
                     /db_xref="InterPro:IPR006239"
                     /db_xref="InterPro:IPR020550"
                     /db_xref="InterPro:IPR020583"
                     /db_xref="UniProtKB/TrEMBL:C5DR25"
                     /translation="MAFERELFVATQAVRKASLLTKRIQAQVISNRDSTTITKSDSSP
                     VTLGDYAAQTIIIHAIKSNFPDDKVVGEESAEGLSDGFVSEILNQVRENDEIFNKNYP
                     SKTNLDLKETPLQSLQEVKDTIDLGNYEGGPKGRFWCLDPIDGTKGFLRGEQFAVCLA
                     LVIDGVTQVGVIGCPNLSLSAFGGDDLLGYEPFGYLFQAVRGQGASFASAAIDNDWKK
                     IHVRSIDSSEEMVSLEGVEKGHSSHDEQSQIKQFLHITRSLHLDSQVKYCMLALGLGD
                     LYLRLPLSLTYQEKIWDHAAGNVLVQEAGGIHTDAMENVPLNFASGRTLLTKGVIASS
                     GPPGIHDRVVGASNKIISSRLV"
     gene            <407831..>410614
                     /locus_tag="ZYRO0B05038g"
                     /db_xref="GeneID:8202316"
     mRNA            <407831..>410614
                     /locus_tag="ZYRO0B05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495125.1"
                     /db_xref="GeneID:8202316"
     CDS             407831..410614
                     /locus_tag="ZYRO0B05038g"
                     /note="similar to gnl|GLV|CAGL0K01507g Candida glabrata
                     CAGL0K01507g and some similarites with YDL035C
                     uniprot|Q12361 Saccharomyces cerevisiae YDL035C GPR1
                     Plasma membrane G- protein coupled receptor that interacts
                     with the heterotrimeric G protein alpha subunit Gpa2p and
                     with Plc1p sensor that integrates nutritional signals with
                     the modulation of cell fate via PKA and cAMP synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495170.1"
                     /db_xref="GeneID:8202316"
                     /db_xref="GOA:C5DR26"
                     /db_xref="InterPro:IPR017452"
                     /db_xref="InterPro:IPR022596"
                     /db_xref="InterPro:IPR023041"
                     /db_xref="UniProtKB/TrEMBL:C5DR26"
                     /translation="MSNLVKELSHTTRPPLPTNNPHDLPLPHQLLHHNTTAANQVLGL
                     PGMFSTFNAGQLKRLRTVAITSSALSLAFGVVAVFCLINIDKRRKVFRHDLLFFLIVC
                     GFIKALVLMIYPMVILIRDSVYFNPYFFNILGWFTAYTVEGSDLAIFFFAVHFGLLIF
                     RPSRKWRNRRTGNLEGGLYRMRALIWPLTGSIPLLLASLAFVDFTIIDEKKLLEETTL
                     VLYNQRYESKNYARIGGYKPYSAWCYLPPYPLWYKLVLSWGPRYFLIIFILTLYAAIY
                     AFVVKESRKIKRELGDFRRNNDGDEDRGRKKSVKSRSLRFSRFFTKPIAALMRAIKSF
                     CISTDDISEQERDVSGAGTQEHGMFLSFFNGMNEANGRGGHDHNKHTGNNDGYHNDNN
                     NTNTNNHNYNQNNIIGAGLGNDSGRVTRQMMGNPHQLHIDSVIQEGCENLDEEEGNSQ
                     VSEDLFGALSNPSGLHNENEAPPSPEEDDHRLKPSNSKMGVSPIHSIFRPLGGKKNHP
                     EKSNAHTDQKKERVNDVQADFQRHTYAEMKRRRLQIQRNVKLIFVYPFSYIAIWIFPL
                     VVDITQYRYEITHGPIVWLAYIATIVQPLNCFVDTIVFLFRERPWKYSWREVETKELM
                     DAYMLKGELNESDIAELCSSELGRRGWYFRGRLERKDCWRHQPARWKRIAWYLYRFFK
                     GTFKKDYDFKDNCNDENYWNQYYSANTKSRSGTTQKHPSLQKERQFSFPSDSTTLSDA
                     AAQHNNVNKRLSVPNESEYTKVPLFWKAIHFLPMLRAIDLDEVNRQIRLKSKDDDFVI
                     PGLQAVLGASHDNDNKNNIDTRRASVADGGTGIFKPGYSLSATRSEDIGGLPTRWEPS
                     AENPHINTNASATDGEGRSRNGTSVPTAVNMDFSDVVGEGPHGPASKKLSLATVTQDD
                     AIDMLAFLKGPTT"
     gene            <410791..>411930
                     /locus_tag="ZYRO0B05060g"
                     /db_xref="GeneID:8202317"
     mRNA            <410791..>411930
                     /locus_tag="ZYRO0B05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495126.1"
                     /db_xref="GeneID:8202317"
     CDS             410791..411930
                     /locus_tag="ZYRO0B05060g"
                     /note="similar to uniprot|Q08227 Saccharomyces cerevisiae
                     YOL065C INP54 Phosphatidylinositol 4 5-bisphosphate
                     5-phosphatase with a role in secretion localizes to the
                     endoplasmic reticulum via the C-terminal tail lacks the
                     Sac1 domain and proline-rich region found in the other 3
                     INP proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495171.1"
                     /db_xref="GeneID:8202317"
                     /db_xref="GOA:C5DR27"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DR27"
                     /translation="MDILYHRRSHMSSRNWKISLTTFNCGKALPFDQPQLVSRILEEL
                     LPNTIADDIYVIGLQEFVPIWQGSFASVVEPLLQSLSDRIMENLNQQSGKEYSLVGFC
                     NTGAIGLLVVADKNLVKNQVVTCNYRCGYFWSSLKGAVSLCCSLSREGDEPETFTFIC
                     SHLAANKGESYKQQRIEDYKAIMATCQEQFRLTAFKQGHIFFMGDLNFRLEGDQDLEL
                     DYTDPDMIKQLSKTRDELNICKEKGLIFQDFQEANIEFPPTYKYITNQADELNNKREP
                     AWCDRILFKKYPQEDHKVDAYVSIRRSETLQFSDHQPVHLAIQVPRLSAASTMNSPRS
                     LPLTQGTLTGDVADKVIGYGGWAVTKRLHFVVILLIVMYLFSKSF"
     gene            <412137..>413972
                     /locus_tag="ZYRO0B05082g"
                     /db_xref="GeneID:8202318"
     mRNA            <412137..>413972
                     /locus_tag="ZYRO0B05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495127.1"
                     /db_xref="GeneID:8202318"
     CDS             412137..413972
                     /locus_tag="ZYRO0B05082g"
                     /note="similar to uniprot|Q12362 Saccharomyces cerevisiae
                     and weakly similar to YDL036C uniprot|Q12069 Saccharomyces
                     cerevisiae YDL036C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495172.1"
                     /db_xref="GeneID:8202318"
                     /db_xref="GOA:C5DR28"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR006224"
                     /db_xref="InterPro:IPR006225"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DR28"
                     /translation="MAFRYKNCFRWIRNMSNYVNGSPSPSSHEFEKHLLKEIESVKTD
                     QLNKRKRKQIESSSKSQKTKAQTNELRDENGFKLRVVEVNNKRSRQVDPDYEVVVDGP
                     LRRITPYYFTYQTFCKLRWRDRNLFEVFCDEFRDRDQDYYRKTIAGGSVYLNDEPANL
                     ESIIRNGDCIRHKIHRHEPPVTSRPIKVVYEDENLLVIDKPSGIPVHPTGRYRFNTIT
                     KILEKKLGRTVHPCNRLDRLTSGLMFMAKTPKGADEMADQLKAREVTKEYVARVVGEF
                     PVGEVVVDNPLKSLEPKLGLNVVCGMDEEGAKHAKTVFRRVSYDGETSIVKCKPLTGR
                     THQIRVHLQYLGHPIANDPIYSNLKVWGPNLGKNGEADYSQVIEKLNAIGRTESAQSW
                     YHRDSQGELLGNEKCPQCETSLFTDPGPSDLDLWLHAYFYESTELDPTTGDKKWSYCT
                     EFPDWALEPHRKYMKLALEQAAKCGPTTTAFSVGAVLINGTEVISTGYSRELPGNTHA
                     EQCALEKYFSNTGSSELPEDTIIYTTMEPCSFRLSGNDPCVQRIINTNGKIKTVFVGV
                     LEPDTFVKNNSSRSLLQRHGIDYIKIPGYEEKATELATKGHEKTN"
     gene            <414229..>416751
                     /locus_tag="ZYRO0B05104g"
                     /db_xref="GeneID:8202319"
     mRNA            <414229..>416751
                     /locus_tag="ZYRO0B05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495128.1"
                     /db_xref="GeneID:8202319"
     CDS             414229..416751
                     /locus_tag="ZYRO0B05104g"
                     /note="similar to uniprot|P12945 Saccharomyces cerevisiae
                     YDL040C NAT1 Subunit of the N-terminal acetyltransferase
                     NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
                     proteins which influences multiple processes such as the
                     cell cycle heat-shock resistance mating sporulation and
                     telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495173.1"
                     /db_xref="GeneID:8202319"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR021183"
                     /db_xref="UniProtKB/TrEMBL:C5DR29"
                     /translation="MPPRKFLGSKNLAGRAKEHSQFLEALKLYESRQYKKSLKTLDTV
                     LKKDSLNIDALALKGLDLLSLGEKKDAENYVKNAISKIQSIGASAICCHVLGIYMRST
                     QNYAEAIKWFQTSLDNGSANQQIYRDLATLQSQIGDFKGALASRKTYWESFLGYRSNW
                     TGLAVAQDINGEHEKAIDTLSQFEKLVEGKLGEPELYEHNECLMYKNDIMFRAAGDNK
                     DKLHNVLNHLNEVEKDIFDKYGVLDRKAAIYHKLGDSKLASKYIRMLIQRNPDDFQFY
                     GRLEEALGIQNDNEKREILYGNLQKFYPRSDPPKFIPLTFIDDKSKLEAKFADYVIAQ
                     LKRGVPATFGNVKPLYRSRSEFVPISDKVVNEFFQQVDPYKDPVSYVWTCYYLAQHYL
                     YVKDFSKAESFINKAIESTPTLVEFYILKGRILKAIGKLDEAAEWLEEGRKLDLQDRF
                     INTKTVKYLLRANNVDKAVETVSLFTKNDDSVNGVKDLHLVEAAWFIVEQAEAYHRLY
                     LESNKRLHEKLSAVKTQGLVEEDVESQLKELKQLEWSTKKYQGLSLKRFQAVAKMYRQ
                     FEDDQLDFHSYCMRKGTPRAYLEMLDWGRRIYGNPMYVRSMKGASQILFQLHDESAES
                     KKEFDETFNGIMKENAKKSKKVNSQLNKHRDEERKACVAYSESEDKDVFGLELISSQN
                     PLEVFWNEFYKSYATKSSEEARDYVLEFEYQYRTGKLALCLAALNKYAKYHGEKSGLT
                     GAMAITLLLATRESEPFEAIAQKVAFKGCESIKDLPVAERDNQEFDWCSFFTEHYEQD
                     LPSLLFLYKHEPRQGETYKALILNQISTVRPQHQMQVLQYQL"
     gene            <416952..>417566
                     /locus_tag="ZYRO0B05126g"
                     /db_xref="GeneID:8202320"
     mRNA            <416952..>417566
                     /locus_tag="ZYRO0B05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495129.1"
                     /db_xref="GeneID:8202320"
     CDS             416952..417566
                     /locus_tag="ZYRO0B05126g"
                     /note="similar to uniprot|P32607 Saccharomyces cerevisiae
                     YOL067C RTG1 Transcription factor (bHLH) involved in
                     interorganelle communication between mitochondria
                     peroxisomes and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495174.1"
                     /db_xref="GeneID:8202320"
                     /db_xref="GOA:C5DR30"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DR30"
                     /translation="MNGSVPSSVQSSNSISKVDRRRRDNINDRIQQLLTMIPQEFFQE
                     YNRSNNDSETSLLDTPVSGTPKESSIAKAKSTGTKDGKPNKGQILTQTVEYINALQNQ
                     VDSNNREEAELIFKVQELSKKTGTIINDVNLENTSAEVALSKIGVGPLAGNTDEPLQS
                     VSPQLQASSVAASTVPGSIPAPQNSSRSTKRTSGFEYGGYTEYS"
     gene            <417804..>419396
                     /locus_tag="ZYRO0B05148g"
                     /db_xref="GeneID:8202321"
     mRNA            <417804..>419396
                     /locus_tag="ZYRO0B05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495130.1"
                     /db_xref="GeneID:8202321"
     CDS             417804..419396
                     /locus_tag="ZYRO0B05148g"
                     /note="similar to uniprot|P53685 Saccharomyces cerevisiae
                     YOL068C HST1 NAD()-dependent histone deacetylase essential
                     subunit of the Sum1p/Rfm1p/Hst1p complex required for
                     ORC-dependent silencing at HMR and for mitotic repression
                     of mid-sporulation genes non-essential subunit of the
                     Set3C deacetylase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495175.1"
                     /db_xref="GeneID:8202321"
                     /db_xref="GOA:C5DR31"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR007654"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DR31"
                     /translation="MTTVFGSNVEGLSHKRRYSQNGEQAKVAGDKKTRLGESSDNANG
                     NGTYASADNVLQVPSKGDELQDVSVGSHAHDTDVLAPVAPQKQISIGKDRHTNKYVFP
                     HISRDDLVNARKFLKYYGLRKFLDSYLPEELNSLYIYFLIKLLGFEIKDREMVNAIYK
                     HVELPEPSAPPRKDLIYNDFEDPLEKRHAVRLIKDLQKAINKVLCTRLRLSNFTTPDA
                     FVERLQSAKSILVLTGAGVSTSLGIPDFRSSEGFYSKIRHLGLEDPQDVFNYDIFMQD
                     PSVFYNIAHLVLPPENIYSPLHGFIKMLQDKGKLLRNYTQNIDNLESYAGIDPEKVVQ
                     CHGSFATASCTTCHWKLPGDKIFENIRRLELPLCPYCYMKRKEFFPNDSVIPSGGNGG
                     SEDISAGLNTPLKSHGVLKPDITFFGEALPSKFHKTIREDILKCDLLVCIGTSLKVAP
                     VSEIVNMVPSHVPQILINRDPVKHAEFDLNLLGYCDDVATLIAQKCSWDIPHERWNTL
                     KNKKFNCIESDRGVYSITPKED"
     gene            <419579..>420328
                     /locus_tag="ZYRO0B05170g"
                     /db_xref="GeneID:8202322"
     mRNA            <419579..>420328
                     /locus_tag="ZYRO0B05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495131.1"
                     /db_xref="GeneID:8202322"
     CDS             419579..420328
                     /locus_tag="ZYRO0B05170g"
                     /note="similar to uniprot|Q07350 Saccharomyces cerevisiae
                     YDL043C PRP11 Subunit of the SF3a splicing factor complex
                     required for spliceosome assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495176.1"
                     /db_xref="GeneID:8202322"
                     /db_xref="GOA:C5DR32"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DR32"
                     /translation="MDYQNRAGSKKGGGGIASDSQANLARRKQVDELLRQGQQVPYTF
                     QDEADELNRNPYIYKNHSGKLVCKLCNTIHTAWSSVERHLSGNKHGLNVLRRGSANDK
                     NGGPSKQQEDQDHEFLEAVDSKRRNLRHNGIVPDCKTALVKDKETDQLGIAIQVDYNA
                     EEDSNDEQVISPFIRIVSGLELSESDQNDKKYVVIAYEPFENVAIEIPSDKEIVMNKN
                     YEDRSSLDELNGKCTFWDVDAHKFYVQLFFA"
     gene            complement(<420331..>421653)
                     /locus_tag="ZYRO0B05192g"
                     /db_xref="GeneID:8202323"
     mRNA            complement(<420331..>421653)
                     /locus_tag="ZYRO0B05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495132.1"
                     /db_xref="GeneID:8202323"
     CDS             complement(420331..421653)
                     /locus_tag="ZYRO0B05192g"
                     /note="similar to uniprot|P33895 Saccharomyces cerevisiae
                     YOL069W NUF2 Component of the evolutionarily conserved
                     kinetochore-associated Ndc80 complex
                     (Ndc80p-Nuf2p-Spc24p-Spc25p) involved in chromosome
                     segregation spindle checkpoint activity and kinetochore
                     clustering"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495177.1"
                     /db_xref="GeneID:8202323"
                     /db_xref="GOA:C5DR33"
                     /db_xref="InterPro:IPR005549"
                     /db_xref="UniProtKB/TrEMBL:C5DR33"
                     /translation="MNNDIFPLLEIPELAICLQSCDFSLATEDNIARPTSMYVMTLYK
                     QIIDNFMGISADSLISIGREGNEEEDAAYNATLQVLVLNKICFKFFQNIGVNDFNMLD
                     LYKPDALRTRRLLSAVVNYARFREERMFDCNRFISQTEALLGQLRSKFDDYNLLQQQL
                     EDYDEEATHFGGPELESLEENNKELEAQLKNLTQVQQTLSLDYNNYKDQKQKMLKELE
                     SFGFQLVELESLKEKLSKYSETNLQALQDGISELQTMLNDKQRNLTELQKSQQNFEVS
                     MQTFQRVIEELYELLRIISTELQESHMKESNLMDLKQQLIIRRDKMENMLSSGLMVKM
                     SVLQEQLDAHRTQLDDLERNARLESERYDQELMELQQEYADKVVPQVQQAEQNIERDF
                     ILGQVKELEQKMQSIKVDFQNEVDAVELEYSLLAGHINKYMETMLDKL"
     gene            <421870..>423561
                     /locus_tag="ZYRO0B05214g"
                     /db_xref="GeneID:8202324"
     mRNA            <421870..>423561
                     /locus_tag="ZYRO0B05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495133.1"
                     /db_xref="GeneID:8202324"
     CDS             421870..423561
                     /locus_tag="ZYRO0B05214g"
                     /note="weakly similar to uniprot|P38866 Saccharomyces
                     cerevisiae YHR176W FMO1 Flavin-containing monooxygenase,
                     localized to the cytoplasmic face of the ER membrane;
                     catalyzes oxidation of biological thiols to maintain the
                     ER redox buffer ratio for correct folding of disulfide-
                     bonded proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495178.1"
                     /db_xref="GeneID:8202324"
                     /db_xref="GOA:C5DR34"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:C5DR34"
                     /translation="MIKKVAVIGGGPAGLCSVYQALKSQSEDYGFECVGFEGKSKLGG
                     VWSDTPGESLESPTVVGQLAKLQDPTIAHDPRNIFYDNSPLVNPADGSIQLKTLSGTG
                     NKKPLKISRRQSLRDGICFADKTGIYDDFVSNTPKEMMSFENSSIGQSNPDIYPLVDL
                     PSIKKAFHEFIDKNQLQSHYRMNTSVEYLDKFGPTKYVIVAKKSDPATDYDEWYLESF
                     DAVIIANGHFLTPYIPYYMSQPKDGELAAKTIHDFNKKFSGALVHLRDIDGWYHNVLP
                     QLPEKSQHRRLVIVGKSFSCMDVLKRIQHLQDSGDYEIIISTNQKPEPDERSPFKWFD
                     EWLLQTDRVTIKPQIQEFDLSTNDPQIKFVDGSHYKVDYVLFATGYLYSFPFISPQLL
                     ESCRITTTPDPRNEDHQPSNVSRVTGLYLHTFSIAEPTLTFCGISSNANFQSFDISAK
                     AIVGAFTKFNKQFQLQNPVDFPHFDSVWSQVLPPIREQLMWTQERYLKTGNSGAFHYY
                     FPLELLFQEWLEPSKRIFPDGEQVQFPSSWREQRKDGFERLQKLFQNAMQTGSSH"
     gene            <423794..>425356
                     /locus_tag="ZYRO0B05236g"
                     /db_xref="GeneID:8202325"
     mRNA            <423794..>425356
                     /locus_tag="ZYRO0B05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495134.1"
                     /db_xref="GeneID:8202325"
     CDS             423794..425356
                     /locus_tag="ZYRO0B05236g"
                     /note="similar to uniprot|Q08229 Saccharomyces cerevisiae
                     YOL070C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cell
                     periphery cytoplasm and bud neck potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495179.1"
                     /db_xref="GeneID:8202325"
                     /db_xref="UniProtKB/TrEMBL:C5DR35"
                     /translation="MEDYQSPSQVSLNTKRLSAMIDSLHQDQDDKDLLNNTRESSPVT
                     TPKRIQHPHSKMTSNQGSPTKLPRSPGGFNVALNTPDKDYRASMLSNYSGVVQEGVGV
                     SYVMKNPQSVIKEESKPRLPTFPSAETIQASSRKPTGASEDVVLKKVENVTTGRGISN
                     ASAGGSRSSSEAPRHGSLKLLSINGNKRSVQPKSSIGSGNMASESETSNQNTDLSNTP
                     KNQQNDEQFPRISTPRVDSDTESIATSIIPEVTTTTNGHDKGIPPERSETTDYNPAIP
                     PRNRNRPLSKYLLQEDDDVVELDDEEHNSRSLKIPDSRTRGSSVTNVSETYYSVAGSD
                     AKGDRVDIDLTNEDDGAEEVDTYLSRPLPTVPQSAEVHRDSTVKREQGREPEVVTTLT
                     STSLKNQGGEDSDDQYEYIDESGRVLENPTPQITPSSHKTGSTKNKRKKQQELRQFDV
                     DTLSQLLNVTKGTLIGAEFANLGMKIEEKRALERLVDSLSRLTADMVLDPDRYEEGLR
                     RLNKATKALEGF"
     gene            <425528..>426751
                     /locus_tag="ZYRO0B05258g"
                     /db_xref="GeneID:8202326"
     mRNA            <425528..>426751
                     /locus_tag="ZYRO0B05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495135.1"
                     /db_xref="GeneID:8202326"
     CDS             425528..426751
                     /locus_tag="ZYRO0B05258g"
                     /note="weakly similar to uniprot|P10849 Saccharomyces
                     cerevisiae YDL044C MTF2 Mitochondrial matrix protein that
                     interacts with an N-terminal region of mitochondrial RNA
                     polymerase (Rpo41p) and couples RNA processing and
                     translation to transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495180.1"
                     /db_xref="GeneID:8202326"
                     /db_xref="UniProtKB/TrEMBL:C5DR36"
                     /translation="MRNTLKSSQLIMFGLRNSLISLKGTRTLTNYTRCCQQQRDKILS
                     KNPTTTGHFKDEDDWTSVQERQVFDKIFEELASKQEMRHRNSQEILHQAQVANNNKNR
                     KDGVHVVFGKKKEELSPQDQKLKDFLESTGRKSKDTAAKITKDDIRLKPVSLIEQTED
                     KPSILPNLNSKFNEETLHDLKSRIQLKATLDTAMKPFINGLVEKIETDYDFFQVVKEL
                     ITVYLQRDQQLDIGDQLVSKNLINQIETSCIDDPHRLPAPYQITLPFTLVKLLTVDEL
                     NFPSYSKYTIASYIYQECKKSSDVSLYLNVCDVDFYNVLLQLSWDNFREINQLKQYTT
                     EMSINGIMGDLYTVEMLDKICYDLRYLNDDIPDEETTENIANQSAVGVVWCRENALQL
                     NQVETYLTRLKESLA"
     gene            <426980..>427864
                     /locus_tag="ZYRO0B05280g"
                     /db_xref="GeneID:8202327"
     mRNA            <426980..>427864
                     /locus_tag="ZYRO0B05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495136.1"
                     /db_xref="GeneID:8202327"
     CDS             426980..427864
                     /locus_tag="ZYRO0B05280g"
                     /note="similar to uniprot|P38913 Saccharomyces cerevisiae
                     YDL045C FAD1 Flavin adenine dinucleotide (FAD) synthetase
                     performs the second step in synthesis of FAD from
                     riboflavin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495181.1"
                     /db_xref="GeneID:8202327"
                     /db_xref="GOA:C5DR37"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DR37"
                     /translation="MAAPSLASTSERCHEIAQSYLQIEEPLSQIIRETQNAIKLTQKL
                     LLNEIFPRWSPFNGEISFSYNGGKDCQVLLIIYLGCLWEYYKTNMNGQEFPLKTLKAV
                     FIDQDKTFQTLEQFVESTKKRYSLSLYESDRNHTKALSMPEAFHKYLGDQPETKAIVV
                     GIRYADPFAQDLKPIQRTDDGWPDFLRLQPLLHWKLAYIWSFLLYSGEPICGIYSVGF
                     SSLGDINHTLPNPYLAKTNDLPLRYQWEITHGCEGVVNCSPLSSQDSHFQNNEYLPGW
                     YLLDDSLERCGRIKKNKT"
     gene            complement(<427933..>428220)
                     /locus_tag="ZYRO0B05302g"
                     /db_xref="GeneID:8202328"
     mRNA            complement(<427933..>428220)
                     /locus_tag="ZYRO0B05302g"
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /transcript_id="XM_002495137.1"
                     /db_xref="GeneID:8202328"
     CDS             complement(427933..428220)
                     /locus_tag="ZYRO0B05302g"
                     /note="similar to uniprot|O75012 Saccharomyces cerevisiae
                     YDL045W-A MRP10 Mitochondrial ribosomal protein of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein YmS-T"
                     /protein_id="XP_002495182.1"
                     /db_xref="GeneID:8202328"
                     /db_xref="InterPro:IPR017264"
                     /db_xref="UniProtKB/TrEMBL:C5DR38"
                     /translation="MSGKPPIHRLPPLPRLKVKKPIIRQEANKCLVLMSNLLQCWSSN
                     GHMNPVCENLAKDLKYCTAENAMGKGNKVEKSNINYHAARLYNKVGGKPHD"
     gene            complement(<428422..>428898)
                     /locus_tag="ZYRO0B05324g"
                     /db_xref="GeneID:8202329"
     mRNA            complement(<428422..>428898)
                     /locus_tag="ZYRO0B05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495138.1"
                     /db_xref="GeneID:8202329"
     CDS             complement(428422..428898)
                     /locus_tag="ZYRO0B05324g"
                     /note="highly similar to uniprot|Q08230 Saccharomyces
                     cerevisiae YOL071W EMI5 Non-essential protein of unknown
                     function required for transcriptional induction of the
                     early meiotic-specific transcription factor IME1 also
                     required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495183.1"
                     /db_xref="GeneID:8202329"
                     /db_xref="GOA:C5DR39"
                     /db_xref="InterPro:IPR005631"
                     /db_xref="InterPro:IPR028882"
                     /db_xref="UniProtKB/TrEMBL:C5DR39"
                     /translation="MYLPRISFIASKTATRFFYQPQFLVSTTHLYRGLATKSKDDVSL
                     RIKVEPIKRHNEPLDRKRARLIYQSRKRGILETDLLLGGFAAKYLKEMTPEQLAEYDS
                     LLDELDWDIYYWATKNYETSPIPEKWKNSELMKKLQVYAENKDKKILRMPDLKEYQ"
     gene            complement(<429144..>429680)
                     /locus_tag="ZYRO0B05346g"
                     /db_xref="GeneID:8202330"
     mRNA            complement(<429144..>429680)
                     /locus_tag="ZYRO0B05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495139.1"
                     /db_xref="GeneID:8202330"
     CDS             complement(429144..429680)
                     /locus_tag="ZYRO0B05346g"
                     /note="similar to uniprot|Q12408 Saccharomyces cerevisiae
                     YDL046W NPC2 Putative homolog of human NPC2/He1 which is a
                     cholesterol-binding protein whose deficiency causes
                     Niemann-Pick type C2 disease involving retention of
                     cholesterol in lysosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495184.1"
                     /db_xref="GeneID:8202330"
                     /db_xref="InterPro:IPR003172"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DR40"
                     /translation="MKLFLALLALFSTAFASLLPFNGFHSLEVHQLATNKPIPGGSPV
                     LQCDVDDKQLLDISSVELSPNPPQRGHNLTIVASGQLHQELVDGAYVDVEVRLGYIRL
                     LYNTYDLCEQLEEHDVDDLKCPIKPGTYNLKKEVSIPAEVPPGRYVFVMRAYTYDDKL
                     ISCLTGEVLFPAGQVRLF"
     gene            complement(<430175..>431110)
                     /locus_tag="ZYRO0B05368g"
                     /db_xref="GeneID:8202331"
     mRNA            complement(<430175..>431110)
                     /locus_tag="ZYRO0B05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495140.1"
                     /db_xref="GeneID:8202331"
     CDS             complement(430175..431110)
                     /locus_tag="ZYRO0B05368g"
                     /note="highly similar to uniprot|P20604 Saccharomyces
                     cerevisiae YDL047W SIT4 Type 2A-related serine-threonine
                     phosphatase that functions in the G1/S transition of the
                     mitotic cycle cytoplasmic and nuclear protein that
                     modulates functions mediated by Pkc1p including cell wall
                     and actin cytoskeleton organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495185.1"
                     /db_xref="GeneID:8202331"
                     /db_xref="GOA:C5DR41"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DR41"
                     /translation="MVDSNPDEWLEKIKKCQSLTENEMKQLCEMVKELLMEESNIQPV
                     QTPVTVCGDIHGQFHDLLELFRTAGGFPDSVNYIFLGDYVDRGYYSLETFTLLMCLKV
                     KYPSRITMVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGRI
                     LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEDWQVSPRGAGWLFG
                     SKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKV
                     DEDLEPTFKIFSAVPDDYIQETAASNSTQRGGYFL"
     gene            complement(<431421..>432800)
                     /locus_tag="ZYRO0B05390g"
                     /db_xref="GeneID:8202332"
     mRNA            complement(<431421..>432800)
                     /locus_tag="ZYRO0B05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495141.1"
                     /db_xref="GeneID:8202332"
     CDS             complement(431421..432800)
                     /locus_tag="ZYRO0B05390g"
                     /note="similar to uniprot|Q08231 Saccharomyces cerevisiae
                     YOL072W THP1 Nuclear pore-associated protein forms a
                     complex with Sac3p that is involved in transcription and
                     in mRNA export from the nucleus contains a PAM domain
                     implicated in protein-protein binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495186.1"
                     /db_xref="GeneID:8202332"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="UniProtKB/TrEMBL:C5DR42"
                     /translation="MNYSLAQFLKDVAAGNYNVISIDLKNNGMVLASLQNELNRGPKS
                     RHDDKSLEKLIESHKFHGGNWTRFNILLVSFLQYCRDVDPWSLWKSCDLIFNFYQNLN
                     NCLLNDSYPIDNLVPLFRSHTEYVIPLAKRLDSNYLIIGTKRHQLLSFISSVISRLFN
                     SIKKLENADTIPAKQTILMYIVNKINNIYFQIDSPQLCSNIFKNFRPKSMAPFREYPI
                     KEQIEYRYLLGRYYLLNNMVTNAFVQLNSAYRQLALVLDCVHPDYIPQLRRNLVRILI
                     YLVPTGLMIGKLPRLNLIRSLNATIADRYSELARHVRGGSIKGLNGWLQTHESELRKH
                     DLLLVLLEKLPMITYRYLIRSVVQTFVTTQDSGRLPYNVVETAMRVSIGPIEQPLTCY
                     NAIHDPKNLENVLVTLINLGLLRGNCFPLLRTCVVKKTHQTQEILPPIQDRVVQAFPL
                     NSDDAWLDG"
     gene            <432923..>433978
                     /locus_tag="ZYRO0B05412g"
                     /db_xref="GeneID:8202333"
     mRNA            <432923..>433978
                     /locus_tag="ZYRO0B05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495142.1"
                     /db_xref="GeneID:8202333"
     CDS             432923..433978
                     /locus_tag="ZYRO0B05412g"
                     /note="weakly similar to uniprot|P48412 Saccharomyces
                     cerevisiae YGR072W UPF3 Component of the nonsense-mediated
                     mRNA decay (NMD) pathway along with Nam7p and Nmd2p
                     involved in decay of mRNA containing nonsense codons"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495187.1"
                     /db_xref="GeneID:8202333"
                     /db_xref="GOA:C5DR43"
                     /db_xref="InterPro:IPR005120"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DR43"
                     /translation="MPNMAVDEPHKAANNPSQKQNKGNGKKNDKKSADGGDKTAPKSF
                     RRSKARNNNRRRDRGTKRGPPGVKLILRLLPPTLTKDQFLETLKPVVGDLSSWQLLRW
                     YYVQGYYTSKIFAEPVYSRCYFIFSNMDQLKHFAQLVEPLTFVDDKDNSAKAVLKLSS
                     YCESYDDDNRKPSRSSEALEGSLDQDIFFQTFMNSMKLMEQSSEYSYADVNLLKPLEK
                     EMNKQRELELAIQKRSESALVALAGDNKPKKSKKKKKKSQQKEVKEPKPKKNKTKKSK
                     SGAQAGGKGSTTAPASDGKSGDNSNVVILEAAGKKELQRRKKVQDTDGKPTEKSKSSA
                     KKNSKKPVKLLKKEPQE"
     gene            complement(<433980..>434597)
                     /locus_tag="ZYRO0B05434g"
                     /db_xref="GeneID:8202334"
     mRNA            complement(<433980..>434597)
                     /locus_tag="ZYRO0B05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495143.1"
                     /db_xref="GeneID:8202334"
     CDS             complement(433980..434597)
                     /locus_tag="ZYRO0B05434g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495188.1"
                     /db_xref="GeneID:8202334"
                     /db_xref="GOA:C5DR44"
                     /db_xref="InterPro:IPR007248"
                     /db_xref="UniProtKB/TrEMBL:C5DR44"
                     /translation="MDITRRYNRALAQKPLLTKVLTGAILASLGELTSQLTTGFISKK
                     QQGILKKLSYVGKIIARNPSKILLMFCYGGFINAPINHYLYGWITQITNGKIVSTKLR
                     KLVQLIASLAIVSPIQVGCLVSALTVVNQNVGWALSKYPSMIRENLKAKYFKILSSSL
                     VTSTILVSIAQRYISPAKWSVFFNFAYAILGTGQNIYLKIASTAK"
     gene            <435020..>435451
                     /locus_tag="ZYRO0B05456g"
                     /db_xref="GeneID:8202335"
     mRNA            <435020..>435451
                     /locus_tag="ZYRO0B05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495144.1"
                     /db_xref="GeneID:8202335"
     CDS             435020..435451
                     /locus_tag="ZYRO0B05456g"
                     /note="highly similar to uniprot|Q02260 Saccharomyces
                     cerevisiae YGR074W SMD1 Homolog of human core snRNP
                     protein D1 involved in snRNA maturation U6 snRNP protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495189.1"
                     /db_xref="GeneID:8202335"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR027141"
                     /db_xref="UniProtKB/TrEMBL:C5DR45"
                     /translation="MPMKLVNFLKKLRNEQVTVELKNGTTVWGTLQTVSPQMNATLTD
                     VRLSLPRSTSNSSTLASVYLSDGSLSQNEPSTTSLQYINIRGSTIRQIILPDSLNIDS
                     LLVDERQLNKLRRAGKVSNDSNKKRRADFGENTNKRIRRGV"
     gene            complement(<435448..>436140)
                     /locus_tag="ZYRO0B05478g"
                     /db_xref="GeneID:8202336"
     mRNA            complement(<435448..>436140)
                     /locus_tag="ZYRO0B05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495145.1"
                     /db_xref="GeneID:8202336"
     CDS             complement(435448..436140)
                     /locus_tag="ZYRO0B05478g"
                     /note="similar to uniprot|Q00723 Saccharomyces cerevisiae
                     YGR075C PRP38 Unique component of the U4/U6.U5 tri-snRNP
                     particle dispensable for spliceosome assembly but required
                     for conformational changes which lead to catalytic
                     activation of the spliceosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495190.1"
                     /db_xref="GeneID:8202336"
                     /db_xref="InterPro:IPR005037"
                     /db_xref="UniProtKB/TrEMBL:C5DR46"
                     /translation="MPQEFHVESFLSPKQLNHQSVSFVIPRILRDRIHNAMYYRVNLN
                     TASLRGDTMNCLSRILVRDLGALKDGSVNQVNVLGGVEFQCLLMKLVEIKPTFDQLTT
                     MLQDDENFNNKYIVGLILTYLRIQYYYLPVDDPWARRCQSFFRQYYNDYRKLKSVQLD
                     QDCWSKSQTINVDILHTDELVDWLLVKDDIWGIPLGKCQWTEINDDDDDDDDDDDDDD
                     ESDSEDSDHEED"
     gene            complement(<436273..>436737)
                     /locus_tag="ZYRO0B05500g"
                     /db_xref="GeneID:8202337"
     mRNA            complement(<436273..>436737)
                     /locus_tag="ZYRO0B05500g"
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /transcript_id="XM_002495146.1"
                     /db_xref="GeneID:8202337"
     CDS             complement(436273..436737)
                     /locus_tag="ZYRO0B05500g"
                     /note="similar to uniprot|P23369 Saccharomyces cerevisiae
                     YGR076C MRPL25 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL25"
                     /protein_id="XP_002495191.1"
                     /db_xref="GeneID:8202337"
                     /db_xref="UniProtKB/TrEMBL:C5DR47"
                     /translation="MSSKQLFDLLPSQLKNFFKSYPPSIQYATKPTSTHAINANPFLP
                     NKHPVTNRYHDPKYSLRRMSDLYKMASLYGVQDLLPPRNKMFFEEKYDNKKMMKGVLM
                     PKGHKHELVHDEKMAKMAEAIKNADKYIMEVKGSKYKRRIERKQEEQRTTWF"
     gene            complement(<436880..>438598)
                     /locus_tag="ZYRO0B05522g"
                     /db_xref="GeneID:8202338"
     mRNA            complement(<436880..>438598)
                     /locus_tag="ZYRO0B05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495147.1"
                     /db_xref="GeneID:8202338"
     CDS             complement(436880..438598)
                     /locus_tag="ZYRO0B05522g"
                     /note="similar to uniprot|Q756P6 Ashbya gossypii AER208C
                     AER208Cp and weakly similar to YGR077C uniprot|P53248
                     Saccharomyces cerevisiae YGR077C PEX8 Required for
                     peroxisome assembly peroxisome associated protein
                     containing a PTS1 signal"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495192.1"
                     /db_xref="GeneID:8202338"
                     /db_xref="UniProtKB/TrEMBL:C5DR48"
                     /translation="MDFDHAVTSLIGLLRNGIPQDGSVLLNNLVYYTPRLRNVRSLEN
                     LIRSTFESYVWANKDLFELYEMSQAIVQWKLEISEPTISLQEFYSAWDLCFANCNAWT
                     PQKLAILGGILSTKSKFEYLQRNHFLDDSGIVIKLYGYWRNEYFLPVWCSLIGKSQPL
                     SRLDELVAIYSTISDPIDVKKNQVPWDTVTWSLTRLSTNYLASPPFGDSPSTRHLNQF
                     VKTLQISIERNNQLVISGALGALCRECFNLCAREAGSSNPNKNYMGEYYRNILFAVII
                     ELKSILDATRRIPENWYPQIIMCLFFTSFIAKDIGIVGFESYEYVYDVVTTGITICPN
                     RWVYMQVLDTMIGNVWNGIPIRSNKPNDAKRLFMLNYMERTLPEFSHLTPNFIEHVIR
                     PLELSYIDSQDVEVRESVHLVLLSLFQNSISGDNLLTWQAHHYHEYVALATEHFLQNK
                     LSEAQLAIVYQGMASRLPLLQVVDRHLTRNTLHYTYLKILNCPQVDQQRVLLLCLIYQ
                     FPYVDKIFLVDWFNTCKELMSKIKFDKAQNRQILEALWKVVSGTKSDDALKWWYGNIV
                     PTKSYL"
     gene            <438746..>439621
                     /locus_tag="ZYRO0B05544g"
                     /db_xref="GeneID:8202339"
     mRNA            <438746..>439621
                     /locus_tag="ZYRO0B05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495148.1"
                     /db_xref="GeneID:8202339"
     CDS             438746..439621
                     /locus_tag="ZYRO0B05544g"
                     /note="similar to uniprot|Q08232 Saccharomyces cerevisiae
                     YOL073C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495193.1"
                     /db_xref="GeneID:8202339"
                     /db_xref="UniProtKB/TrEMBL:C5DR49"
                     /translation="MSMENPTGLYRYPVTKLCMVGTTMVTLVASIASCKYIFIAKYDP
                     FISEYQQYFRLLTFQLGCVNETDMALLVLIWYQFRNLERLMGSLKYISVISLALIYTT
                     VCLAGLNCLVNRILPWKIWNGLTTGCLPLVLALFHFYKEYTPQVYEFEVLLTQPWSQK
                     SHRKQYKWILNDQFLVNALVAILLINQGVEGIICGFISWIIGVFLDKGLLPGMDRWRL
                     PLMQHLLMPKDASNNQGVYENPGGETSEELLIRRDDREESPGASNGASPLDDENANDE
                     PARPLGVQFLETFRT"
     gene            complement(<439692..>440261)
                     /locus_tag="ZYRO0B05566g"
                     /db_xref="GeneID:8202340"
     mRNA            complement(<439692..>440261)
                     /locus_tag="ZYRO0B05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495149.1"
                     /db_xref="GeneID:8202340"
     CDS             complement(439692..440261)
                     /locus_tag="ZYRO0B05566g"
                     /note="highly similar to uniprot|P48363 Saccharomyces
                     cerevisiae YGR078C PAC10 Part of the heteromeric
                     co-chaperone GimC/prefoldin complex which promotes
                     efficient protein folding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495194.1"
                     /db_xref="GeneID:8202340"
                     /db_xref="GOA:C5DR50"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016655"
                     /db_xref="UniProtKB/TrEMBL:C5DR50"
                     /translation="MDSLMNTGKTNPRGIPEAPFVEKVQDFIKDASDFDLLFNKFQER
                     LSMYKYMQESKLSNIRLLRTTIPDIENTLKVCNQLKNREEPLETSYQLNDTLFTKAVV
                     ETGSDLKVGLWLGADVMLEYPVEEAISLLVTKLSDAKENLRISNEDVEFLRENITTME
                     VNCARLYNWDVERRQALKKAEQGTKDMKI"
     gene            <440556..>444368
                     /locus_tag="ZYRO0B05588g"
                     /db_xref="GeneID:8202341"
     mRNA            <440556..>444368
                     /locus_tag="ZYRO0B05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495150.1"
                     /db_xref="GeneID:8202341"
     CDS             440556..444368
                     /locus_tag="ZYRO0B05588g"
                     /note="similar to uniprot|Q08234 Saccharomyces cerevisiae
                     YOL075C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495195.1"
                     /db_xref="GeneID:8202341"
                     /db_xref="GOA:C5DR51"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DR51"
                     /translation="MATTGLLENDISFVRAPPIALHARNVTISASKTNKVLVNSFSVD
                     LPSGSVMAVMGGSGSGKTTLLNVLASKVSKGLQLDGEIHYALEDNSEHFNADTEASMA
                     YLPQHDVLPARLTCRETLMIAADLKLKSSLEKKNEIVDQLLLELGLRDCANTLVGDAR
                     NRGLSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKLARDGQKSFI
                     MSVHQPRSDIMFLLDSVCILSKGNVVYCGKTTEMIPYFDSLGYSVPHLVNPADYFVDL
                     SSVDARTEYSKKKSQELVDQLVQQWDDHQSQMMRLVTFDTSRGIHPRNMAARVSFWKQ
                     VEVLTRRNIKLNSSDHFTLVATFTEPALVGAIMGWIFYKPNPNTQEGLRTLTSSLYAT
                     AVLQCYLYLLFDTYRLTEQDIILYDRERAEGIVSPASFMLARKLLLFWTDDIMMILIF
                     VTISYFMIGLEVSAKKFFLHFSVVFLIQLSCSGLALFSVAISRDFAKASLVGNMSFTL
                     LSLACGFFVNAKSMPVYVRWTKYIAFTWYGFGALVSNTYTDKLCHSSNKDQCEGNALI
                     HSLGFWPHWRSLPFSILFCFALGNFGAALIMFYIKKVDIALQNEVKPSKTEDNDGLEG
                     DRESSLDDTLQEIGVEKVEDLESKLSDFVPITVTLKNINLEVMASQLSKSPRHGWLQK
                     KTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFHSTGSILLNT
                     NSISKEMFKSVCSYVSQDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEILLA
                     LGLTHCENTVIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTSGLDSFTSAAIL
                     EILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSGRAAFNGSPNEMINYFANIG
                     HVCPPYTNVADYFLDLISVNTQNEQNEMISRQRVESLLDNWRLKGNDIMEDPVLNWNE
                     MSKGQFLGEYDDFIKKPCNAVLAYFVNLRRQYTTTRRNIDSLMARVAQVPGSGIIFAL
                     YWAPIKHNFKSVGNRLGLAQQSTALYFIGMLANLACYPAERDYFYEEYNDNVHGIAPF
                     FLAYMTLELPLTAFSSSIYAVFTVLVCGLPRTAGNFFATMYCAFVIIACGEALGIMTN
                     TFFRRPGFVVNCISVILSIGTQLSGLMSLHMSRVLKGINYLNPLNYTSMILINYSFPS
                     DMKLTCEDGGRKPDGSCQFSNGHDVLREYGLVKNTQKYLGIIICVMIIYRLLSYWVLK
                     AKLEWIKW"
     gene            <444535..>445089
                     /locus_tag="ZYRO0B05610g"
                     /db_xref="GeneID:8202342"
     mRNA            <444535..>445089
                     /locus_tag="ZYRO0B05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495151.1"
                     /db_xref="GeneID:8202342"
     CDS             444535..445089
                     /locus_tag="ZYRO0B05610g"
                     /note="similar to uniprot|P38276 Saccharomyces cerevisiae
                     YBR137W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495196.1"
                     /db_xref="GeneID:8202342"
                     /db_xref="InterPro:IPR005624"
                     /db_xref="InterPro:IPR010371"
                     /db_xref="UniProtKB/TrEMBL:C5DR52"
                     /translation="MLDRNWLRSLASLDGATKNILSSYEFDKERSSALPRFDYNDAFE
                     IGNVARNLAKETFPNKPVVIDISLPNGHGLFRAITYTGSSLDNDYWVERKRRTAMRFG
                     CSSYFMGLKLREVKKSPEDKYFLDSKDYAFHGGAVPVFIDSCEFPVACLTISGLKQFE
                     DHWLAVQAINEYLANSNEKDLALD"
     gene            complement(<445200..>446570)
                     /locus_tag="ZYRO0B05632g"
                     /db_xref="GeneID:8202343"
     mRNA            complement(<445200..>446570)
                     /locus_tag="ZYRO0B05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495152.1"
                     /db_xref="GeneID:8202343"
     CDS             complement(445200..446570)
                     /locus_tag="ZYRO0B05632g"
                     /note="weakly similar to uniprot|P38277 Saccharomyces
                     cerevisiae YBR138C Cytoplasmic protein of unknown function
                     potentially phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495197.1"
                     /db_xref="GeneID:8202343"
                     /db_xref="UniProtKB/TrEMBL:C5DR53"
                     /translation="MEDFPQSRVLEPIDSNSLSLISSSSGNGSGNVTNDSFNNMFTRP
                     VTPTFLKSEGTVGGSFLGWQFDGKEFEFDSNSTPTKNNDSGHQKFLHVRKRHAQLMGA
                     KPRIPSRLHQSISKLDLLDENSLTSLPIPPPISRDIPPRKRSKLNPVHEMRIHNDTFN
                     RRISYGVSKRYAHEEEEGEEEEKEEEDAGHPIVMVEDYIPPSNDDQSKRFAKKKVSVS
                     NLKNKMSRNLDMHVPLKLRKNADRCATAASSVTLVPHILDDNINDNNAVDSYHDEPNH
                     IADNVKDILEGLIKPNPQQEHDKYLFHIAKDTKLRKCVICESLLYEVSSLLADRSDFK
                     EIVCGKCTEKYEEAAKIFEEYEFESSCESSKNSSMSSMDSAVQLTDNSPQPLGNKANF
                     SQELISRLQWQLQASMRDDDTHLDKSMDFSTMTWFIEAKKKIRWRWRVSGLLPHFLVR
                     KYKNAN"
     gene            complement(<446794..>449163)
                     /locus_tag="ZYRO0B05654g"
                     /db_xref="GeneID:8202344"
     mRNA            complement(<446794..>449163)
                     /locus_tag="ZYRO0B05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495153.1"
                     /db_xref="GeneID:8202344"
     CDS             complement(446794..449163)
                     /locus_tag="ZYRO0B05654g"
                     /note="similar to uniprot|Q12387 Saccharomyces cerevisiae
                     YOL076W MDM20 Subunit of the NatB N-terminal
                     acetyltransferase which catalyzes acetylation of the
                     amino-terminal methionine residues of all proteins
                     beginning with Met-Asp or Met-Glu and of some proteins
                     beginning with Met-Asn or Met-Met involved in
                     mitochondrial inheritance and actin assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495198.1"
                     /db_xref="GeneID:8202344"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019183"
                     /db_xref="UniProtKB/TrEMBL:C5DR54"
                     /translation="MGDKFEQEIFQLIQKTNFKACNAKISDWKKKYPNSTYIWVLETY
                     VKYRQSPSKFNYDSSLGQFFGLQGTQITSDLRSLKLLHDMFLEMQRYDEALHVYERAN
                     FKYPNFDVAYEWFCKSLDDGNYKMMARACQQMAKWNNDNGTTQSILSRDYTFWYAICT
                     VALFKFQKSKVNAAEEKLLPQLALRSLESQKPFKSTQEIIVYCYVCQELFNDKSKEIV
                     AAIWPQLNQSLDLYCKNFLIKHISDDAQMLEACKSMLNRIDDYELLCKLSEATHNLSW
                     DKKDVIQLVDSLVGDSRNTRLCRLEIDLKFDTEIGRESLTYYLSKYHNKPCCPHDLSH
                     FKNQLNPQMVEEVFQSCEPRDVIHDSNAFRLGCLPTDSITAFQNHKSTLVNQAKNDYS
                     TLSGFIMDVVHDLVIRKEPTLNNVLLALSILENYQNGDPFNYETSVWIIVLYMHLGLV
                     PAAYSRYLDLKVKNLQNDSVNFILYSRFATLFPQKEHDYLRKFQTNNYKLYSVSGHRL
                     PQFIHIAMERRAYSKLLGMFEFKNRMVKSDMKWMNLLEEFQLARLCNDKRQALWSQLT
                     RSQRELELVGDDKEFSDNRDWAILGTDIDPKSLPSALKFLDINQDYISLKTVLESIIE
                     LVPSAQQDSRVDEFLNRTLNGRDLEATLHASLSPMEVWTFKVFYDLYKNDGAQLSGLL
                     NHAEPITNFSWRLTHDYLTKLSTLKTLDNFKRIKDKQLKQLIKSQIRELRDQCDQLYN
                     EYTSQLVKTCEDLKKGSNGALLDRLGYVPLSSSSLQSPLLTVLKTVRNL"
     gene            <449381..>450241
                     /locus_tag="ZYRO0B05676g"
                     /db_xref="GeneID:8202345"
     mRNA            <449381..>450241
                     /locus_tag="ZYRO0B05676g"
                     /product="ribosome biogenesis protein BRX1"
                     /transcript_id="XM_002495154.1"
                     /db_xref="GeneID:8202345"
     CDS             449381..450241
                     /locus_tag="ZYRO0B05676g"
                     /note="highly similar to uniprot|Q08235 Saccharomyces
                     cerevisiae YOL077C BRX1 Nucleolar protein involved in the
                     biogenesis of large ribosomal subunits depletion leads to
                     defects in rRNA processing and a block in the assembly of
                     large ribosomal subunits possesses a sigma(70)-like
                     RNA-binding motif"
                     /codon_start=1
                     /product="ribosome biogenesis protein BRX1"
                     /protein_id="XP_002495199.1"
                     /db_xref="GeneID:8202345"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR007109"
                     /db_xref="InterPro:IPR026532"
                     /db_xref="UniProtKB/TrEMBL:C5DR55"
                     /translation="MSSIYKALANPKSKEKSEKTHMNRQRVLLITSRGVNYRHRHLIQ
                     DLYSLLPHSRKEPKLDTKKDLQQLNEIAELYNCNNILFFEARKHQDLYLWMSKPPNGP
                     TVKFFVQNLHTMEELNFTGNCLRGSRPILSFDHKFDESPHYQLIKELLLHNFGVPPQS
                     RKTKPFFDHVMSFSIVDDKVWVRTFEISHSARNTEEYQEEQEDISLVEIGPRFVMTVI
                     LVLEGSFGGPKIYENKQYVSPNFVRAQLKQQAAQQARDRSEAAIQRKIRKRENVLAAD
                     PLSNEVLMKE"
     gene            complement(<450310..>450513)
                     /locus_tag="ZYRO0B05698g"
                     /db_xref="GeneID:8202346"
     mRNA            complement(<450310..>450513)
                     /locus_tag="ZYRO0B05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495155.1"
                     /db_xref="GeneID:8202346"
     CDS             complement(450310..450513)
                     /locus_tag="ZYRO0B05698g"
                     /note="similar to uniprot|P81451 Saccharomyces cerevisiae
                     YOL077W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495200.1"
                     /db_xref="GeneID:8202346"
                     /db_xref="InterPro:IPR021278"
                     /db_xref="UniProtKB/TrEMBL:C5DR56"
                     /translation="MGNAYHILGRTVQPHQISLATLSLVALLAVPNPFAKKQPQTLDF
                     AASSADEEKFIKNYVEQHSKAEH"
     gene            <450893..>452428
                     /locus_tag="ZYRO0B05720g"
                     /db_xref="GeneID:8202347"
     mRNA            <450893..>452428
                     /locus_tag="ZYRO0B05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495156.1"
                     /db_xref="GeneID:8202347"
     CDS             450893..452428
                     /locus_tag="ZYRO0B05720g"
                     /note="similar to uniprot|P38109 Saccharomyces cerevisiae
                     YBR139W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495201.1"
                     /db_xref="GeneID:8202347"
                     /db_xref="GOA:C5DR57"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DR57"
                     /translation="MKLITVLSTLAGVSQAVSLFEGNWLGEFESKLQSPRNIYQEVTK
                     GFSHRWDSVQVLESPIDPSYSLRIKEVDPAKLGVDTVKQWSGYLDYEDSKHFFYWAFE
                     SRNDPSKDPVILWLNGGPGCSSFTGLLFELGPSQIGPEIKPIHNPHSWNNNATVIFLE
                     QPLGVGFSYGDEKVTNTRAAGRDVYIFLELFFEKFPHLRSHDFHIAGESYAGHYIPQI
                     AHEIVIENPGRTFDLTSVLIGNGITDSLIQNDYYQPMACGEGGYPQLLTDEDCSTMEK
                     NTNRCRTLNRICYGTKSNIACVAATAFCESVTVGTFQEKTGLNVYDIRGPCEDNDSGT
                     CYFGMNYVDDYMNQRYVQDALGSDVHNYTGCNDQVFLGFALTGDGAKPFQQYVTELVD
                     LNIPVLLYAGDKDYICNWLGNKAWSDKLDWRYGEKYESLPLKAWKSQSTGEKLGEVKN
                     YGPLTFLRIYDAGHMVPYDQPEAALEMVNDWITGSHDFGYSEERLDAEDLWLEKLKEI
                     WLE"
     gene            complement(<452478..>456092)
                     /locus_tag="ZYRO0B05742g"
                     /db_xref="GeneID:8202348"
     mRNA            complement(<452478..>456092)
                     /locus_tag="ZYRO0B05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495157.1"
                     /db_xref="GeneID:8202348"
     CDS             complement(452478..456092)
                     /locus_tag="ZYRO0B05742g"
                     /note="weakly similar to uniprot|Q08236 Saccharomyces
                     cerevisiae YOL078W AVO1 Component of a membrane-bound
                     complex containing the Tor2p kinase and other proteins
                     which may have a role in regulation of cell growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495202.1"
                     /db_xref="GeneID:8202348"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008828"
                     /db_xref="UniProtKB/TrEMBL:C5DR58"
                     /translation="MDTETSINRLRAQFLSECPDKDLMRRIIKPYCHGHDVLRPKDVN
                     SNIRKFYITPEGIDIFPDLESPPMSRNYMDNCLSNSNKKPGKGSKSSSQPNEYNSDSE
                     AEMENYNKDGGGGVKNVPEKAQGLGLHRGDTTMAPHNFSDDDGESTSKVGEPVPMPIL
                     SEAQGEEEEGREDENNIIETNDLDSDSDDSDSDDSDFSSESRDSKKKGNSNRKLSFPR
                     IFKGSKKENADSSRKSSGKKKASVSSQTNKRHNSAFDMNFGYEHGFEDTDEDEDEDED
                     DSGADLPSQFFQLDRQASKNSNNNEIGESESQPHRPNSNNSLSYINNNNSNTNVGGRD
                     SSKKKSHFPQNMIPRPTLLDGGRNSSRSERFLKGGNGASNGAGNGNGNGNGNNNGNNN
                     NYNGNLNGNSNGVGVNEEYLGSPGVTSEGTKSDEQEEEISDIESYINEQDLDNLNLDA
                     TPPMNEKSLSSKNELDITDNKDVVTTDSLPEDENSFNYPDNSDLVSSYGKSLLDSDFS
                     GDNVFKPVDSATESNSILEDSDLQPETVSHSIPLSLDEYGIYHGQDDTTLDTAFDKAV
                     LNIKGLKPSNLKEKRQYGRPNSRSTSISRHSNSSNAKGKDTTNSFMGASGDSNKVLKH
                     VDSRAQMHASVDSKAEKSATPASSAYNNKNPAKNDWLSVEKTTNFGKPKNHNSQLSSL
                     FRKKINPSKSSKDLLEYFSFVSGSKVPQFESTELNVYIEASKSFKRTPFNLQVRKSAN
                     VFEVIGFILFHYATEVEEKNMKDDGLKLEELQNPNRFCLKIVDEDGAPFEDDFGKLSR
                     KKVIETLSDDEVVLCRVGDAEMESNERETPVPFNGGGEVMNGTEVLKKDLSSGALNQL
                     SYYKPILGQDDANDNNGGNSKTIEVKVYIYPNTNKKFNFTNINVSVTSSINDILVKYC
                     KMKHMDPNEYIVKIPEKKLALNLNDTVLRLDGNYQVEIISKKDARELNLEKLKPDIKK
                     PNLPTIQSNDLTPLTLEPGTEYLKPEKVNEKSERENQSSAHRTLSKKKLAAKHKLGLS
                     TPNSSTSSNNSVPLGNGFFKLKNNSKTSLHGSLSYYAPNRPLLAGTGVAAGLTDNGYQ
                     DLFSGAYHRYRVWRRQQMSLINKHERTLALDGDYIYIVPPENYLHWHENVKTKSLHIS
                     QVILCKKSKRVPEYFKIFFRRGQDEIKRYYFEAVSPEECTEIVSRIQNLASAYKMNHK
                     "
     gene            <456317..>457123
                     /locus_tag="ZYRO0B05764g"
                     /db_xref="GeneID:8202349"
     mRNA            <456317..>457123
                     /locus_tag="ZYRO0B05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495158.1"
                     /db_xref="GeneID:8202349"
     CDS             456317..457123
                     /locus_tag="ZYRO0B05764g"
                     /note="similar to uniprot|Q08237 Saccharomyces cerevisiae
                     YOL080C REX4 Putative RNA exonuclease possibly involved in
                     pre-rRNA processing and ribosome assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495203.1"
                     /db_xref="GeneID:8202349"
                     /db_xref="GOA:C5DR59"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:C5DR59"
                     /translation="MVLSSNWLELQKKSGDVSIKKRKSSKKSNKIAKPDVKPKKEPSK
                     VMQVVYEMNRAIKKVEEDKKQGKQPEVKTQVPSKLDELLGKDVSSTKSKDIGKFIAID
                     GEFVGVGPEGKENALARVSLVNYNGYVIMDEYVKPRERVVDWRTWVSGIEPKHMRIAI
                     DYKEVQQKVADILRDRILVGHAVAHDLSALALKHPRSMIRDTSLFTPFRKEYAEGKTP
                     SLKKLAKNVLGIDVQEAEHSSVEDAKITMLLYKSRKKEIDRFHSAKNGGG"
     gene            complement(<457353..>466337)
                     /locus_tag="ZYRO0B05786g"
                     /db_xref="GeneID:8202350"
     mRNA            complement(<457353..>466337)
                     /locus_tag="ZYRO0B05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495159.1"
                     /db_xref="GeneID:8202350"
     CDS             complement(457353..466337)
                     /locus_tag="ZYRO0B05786g"
                     /note="similar to uniprot|P18963 Saccharomyces cerevisiae
                     YBR140c IRA1 or uniprot|P19158 Saccharomyces cerevisiae
                     YOL081w IRA2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495204.1"
                     /db_xref="GeneID:8202350"
                     /db_xref="GOA:C5DR60"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:C5DR60"
                     /translation="MVGPVPSLVNHMYWERILPILPHEVGHGQYHDVESNEVFLMHRG
                     IIMDVSYSQGFDPVVQASLEVIESILGKQQNILQLNEEQIQSILVLVRLLSDNMENVW
                     EGIEAKRTGEPRGGGIGRVIGFSTHRPCFHSVSPQPLDPEIALRLLDLCGRIKFDTNA
                     LHILRGMSQQLYGNTSLVSANILPSQQQFLRQRNGTGCANKVDLTVNYILRFISAANP
                     AEFTRYLRRTVLKPFLENHVGIEQGVLHYMDLFGCVYLNKRNVARYLDMVRGMANNMR
                     KTIYHCLLLHYASRTLMFWIIGRPAEYTHVFRLLRRSTGSSSSGGSISGGGSSSGGGS
                     ISGNNGSTSSATASFVSHDNVSSTSSSSSVNEDEIARPILQLASALFEETYSTFNVSS
                     LLTSVTTHTNSTNGNMNSSSGIGLTAGGNSSSTHNSRELPTPQSASSSMSVSSALSTG
                     SNGSDINLSESEDQSLDRWHSDARPIQPEVPHMRNVLELYTTPDGSESLSHTSVLKFL
                     MTLLMLDPDVFTELNATSFKNVPDVKSNNSNNAKSDTEERERPIGGSIKHFTQGLKKL
                     TTLPSSKKRSVKMVTTIVKNITGVHLVADRAIMDTIKSLITLFTMASSVSLVDTSVPS
                     VLFCKRLFPILACNLDLGKNWEKEAKLNPYLQKCLARHPTAYCRLQIEFFAASTQLEQ
                     NAFLSHLQLNDVGSGSNLKRLTLYTEGFRVFFHLPSTRELREGTALTTAEFLKTLFYW
                     VPDLIMKSLPYFDGKVTHLVSSILDGTVLDGGNGCQLFKISAASSSSSSIASLSNAQH
                     APIGSPTSGSALDFYNSSHSQAVVRTNSNTSSSSEASLVNTPVNQTDVQFGHLIAPKA
                     RRVSGTSSTAKKTSILISPEALEADRVPHSSIRSQGANVSGIGGGSGSTAVAGDFSTI
                     STGTSPAVRNIRSPLRQAIQRRGSDETSTRPSRSSMTMALDNTSSREHDARRIMVNIF
                     SIFKRITDYIIVPHIENVDPEWPEKDFRSIIKSIFCAIIDTDANLQQTAQSFMDVLIN
                     YMSEFSENVSPRTTCGYYKLYSYTITLFSSSLFDLKLDNQKREAILDIVVKSLKVRGR
                     LGRNVELTDVNFDEFLEVERSTFPLIFGTVGRGLFVSLYCNRSNVQRLVKAAYREFYM
                     EIIFHGKISGHLDPSWADNLAFVKSMSEDNYVPSGSVAFQRRLRINILKFVKHPNAIL
                     FDAMSFIYKKWMSLANVKNMNQEESSDFRSFGGMIASLSGVLLTVDTVRYPNLSDMRI
                     DLGHQINYFISKQCNWLNKPELLTRESARDILSTELHPFAFKSLFSNLKLKIDELKEL
                     DLTAPGHELSFVLLEQIIIILRTILRREDDDKIMILFSVDVINFIDDMVEILEKMPND
                     SIKFFKAVIHMSKVFRAMESAEGNLGIVGHYNLKNKWLKLVTIWFKFTMDREYDIGNI
                     SKPHREMDLRKRDVDILLIDTAIECSKALAFLTKNVPLEVPPSVSEEELKRSKYVVFG
                     NHFNILLKGLERSTDLDSYPPSLKHKISVLNENVIISLTNLSNANVDAGLQYSFPMGF
                     SKDNNIKIAFLKVFINIVNNYSACQGQEEESKLRAQNNIILVGLKNPSSVINFTKICP
                     ANEIDSLAAGLVNAFDSRNASILLVMELIKYEIKNAPRHMDILRRNSCATRALSLFAR
                     NKGNEYLVRVLRPVLSELINSEEHFEVEKLNPHDPGTDVQVALFVKYMTLLVDAITSS
                     VDIFPTELVVLCQTIFSAVEDKFPLYVYVAVGSFVFLRFFCPALVSPESESIIEISEA
                     PYKRPFITLAKVIQSLANGSDNVARWPVLESQSQFLEECRDRIFEFLREICETKRDVN
                     IPINLDPTPIPFDFNYIHKYIYLFELDMRKANLDEFQSFSEFPHLKQRFLTIDENMAI
                     LGQPREELRNEIPQCIIDSKEEYPQLYEFMSRHAFRSIAVFDTTNTFVHESMSSDGLP
                     IITLTFSSFRSKNIEIETIIYRTFQIYARIWSVKYYLVLDCTHFDEHEIDVVKLTSLF
                     NNLVPPIAIQNCCGYYYFNITEKFVNQWNKLFTKANPFVAHKVPQHFVNSYSQSDFVK
                     SLGLGAQSMEVISDVRVSLHDVALYDERKKRFTPVSLKIGNRFFQVLHETVKRYKIHG
                     WDHLVDMKFNEVFQINNVSSVNITSNTGVTSEFTVSLEGGRILIFSSPKYLEIVKMFY
                     YALAKIDDEYGMVSLASDAEDTVTDTDKDEHEQRCKTVCHLLLIIMVGLFSEDETVKN
                     VSYNLLAATQDTFKLDFGTRFHSSPEVHVPGDCGTFLCLLAKSIAKASPDLTRYVLEY
                     FINGLLNQVIPFNFVPQTIFCLSYWVPNVYRHVYLMDEEEGPEVTAKIIRGLIRLTVL
                     EPSFTAVYLQQIWHHLALEGRLTFLIVEEVLNQALDRDSENRDWKKLLPLLNALPTVE
                     VTSHIIGRLMDMIKSFLPSLRLETFTQSWSELTILVKAIVPLFFESPLMAQMFLPEAL
                     FIASLLIDVGPNEIRSSLYELLMNICHSLTINDSLPESDKQKLDGVCTTFFRQRFRFM
                     FGFSQYKGRTMQSFSVSSFASKFAALEQFTTNLVYLMDYSGKLEAPQWKTRYKKYLVD
                     AVFNNDSFLSARAMMILGIIGKTNTSEVLCKNLLDETLKVYSDPHITDEHLFLVIAHV
                     FTYSKVVEGLDPSLELMKQLFWLSAVLVESPSSVIFEGGFLFMTNCLNRLYENHFASD
                     KENRLLTPILMRSRFFVESYLAELEEHNDGIWSEKNFAHNILLMICRGCSVPSLKSAA
                     IEFLQVQFRNSYREHSIYPESTHYLCYLFFIYLLLPPEKFHSIWNEVKPKDDHLIGLD
                     NNNYLPKCLLKWISSNRECPNITLYQGAILFNSTLSDEPCKLRFALVMRFLIKTNPPC
                     VFNFYMATRKELRRISALEMTSDCVPVSFDVLRMMLRHSEVSVLDEYHESSLARIKQR
                     GLGFITKIDVSDQSVTDILAVLDSQDDLIYRRKRAITVILSRMSCFQEGV"
     gene            complement(467070..467140)
                     /locus_tag="ZYRO0B05808r"
                     /db_xref="GeneID:8202351"
     tRNA            complement(467070..467140)
                     /locus_tag="ZYRO0B05808r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (CCC) cove score=65.75"
                     /db_xref="GeneID:8202351"
     gene            complement(<467225..>468238)
                     /locus_tag="ZYRO0B05830g"
                     /db_xref="GeneID:8202352"
     mRNA            complement(<467225..>468238)
                     /locus_tag="ZYRO0B05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495160.1"
                     /db_xref="GeneID:8202352"
     CDS             complement(467225..468238)
                     /locus_tag="ZYRO0B05830g"
                     /note="similar to uniprot|P38278 Saccharomyces cerevisiae
                     YBR141C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495205.1"
                     /db_xref="GeneID:8202352"
                     /db_xref="GOA:C5DR61"
                     /db_xref="InterPro:IPR021867"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DR61"
                     /translation="MSFDEKFHIMKKRSAMISRKRKTITGRQVSGNVPISIKPTKSRR
                     IIRRFHLLINKRRILCNKLGISLVDNDEDANKKTIDDSLNPKMKRQYEIGTSRDDMEP
                     QLLKAQSLQSEQELVQCLGYIMNQIHSRGGLRDYQLASRVGQTNNRGGDSSKILVQWL
                     QELGHRSDGSLSALEIGSLSTENRISTCGLFEPVIRIDLESSQPGIQKQDFMQRPLPK
                     DEGEKFDFVSCSLVLNFVPTPIQRGQMCMRFEHFLRENGYLFVVLPLPCINHSRYMSK
                     NHFTQLMEFLGYSMVKYHESKKLCYMLLRRTSSKNQEGYDKFTKKHKFHDKPGFNNFC
                     IML"
     gene            <468295..>470550
                     /locus_tag="ZYRO0B05852g"
                     /db_xref="GeneID:8202353"
     mRNA            <468295..>470550
                     /locus_tag="ZYRO0B05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495161.1"
                     /db_xref="GeneID:8202353"
     CDS             468295..470550
                     /locus_tag="ZYRO0B05852g"
                     /note="similar to uniprot|P38112 Saccharomyces cerevisiae
                     YBR142W MAK5 Essential nucleolar protein putative DEAD-box
                     RNA helicase required for maintenance of M1 dsRNA virus
                     involved in biogenesis of large (60S) ribosomal subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495206.1"
                     /db_xref="GeneID:8202353"
                     /db_xref="GOA:C5DR62"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DR62"
                     /translation="MSNTRTTVKKMVKNHGKALKKSKLGPSKAAKKTQAKKKSNAPQG
                     KVVGATELNWKKVDIPDTLDDYGGFYGLEEIDGVDVKVVDGKVQFIARDETAVKSKDD
                     EAKSEPENEEPAQEQDQTNEEAEQEQEQEQEQEQEQEQEHKSEEEEQESDDEEQDQDE
                     NQELKPNVFNSELNLEDFSSPELPEWQKIAPLSFTVLNGLSQQGFTKPTDIQKEVLPL
                     ALKNEDIMGKAATGSGKTLAYGIPLLESLVHEPDHSKSIGLIFTPTRELAQQVTQHLK
                     KLGQLIIQKSKFAILPLTGGLSIQKQERILKYENSARIVVATPGRFLELIEKNIDLIP
                     RFARINTLVLDEADRLLQDGHFDEFEKILKLLGGARKSFDKTGWQTMIFSATFSLSLF
                     SKLATASWKSLKKDEDEMEQVLKHLMQKIRFKSKPVIVDTNSEEKIKSQIRESLIECG
                     PMERDLYSYYFLAMYPGTTLIFCNSIDSVKKLCAYFNNLKIDAFQIHSSMTQKNRLRS
                     LERYLQKSAQNDSQNKATVLVASDVAARGLDIPGIKHVVHYHLPRTADTYIHRSGRTA
                     RADNEGVSVMICSPEEAMGPLRKLRKMLADKSAEDEYTKHKKWQKEVPLLPIELDIVN
                     ELKERGSLASELAEHQLALTSINKQDNWMQKAAEDLGIDIDSDEEFMDSNKSKKQKKT
                     MGKVEAKQARAYLNQLLSRPIRKDRRQKYLTGGFVNLADNIVKKRGHESIIGHDKVDA
                     LETLKSKKRRK"
     gene            complement(<470712..>472034)
                     /locus_tag="ZYRO0B05874g"
                     /db_xref="GeneID:8202354"
     mRNA            complement(<470712..>472034)
                     /locus_tag="ZYRO0B05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495162.1"
                     /db_xref="GeneID:8202354"
     CDS             complement(470712..472034)
                     /locus_tag="ZYRO0B05874g"
                     /note="highly similar to uniprot|P12385 Saccharomyces
                     cerevisiae YBR143C SUP45 Translation release factor
                     involved in translation termination mutant form acts as a
                     recessive omnipotent suppressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495207.1"
                     /db_xref="GeneID:8202354"
                     /db_xref="GOA:C5DR63"
                     /db_xref="InterPro:IPR004403"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR024049"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5DR63"
                     /translation="MGNLETDAEKNIEIWRVKKLIKSLESARGNGTSMISLVIPPKGQ
                     ISIYQKMLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYTKVPPNGLVIYCGDIIN
                     EEGKEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLEADDKFGFIVMDGQGSLFGS
                     LSGNTRTVLHKFSVDLPKKHGRGGQSAMRFARLREEKRHNYVRKVAEVAVQNFITNDK
                     INVKGLILAGSADFKTDLAKSELFDQRLASKIIKIVDISYGGENGFNQAIELSAETLA
                     NVKFVQEKKLLTEYFEEISLDSGKFCYGIDDTLKALDLGSIESLIVYENMETIRYVFK
                     NDEGEEVLKFAEPDQLDKSQAIDKNTGQEMEIVDEMPLIEWLAENYKNYGAHLEFITD
                     KSSEGAQFVSGFGGIGGILRYKVNFEQLVDESEDEYYDGDIGSDYEIF"
     gene            complement(<472385..>473800)
                     /locus_tag="ZYRO0B05896g"
                     /db_xref="GeneID:8202355"
     mRNA            complement(<472385..>473800)
                     /locus_tag="ZYRO0B05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495163.1"
                     /db_xref="GeneID:8202355"
     CDS             complement(472385..473800)
                     /locus_tag="ZYRO0B05896g"
                     /note="some similarities with uniprot|P35193 Saccharomyces
                     cerevisiae YOL082W ATG19 Protein involved in the
                     cytoplasm-to-vacuole targeting pathway and in autophagy,
                     recognizes cargo proteins and delivers them to the
                     preautophagosomal structure for eventual engulfment by the
                     autophagosome and degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495208.1"
                     /db_xref="GeneID:8202355"
                     /db_xref="GOA:C5DR64"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR024543"
                     /db_xref="UniProtKB/TrEMBL:C5DR64"
                     /translation="MSETLRNVGVVYGARGEIFDARRKQSLEEFIKHTFGIDNVFEDK
                     LVMGRCICHGKKDLETDILLSNQQDTEKFMFSKESTKPHIVLIYDKPSVPAAPEPEPQ
                     NDVLVSAKQWEELVGSVKKLQLSVDTQHNKPIATPTVPTPAVAAPAVALPTGPVHEAV
                     FCDVCYPEYDTSAKPIVGPRFKCLDCNNFDLCSSCEAKGVEANSHRRHHNMAKINTPL
                     RKGTHLDTTGLSSMTLNDKEVIVDIPEHEKDIFEMFSSVEAVREVVRGYRAYCAHQAK
                     AASSEKPRSRHEFASLEITVSHRDDLLTFDIYNNGRRALPGDCTLVLATCDSSTSGSR
                     PTVESYLGPHELRPGNRKLFHKKISRGSVIECARIDILDGKNKEEVLYTGSSSWLLDT
                     SIKLKPPRLSKSPSPSPTATLTPSAAPEDQSSCKPLSSLAKEDEGVISSSMTNDEYSL
                     CSDSGSDTNWEEYDFLSEDDV"
     gene            complement(<474192..>477038)
                     /locus_tag="ZYRO0B05918g"
                     /db_xref="GeneID:8202356"
     mRNA            complement(<474192..>477038)
                     /locus_tag="ZYRO0B05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495164.1"
                     /db_xref="GeneID:8202356"
     CDS             complement(474192..477038)
                     /locus_tag="ZYRO0B05918g"
                     /note="similar to uniprot|Q12252 Saccharomyces cerevisiae
                     YOL084W PHM7 Protein of unknown function expression is
                     regulated by phosphate levels green fluorescent protein
                     (GFP)-fusion protein localizes to the cell periphery and
                     vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495209.1"
                     /db_xref="GeneID:8202356"
                     /db_xref="GOA:C5DR65"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="InterPro:IPR022257"
                     /db_xref="InterPro:IPR027815"
                     /db_xref="UniProtKB/TrEMBL:C5DR65"
                     /translation="MADSSSSTSAFVSSLIFNGCIAAIFTLAFLTLRPKDRRVYEPRT
                     LDDVKTLKDEERTESVPSGYFRWVSYLLSRPHSFLIQHASLDGYFYLRYIALGAGFSL
                     LGIILLYPIILPVNATNGRNFKGFELLAFSNVTNKNRFFAHVFLSWIFYGAIVFTVYR
                     ELYYYIMVRHALQTSPMYDSLVSSRTLVITELHSEIMNEEAILSTFPRADRIAFAHDE
                     TELQKLVGERTKSAQKLEAALNKCINKCVKLKLKADKKVGVPEVDGDKLEDYIPEKKR
                     PKRRLGKWKIPFLGEKVDVIEYDANKIGELNEDIHDLQAHWDDTKILPVCFVQFPSQL
                     EAQRAYQTIKNRLKGMYSRAIIGFASEDISWGNMELTKPMRKSKRTGANAFLTAMIIF
                     WAIPVALVGCISNISFLTSKIHWLQFIDKCPKPLLGLITGILPAVALGILMSLVPPII
                     MLAGRKSGCMTVQETDLYCQSWYFAFQVVQVFLVTTCTSSASATVDAIIEDPSSAMTL
                     LANNLPKASNFYISYFLLQGLSVSSGTLLQLVTLILSKFIGKILDSTPRKKWNRYCTL
                     AKPSMGVAYPIMELLVAIALCYSVIAPLILVFSFVGLSLMYLAYIYTLNYVQGFTFDS
                     KGRNYPHALFQVFCGLYLSQVCLIGLFIMAKTWGPLVLEIVALVATAGAHIWLKRRFI
                     PLIDSVPLSAIRYVYGENQASYPSDQGLHEVKNAIDEVEEGDIKRDQVDNDDENDAGS
                     LEYRLHDNAVGTSGKELDRKETLAGNNDLEKGDREMEDFESAEMDKPNEDRLFVVERE
                     GAPTVGSESLSSKKTDVFADNKQIGSTKRIPFSGGPIREWGPEKPKSWRERVMLYFQP
                     SKYYSFEEVRSRLPTVLETTVEYVDSELDCAYTDPSVVDKDPIIWVCEDPMGVSKQQI
                     ELAQEVGADVRDENTAYDEKGRSQYTGDPPDFEI"
     gene            <480279..>481418
                     /locus_tag="ZYRO0B05940g"
                     /db_xref="GeneID:8202357"
     mRNA            <480279..>481418
                     /locus_tag="ZYRO0B05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495165.1"
                     /db_xref="GeneID:8202357"
     CDS             480279..481418
                     /locus_tag="ZYRO0B05940g"
                     /note="highly similar to uniprot|P00330 Saccharomyces
                     cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved in
                     the production of certain carboxylate esters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495210.1"
                     /db_xref="GeneID:8202357"
                     /db_xref="GOA:C5DR66"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DR66"
                     /translation="MQQIKKNKNNNSSVYFSLQTTKNNIMSAAPAPVIPKTQKGVVFN
                     ESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAG
                     EVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNCPDADLSGYTHDGSFQQY
                     ATADAVQAAHIPPGTDLAEVAPVLCAGITVYKALKSANLKAGQWVAISGAAGGLGSLA
                     VQFAKAMGLRVVGIDGGPGKEELFKTLGGEVFIDFQKESDIVGAVVNATNGGAHGVVN
                     VSVSEGAISASTKYVRACGTSVLVGMPAGAVCKSEVFDQVVRSTKIVGSYVGNRADTR
                     EALDFFARGLVHAPINVVPLSTLPEIFEKMEKGQIIGRYVVDTSK"
     gene            <481737..>482573
                     /locus_tag="ZYRO0B05962g"
                     /db_xref="GeneID:8202358"
     mRNA            <481737..>482573
                     /locus_tag="ZYRO0B05962g"
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /transcript_id="XM_002495166.1"
                     /db_xref="GeneID:8202358"
     CDS             481737..482573
                     /locus_tag="ZYRO0B05962g"
                     /note="highly similar to uniprot|P38120 Saccharomyces
                     cerevisiae YBR146W MRPS9 Mitochondrial ribosomal protein
                     of the small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS9"
                     /protein_id="XP_002495211.1"
                     /db_xref="GeneID:8202358"
                     /db_xref="GOA:C5DR67"
                     /db_xref="InterPro:IPR000754"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020574"
                     /db_xref="UniProtKB/TrEMBL:C5DR67"
                     /translation="MFSRVLQLSKLSYRQPCRGFSTGQLLCKPVEQFPMRTVPKLPTF
                     YSANPHHEHRIDRLESLLRKYVKLPLQSISQQQLERPVWITLDDYALVGGGTRLKPIQ
                     YQQLLSLLNKLHAIDPQLTNDEIKQELSQYYRKSNMSATSAKLKTLDEFGRSIAIGRR
                     KASVSKVQMVKGTGEIIVNGRSLNDYFVKLKDRESVAYPLQAVDSVGKYNIFITTSGG
                     GPTGQAEASMHAIAKALLIFNPLLKPRLRKAGTLTRDYRHVERKKPGHKKSRKMPTWV
                     KR"
     gene            <483249..>486374
                     /locus_tag="ZYRO0B05984g"
                     /db_xref="GeneID:8202359"
     mRNA            <483249..>486374
                     /locus_tag="ZYRO0B05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495167.1"
                     /db_xref="GeneID:8202359"
     CDS             483249..486374
                     /locus_tag="ZYRO0B05984g"
                     /note="similar to uniprot|Q99247 Saccharomyces cerevisiae
                     YOL087C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495212.1"
                     /db_xref="GeneID:8202359"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR021772"
                     /db_xref="UniProtKB/TrEMBL:C5DR68"
                     /translation="MSELTVSYGLLPPQGRSSQNLHILPISKILYPYDRNDCFITCGR
                     DGSVIRHLCTPEGVSIGGVKVQAHSDWVSDIIQVDIDSYVTVSYDFSIVLLTWKPALG
                     NWETKIIGDHEDYIKCIVGIPTTEEDCIMFATGGLDKKVKVWKMESKSNGAECIRVFD
                     NIQANDTGSIYTMDSVGAHKNLPFDLIIGDGNGDLIFYSSKQDKEFSRVKNIHFTNMK
                     VVKMFDDYTRLVSTCSDGLICIWDLTEVTSVLKILASFKWDCSIWCIEGNSLEELYVG
                     DSKGRITKSNFSNIQNVGLEVVYEPQPSIEETNEDTRSQSSTKPKKKHVGILCINWLR
                     NNYLLFSQSVDSNLNRLDLSNNTLAVAEGGIALTKSSLLTNRRHVITENTKGEIQRWD
                     IVVCELLDTFDPSEGNFDQVVSKYTSREVLSHWCSVSVKVGLLFVKLNQRLLNTEVYG
                     SSLKEYHVVNGLKPNPDERYNLGKIVANSLFNELVMYEMHKDKVYRLEMVSKKKNSSF
                     FHKETSNSTESPLDTKRGATRRKSAFHRLNTNAGQLATERCSPSTSAPNSPFLQGESP
                     LPVDDKPFLGPPAFSDRGLTTRASSNASSNDANSDSGYNPPHLKTTEARTTSSGSLFG
                     RKLRLFKTTSARALAGSSGSNDSNYTSAVSDAEESAVDDDTKDTSATSTNTVNTTTTS
                     THAPAETVVWNSELSTDSVPLPQPSDTTKPTSTSAEPAESEQRKKSREESMSDLIEQF
                     HDNYRSQVSNNTSTLKMLSRKPPHTKIIRDACSPIIRVTNGVLIVLHSWQKGSCGGRV
                     LFSTYLPPARNDEYVKTLEKVDGDESEDFEDTLGEPLQQERVIEEKEKLSKEEWADRE
                     FGNGSNRRQIYEQLENILPFWFSKTLLCDSKVVKQQPKLNFVITPWRGSNDQATVSQG
                     SSQGSSQQQQPSSLQHYKMKFGRSGLRSNDTLLGTTDLPKVSETNLKLLAPAMIKVKK
                     IKVYIVDRFETKTPEMRNKIEPSEWLELLCKGQILDNDMTLSTVRTLYWKSQGDIVFE
                     YRRKTSAPSAI"
     gene            <486772..>487419
                     /locus_tag="ZYRO0B06006g"
                     /db_xref="GeneID:8202360"
     mRNA            <486772..>487419
                     /locus_tag="ZYRO0B06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495168.1"
                     /db_xref="GeneID:8202360"
     CDS             486772..487419
                     /locus_tag="ZYRO0B06006g"
                     /note="highly similar to uniprot|P20434 Saccharomyces
                     cerevisiae YBR154C RPB5 RNA polymerase subunit ABC27
                     common to RNA polymerases I II and III contacts DNA and
                     affects transactivation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495213.1"
                     /db_xref="GeneID:8202360"
                     /db_xref="GOA:C5DR69"
                     /db_xref="InterPro:IPR000783"
                     /db_xref="InterPro:IPR005571"
                     /db_xref="InterPro:IPR014381"
                     /db_xref="InterPro:IPR020609"
                     /db_xref="UniProtKB/TrEMBL:C5DR69"
                     /translation="MDQENERNISRLWRTFKTVKEMVKDRGYFIAQEEIELPLEDFKA
                     KYCDSMGRPQRKMMSFQSNPTEESIAKFPSMGSLWVEFCDEPTVGVKTMKTFVIHIQE
                     KNFQTGIFVYQNNVTPSAMKLVPSIPPATIETFHEASLVVNITHHELVPKHIRFSEDE
                     KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM"
     gene            complement(<487500..>488195)
                     /locus_tag="ZYRO0B06028g"
                     /db_xref="GeneID:8202361"
     mRNA            complement(<487500..>488195)
                     /locus_tag="ZYRO0B06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495169.1"
                     /db_xref="GeneID:8202361"
     CDS             complement(487500..488195)
                     /locus_tag="ZYRO0B06028g"
                     /note="similar to uniprot|P33312 Saccharomyces cerevisiae
                     YBR153W RIB7 Diaminohydroxyphoshoribosylaminopyrimidine
                     deaminase catalyzes the second step of the riboflavin
                     biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495214.1"
                     /db_xref="GeneID:8202361"
                     /db_xref="GOA:C5DR70"
                     /db_xref="InterPro:IPR002734"
                     /db_xref="InterPro:IPR011549"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:C5DR70"
                     /translation="MSLVPLKPDLPVFLRPYLPPDNDSKPFITLTYAQSLDSRISKGH
                     GIRTTISHPETKTMTHYLRYHHDGILVGTGTALADDPGLNCKYNDAMDQSPRPIILNH
                     SGKWKFNGSKLQELYEKGHGKKPIIVVSELPVDEDSSVDYLVCQSRQWSILFDKLHKE
                     YGLKSIMVEGGANVINQLLMSSNLVNSLIITVGPVYLGEKGVSVSPAGPLQLKDVDWW
                     KGTSDVVMCARLH"
     gene            complement(<488202..>488795)
                     /locus_tag="ZYRO0B06050g"
                     /db_xref="GeneID:8202362"
     mRNA            complement(<488202..>488795)
                     /locus_tag="ZYRO0B06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495170.1"
                     /db_xref="GeneID:8202362"
     CDS             complement(488202..488795)
                     /locus_tag="ZYRO0B06050g"
                     /note="weakly similar to uniprot|P38282 Saccharomyces
                     cerevisiae YBR152W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495215.1"
                     /db_xref="GeneID:8202362"
                     /db_xref="UniProtKB/TrEMBL:C5DR71"
                     /translation="MDDSKSFEEKSDESMDSSESDEEGLVPLQRPVFLKRPGRQQGDD
                     DDRDVKRRQTPMQVVERENQSLKAREDAQQLIGTNYSSEQDMVRRALTLDDDDSRDPE
                     LEKQLWFQRQEARSRARRDRLVAQQLEWEAYEHNRQQGSKQLNTTPAPAPTPAPASSS
                     FTRTSNNDNRHFKPERVRDTTFGASKNSTQDTEYSIL"
     gene            complement(<488902..>489603)
                     /locus_tag="ZYRO0B06072g"
                     /db_xref="GeneID:8202363"
     mRNA            complement(<488902..>489603)
                     /locus_tag="ZYRO0B06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495171.1"
                     /db_xref="GeneID:8202363"
     CDS             complement(488902..489603)
                     /locus_tag="ZYRO0B06072g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495216.1"
                     /db_xref="GeneID:8202363"
                     /db_xref="GOA:C5DR72"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:C5DR72"
                     /translation="MILSWLLQLLTACLLGVAYGDSQEAAKIARRMVDSESTLHFNTL
                     NPDGTPVSFIEYYISSDSCPDLQEVSNNGNPILFLSTMSTSYKNWYQRGSMSLAVERY
                     GKRRFENAFNQPRANLYGHLRNLTLSDEDQDKLIRCFIRKHPDAHRWLPGDKHPIIHD
                     TIWVEFDVESLYFIGGFGDRSYIGTLTGDEYHRGIGKLYADHGHRDRVMDSNECEKSL
                     WNQFTRFIKTLMIRY"
     gene            <489756..>490562
                     /locus_tag="ZYRO0B06094g"
                     /db_xref="GeneID:8202364"
     mRNA            <489756..>490562
                     /locus_tag="ZYRO0B06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495172.1"
                     /db_xref="GeneID:8202364"
     CDS             489756..490562
                     /locus_tag="ZYRO0B06094g"
                     /note="similar to uniprot|Q99316 Saccharomyces cerevisiae
                     YOL088C MPD2 Member of the protein disulfide isomerase
                     (PDI) family exhibits chaperone activity overexpression
                     suppresses the lethality of a pdi1 deletion but does not
                     complement all Pdi1p functions undergoes oxidation by
                     Ero1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495217.1"
                     /db_xref="GeneID:8202364"
                     /db_xref="GOA:C5DR73"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="UniProtKB/TrEMBL:C5DR73"
                     /translation="MRFSWTLPLLLSANGCAAAWKERHVDLVMNIDDYYDQANSVDSY
                     TMVEYTTQWCHHCKTLKPIFRDLMLSYDDDEGKLPIKFLDLSCEVFNSHKVCTELTGF
                     PQINFIVPRDEPLVLHEPDYTSMPFYQRWWTRFRRHIQDPKWQLDKERVYGYSGNRDV
                     ESMRNFIETIRSKHEVHRLALRVTKPEYDCNDENDEQEIELCQLGQNYARQLDINNLD
                     AEESRLENLIANNNEDQLKTVKFQLEIVKLLKPGPIPEKTEENVQEHDEL"
     gene            complement(<490609..>491682)
                     /locus_tag="ZYRO0B06116g"
                     /db_xref="GeneID:8202365"
     mRNA            complement(<490609..>491682)
                     /locus_tag="ZYRO0B06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495173.1"
                     /db_xref="GeneID:8202365"
     CDS             complement(490609..491682)
                     /locus_tag="ZYRO0B06116g"
                     /note="similar to uniprot|P38281 Saccharomyces cerevisiae
                     YBR151W APD1 Protein of unknown function required for
                     normal localization of actin patches and for normal
                     tolerance of sodium ions and hydrogen peroxide localizes
                     to both cytoplasm and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495218.1"
                     /db_xref="GeneID:8202365"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DR74"
                     /translation="MSFYRRWHQPRYGNETLKSSTYIKTLVKIFLLLYSRGITYRKLI
                     AVGIGMGLLEYFKGKSEDPVSASDVQEISEMIQVCDEESCDGGCENDDGEIEEGEVAF
                     SKLKIDHETPLYNSSKPPKLHFVVPTSQKDWAHDACSENSASVEYQIHKWCESHESDF
                     DKVGQGVKFNCAVSSLPKDIMDIQVMKRTKNNVLVLPHFVWIDGLTSDKVDETLDRLV
                     PELLTKSVEELPLEAMGLRLAKEQAYVFICSHMKRDKRCGVMAPYLKKSIDKQLQKLG
                     LYRDNSDFSPDGVRVAFVNHVGGHKFSANMQIYLKNPNTLIWLGRVTPRNVPYVVNEL
                     IVPEKPRLPWPEKVRCLQKYDCW"
     gene            complement(<491830..>492816)
                     /locus_tag="ZYRO0B06138g"
                     /db_xref="GeneID:8202366"
     mRNA            complement(<491830..>492816)
                     /locus_tag="ZYRO0B06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495174.1"
                     /db_xref="GeneID:8202366"
     CDS             complement(491830..492816)
                     /locus_tag="ZYRO0B06138g"
                     /note="similar to uniprot|P38115 Saccharomyces cerevisiae
                     YBR149W ARA1 Large subunit of NADP dependent arabinose
                     dehydrogenase involved in carbohydrate metabolism small
                     subunit is unidentified"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495219.1"
                     /db_xref="GeneID:8202366"
                     /db_xref="GOA:C5DR75"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DR75"
                     /translation="MARLLHPKGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVK
                     AAVKAGYRHIDTAWAYGSEPFVGEAIKELMEEGVIRREDIFITSKVWPVLWDDVERSL
                     NESLESLGVDYIDLWLQHWPLCYVKQEDTHGINGLARNPETPNGEPYYEVDGDWLETY
                     VQMEKIYLDPSDNRVRSIGVSNFPVQYLERTLFECAVKPAVNQVEMHPRLPQFELNKF
                     CRAHNILLEAYSPLGSHNAPNVHLQLVQDLAEKYSMSPSGILNSYHIRQGNAVVSRSV
                     NTMRIASNVEFAALTEEELDNLDQLGITKPKRFVNEKWNAVVPGFSGEGPAI"
     gene            complement(<493345..>496218)
                     /locus_tag="ZYRO0B06160g"
                     /db_xref="GeneID:8202367"
     mRNA            complement(<493345..>496218)
                     /locus_tag="ZYRO0B06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495175.1"
                     /db_xref="GeneID:8202367"
     CDS             complement(493345..496218)
                     /locus_tag="ZYRO0B06160g"
                     /note="highly similar to uniprot|P25847 Saccharomyces
                     cerevisiae YOL090W MSH2 Protein that forms heterodimers
                     with Msh3p and Msh6p that bind to DNA mismatches to
                     initiate the mismatch repair process contains a Walker
                     ATP-binding motif required for repair activity Msh2p-Msh6p
                     binds to and hydrolyzes ATP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495220.1"
                     /db_xref="GeneID:8202367"
                     /db_xref="GOA:C5DR76"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR011184"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DR76"
                     /translation="MSSAARPELKFSDISEERRFYKRYLGLPEKPSTTLRAIDKGEYY
                     TIIGHDAIFVADSIYHTQSVLKDCKVEPSVARQTNEPLKYVTVLPQVFSTLLKTCLLD
                     LGYKVEIYDKACSLSKSASPGNIEQIQDLMNLAVDSSIVIAGLKLQFNTQEGHCVIGV
                     AFIDTSNYKVGMLDIIDNEVYSNLESFLIQLGVRECLLPDMSKSESISSELKKIIGVI
                     ERCGCVSTLIKSSDFTDKDVELDLANLVGDELSLSLPRYSKSALSSCGALLNYLQLLN
                     EQDQVGKYELIQHSLQEFMKLDASAIKALNLFPQTANQPFGPAAGISLGGAGTKVSSL
                     FQLLNHCRTNAGVRLLNEWLKQPLTDVEQIEKRHILVDYLIDQLELRQILQTDHLPSV
                     LDVRRITKKLNRNGNLEDVLKIYQFGKKIPEIADLLSSFLDDDQGSAEAKSLVKSTWL
                     EPLMSHTEPLTKLLEMVETTVDLDAYEQHNGFMIKVELNEGLANIRDQLDALKDEINS
                     IHLETAEDLGFDPEKKLKLENHHIHGWCMRLTRNDARELRNHKEYLELSTVKAGIYFS
                     TKKLKEIASETAVLQKEYDKQQSALVKEIVSITLTYSPVLEKLSLVLANLDVLCSFAH
                     ASSYAPIPYIRPKMHGLETTRTTRLVASRHPVLEVQDDVTFIANDVNLESGVNDFLII
                     TGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEADIAVVDAVLCRVGAGDSQLKGVSTF
                     MVEMLETASILKNATKNSLIIVDELGRGTSTYDGFGLAWAIAEHIASKIGCFALFATH
                     FHELTALADKLPNVKNMQVVAHLEKDQDGQNESDDITLLYKVEPGISDQSFGIYVAEV
                     VQFPQKIVKMAKRKANELEELKSHDQDSKRAKLSVEELNEGNQRLKTLLKDWVNQLRQ
                     QGLDDPRKLTEEDSQIQIQNLLKSLAGESSEDKFLQYISDTLV"
     gene            complement(<496610..>499180)
                     /locus_tag="ZYRO0B06182g"
                     /db_xref="GeneID:8202368"
     mRNA            complement(<496610..>499180)
                     /locus_tag="ZYRO0B06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495176.1"
                     /db_xref="GeneID:8202368"
     CDS             complement(496610..499180)
                     /locus_tag="ZYRO0B06182g"
                     /note="some similarities with uniprot|Q12411 Saccharomyces
                     cerevisiae YOL091W SPO21 Component of the meiotic outer
                     plaque of the spindle pole body involved in modifying the
                     meiotic outer plaque that is required prior to prospore
                     membrane formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495221.1"
                     /db_xref="GeneID:8202368"
                     /db_xref="UniProtKB/TrEMBL:C5DR77"
                     /translation="MPLLNSDYLDRSDMTNSEIETSMKTPETSFNGDYHQDVHSLDNY
                     SVRDDDEEDTSSDEETQGTNQPENSSLKSWFFKPKSKSAATSPTKENAKEERINSSGS
                     AITQSTPTNSKSGSPFRKSLRSFFRREEVKDSDVTQPENSTLESAKDEEPPRQHRFWK
                     SWRGHHSHPNGDYSDSEHDTPQQETVENDFNASKVDPDDMLTHEQKRERNMERLTQQL
                     MNFSSDDDEENGRKSHRYAAEKTHGAGFIEGNVVHDDDDDSNYESSDSSASSSVERAR
                     EVKAKIGQVFSPASEEILCKNNEISPITPVDDVMDNPYKYVFEPVKAQSNASIAHDCS
                     WIDKNSVAFDNFDKALRILTDGLNCSSSLEGSLFTISELSNEFLDMVKNYTENHEKVA
                     QEKIDMEITLNTVQSSFGNLRKEVEDKDRENVKLKTELELLKDKYSHLEKDFESLSEE
                     AEILTDEVAHSKKDFFAAKDCERTVNERTQEQVNTLKKELEIKTKEFDETLADLQRER
                     AKQDSSQANQETLQSKQDSLQNKLDCLEADNKTINCEFQSSKKEYDIMKAKYDFVESQ
                     YQTLRSECDAIRAKHESMQTNHHSMEEQYESLRAAHESLKLQFDTVQNDYKTTIFDNE
                     IIHEKNNILTTRLSDLVGSMNKGGNDERDMKCSNQESFSNKLRRSENIIELLKVGNLK
                     IQDNFRSERSKVLDLRKDNKTLRKQIQLTECYRIQSLQFMSHLMLYYRGIVTDETLAS
                     FEFHLKTISNFGSITEFMVEDDATEKKMKDHETMIVKFYNEIAKESFLDQIVTKHVSY
                     MRSNNFLSNQLSGLKKQMSEYEEYANRLLQEIETHRKTNDKNQKKIAYLKGELSQCSR
                     "
     gene            complement(<499530..>500432)
                     /locus_tag="ZYRO0B06204g"
                     /db_xref="GeneID:8202369"
     mRNA            complement(<499530..>500432)
                     /locus_tag="ZYRO0B06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495177.1"
                     /db_xref="GeneID:8202369"
     CDS             complement(499530..500432)
                     /locus_tag="ZYRO0B06204g"
                     /note="similar to uniprot|Q12010 Saccharomyces cerevisiae
                     YOL092W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495222.1"
                     /db_xref="GeneID:8202369"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C5DR78"
                     /translation="MQLVPIEWNSENISGIAGSISIACWVIVFVPQIYENFHRKSADG
                     LSLMFVILWLAGDVFNLVGAMLQHLLSTMIILAAYYTLADIILLVQCFWYGTEEKVDP
                     VHLSPANPINESVLQDVFHESEPLLHAEIRNRSNEPNQEYQTLNSAELISENGAKRYF
                     NDLFIVFAVVIGGFLSWYISYCNNPHKSKPSSPDLDMNWLAQLFGYLSAVLYLGSRIP
                     QILLNFQRKSCEGISFLFFLFACLGNSAFILSVIIISLDPKYLLVNASWLIGSLGTLF
                     MDFVIFIQFFAYGKGPSASVGDFA"
     gene            complement(<500661..>501551)
                     /locus_tag="ZYRO0B06226g"
                     /db_xref="GeneID:8202370"
     mRNA            complement(<500661..>501551)
                     /locus_tag="ZYRO0B06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495178.1"
                     /db_xref="GeneID:8202370"
     CDS             complement(500661..501551)
                     /locus_tag="ZYRO0B06226g"
                     /note="similar to uniprot|Q12400 Saccharomyces cerevisiae
                     YOL093W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495223.1"
                     /db_xref="GeneID:8202370"
                     /db_xref="GOA:C5DR79"
                     /db_xref="InterPro:IPR007356"
                     /db_xref="InterPro:IPR016009"
                     /db_xref="InterPro:IPR016653"
                     /db_xref="InterPro:IPR028564"
                     /db_xref="UniProtKB/TrEMBL:C5DR79"
                     /translation="MSSEDYKRKMTTLPPTPEGMSKSKWKKVWKKQRYNIMKEEYAQI
                     RKEKRKRARENRRARIQEYIDRGEEIPKELKRQPRENPNQKDSGVNIVLDCGFDDLMN
                     DREIVSMSNQITRAYSSNRRENHFTHMKVTSFGKRLKNRFDEEMKGCHYEQWKNFEFH
                     EDDQLIMGPDVDKTKLVYLTADTDDKLETLEPGMTYIVGGIVDKNRHKALCYNKAKEM
                     GVPAKRLPIDEFINISGRKVLTTTHVVQLMLKYFDNHDWKEAFEYVLPPRKLDQENSQ
                     DDEDDEDEESEDGESEEGGE"
     gene            <502255..>503220
                     /locus_tag="ZYRO0B06248g"
                     /db_xref="GeneID:8202371"
     mRNA            <502255..>503220
                     /locus_tag="ZYRO0B06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495179.1"
                     /db_xref="GeneID:8202371"
     CDS             502255..503220
                     /locus_tag="ZYRO0B06248g"
                     /note="highly similar to uniprot|P40339 Saccharomyces
                     cerevisiae YOL094C RFC4 Subunit of heteropentameric
                     Replication factor C (RF-C) which is a DNA binding protein
                     and ATPase that acts as a clamp loader of the
                     proliferating cell nuclear antigen (PCNA) processivity
                     factor for DNA polymerases delta and epsilon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495224.1"
                     /db_xref="GeneID:8202371"
                     /db_xref="GOA:C5DR80"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DR80"
                     /translation="MSKPPLTLELPWVEKYRPKQLSDTVGNEETIHRLQQIAKDGNMP
                     HLIISGLPGIGKTTSIHCLAHELLGDSYSQGVLELNASDDRGIDVVRNQIKQFAQKKC
                     HLEPGKHKIIILDEADSMTAGAQQALRRTMELYSNTTRFAFACNQSNKIIEPLQSRCA
                     ILRYSKLSDEQVLKRLLEIIKAENVQYTNDGLEALIFTAEGDMRQAVNNLQSTVAGHS
                     LVSGENVFKIVDSPHPLVVKKMLLAPTLDESIALFKNELWDKGYSSVDIVTTCFRVTK
                     TLYQLKEAKRLEMIKEIGIAHMRILEGVGTYLQLACLLAKIHQLK"
     gene            <503348..>505165
                     /locus_tag="ZYRO0B06270g"
                     /db_xref="GeneID:8202372"
     mRNA            <503348..>505165
                     /locus_tag="ZYRO0B06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495180.1"
                     /db_xref="GeneID:8202372"
     CDS             503348..505165
                     /locus_tag="ZYRO0B06270g"
                     /note="similar to uniprot|P39904 Saccharomyces cerevisiae
                     YDR484W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495225.1"
                     /db_xref="GeneID:8202372"
                     /db_xref="InterPro:IPR007258"
                     /db_xref="UniProtKB/TrEMBL:C5DR81"
                     /translation="MLNNPEGRENSLECTAMDVLSSVLGVNENVLDPGENPGEVDHLQ
                     VYLEDSRDPKLQINNNLWHELEKLQEKQKHIQLTIKTTVPPLREYMERFNSQLSEFTS
                     DLGYIRNKSTELKNMLEYNSTRLAKVSPLVNDLMIPPSVIHSILRDKINAAWQENIAF
                     MRDKQEIYDKYKNSDATKPKDFELLYEVLSYLKTVILDRSRKFITRCIKKLRSHQPTA
                     SQRIQDTLLQVRDIFQYIVENNYSLALELRQAYAYTLRWYYKEYFGRYVRSLTILPLK
                     NIDSQYSLSNSISNVHASKSGTSMFSNYLSYGYGKNAGPVTAESIQDYFQISKRLSIL
                     TQEDNTVMVSQIAENNTMSHYIEIGFKNLNLAVLDNCSVELEFLRNFFRINNDEDEFR
                     GMLEQIFQPTFAKTVEYTKQLIQYTFDIFGVLMCIRIAQQLQFESKKRQLVVMEENLN
                     NHLMLLWPKFQQLVDFQCDSLHKVPITAAVARPLNNSSHRNPLTTPLELTIQFSKFLT
                     SLLTLACTHRAPIDERSEPLYNSIFRIRNDFETVMTKCSKKTSSPERMLAINYMFLYN
                     TLEHQNLNLQGQADQELPAVVKETEDHFKALVEALSKVT"
     gene            <505377..>507515
                     /locus_tag="ZYRO0B06292g"
                     /db_xref="GeneID:8202373"
     mRNA            <505377..>507515
                     /locus_tag="ZYRO0B06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495181.1"
                     /db_xref="GeneID:8202373"
     CDS             505377..507515
                     /locus_tag="ZYRO0B06292g"
                     /note="similar to uniprot|Q05379 Saccharomyces cerevisiae
                     YOL095C HMI1 Mitochondrial inner membrane localized
                     ATP-dependent DNA helicase required for the maintenance of
                     the mitochondrial genome not required for mitochondrial
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495226.1"
                     /db_xref="GeneID:8202373"
                     /db_xref="GOA:C5DR82"
                     /db_xref="InterPro:IPR000212"
                     /db_xref="InterPro:IPR014016"
                     /db_xref="InterPro:IPR014017"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DR82"
                     /translation="MELTTSQRKVIEFPYKPASTLKVVAGPGSGKTVTLLYKVRHLVE
                     TEQVRPDEILILSLTNKAVDNVIDKLLGVFEESYGENQLTDYELREIVGQIHVNTIHG
                     LANRIIIENEGLVSIIEENGWKGLMKLLSQDLWKNQHSRLMTPRGVQKMFNEYKLGNT
                     KKNEVMERLMKIMKDCQVFTNEDLISNAPHYLDHPSDRIDSLEGQCFTRALVDGFKVV
                     LIDEFQDLFPSVLPMLEKIAANKQLILFGDSNQSIYNFLGDNKTVIDRLDKLHTGDNF
                     TVVHLYDNFRSTPEIISVASKVMRHKVDLDELAKKDLVLKDPSGVYPEFQEIGDPLDE
                     LEALTEKICMLVCSGATLSDVAVLARTNAHVQIIADHLRFYGIPFRKLTAQPDWISDS
                     RVQFLIGLLRTVVLVRRGIFEESDPLAAKRSDFSVIVTLSAIRGVGNQAIQSLFRVCN
                     EKKVSLWNYITEVPKNEWPPAVTNRKKIEGYITMISHLMEEDPLVEIEDPLQLLTRIS
                     EAAYSLDFAPMVIKSEREIHEFKANLQEMFRVMKICSLNRSPESSLADWFLESYVEQG
                     AIQHHQDVEFQSEGLGAVNLSTIHSSKGLEFPVVFLIGGLNHFPMEQNLLYVGMTRAR
                     NLLYLNNIKHASISSNANTRESGSALLNDKFWNYYSQDMKRPTLHSAADSIKKYEMIR
                     KKYGFNFIGKRTITTWNYKHAISLFKRLIR"
     gene            complement(<507523..>509727)
                     /locus_tag="ZYRO0B06314g"
                     /db_xref="GeneID:8202374"
     mRNA            complement(<507523..>509727)
                     /locus_tag="ZYRO0B06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495182.1"
                     /db_xref="GeneID:8202374"
     CDS             complement(507523..509727)
                     /locus_tag="ZYRO0B06314g"
                     /note="similar to uniprot|Q03388 Saccharomyces cerevisiae
                     YDR485C VPS72 Protein of unknown function component of the
                     Swr1p complex that incorporates Htz1p into chromatin
                     required for vacuolar protein sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495227.1"
                     /db_xref="GeneID:8202374"
                     /db_xref="GOA:C5DR83"
                     /db_xref="InterPro:IPR008895"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="UniProtKB/TrEMBL:C5DR83"
                     /translation="MSDDDLDLNEEEFLMSTRQRRSNAGNKMKKLLEQELEDMQSRTE
                     RLEEDEVDLLFKEEGDDEDFESEASGDNENEFGQNLEETGGGDADEMFSESEEEPGDQ
                     EEDNEEGEKNLRRQEKLESRKRKRRTPAVIKRKRPKSDTEDVAAKQEQEEKKKAQYEQ
                     IKAETLLITNRRTSQRSSVVANKLKVYEKLSKAEKKRKVIQDRIKKHKESQKEEILTQ
                     EDRIRIALETEKFNILSLDKYKEQEISKKQSRIALQQRQKMKFKPGETVLRQLSCTWQ
                     VTPANEIEDAKYWEEQLKRREKKTRRYTRRPHKKKNLDPKEEENGVKVKEEVHEESAL
                     KDTNDTGSQLQVATSITTPLEPNEKVSMQPREEKESVKPVQGTETLTEEGEKDKSVAT
                     NTEDDNMEKKSTKEPSPPLNESNSENASGEQRGSDTQSTPEDGSSLKLEEDIQAMREE
                     KKTELTADEIKEATPPQSANEVEAPSEREKLSTATISKQVQFVDEPQVNIIDSSDRPL
                     SASPNMPSPTDTTHDKPTPDLIEDAGSEEELVFEGPEQLVGKNFITLYSFPTESYRND
                     INKELFGENWANGSSHRSSDVETVCKLTMPEGKIDVLEDTSLAPNLSFLNNFPAFGEY
                     DKKVVHDVDSTANKEHEIEVKTAPPTGVFLPNGFRKKCLISSKECQYFDPKNGVPYSD
                     VETYKTIQDLQDPIGSGTEEEPGPHYRWFGFGNGGIYLDVGQKPAKGVPDGF"
     gene            <509906..>510814
                     /locus_tag="ZYRO0B06336g"
                     /db_xref="GeneID:8202375"
     mRNA            <509906..>510814
                     /locus_tag="ZYRO0B06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495183.1"
                     /db_xref="GeneID:8202375"
     CDS             509906..510814
                     /locus_tag="ZYRO0B06336g"
                     /note="similar to uniprot|P27680 Saccharomyces cerevisiae
                     YOL096C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495228.1"
                     /db_xref="GeneID:8202375"
                     /db_xref="GOA:C5DR84"
                     /db_xref="InterPro:IPR010233"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DR84"
                     /translation="MIPRVTVRRLVPQLRPGVASLRFKTTSASKDEIGHFQELAPTWW
                     DVNGSQRILHLMNNSRLDFIQRIIRQSVKVEDPDTYIPGFQYKAFFPQQVSQGIEDDL
                     DSKINEKLKDAQFNVLDIGCGGGILAECLARLPITRHVTGVDLTPDVIKVAREHSAKD
                     PALSGKLEYRLQALEEVEGTYDLVTCFEMLEHVDVPAEILRHAWMRLKPQGILFLSTI
                     NRDFISWFTTIFMGEYVLKVVPKGTHHLTKYIKSSEIKEWFQENEPHTHKILDTKGVM
                     YRPFNGWAEHDCPDIGNYFMAIKKLN"
     gene            complement(<510866..>511540)
                     /locus_tag="ZYRO0B06358g"
                     /db_xref="GeneID:8202376"
     mRNA            complement(<510866..>511540)
                     /locus_tag="ZYRO0B06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495184.1"
                     /db_xref="GeneID:8202376"
     CDS             complement(510866..511540)
                     /locus_tag="ZYRO0B06358g"
                     /note="similar to uniprot|Q03390 Saccharomyces cerevisiae
                     YDR486C VPS60 vacuolar protein sorting (putative)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495229.1"
                     /db_xref="GeneID:8202376"
                     /db_xref="GOA:C5DR85"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DR85"
                     /translation="MNRILGYGNKKSHEQMLQESGRAMDQAQQGLQQRVSNLDTQISQ
                     LSFQLQTLQRKISTSRSAAGQRPLRQQALKLLNKRKQLEQMRDQLDSQSWSMSQAQMT
                     SDNLKNTMVTVNALKTTNKALKAQYGKINVDKLQDMQDEMADLIEQGDELQQVLASNS
                     LAYDAEDVDEDELDAELDALADEDLTSGIEGSGLEVPSYLSGTAPQFVDEEPDSEPAK
                     ALESAQ"
     gene            <511760..>513052
                     /locus_tag="ZYRO0B06380g"
                     /db_xref="GeneID:8202377"
     mRNA            <511760..>513052
                     /locus_tag="ZYRO0B06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495185.1"
                     /db_xref="GeneID:8202377"
     CDS             511760..513052
                     /locus_tag="ZYRO0B06380g"
                     /note="highly similar to uniprot|Q12109 Saccharomyces
                     cerevisiae YOL097C WRS1 Cytoplasmic tryptophanyl-tRNA
                     synthetase aminoacylates tryptophanyl-tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495230.1"
                     /db_xref="GeneID:8202377"
                     /db_xref="GOA:C5DR86"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002306"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DR86"
                     /translation="MNQADQAVEQLAQLSTKESKKDQVITPWDVNGAVDDKGVAQSID
                     YDKLITQFGTKRISDELLQRFESVTGHKPHHYLRKGLFFSERDVSKILDLYEQGKPFF
                     LYTGRGPSSDSVHLGHMIPFIFTKWLQDVFDVPLVIELTDDEKFLFKQKLTIEDVKGF
                     SKENCKDIIAVGFNPENTFIFSDLEYMGSGFYETVVRVSRQITGSTAKAVFGFNDSDN
                     IGKFHFASIQIASSFPSSYPDVLGLPPKTPCLIPCAIDQDPYFRVCRDVAEKLKFSKP
                     ALMHAKFFPALQGSTTKMSASDDTSAIFMTDTPKQIQKKINKYAFSGGQVSMEQHREL
                     GGNPDIDVAYQYLSFFKDDDELLARLAKDYKSGDLLSGEMKKECIGVLQEFVKGFQER
                     RAKVDESVLESFMKPHKLVWGQKERLVPVKEAPPKGKK"
     gene            complement(<513145..>513813)
                     /locus_tag="ZYRO0B06402g"
                     /db_xref="GeneID:8202378"
     mRNA            complement(<513145..>513813)
                     /locus_tag="ZYRO0B06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495186.1"
                     /db_xref="GeneID:8202378"
     CDS             complement(513145..513813)
                     /locus_tag="ZYRO0B06402g"
                     /note="highly similar to uniprot|Q99258 Saccharomyces
                     cerevisiae YDR487C RIB3 3
                     4-dihydroxy-2-butanone-4-phosphate synthase (DHBP
                     synthase) required for riboflavin biosynthesis from
                     ribulose-5-phosphate also has an unrelated function in
                     mitochondrial respiration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495231.1"
                     /db_xref="GeneID:8202378"
                     /db_xref="GOA:C5DR87"
                     /db_xref="InterPro:IPR000422"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:C5DR87"
                     /translation="MSNSTTMTSDQTFMPIEQVLEHFKKNQFVIVMDDEDRENEGDLI
                     CAAAGITTEQMAFLVRHSSGYVCAPMSNEVADRLDLPLLRTGMKYTSNADDRHGTAYT
                     ITVDAAEGTTTGISAHDRALTCTQLAAAHSQSTDFLKPGHICPLRAADGGVLQRPGHT
                     EAAVDLSRLCGLPPVGVICELVNDHDGSMMRLDDCKEFGKQWGIPLITIKQLAEYAKR
                     HGQQ"
     gene            complement(<514172..>515944)
                     /locus_tag="ZYRO0B06424g"
                     /db_xref="GeneID:8202379"
     mRNA            complement(<514172..>515944)
                     /locus_tag="ZYRO0B06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495187.1"
                     /db_xref="GeneID:8202379"
     CDS             complement(514172..515944)
                     /locus_tag="ZYRO0B06424g"
                     /note="weakly similar to uniprot|P40960 Saccharomyces
                     cerevisiae YDR488C PAC11 Dynein intermediate chain acts in
                     the cytoplasmic dynein pathway forms cortical cytoplasmic
                     microtubule capture site with Num1p null mutant is
                     defective in nuclear migration essential in the absence of
                     CIN8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495232.1"
                     /db_xref="GeneID:8202379"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DR88"
                     /translation="MDKLQELEEKKRQLRELRERRQNHGGIISNLLQQSVQSPVMVSA
                     SVQTDEVGTIKSEPQTVHREVITYDKSIQVDLPQESAAEQDSIAINVPETIDESTQED
                     DKEADDQPKNESVLQPQLKYLEPLVVEDQSNTVHDKSFSIFEILQESHGSHTFDGGSA
                     QPNTGDPFEHVVEWDSTLTCPEGGRLICVSLDHYKDLIVALFRSEPVAKFNKMAATWS
                     HVRVFKWDTGQMVDSIDFRGQTLLWAKFLRRNTSSNVVPILITTYTGKTILCELRCVG
                     NTQNKRMERNLIIKNYHAHPIYAFDEYKNVAQGKERFLVASSNGIINELSPWNLSPYK
                     DATSNTQQLWETVVEPPKASEIYNLNHDDDDDDSIEDMVKEDLHQQCFTDHLLRVSLY
                     DELAITSLAICPSNQEQIYVGTEDGGIYKLELSNLTTKNSLVIHQSNHGFIPNTMAPA
                     FHSSHVVSLHFDQNELLLSASLDWTCCLWDPKNNCKLGQFDVGTPIISTEWLDGNKCA
                     ILTSQALLIVSWHITISLDHRTRIKTYKCTSPPQLEHTFNNPKGNFTCFKTFPAKGSS
                     TLLVLGSSDDTRVQFYRLKNPQTQ"
     gene            <516080..>516946
                     /locus_tag="ZYRO0B06446g"
                     /db_xref="GeneID:8202380"
     mRNA            <516080..>516946
                     /locus_tag="ZYRO0B06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495188.1"
                     /db_xref="GeneID:8202380"
     CDS             516080..516946
                     /locus_tag="ZYRO0B06446g"
                     /note="similar to uniprot|Q6Q558 Saccharomyces cerevisiae
                     YDR489W SLD5 Subunit of the GINS complex (Sld5p Psf1p
                     Psf2p Psf3p) which binds to DNA replication origins and
                     facilitates assembly of the DNA replication machinery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495233.1"
                     /db_xref="GeneID:8202380"
                     /db_xref="GOA:C5DR89"
                     /db_xref="InterPro:IPR008591"
                     /db_xref="InterPro:IPR021151"
                     /db_xref="UniProtKB/TrEMBL:C5DR89"
                     /translation="MDINIDDILADLDRDTTAVEYSDPSQQLPSDGTTVMMNSSIDPN
                     RYKHTQIEISPEKDFKQLMRLWRNERCSPELLPYPSLLMSRMLRRVQEQMDHIENVSM
                     GFLEEYESLEPAPTPNNKLQLLCMEAELERVKFVIRSYLRCRLNKVDKYMLYLRQLND
                     NEDDPGITPLNELLSSHELHYHEKHSAILLKLLNNSIVKHMPPELQAINDTEGSVSMV
                     DEPNWNKFVFIYVKGIPNDPLLEEGESGKPCYTVSISDLNEDVELSIGGIYVMPYSVI
                     RDLLMQEKIELI"
     gene            517359..517468
                     /gene="SNR58"
                     /locus_tag="ZYRO0B06468r"
                     /db_xref="GeneID:8202381"
     ncRNA           517359..517468
                     /ncRNA_class="snoRNA"
                     /gene="SNR58"
                     /locus_tag="ZYRO0B06468r"
                     /product="snR58"
                     /note="C/D snoRNA monocistronic SNR58"
                     /transcript_id="XR_002648385.1"
                     /db_xref="GeneID:8202381"
     gene            <517721..>520807
                     /locus_tag="ZYRO0B06490g"
                     /db_xref="GeneID:8202853"
     mRNA            <517721..>520807
                     /locus_tag="ZYRO0B06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495189.1"
                     /db_xref="GeneID:8202853"
     CDS             517721..520807
                     /locus_tag="ZYRO0B06490g"
                     /note="similar to uniprot|Q12496 Saccharomyces cerevisiae
                     YOL098C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495234.1"
                     /db_xref="GeneID:8202853"
                     /db_xref="GOA:C5DR90"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C5DR90"
                     /translation="MVFSKLISVQLDYAPQYHLTKYVSSRTRLQLVHINHKTSPLVQG
                     YFAVATECPTDSGAPHTLEHLVFMGSQKYPYKGLLDTAGNLCMSSTNAWTATDQTVYT
                     LTTAGWQGFKKLLPVYLDHILNPTLTDESCLTEVHHIDPDHLSDKGVVYSEMEAIETQ
                     SWFLTMLEKQKLLFPHGSGYRSETGGLTTHLRELTNDEIRKFHEVSYSPENFCIIVSG
                     NVPEEELLSIVGEWDDELPTFNNPSYKRPFLDTESAKIPAKLSNSVESTVEFPEADES
                     QGELLFAWIGEPYHSYRRDLALSMLMDYFTETALAPLTKQMVEIEDPYANAIDCWSDD
                     FVRTIINLNIHGVPTEKLQATKLKTLEVLSTHEIDLGRMRQVVDNAKWDYVLKVEKSG
                     DAILSQAAITDFIYGHLDGSSLETTLKDLTDFEYLLEWTQEMWQTLLQETFVDNKPVI
                     VIGKPSVKMNKRLETDGNDLIKQREAEFGVHGKALLREQLQNAIACNDEPIPVSLLKS
                     FSLQDHAQAVEFINTKSITTLDNFEYNNNGDEITRRVLEAKPRNFPFFLHLEHFPTQF
                     VELHALVNTRIIKDTSLLPYYHVLDEMFSMPMVEDGQFIPYEDVILKLQRETVDAEVS
                     LGLQGTAPDFIDFKIRCKAENYSKAVEWIKHCLFDMVFEESRVRVLLDNYLTSIVEVK
                     REGDLMLESLTGTHLYTERSVKRSVDPLFVEEILGEVLDDIENGHYETKILPKLELVR
                     NELRAAFSKYHLLVLADATKIGPDIYKPWESLARALGNIPENHVVHVPPAPRLLDATS
                     SLCKSPGDKAFIITTPASESAYMNIVTSVPFDLDYRHPDYPIVSLAAEYLQSVEGPFW
                     KGIRGTGLAYGASMIKMTEANSLGFNIYRGSDVVKCYQVAKDIVTQHASGAVPVNVEL
                     LEGAVSMIINSIASVEKGYFSAAVSKYIDNFILQRGPNFNDYYLQKLGQVTVQDIQDA
                     FKKYFVNLFDSTKSIVFVSCHPSKLENVQEFLEKEGFQVEVKELEDDEEESEVEFD"
     gene            complement(<521075..>524410)
                     /locus_tag="ZYRO0B06512g"
                     /db_xref="GeneID:8202382"
     mRNA            complement(<521075..>524410)
                     /locus_tag="ZYRO0B06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495190.1"
                     /db_xref="GeneID:8202382"
     CDS             complement(521075..524410)
                     /locus_tag="ZYRO0B06512g"
                     /note="similar to uniprot|Q12236 YOL100W Saccharomyces
                     cerevisiae YOL100W PKH2 Serine/threonine protein kinase
                     involved in sphingolipid-mediated signaling pathway that
                     controls endocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495235.1"
                     /db_xref="GeneID:8202382"
                     /db_xref="GOA:C5DR91"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DR91"
                     /translation="MTINGIGRPDTRPLLPGDEDEINSQFTKRHAALQIAEMNRRRVR
                     PPGGPLRSVSSRNLGEPLENDSLPLHRALTNTDNFIPNADLESESIITNNGSGDLGYS
                     ADEQESLGSEDNLSHLAEMEHGMQLDPRLKKQREEWAEKGAAKIVRDVTNPKTGQTTK
                     EVIKKGIKDFKFGDTLGDGSYSTVMVATARDSGKKYAVKVLSKEYLIRQKKVKYVNIE
                     KNALQRLNNSRGIIRLYFTFQDEASLYFLLEYAPNGDFLSIMKKYGSLNEECTCYYSA
                     QIIDAIKFLHQRGIIHRDIKPENILLDKEMKVKLTDFGTAKLLDGKSQASGETYDLHT
                     RSKSFVGTAEYVSPELLNDNWVDYRCDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVM
                     KVQYAFTAGFPVVVRDLVKRILLRQPDQRLSIPQIERHYFYRDKNFRDGSIWFEPAPE
                     VQPYRVTAKSMQPIPALNTNQHQYQYQPKRPMYVKPTSSGKLTAQDSAGGNAAGAIGG
                     SGVGVGGGGAAAIAASSNNPSSNNGVSSPVGPAKAASPAVPQKKVMDDTTAQILDRAR
                     REVDNRKFPGQKRSTAGTATQNAAYKKNQSSMTSSPSSSGASSIAPLASHVRPKSAAT
                     VKSTNTYTSPMIFPSNNGSTNTVDSMKKTSASPPISQGFTGQPPGNRVVGNETKGTLK
                     MSKIDLLWELYLKDSNEHVLGAGEVNFAVVDNSSFERRVSKSNGSLSESQRLGSSRAT
                     LLSQVARGGGGVTGLRNEYNPTTLLESDYYGTLDVSLEDLHPDYQVLGGDSSLNPSAE
                     KEGSPTPSSEENPNAPISNKFRKFFYHKQDATPSVTDLGNYYRRMLVVTSYGRVLILT
                     KRNKLIPGTSMNFDLCYDINVSQSGVRIREVSVPSVTEKSGNFVIQTPYDSFLFRTTE
                     HSVDGWLLVLHDCIKRNHERLVTKSKNDAARNEDAMKAAKLATPVLVQEKPVQQREPH
                     QKELYYSSSPQALGSPPAVPSRTPKTPRSSLYSVASGDSTVSLSGTGPSRSAKNEHMF
                     ESFVNSKEKNTKKQTSPVPMSSKLVSGLPYYNYNNSVGLGISPQSSVSPAVANTGKTS
                     KKSINPSNSRLLARSEQTFRRKH"
     gene            <525578..>526144
                     /locus_tag="ZYRO0B06534g"
                     /db_xref="GeneID:8202383"
     mRNA            <525578..>526144
                     /locus_tag="ZYRO0B06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495191.1"
                     /db_xref="GeneID:8202383"
     CDS             525578..526144
                     /locus_tag="ZYRO0B06534g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495236.1"
                     /db_xref="GeneID:8202383"
                     /db_xref="UniProtKB/TrEMBL:C5DR92"
                     /translation="MNVAATVIKSELMQVAKGRKSEAKVRIRRYLQHAGFTPGDVRDL
                     PPRPTSEISLDTEMLFFLISMNELDILEENISMAKLSSPNNEAPRKLRLFSSIYLKIK
                     RGLFHHHRGHQRFNRPSSGSEDEGDAAEEELDEKMELLGFENGSDSYKGDSPSSIQTV
                     IQNDSLVMITPPGFPSDPKPTTNILKIM"
     gene            <526478..>527434
                     /locus_tag="ZYRO0B06556g"
                     /db_xref="GeneID:8202384"
     mRNA            <526478..>527434
                     /locus_tag="ZYRO0B06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495192.1"
                     /db_xref="GeneID:8202384"
     CDS             526478..527434
                     /locus_tag="ZYRO0B06556g"
                     /note="similar to uniprot|Q6Q557 Saccharomyces cerevisiae
                     YDR492W IZH1 Membrane protein involved in zinc metabolism
                     member of the four-protein IZH family transcription is
                     regulated directly by Zap1p expression induced by zinc
                     deficiency and fatty acids deletion increases sensitivity
                     to elevated zinc"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495237.1"
                     /db_xref="GeneID:8202384"
                     /db_xref="GOA:C5DR93"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:C5DR93"
                     /translation="MSSITEVKRRRVPIGNGNGEGLYKEVLEEKTLYDFHELPEWQQD
                     NDKILTGYIRETKSVLKCVRSLFIWNNETVNIYTHLVSAVSYFLLMLGITDLVMVPHF
                     PTSTFTDYSVINFYLLGAFGCLMCSSCFHTFKQHSGPHSDAWSKVDYMGIIVLITCSM
                     ISLIYYGFFDHMEYFRLFTVLTLTLATACTVCVLSDKFNHKDFRPLRAGFFIAFGLSG
                     VFPVAAGIIKFGIQGGVQRVQLKYLGLEAIFYIAGALIYGFRIPETMFPGRFDFWGHS
                     HQIFHVLVVIASFLHLKAVMGSYIFKHSHLNGVGLAALQSTY"
     gene            <527737..>528096
                     /locus_tag="ZYRO0B06578g"
                     /db_xref="GeneID:8202385"
     mRNA            <527737..>528096
                     /locus_tag="ZYRO0B06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495193.1"
                     /db_xref="GeneID:8202385"
     CDS             527737..528096
                     /locus_tag="ZYRO0B06578g"
                     /note="similar to Q03429 YDR493W uniprot|Q03429
                     Saccharomyces cerevisiae FMP36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495238.1"
                     /db_xref="GeneID:8202385"
                     /db_xref="GOA:C5DR94"
                     /translation="MSLRQNALNAYRNGLRATRIAFGGDTRMLLASRAKMREGMENPP
                     NPELSKEQQIKHLEDVATFLKRNLVQGRKEGTDEKYHLNIHKETELGDNESIKQTKKT
                     LVSQGGGCCGGGKDLYK"
     gene            <528219..>528914
                     /locus_tag="ZYRO0B06600g"
                     /db_xref="GeneID:8202386"
     mRNA            <528219..>528914
                     /locus_tag="ZYRO0B06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495194.1"
                     /db_xref="GeneID:8202386"
     CDS             528219..528914
                     /locus_tag="ZYRO0B06600g"
                     /note="similar to uniprot|Q12272 YOL102C Saccharomyces
                     cerevisiae TPT1 tRNA 2'-phosphotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495239.1"
                     /db_xref="GeneID:8202386"
                     /db_xref="GOA:C5DR95"
                     /db_xref="InterPro:IPR002745"
                     /db_xref="UniProtKB/TrEMBL:C5DR95"
                     /translation="MSKRDIQISKSLSYLLRHGALKEKLPIDANGYVPLQVLLAHNRL
                     KSHRCTLEDVHRIVDSNEKKRFHTKVSSEGQELICATQGHSIKSVLPTEDVLHEIRDP
                     KELPPKLVHGTTVHNALLILQSGAIKKLRRNHVHLSPGVTGVDAAVVSGMRATSNVHI
                     YIKLGSELLEQMKVYKSLNNVYLVPDDVPIALFDKLTIRPLKQQEKMGEELSELLQLL
                     KDHQIHFEFIQDA"
     gene            <529068..>530006
                     /locus_tag="ZYRO0B06622g"
                     /db_xref="GeneID:8202387"
     mRNA            <529068..>530006
                     /locus_tag="ZYRO0B06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495195.1"
                     /db_xref="GeneID:8202387"
     CDS             529068..530006
                     /locus_tag="ZYRO0B06622g"
                     /note="weakly similar to uniprot|Q8X185 Saccharomyces
                     cerevisiae YDR494W RSM28 Mitochondrial ribosomal protein
                     of the small subunit genetic interactions suggest a
                     possible role in promoting translation initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495240.1"
                     /db_xref="GeneID:8202387"
                     /db_xref="UniProtKB/TrEMBL:C5DR96"
                     /translation="MFNRVGRACYSTGVTQEFLQNILARAQEATAKKTDAVANPAKRR
                     RDNVKKASRRSKPVAPRVKPAASPSVINKQPQFKKKNGAAMKGESEGVDLIDVMSGSK
                     PRTNKKPGFRQSKREIPGMKKSTMIKGESKQFVPKPVVQKEYAPQEPTPLSLMRFCPD
                     IPVTPASRMINYSLDALKSANYPLNRFPNYGFYDNAQGPPKHITISLHTPNFGRYQPD
                     QGLVFEREKFLSELAVECEPSKLAAEVSGKYQILKQHNKEDFKSIAKSEKKREELVAN
                     GEVVRKSLESNPLDPAVKELLYDVCSGLKPISDLTQ"
     gene            complement(<530103..>532883)
                     /locus_tag="ZYRO0B06644g"
                     /db_xref="GeneID:8202388"
     mRNA            complement(<530103..>532883)
                     /locus_tag="ZYRO0B06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495196.1"
                     /db_xref="GeneID:8202388"
     CDS             complement(530103..532883)
                     /locus_tag="ZYRO0B06644g"
                     /note="similar to uniprot|P23643 Saccharomyces cerevisiae
                     YDR495C VPS3 Vacuolar sorting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495241.1"
                     /db_xref="GeneID:8202388"
                     /db_xref="GOA:C5DR97"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="UniProtKB/TrEMBL:C5DR97"
                     /translation="MGQDEGEQSNKEARCENPDEDPQNETKTTTDESEGSQEQTEDGI
                     GLQVEEGPFEKHTLIQNLLPDLEYSCFEAYDENIYLGTKNGDLLHYFEIERQNYMLVS
                     RTKFNDESNKPIRKIILLPQIERALVLCDGILVVFLLPEFAPAPNTTKLKGVLDITLR
                     NYSSQFKFYRFYAIKEESVKMLKISSQSISTAQNFDFKLISKASAIDYTLMTSKLNSY
                     EIINLKDSAAIPLFPVSETDAPLKPIITKFGDNEFLVTTGGGSEDDNSIAFVVTSTGE
                     ISHGTIVLSRYPKDIVVEYPYVVVNLNSKQIEVFKLSPNAEPQVVQRMSLNNSDMGLC
                     RSSKVFNNFEQTQTKGKVVEKLRLVPLYEGNHHFRIESEVAYINEIFEEETSLVVYGK
                     FGIELLVKRSPILDFEQHGESEIDKLEDYLDETKSLTFSKLQLIERNYVITMLLLLII
                     LHGKSVSEETAEGWCSRADRVDIKLLFYLLDLTIYGELWVCNGLTKLINQLKALNLIN
                     KCDDVVKLLKLIKNRVQNSKLRKSIKDYSNVIKMADVNILQRQLMEGGDNIDVDSFEE
                     NSLEDITTIVEEKSEDHLELLLSIYQRRSMFQELINLLKKKKDIKRIFQFLKKNATEL
                     PPRYKADNLADDLIFIINETPQPEKYLIREFLKILSSAEVDPGELLGKTGSNTKVKVF
                     IIEEIGPRSSDDKEFLINFYMAKLQEALQEGNIWDVFAGFAAEYTRDMNYTKCSIAEF
                     LLIKLRHNEHCQSFTECYQNVKNLCMQDEGDRLLRSVITQVKSFDVNHMLTILFIPED
                     EIKEEFLTRQDMFKAFLSFNDFLGIEKFINEDTILEVLRHYNTLPRGPDSLKLMVQLL
                     KRNMYCVHDDGTLVALLREIPQEYSFKPLFEVIYSALRRIDNLKKELELQKALLKDEN
                     AINKTILTDISK"
     gene            complement(<533122..>535101)
                     /locus_tag="ZYRO0B06666g"
                     /db_xref="GeneID:8202389"
     mRNA            complement(<533122..>535101)
                     /locus_tag="ZYRO0B06666g"
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /transcript_id="XM_002495197.1"
                     /db_xref="GeneID:8202389"
     CDS             complement(533122..535101)
                     /locus_tag="ZYRO0B06666g"
                     /note="similar to Q04373 YDR496C uniprot|Q04373
                     Saccharomyces cerevisiae PUF6 Pumilio-homology domain
                     protein that binds ASH1 mRNA at PUF consensus sequences"
                     /codon_start=1
                     /product="pumilio-family RNA binding domain-containing
                     protein"
                     /protein_id="XP_002495242.1"
                     /db_xref="GeneID:8202389"
                     /db_xref="GOA:C5DR98"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012959"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DR98"
                     /translation="MVSMAKRNKQNGKRSFEAEKSTLQTAKKPRISVDSSDEEYDEPM
                     KAPSDLGSEDEDELDELDDVDEQEADGSDQEEGEGGLEDSEGEEEGDVKEQDNDTEGK
                     HKEQRKLLRERKQSRKGGTQVQQIKSLWEKLRVKNAPIPRAERQELSDQVWELSKDCI
                     SDLVLKHDASRVVQTLVKYSSKERREQIVDALKGKFYLLATSAYGKYLLVKLLHYGSR
                     KSRQTIIDELHGCLRKLMRHREGAYVVEDLYVLYASNEQKQQMIREFWGSEYAVFRDD
                     HQGLTIEKACESSVEKRTIISKNLLGTISASVEKGSTGFQILHAAMRQFVHIANDKEI
                     EELIEILHESFAELVHTPEGSEVACTLIARTNAKERKQIIRSLRDHTEALIKNEYGTA
                     AFITLLFCVDDTVLVHKTFGPSIRENMKEFLVHKYGRRPFLYLLVGLDSKYFNPHVIG
                     EFNKYIKLSEATSKKPFLQRRHELLGKFAPEFLQTVLENYSGILSENLGCQFISELLV
                     NDEVYEVLKEKDQQLFQDVVDSIAITFKGDITEEDHPIHHPFSVRLLKALIQGGKWNN
                     KEKRFEPLEKVPCLGVKFAQKFYDEIIDSSNLLDWINNPDSSFTIVALFESLLGKKEG
                     KQFFGDFKKIKNKIQTDDSNKGANLLLRLVKEKGV"
     gene            complement(<535548..>537329)
                     /locus_tag="ZYRO0B06688g"
                     /db_xref="GeneID:8202390"
     mRNA            complement(<535548..>537329)
                     /locus_tag="ZYRO0B06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495198.1"
                     /db_xref="GeneID:8202390"
     CDS             complement(535548..537329)
                     /locus_tag="ZYRO0B06688g"
                     /note="similar to uniprot|P30606 Saccharomyces cerevisiae
                     YOL103W ITR2 Myo-inositol transporter with strong
                     similarity to the major myo-inositol transporter Itr1p,
                     member of the sugar transporter superfamily; expressed
                     constitutively and similar to YDR497C uniprot|P30605
                     Saccharomyces cerevisiae YDR497C ITR1 Myo-inositol
                     transporter with strong similarity to the minor
                     myo-inositol transporter Itr2p, member of the sugar
                     transporter superfamily; expression is repressed by
                     inositol and choline via Opi1p and derepressed via Ino2p
                     and Ino4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495243.1"
                     /db_xref="GeneID:8202390"
                     /db_xref="GOA:C5DR99"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DR99"
                     /translation="MKLQWSRSKTPPQNEEVSSLEGSGANSQLETSNDNIKENATQTL
                     TYGADEQNAGPYSTFVDGEADGEDKKDFEDGYDEQSVFSDEYDEGLSWFVIVLTLVSS
                     ISGFMFGYDTGYISSALTSVKQDLSNKTLSYGDKEILTAATSLGAFISSLFAGIVADI
                     IGRKPSIMASNVMFLVGIVLQVCAHKYWQMAAGRLIMGFGVGVGSLVAPLFIGEIAPS
                     MIRGRLTVINSLCVTGGQLVAYACGAGLTHVNNGWRVLVGLALIPVALQFAFFMFLPD
                     TPRYYVMKNDVESARKVLRRTYRRAPDRVIDAKVKELHELNDGIDGKNVLDKVWNMTK
                     ELHANPANLRALIIACGLQGIQQFTGFNSLMYFSGTIFETVGFNNSSAVSLIVSGTNF
                     VFTVIAFFTIDKLGRRPILLIGVPGMMVALIICAISFHFIGIKFEGTSAIVEHSGFTS
                     WGILIIVFIVVYAAFYALGIGTVPWQQSELFPQNVRGVGTSLSTATNWAGSLVIAACF
                     LTMLQNITPSGTFALFAAIAAVSSVFIYFCYPELSGLELEEVQEVLKNGFGIKKSKEL
                     AKHRKKQAAAAKAAAQHKIPRNEIMGD"
     gene            complement(<538123..>539163)
                     /locus_tag="ZYRO0B06710g"
                     /db_xref="GeneID:8202391"
     mRNA            complement(<538123..>539163)
                     /locus_tag="ZYRO0B06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495199.1"
                     /db_xref="GeneID:8202391"
     CDS             complement(538123..539163)
                     /locus_tag="ZYRO0B06710g"
                     /note="similar to uniprot|P28791 Saccharomyces cerevisiae
                     YDR498C SEC20 Membrane glycoprotein v-SNARE involved in
                     retrograde transport from the Golgi to the ER required for
                     N- and O-glycosylation in the Golgi but not in the ER
                     forms a complex with the cytosolic Tip20p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495244.1"
                     /db_xref="GeneID:8202391"
                     /db_xref="InterPro:IPR005606"
                     /db_xref="UniProtKB/TrEMBL:C5DRA0"
                     /translation="MVLVYAQDLRSLQTAMMQELREIGLSCADEKHTKVSEMIIEFES
                     LLKAAVVCLNHEKRLLKLYWTKTSHGMSLQVVNQEPDQYETVLEEIVQLVNFTDWLTE
                     YKTKLKEFIRKAHQDALAQVDSKRDEAIERNALEWEEQQQQQQPANQKATTATTKPAN
                     TSDQVLSKTKQVSANLIRGNQILQAGVLQSDLNLDELKQQTSSLSQMNDKYSQLGFVF
                     DKTSQLVKHLEKASRQEKRDVYLSLGFLCLCITWVLWRRIFKLPCKLVLWVLFRFFKT
                     ILISIGLVRKQSSMPLSPTMDTVATATTSATTTTPTSATSASLDLLSANTKSLEQVVD
                     QAMDRIFPHDEL"
     gene            <539413..>540387
                     /locus_tag="ZYRO0B06732g"
                     /db_xref="GeneID:8202392"
     mRNA            <539413..>540387
                     /locus_tag="ZYRO0B06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495200.1"
                     /db_xref="GeneID:8202392"
     CDS             539413..540387
                     /locus_tag="ZYRO0B06732g"
                     /note="weakly similar to uniprot|Q12366 Saccharomyces
                     cerevisiae YOL104C NDJ1 Meiosis-specific telomere protein
                     required for bouquet formation effective homolog pairing
                     ordered cross-over distributio (interference) sister
                     chromatid cohesion at meiotic telomeres and segregation of
                     small chromosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495245.1"
                     /db_xref="GeneID:8202392"
                     /db_xref="UniProtKB/TrEMBL:C5DRA1"
                     /translation="MSDSEVKPEFSSLLLVSSARSTTLPIKAPTPVFPPSQFVDTIRD
                     RRVALCPSSCFLLYSLNSAKLTFDTSQTSEVPFELFKECYHKNKSRFDLSKYFEVDKM
                     DVPLDQELTFEGTTISETSKEEVSVLPLILKYHRTTANLNTEKHLMAHLTKLKALFKR
                     FVDRKVSNLYINWLKLIESYVELVFRDLLVKWCQWLHTVRAMGHRRSVQTVLRMWLNR
                     LCKQFWSRYFVFENGQKNSVNDMGRRLIRFAQASEWNLDGTSASYGVWIDSKNGIILF
                     ASGLVFEQVQVCPMYGTCIDQIAPEAITTKLLFYVNVAIIECFVNEIS"
     gene            <540624..>541934
                     /locus_tag="ZYRO0B06754g"
                     /db_xref="GeneID:8202393"
     mRNA            <540624..>541934
                     /locus_tag="ZYRO0B06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495201.1"
                     /db_xref="GeneID:8202393"
     CDS             540624..541934
                     /locus_tag="ZYRO0B06754g"
                     /note="similar to uniprot|P32462 Saccharomyces cerevisiae
                     YNL280C ERG24 C-14 sterol reductase acts in ergosterol
                     biosynthesis mutants accumulate the abnormal sterol
                     ignosterol (ergosta-8 14 dienol) and are viable under
                     anaerobic growth conditions but inviable on rich medium
                     under aerobic conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495246.1"
                     /db_xref="GeneID:8202393"
                     /db_xref="GOA:C5DRA2"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:C5DRA2"
                     /translation="MALNPKTRPIEFGGPAGVLGLALGLPIFTVFLNQMVRPDYYIRG
                     FFCNFDFAQLWNGIKPWHYYLTRYDLWTYYTVWFVSLAVMSVILPGKHMQGLPLRDGT
                     KLPYKINGIAISSALALVLSARWTLTGGQMPELQFLYDNHTDICIITILFSLVLSILC
                     YLASFVPLLRGNNGVGTRERILAAPGHTGNCIYDWFLGRELNPRLGPLDVKLFCELRP
                     GMLLWLLINLSCLHHVYLQTGQFNNSLILVNFLQGLYILDGVLNEEGVLSMMDIATDG
                     FGFMLAFGDLTLVPFTYSLQCRYLSVSPLVFSPYHIAAIIAVMTLGFYIFKASNHEKA
                     MFRAGKLPHLKSIKTATGTSLLCDSWWSLSQHTNYFGDWLVSLSWCLATGFQTPLTYY
                     YSAYFATLLLHRQQRDSHKCRSKYGASWQEYESKVPYKIVPYVY"
     gene            complement(<541931..>542368)
                     /locus_tag="ZYRO0B06776g"
                     /db_xref="GeneID:8202394"
     mRNA            complement(<541931..>542368)
                     /locus_tag="ZYRO0B06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495202.1"
                     /db_xref="GeneID:8202394"
     CDS             complement(541931..542368)
                     /locus_tag="ZYRO0B06776g"
                     /note="similar to uniprot|P53834 Saccharomyces cerevisiae
                     YNL281W HCH1 Heat shock protein regulator that binds to
                     Hsp90p and may stimulate ATPase activity originally
                     identified as a high-copy number suppressor of a HSP90
                     loss-of-function mutation GFP-fusion protein localizes to
                     the cytoplasm and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495247.1"
                     /db_xref="GeneID:8202394"
                     /db_xref="GOA:C5DRA3"
                     /db_xref="InterPro:IPR015310"
                     /db_xref="UniProtKB/TrEMBL:C5DRA3"
                     /translation="MVVVVNPNNWHWVEKNTLSWSQAYFEEKLPQLQVEDGSHQVIVT
                     KVSSVRGDSNVSQRKGKPICYFDLQISLMVAVKDGADELISGSLTVPELTHDEEPEIK
                     MESSFGEHQTLLEKQFYPVLLEALLRYQSDLMRAHSGDLGSNV"
     gene            complement(<542545..>543168)
                     /locus_tag="ZYRO0B06798g"
                     /db_xref="GeneID:8202395"
     mRNA            complement(<542545..>543168)
                     /locus_tag="ZYRO0B06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495203.1"
                     /db_xref="GeneID:8202395"
     CDS             complement(542545..543168)
                     /locus_tag="ZYRO0B06798g"
                     /note="similar to uniprot|P53833 Saccharomyces cerevisiae
                     YNL282W POP3 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495248.1"
                     /db_xref="GeneID:8202395"
                     /db_xref="InterPro:IPR013241"
                     /db_xref="UniProtKB/TrEMBL:C5DRA4"
                     /translation="MSLKNLDKQYAQRRQTYRAVLDNPFTNEGSLWPHVKDQQQVWEL
                     IQTILLARCRALADAEVPAPEWPLGITTSFNEIVTLLQHENDDNDQSNRSPLLLLVCN
                     KDHGVSSVVLQQIPLLAYMSPRKVTLVQLPRGALATIQTQLKSDCTEGLLLAWGDELQ
                     SLVNQITAKIDQPQLPWLDQVKFEPTALKLLKTTAPLKKPVEKAGKK"
     gene            <544148..>545521
                     /locus_tag="ZYRO0B06820g"
                     /db_xref="GeneID:8202396"
     mRNA            <544148..>545521
                     /locus_tag="ZYRO0B06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495204.1"
                     /db_xref="GeneID:8202396"
     CDS             544148..545521
                     /locus_tag="ZYRO0B06820g"
                     /note="weakly similar to uniprot|P53832 Saccharomyces
                     cerevisiae YNL283C WSC2 cell wall integrity and stress
                     response component 2 Putative integral membrane protein
                     containing novel cysteine motif. Similarity to SLG1 (WSC1)
                     WSC3 and WSC4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495249.1"
                     /db_xref="GeneID:8202396"
                     /db_xref="InterPro:IPR002889"
                     /db_xref="UniProtKB/TrEMBL:C5DRA5"
                     /translation="MEFRRQWLLVLCLFHCLALADYVHKGCYDTRGLNLRSQSQHDWQ
                     SLSNCQQHCGGSPLVAMRNGGECFCGDSLDLLSSASLTPGLCNTQCNGWAYQSCGGNS
                     SVDVYVDASRSSHSHGSASVSQVALTTTLTSGSSSQVSNINSGSSDSSFVSSSLASST
                     SEPSASGSSQSSSFATSYHHVSSSSLSPVKARVSNPTASQTIQTTPVSISGSPSISTG
                     YVTRVVSTLITRDNKDETVLRTTTALELPSSYSNIDKSTSPKNGNLGGGAIAGIVVGV
                     VLGVLVILAGAGFYLWRRHVLNQEPDLEETKHYQPYSFGDADAMSIDSPSRTGSTCHK
                     GSSATRSSSYGSVPTGFLSDSISKGSLNSLLMTEDTGVNHMRQNMPSTVFEEPPSVYN
                     GSQRFSTGSLPDMMEERNLTVANPDGENNRYSQRKFDDVDEVDEENMFSAGSSGGSYY
                     DQEPKSY"
     gene            complement(546053..546125)
                     /locus_tag="ZYRO0B06842r"
                     /db_xref="GeneID:8202397"
     tRNA            complement(546053..546125)
                     /locus_tag="ZYRO0B06842r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8202397"
     gene            <546314..>547198
                     /locus_tag="ZYRO0B06864g"
                     /db_xref="GeneID:8202398"
     mRNA            <546314..>547198
                     /locus_tag="ZYRO0B06864g"
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /transcript_id="XM_002495205.1"
                     /db_xref="GeneID:8202398"
     CDS             546314..547198
                     /locus_tag="ZYRO0B06864g"
                     /note="similar to uniprot|P36520 Saccharomyces cerevisiae
                     YNL284C MRPL10 Mitochondrial ribosomal protein of the
                     large subunit appears as two protein spots (YmL10 and
                     YmL18) on two-dimensional SDS gels"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL10/YmL18"
                     /protein_id="XP_002495250.1"
                     /db_xref="GeneID:8202398"
                     /db_xref="GOA:C5DRA6"
                     /db_xref="InterPro:IPR005749"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="UniProtKB/TrEMBL:C5DRA6"
                     /translation="MFSGIFKLNSSLRVNFTALQRNTVRSVSILGNLKPSEGSTKGFK
                     RLGRGPSSTKGKTSGRGQKGQKARGKVKSWFEGGQTPIYKLFPKIGFTNVNARPLNEL
                     NLQRIQWFHDCGRLNLEPGEVLDMKKMKDLGLVTGPIKHGIKILGNGKTNFNVPIKIE
                     ASKATPDAIQAIEKVGGEFTSRYFSQFGLRAHLVPHWFLEKRGRIPLQARPTKRKDIE
                     YYSDESRRGYLIKEKSEYWKTIMEARQGGAAQMGKKKTKRTPLELQLEKLSEDSKSNK
                     SLTVNSKIITLEDFKQQH"
     gene            complement(<547283..>548263)
                     /locus_tag="ZYRO0B06886g"
                     /db_xref="GeneID:8202399"
     mRNA            complement(<547283..>548263)
                     /locus_tag="ZYRO0B06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495206.1"
                     /db_xref="GeneID:8202399"
     CDS             complement(547283..548263)
                     /locus_tag="ZYRO0B06886g"
                     /note="similar to uniprot|Q12239 Saccharomyces cerevisiae
                     YOL107W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495251.1"
                     /db_xref="GeneID:8202399"
                     /db_xref="InterPro:IPR013861"
                     /db_xref="UniProtKB/TrEMBL:C5DRA7"
                     /translation="MHYDSKYFEINGPDTLFALNGTPQATKLLAIGYIAISGALLFAR
                     LSEYNRLDDPELKFNSIVSPIVQLIPSKIWKFPVSLILSNFIDVEVWKFIINFTNLII
                     GGSFIEQNWNDNSKELLKFVFVIGSVTNLVVVIVTILLGLITSHIQLDEPLDGNYTVL
                     IGFPIIYKQLMPETTIFQLKNLGFLSKNFRFKLLPIFIMSYLTIFHLIKMHWIQLISI
                     WINFFACWTYLRFFQMLRIGEQITVGDASDTFQLLYFFPDLVKPILKPIFDKTYSLVC
                     YKLELIRPFQNDDIDKSNAIAEQRGAKKISGTLEERRKQLALQVLQERMV"
     gene            complement(548523..548594)
                     /locus_tag="ZYRO0B06908r"
                     /db_xref="GeneID:8202400"
     tRNA            complement(548523..548594)
                     /locus_tag="ZYRO0B06908r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (TCT) cove score=66.58"
                     /db_xref="GeneID:8202400"
     gene            <549372..>550016
                     /locus_tag="ZYRO0B06930g"
                     /db_xref="GeneID:8202401"
     mRNA            <549372..>550016
                     /locus_tag="ZYRO0B06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495207.1"
                     /db_xref="GeneID:8202401"
     CDS             549372..550016
                     /locus_tag="ZYRO0B06930g"
                     /note="some similarities with uniprot|P13902 Saccharomyces
                     cerevisiae YOL108C INO4 Transcription factor required for
                     derepression of inositol-choline-regulated genes involved
                     in phospholipid synthesis forms a complex with Ino2p that
                     binds the inositol-choline-responsive element through a
                     basic helix-loop-helix domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495252.1"
                     /db_xref="GeneID:8202401"
                     /db_xref="GOA:C5DRA8"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DRA8"
                     /translation="MVVKLREIKSNGSIRNIHNSMQLDDVDADVRRQRDESEELLRKK
                     RKPRAKKVNKLSKEEVRQNHVSSEKKRRELVRTIYDELVKMIPDLQPTENRSEMVIYL
                     KTINHLNWLYRNNKRLCAQLEKKYKELGKDGCRIPESLVWELRQGGDSGGNSNDEGNH
                     DNEDIGDNSDDYSNASTNTNNNSKTNSNTNSNTDSNINFNTDTDNSNNNNGTKL"
     gene            complement(550193..550266)
                     /locus_tag="ZYRO0B06952r"
                     /db_xref="GeneID:8202402"
     tRNA            complement(550193..550266)
                     /locus_tag="ZYRO0B06952r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=74.61"
                     /db_xref="GeneID:8202402"
     gene            550597..550668
                     /locus_tag="ZYRO0B06974r"
                     /db_xref="GeneID:8202403"
     tRNA            550597..550668
                     /locus_tag="ZYRO0B06974r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (TCC) cove score=71.59"
                     /db_xref="GeneID:8202403"
     gene            complement(<550779..>551573)
                     /locus_tag="ZYRO0B06996g"
                     /db_xref="GeneID:8202404"
     mRNA            complement(<550779..>551573)
                     /locus_tag="ZYRO0B06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495208.1"
                     /db_xref="GeneID:8202404"
     CDS             complement(550779..551573)
                     /locus_tag="ZYRO0B06996g"
                     /note="weakly similar to uniprot|P53830 Saccharomyces
                     cerevisiae YNL286W CUS2 Protein that binds to U2 snRNA and
                     Prp11p may be involved in U2 snRNA folding contains two
                     RNA recognition motifs (RRMs)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495253.1"
                     /db_xref="GeneID:8202404"
                     /db_xref="GOA:C5DRA9"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DRA9"
                     /translation="MEKDELDLKEELKELKELKRQELKKRRNREDGGSKEGKIKPNAI
                     YLSNLEKQNTTEDQLIDEFSKFGAIKRDQAGVPKCKLYKDDEGKVKGDALIVYARHES
                     VPIAIEMMNGYKLNGFEIKVEVAQFQDKKRKLEDSNDEERSYKSVKSHNNEENVPKPP
                     VVVIGNILDLYEDYHEQELDDIKRDILDGCLEIGFVKKIDLNSVTGEAEVSFENESHA
                     RNCCKEMNGRFFDGRRLLVYMKGEEDESPSDDESQRDSSEGDDLLE"
     gene            complement(<551747..>554551)
                     /locus_tag="ZYRO0B07018g"
                     /db_xref="GeneID:8202405"
     mRNA            complement(<551747..>554551)
                     /locus_tag="ZYRO0B07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495209.1"
                     /db_xref="GeneID:8202405"
     CDS             complement(551747..554551)
                     /locus_tag="ZYRO0B07018g"
                     /note="highly similar to uniprot|P32074 Saccharomyces
                     cerevisiae YNL287W SEC21 Gamma subunit of coatomer a
                     heptameric protein complex that together with Arf1p forms
                     the COPI coat involved in ER to Golgi transport of
                     selective cargo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495254.1"
                     /db_xref="GeneID:8202405"
                     /db_xref="GOA:C5DRB0"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="UniProtKB/TrEMBL:C5DRB0"
                     /translation="MSTHTYKKFENAGSGDLPDRMTIYQDCMSEFNESPVNPKRCRLL
                     ISRLLRLLAEGETFPENEATALFFSISKLFQHPNDSLRQSVYLAIKALSSISEDVLMA
                     TSSIMKDVQNGSDLVKPNAIRALTTVLDESTAFSAERLLKSAVVNKHPSISSAALTSS
                     YHLLPIAEATAKRFVNETQEAVMDLKPFPHRNVVGDYYPNSTFITQYHALGLLYQLKK
                     SDKMALLKLIRQFSDNNTLKSQLAKVGLVKLVSELVTRDAQLFSSFQPLLNNWLSNKY
                     ESVQLETAKLITNFAIQHPHLVSAELHASAVTTLQSLLTVPRVSARFAALRILNRVSM
                     VSPEKIVVCNPELESLINDPNRNISTYAITTLLKTGTESNISSLISTITKFIHEVSDD
                     FKIIIVDAIRTLSINFPQEWMAILNFLIDVLKNGEGGLKFKNNIVEALIDMVSFVPQA
                     KDLALENLCDFIEDCEFNEILVRILHLLGKEGPSTATPSLYVRHIYNRVVLENSIIRS
                     AAVVALSKFALTKNDPTLGESIVSLLRRIANDQDDEVRDRATIALKFIESAKKEENPE
                     AREFVQSRYSYDLPSLESKLSSYISSNADSFQTPFDVTNIRKYTEDEAKAIELKKKQE
                     QLLKGHLENGSESTPGLEEGSKGEKRDSSYAGPSLDEHQEDLRSTKYAEELLSMEQIK
                     EFGPLVNSSRTIDLTDPEAEFVVRGVKHLFNNHAVLQFNITNTLTDIALDNVTVTCTP
                     ENPSESSLEELFSLSIDRLSPSQEAACYVAYNKSEEIVMEGFLNNLTFTTRELDPETQ
                     QPLDDTEGFQDEFDIDSIFLNAGDYIKSSFVGDFTNAFDELPNEEVAVYNIKENITLQ
                     ELVDRLVVNTSCLPLESTQYAPSDSSSHTVKLFGKSALKGEKIALVVKLIKTSKGIAM
                     KAQGRSEDATLCSYLVNGLM"
     gene            <555286..>555705
                     /locus_tag="ZYRO0B07040g"
                     /db_xref="GeneID:8202406"
     mRNA            <555286..>555705
                     /locus_tag="ZYRO0B07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495210.1"
                     /db_xref="GeneID:8202406"
     CDS             555286..555705
                     /locus_tag="ZYRO0B07040g"
                     /note="some similarities with uniprot|P36046 Saccharomyces
                     cerevisiae YKL195W MIA40 Essential protein of the
                     mitochondrial intermembrane space, involved in import and
                     assembly of intermembrane space proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495255.1"
                     /db_xref="GeneID:8202406"
                     /db_xref="UniProtKB/TrEMBL:C5DRB1"
                     /translation="MFRKIVSIGLISRVPQVTRRNIEITKRYASTSSRRISESDRDFA
                     AASLGVITILGSIIFVSPWELKSFLPSFGRKERNTAEPNREPGSEETPKEQSEKPEGE
                     EQPKEEEEQPKQEQQSEESPSTTQESSNKPESENNGN"
     gene            complement(<555842..>556837)
                     /locus_tag="ZYRO0B07062g"
                     /db_xref="GeneID:8202407"
     mRNA            complement(<555842..>556837)
                     /locus_tag="ZYRO0B07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495211.1"
                     /db_xref="GeneID:8202407"
     CDS             complement(555842..556837)
                     /locus_tag="ZYRO0B07062g"
                     /note="similar to uniprot|P53829 Saccharomyces cerevisiae
                     YNL288W CAF40 Evolutionarily conserved subunit of the
                     CCR4-NOT complex involved in controlling mRNA initiation
                     elongation and degradation binds Cdc39p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495256.1"
                     /db_xref="GeneID:8202407"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DRB2"
                     /translation="MFQPYNNMQVPMPMMPGHQVPHGVPMGVMPMLQQQQQQQQAPQP
                     QPQPQPQQLEHGVHALDDPNVYHWICQLTYGPQKEQALLELGRKREQFDDLAVVLWSS
                     FGVMTSLLDEIISVYPMLQPQLLSNQLSNRVCNALVLLQCVASHSETKHLFLQAHIPL
                     FLFPFLNTTSRQRTFEYLRLTSLGVIGALVKNDSQEVINFLLRTDIIPLCLRIMKSSS
                     ELSKTVAIFILQKILLDDVGLQYICATLERFYAVTNVLRDMVDQLTIHTPPGRLLKHI
                     IRCYLRLSDNLEARRLLKVALPAKLRDNTFTDVLRDDVGSKRCLAQLLLTLNEEA"
     gene            complement(<557211..>557450)
                     /locus_tag="ZYRO0B07084g"
                     /db_xref="GeneID:8202408"
     mRNA            complement(<557211..>557450)
                     /locus_tag="ZYRO0B07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495212.1"
                     /db_xref="GeneID:8202408"
     CDS             complement(557211..557450)
                     /locus_tag="ZYRO0B07084g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495257.1"
                     /db_xref="GeneID:8202408"
                     /db_xref="UniProtKB/TrEMBL:C5DRB3"
                     /translation="MSDIENTQVPKTQEPQVEEGFEPKETLQQEQEEPKQALKQAEEQ
                     PKKQAEEQPKKQAEDVKEKKSLFKKITGKIKSFVS"
     gene            <558649..>560571
                     /locus_tag="ZYRO0B07106g"
                     /db_xref="GeneID:8202409"
     mRNA            <558649..>560571
                     /locus_tag="ZYRO0B07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495213.1"
                     /db_xref="GeneID:8202409"
     CDS             558649..560571
                     /locus_tag="ZYRO0B07106g"
                     /note="similar to uniprot|Q07379 Saccharomyces cerevisiae
                     YDL057W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495258.1"
                     /db_xref="GeneID:8202409"
                     /db_xref="GOA:C5DRB4"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR026893"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:C5DRB4"
                     /translation="MNGRFHSLAMGVGVDSKQIEKVSYRVVAEPPSHIKLGNNEQFVY
                     IKHKQFHKAEGVAGILSHPKSMQYDSLQDRLKHEDQFALPQHRLVLLVHGHQAHKNSN
                     YQPILASRLTDLGFYALRIDFRGLGDSEDSKDSKIGRTVVQDTEDIETICELVSDENL
                     SNELFGLPVTLDAIVAHSRGVIAMLEFCRRHPERYIPNLINCSGRYDGKGIIQKRLKY
                     SPNWKKDGGFYCDLPRHGGVSKVWIPHSETLSAVECPSHAFGSINQMTSIMSCYGTCE
                     EIIPLSAVASYSNMFQGRHHLEMIRGATHNFYGLPSDPNAMNLPLRNGLVNYCYVVAD
                     RVIEYLSNENQLQRFFEKTQYIKNATLNPAEILPRWPLPHSFSHVSNFRDLGGYETVF
                     QKRRVKSGCFYRCANICDITPQALKYLQTRLGVVKIFDLRAPDEAKENGLLPNEELVH
                     SLPFNRGMSVSPEMLAEKHKGLLISSYSFPKGYMMILKNSIDEIRIFFQFLLNMTSGE
                     AVVFHCTAGKDRTGILGMLLLLILGVDEDTISREYELTTLGLKTETKLIKKLEARGDL
                     YYSMLGSNSEELVKQYKLTPKKMCQNLLSSRYESMRFFIDDFFEEYKSIDNFFLYELE
                     FTTQDIGKLRDFYLEE"
     gene            <560990..>563464
                     /locus_tag="ZYRO0B07128g"
                     /db_xref="GeneID:8202410"
     mRNA            <560990..>563464
                     /locus_tag="ZYRO0B07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495214.1"
                     /db_xref="GeneID:8202410"
     CDS             560990..563464
                     /locus_tag="ZYRO0B07128g"
                     /note="similar to uniprot|P39678 Saccharomyces cerevisiae
                     YDL056W MBP1 Transcription factor involved in regulation
                     of cell cycle progression from G1 to S phase forms a
                     complex with Swi6p that binds to MluI cell cycle box
                     regulatory element in promoters of DNA synthesis genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495259.1"
                     /db_xref="GeneID:8202410"
                     /db_xref="GOA:C5DRB5"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="InterPro:IPR018004"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DRB5"
                     /translation="MSSNQIYSAKYSGVDVYEFIHPTGSVMKRRDDDWVNATHILKAA
                     RFAKAKRTRILEKEVIKEVHEKVQGGFGKYQGTWVPMDVARTLATKFGVHDELSPLFD
                     FTQTNGSASPPQAPKHHHASRGDSTRKRAVKSASTSAVVEGQQGTALVNPAVSRRRGR
                     PATGQRGKRKLNTTLQRSQSDMGYPRPAIPNSSIATTQLPSIRAAHMNSLVEENDGAD
                     DDDNDINNTNNRNNNAGHRAHFKELDIVDGLSSDIEPHGHMTMAHPGLVPGNGANDTT
                     TNSQKLIHGTISSSQSSPSLPTSPSELSEANPFDHRFGSAGTSPIMSAIPRYSIQSRP
                     QSTDIHDKVNEYLSKLVDYFISNEVRSNRSVPTELLLPPPHSAPYIDAPIDPELHTAF
                     HWACSMGNLPILEALVEAGTSTRSTNSQGQTPLMRASMFHNSYSRRTFPRIFELLHDT
                     VFDVDSQLQTVIHHVVKRKSTTPSAVYYLDVILSKLKDFSPQYRIELLLNSQDSFGDT
                     ALHIAAENGDKTFFNTLIRNGALSTITNKERLTPNEIMNEHYEQILNKNQAQMNSEIN
                     AATNGSGLGVGIGNGVTSGGFTTAGHNASGISANSGGIGLSGKIDSPVGSMTPLLNTA
                     ASDYMMFPSQAATRISRCIPEVVASMKQMSDRYNNLYHQRDTDIKNMERTLHSMSKTI
                     RSVNLRTMAVLNNSSFEEFDKTMLEKLTETEKLRWEVKNLRKGMTNRWEKEHYLLLRH
                     FLKQNDTKTQNHDSNGSIDERLKLAVELCVLQLSRKGKLETGLQIVEDSSKIHKYRKM
                     ISEGTEMETEKVDSCLDVILESLSNK"
     gene            complement(<563621..>564706)
                     /locus_tag="ZYRO0B07150g"
                     /db_xref="GeneID:8202411"
     mRNA            complement(<563621..>564706)
                     /locus_tag="ZYRO0B07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495215.1"
                     /db_xref="GeneID:8202411"
     CDS             complement(563621..564706)
                     /locus_tag="ZYRO0B07150g"
                     /note="highly similar to uniprot|P41940 Saccharomyces
                     cerevisiae YDL055C PSA1 GDP-mannose pyrophosphorylase
                     (mannose-1-phosphate guanyltransferase) synthesizes
                     GDP-mannose from GTP and mannose-1-phosphate in cell wall
                     biosynthesis required for normal cell wall structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495260.1"
                     /db_xref="GeneID:8202411"
                     /db_xref="GOA:C5DRB6"
                     /db_xref="InterPro:IPR001451"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR018357"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DRB6"
                     /translation="MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAA
                     GVTDIVLAVNYRPEVMVETLKKYEEEYGVSITFSVETEPLGTAGPLKLAEKVLKKDSS
                     PFFVLNSDVICEYPFKVLADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRF
                     VEKPVEFVGNRINAGLYILNPEVIDMIDLKPTSIEKETFPVLVEQKQLYSFDLEGYWM
                     DVGQPKDFLSGTVLYLNSLRKHKPEKLAKDSNVIGNVIVDPTAKIDPSAKIGPDVVIG
                     PNVTIGEGVRITRSVVLSNSTVKAHSLVKSTIVGWASTVGQWCRLEGVTVLGDDVEVK
                     DEIYINGGKVLPHKSISSNVPAEAIIM"
     gene            <565570..>566499
                     /locus_tag="ZYRO0B07172g"
                     /db_xref="GeneID:8202412"
     mRNA            <565570..>566499
                     /locus_tag="ZYRO0B07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495216.1"
                     /db_xref="GeneID:8202412"
     CDS             565570..566499
                     /locus_tag="ZYRO0B07172g"
                     /note="highly similar to uniprot|P53045 Saccharomyces
                     cerevisiae YGR060W ERG25 C-4 methyl sterol oxidase
                     catalyzes the first of three steps required to remove two
                     C-4 methyl groups from an intermediate in ergosterol
                     biosynthesis mutants accumulate the sterol intermediate 4
                     4-dimethylzymosterol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495261.1"
                     /db_xref="GeneID:8202412"
                     /db_xref="GOA:C5DRB7"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:C5DRB7"
                     /translation="MSAVFANSTLSHLVRAETFAGTLTNVQNRVPLKLNLVEQLWAAW
                     YSYMNNDILATGLLFFLLHEVMYFGRSLPWFIIDQIPFFRRYKIQPTKIPSAKEQWHC
                     LKSVLLSHFLVEAIPIWTFHPLCEKLGISVQVPFPHWKKIAIQIGLFFLGEDMWHYWM
                     HRLFHYGVFYKYIHKQHHRYAAPFGMAAEYAHPMETMILGFGTVGMPILYVLYTGHLH
                     LFTLCLWISLRLFQAVDSHSGYDFPWSLNKFFPLWAGAEHHDLHHHYFIGNYASSFRW
                     WDYTMDTEAGPEAKLAREERMKSIANRGAKKNL"
     gene            567502..567588
                     /locus_tag="ZYRO0B07194r"
                     /db_xref="GeneID:8202413"
     tRNA            join(567502..567538,567553..567588)
                     /locus_tag="ZYRO0B07194r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (TTT) cove"
                     /db_xref="GeneID:8202413"
     gene            complement(<567629..>569548)
                     /locus_tag="ZYRO0B07216g"
                     /db_xref="GeneID:8202414"
     mRNA            complement(<567629..>569548)
                     /locus_tag="ZYRO0B07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495217.1"
                     /db_xref="GeneID:8202414"
     CDS             complement(567629..569548)
                     /locus_tag="ZYRO0B07216g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495262.1"
                     /db_xref="GeneID:8202414"
                     /db_xref="GOA:C5DRB8"
                     /db_xref="InterPro:IPR005201"
                     /db_xref="UniProtKB/TrEMBL:C5DRB8"
                     /translation="MKRINQVPGKPEITSLYFDDLNSLQRWFDKGFMDSRDLSNVPKE
                     RYSNYVKFEKDSIITIPNLSARKTEIIVCHDFKGGYQSGHDLYPNGQYGTESCKPYSL
                     RYPEIVDKFVYFSHHCVTIPPSPWTNYLHRHSIPVLGTLILEHYPHNGELFKKNAKGE
                     FLYVKYLVELCRKFHFEGWLINFETVFGNNSKQVIPFLRELTARVECEIYGGSVIWYD
                     AFTTFSNKPSHQNEVNLFNYDAYENSSQFMTNYMWDSHNVGNSLRNVGALGMHSHVAL
                     GVDVWGRNMQVCRGGFESNIAIYYAKRFGTNAVIFAPGWTYENFGEDQFYEKDDIFWG
                     NIKSTLQLDSYSDSQLSSWFVSESKKTRYFTTFFSTGSGNFFNLNGRRISNDNWVQLG
                     LSTPFPVNSHSYLSFKDSFVGGSCLALPLSPMENGKLHLFRFEQFIKDQQKTSDSEIR
                     VKLSYKSLGALPPVKLVIKCFVIRRGKRSKTILKVDDVSLVLPLSHSACQTAQGSTKW
                     AVVEQIVPLPSLESRFLEEYYVEDAHLEWTMDNNHDEWLMVPERTEDLDCKLLIGSLC
                     LEIGPHEDNNKRQIVRNGPQLSWQDNESSFMWLKLQDGKLDSVLFTPTTKVNGKQPTI
                     LECGRNGTLKFVVKK"
     gene            complement(<569894..>571333)
                     /locus_tag="ZYRO0B07238g"
                     /db_xref="GeneID:8202415"
     mRNA            complement(<569894..>571333)
                     /locus_tag="ZYRO0B07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495218.1"
                     /db_xref="GeneID:8202415"
     CDS             complement(569894..571333)
                     /locus_tag="ZYRO0B07238g"
                     /note="highly similar to uniprot|P32915 Saccharomyces
                     cerevisiae YLR378C SEC61 Essential subunit of Sec61
                     complex (Sec61p Sbh1p and Sss1p) forms a channel for SRP-
                     dependent protein import and retrograde transport of
                     misfolded proteins out of the ER with Sec63 complex allows
                     SRP-independent protein import into ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495263.1"
                     /db_xref="GeneID:8202415"
                     /db_xref="GOA:C5DRB9"
                     /db_xref="InterPro:IPR002208"
                     /db_xref="InterPro:IPR019561"
                     /db_xref="InterPro:IPR023201"
                     /db_xref="UniProtKB/TrEMBL:C5DRB9"
                     /translation="MSGRVLDFFKPFEAYLPDVIAPQRKVPYNQKLIWTGVSLLIFLV
                     LGQIPLYGIVSSETSDPLYWLRAMLASNRGTLMELGVSPIITSSMIFQFLQGTQILQV
                     DMQNKQDRDLFQIAQKVCAIILTFGQAVVVVLTGNYGRPKDLGIAISLLLIFQLMFAS
                     FVVLLLDELLSKGYGLGSGISLFTATNIAEQSFWKAFAPTTTNSGRGKEFDGAVIAFF
                     HLFAVRKDKKRALVEAFYRSNAPNMFQVVATVFVFLFVLYLQGFRYELPIRSTKIRGQ
                     IGTYPIKLFYTSNTPIMLQTALTSNIFLISQILYQRFPSSPITRLLGVWGIKPGSLGP
                     QQALSGLSYYIQPPTSYKEIVLDPIKSVVYVSFVLGACALFSKTWIEISGTSPRDVAK
                     QFKEQGMVINGMRETSVYRELKKIIPIAAAFGGATIGALSVCSDVLGTLGSGTSILMA
                     TTTIYGYYEMAAKEGGFSKSLVPGFSELM"
     gene            complement(<571581..>572978)
                     /locus_tag="ZYRO0B07260g"
                     /db_xref="GeneID:8202416"
     mRNA            complement(<571581..>572978)
                     /locus_tag="ZYRO0B07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495219.1"
                     /db_xref="GeneID:8202416"
     CDS             complement(571581..572978)
                     /locus_tag="ZYRO0B07260g"
                     /note="similar to uniprot|Q07376 Saccharomyces cerevisiae
                     YDL054C MCH1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495264.1"
                     /db_xref="GeneID:8202416"
                     /db_xref="GOA:C5DRC0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DRC0"
                     /translation="MTVSRLENALSYHVRCLLPQLLSHERSHKLAYVFSLVSAISSGF
                     IALITLYAQPWQSHLKYNAWQINLIVSVANLGVYLVPPLLGIFADAHGPILLSSLATV
                     GFVPSYSILSYLFNHPEIDTITSFHWSIGCFCLIGASTSALFFSSLLTCAKLYPETKL
                     LSISLPTTCFGLSSFLVSQLLQLDWFWYTNRQYLDLGRVFGTFAGIYASVGALAWIAT
                     ARVSMMQFKQNDAEDDEDDENEPLLSSHLSIPPNQRSFFKDIAGYLFALSLMLALGPL
                     EMMTADIGVVANLVFPHFPTLSSELVSVYAFYSTITRLLTGVVTDWFTRKNWSPKWIL
                     LGFLSTGLLLQLGLWWLVVTPSVGRIHALGMSSLLGIVYGGSFTIVPTVVMIVWGEQL
                     FGTAYGSMMVAPAIGTLSTCMAFAKVYDSNCAVGQNGSYCISPVFKMTSLQFLCSIFF
                     ICCLFRIWSKRKVNI"
     gene            complement(<573123..>573704)
                     /locus_tag="ZYRO0B07282g"
                     /db_xref="GeneID:8202417"
     mRNA            complement(<573123..>573704)
                     /locus_tag="ZYRO0B07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495220.1"
                     /db_xref="GeneID:8202417"
     CDS             complement(573123..573704)
                     /locus_tag="ZYRO0B07282g"
                     /note="some similarities with uniprot|Q07362 Saccharomyces
                     cerevisiae YDL053C PBP4 Pbp1p binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495265.1"
                     /db_xref="GeneID:8202417"
                     /db_xref="UniProtKB/TrEMBL:C5DRC1"
                     /translation="MATSTTTQTATSLAANAGSLPRKPQNNPSLQKPKLTGWAQAAAR
                     SLPKSQQQQQPNQTSSSQQRNIQHPSNVAKSSSSTLTNSNSSTPSLRKSRKQTNGNNS
                     NNNNGTNNNNANVNNNNNNANKPRQPYNREEVRNYMKDLFTQYTSSTSISTYNGLNSS
                     RRGNNLDWGAVTNNRYRNKKYGSLNEIAQVLRN"
     gene            <574633..>575661
                     /locus_tag="ZYRO0B07304g"
                     /db_xref="GeneID:8202418"
     mRNA            <574633..>575661
                     /locus_tag="ZYRO0B07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495221.1"
                     /db_xref="GeneID:8202418"
     CDS             574633..575661
                     /locus_tag="ZYRO0B07304g"
                     /note="highly similar to uniprot|P09201 Saccharomyces
                     cerevisiae YLR377C FBP1 Fructose-1 6-bisphosphatase key
                     regulatory enzyme in the gluconeogenesis pathway required
                     for glucose metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495266.1"
                     /db_xref="GeneID:8202418"
                     /db_xref="GOA:C5DRC2"
                     /db_xref="InterPro:IPR000146"
                     /db_xref="InterPro:IPR020548"
                     /db_xref="InterPro:IPR028343"
                     /db_xref="UniProtKB/TrEMBL:C5DRC2"
                     /translation="MPAPTLKEQFNTDIITLSRFLLESQKLQSNSTGEFTLLLNSLQF
                     AFKFISQTIRKAELVHFSGLAGTSNTTGDEQKKLDVLGDEIFINAMKSSGNVKVLVSE
                     EQEDLIVFPTSNGTYAVCCDPIDGSSNLDAGVSVGTIVSLFKLLPGSTGTIQDVLRPG
                     TEMVGACYAMYGASTHLLLTTGRGVDGFTLDNNIGEFILVYPDLKLPLHNPIYSINEG
                     NSYYWNDETKAFIEKLKEPQENGKPFSARYIGSMVADMHRTFMYGGLFAYPGDRKASS
                     GKLRLLYEAFPMSYLVEQAGGIAVNDRGQRILDLKPNHIHDKSSIWLGSKDDVSQYVK
                     HIGKSVKS"
     gene            complement(<575727..>576593)
                     /locus_tag="ZYRO0B07326g"
                     /db_xref="GeneID:8202419"
     mRNA            complement(<575727..>576593)
                     /locus_tag="ZYRO0B07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495222.1"
                     /db_xref="GeneID:8202419"
     CDS             complement(575727..576593)
                     /locus_tag="ZYRO0B07326g"
                     /note="similar to uniprot|P33333 Saccharomyces cerevisiae
                     YDL052C SLC1 fatty acyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495267.1"
                     /db_xref="GeneID:8202419"
                     /db_xref="GOA:C5DRC3"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR004552"
                     /db_xref="UniProtKB/TrEMBL:C5DRC3"
                     /translation="MLRKALYYFRFTLATAVLCGCSLYGVVASIVLTLVGKQHLAQWA
                     TARCFYYASILFLGIDVKVENEHYLENKPYIIVSNHQSTLDILMLGRVFPQGCTVTSK
                     KSLKYTPFLGWFMTLSGTLFLERANRQKSVETLNRSLDVLKKEKRALWIFPEGTRSYT
                     TNLNILPFKKGAFHLARQGKLPIVPVVVSNTSTLMNHKWKVFNKGCIVARVMKPISVD
                     DLTTEDVGKFSEDLREKMLTELQDLAYSQATVDTHIPPEAKAYKRVENATALSSENSS
                     ERVSTLTKEIDN"
     gene            <576736..>577466
                     /locus_tag="ZYRO0B07348g"
                     /db_xref="GeneID:8202420"
     mRNA            join(<576736..576777,576852..>577466)
                     /locus_tag="ZYRO0B07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495223.1"
                     /db_xref="GeneID:8202420"
     CDS             join(576736..576777,576852..577466)
                     /locus_tag="ZYRO0B07348g"
                     /note="similar to uniprot|Q12318 Saccharomyces cerevisiae
                     YLR376C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495268.1"
                     /db_xref="GeneID:8202420"
                     /db_xref="UniProtKB/TrEMBL:C5DRC4"
                     /translation="MDVLAHCRVYPISNFYHAVPQSLTLPSCIGSHCVSFVHLIEHNF
                     KFTPFKRQIWNQCIECSVNDGSSILVIDIISEWKKIIQENSQGVHYMNSTSICNMEGL
                     QNFLMQLQASPLEALQRCLIKDRLDKQISGIIIDNLSYLAHDLSSYSALIKILKQLRR
                     TFGCWILTIGYGLEYYDGVENSTSTPNRTGALTKLPASYINEMDVIILRETADRGRTV
                     "
     gene            <577628..>578401
                     /locus_tag="ZYRO0B07370g"
                     /db_xref="GeneID:8202421"
     mRNA            <577628..>578401
                     /locus_tag="ZYRO0B07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495224.1"
                     /db_xref="GeneID:8202421"
     CDS             577628..578401
                     /locus_tag="ZYRO0B07370g"
                     /note="similar to uniprot|P33399 Saccharomyces cerevisiae
                     YDL051W LHP1 RNA binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495269.1"
                     /db_xref="GeneID:8202421"
                     /db_xref="GOA:C5DRC5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002344"
                     /db_xref="InterPro:IPR006630"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DRC5"
                     /translation="MSEDQQRRGSYVPIEFTPEITEQCLKQVEFYFSEFNFPYDKFLR
                     ITTEKNDGWVPIGTIATFNRMKKFRPVEKVVEALRTSKILQVSEDGENVKRIEPLDLE
                     GTKNARHERNKRTLAVMNFPHENVDDMTELQEKLEGFFNGLAQINQVRLRRDHGRKFN
                     GTAIVEFNSLEESEKFLKTYSGEDAENLSFEGRKLDVFSKKQFDLQREATRGKNFSGS
                     GQKSRSMTGHRKNMPKEDTKKEEKTEEKKEEEKKEETKN"
     gene            complement(<578441..>579247)
                     /locus_tag="ZYRO0B07392g"
                     /db_xref="GeneID:8202422"
     mRNA            complement(<578441..>579247)
                     /locus_tag="ZYRO0B07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495225.1"
                     /db_xref="GeneID:8202422"
     CDS             complement(578441..579247)
                     /locus_tag="ZYRO0B07392g"
                     /note="similar to uniprot|P39005 Saccharomyces cerevisiae
                     YJL174W KRE9 Glycoprotein involved in cell wall
                     beta-glucan assembly; null mutation leads to severe growth
                     defects, aberrant multibudded morphology, and mating
                     defects"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495270.1"
                     /db_xref="GeneID:8202422"
                     /db_xref="GOA:C5DRC6"
                     /db_xref="InterPro:IPR008659"
                     /db_xref="InterPro:IPR018466"
                     /db_xref="UniProtKB/TrEMBL:C5DRC6"
                     /translation="MRLLLPLFLLVSHVLGQVNVDSPKFGTKYDLSSGTSMITVEWSV
                     SDSPGPKKQEILEYIFTLVSGPNLNIEAFETVGKADAKQVENQKFSFPLRNNVGANGW
                     YYIQVLALTEEGHVIQYSPRFQLTGMVGGRTPQLATDTMTPSREIMLTPNILANMNSM
                     SFSVPYGMQTGLARFAPMQTQPATKVTKKTWSMVYPTSSFTYFKDNKRRGEQLTTVTP
                     GWSYGLPSKWNEAAIAPQPSENGGWYHPSQRLSLTPRKINADERLRLASQ"
     gene            <579784..>581031
                     /locus_tag="ZYRO0B07414g"
                     /db_xref="GeneID:8202423"
     mRNA            <579784..>581031
                     /locus_tag="ZYRO0B07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495226.1"
                     /db_xref="GeneID:8202423"
     CDS             579784..581031
                     /locus_tag="ZYRO0B07414g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495271.1"
                     /db_xref="GeneID:8202423"
                     /db_xref="GOA:C5DRC7"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="UniProtKB/TrEMBL:C5DRC7"
                     /translation="MTVNRTTGVSATQTTEDKYAVDTYGHVFKVPNFTIKDILKVIPA
                     ECYERSLLRGLGYIARDIACLASIGYAAHKVLYPMLFDSASDQWYMQLAKFSFWLTYT
                     YIQGLFCTGLWVLAHECGHQAFSDYGTVNDFVGWCLHSYLLVPYFSWKYSHSKHHKAT
                     NHMTRDMVFVPPDAAKFKEQRGIIGELAHHSEDSPLRTLYELILQQAGGWWTYLLVNV
                     TGQEYPGVAKWKWNHFYPFTPLFERRDALYVFLSDVGIFTMGLILKIWYDKFGGWSLF
                     INWFVPYLWCNHWLVFITYLQHTDPTLPHYDSEEWTFAKGAAATVDRQFGFVGKHIFH
                     DIIETHVSHHFCSRIPFYRAREATEHIRSVMGDSYRSSDENMWVSLWKSARACQWVEG
                     SNGVLMFRNVNEVGVGADDKKKL"
     gene            complement(<581225..>582256)
                     /locus_tag="ZYRO0B07436g"
                     /db_xref="GeneID:8202424"
     mRNA            complement(<581225..>582256)
                     /locus_tag="ZYRO0B07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495227.1"
                     /db_xref="GeneID:8202424"
     CDS             complement(581225..582256)
                     /locus_tag="ZYRO0B07436g"
                     /note="similar to uniprot|Q7LH06 Saccharomyces cerevisiae
                     YDL048C STP4 Protein involved in pre-tRNA splicing and in
                     uptake of branched-chain amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495272.1"
                     /db_xref="GeneID:8202424"
                     /db_xref="GOA:C5DRC8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DRC8"
                     /translation="MHTYPLMSTMTAVQDRSDGMVAGASSTNNSNQHVTLPPISSFDS
                     LIRAAENQYPQDPSVLSYQLSTVPRIVTQRAPSNTSTTGTSSGSGSGSGTGTSTTTPA
                     LSPGSSGSLSPTTASSLETSLSPVFQGSQIRSGSAKIHKPRKKKECPICHNLYANLST
                     HKSTHLTPENRPHKCPICQRGFARNNDLIRHKKRHWKDEIVQINSHSNSSSFMSSDSS
                     SSVENGTIQHHRLDERDQLRSLHQIKGTFKCPFNSSLIQLDMEIYPYKSKPLNFETSN
                     CHQTGVFSRCDTFKNHLKALHFEYPPGTKKRDRSVVPGRCKHCGLRFANVDLWLNEHI
                     GKTCGYLYH"
     gene            complement(<583127..>584134)
                     /locus_tag="ZYRO0B07458g"
                     /db_xref="GeneID:8202425"
     mRNA            complement(<583127..>584134)
                     /locus_tag="ZYRO0B07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495228.1"
                     /db_xref="GeneID:8202425"
     CDS             complement(583127..584134)
                     /locus_tag="ZYRO0B07458g"
                     /note="similar to uniprot|P40319 Saccharomyces cerevisiae
                     YLR372W SUR4 Elongase III synthesizes 20-26-carbon fatty
                     acids from C18-CoA primers involved in fatty acid
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495273.1"
                     /db_xref="GeneID:8202425"
                     /db_xref="GOA:C5DRC9"
                     /db_xref="InterPro:IPR002076"
                     /db_xref="UniProtKB/TrEMBL:C5DRC9"
                     /translation="MAEVVETAVEQAVGDVAEQFLASDAFANVVQETSWVRFHVPSIQ
                     YPFGLELWPIFSKGFEKVVGYPAENFRYIEGKTFMANGWKAMGVIALYITVISSGQWI
                     LRKTNARPLKLHLLTSIHNVLLTVMSLVLLLLLAEQLTPMIYEHGLFYAICNEEAFAP
                     KLVTLYYLNYLTKFIELLDTVFLILKRKNLLFLHVYHHSATALLCFTQLAGQTSIEWV
                     PITLNLAVHVLMYWYYFLSSQGIRVTWKQWVTKFQIIQFVIDVGFVYFATYTFYAEKF
                     FKNTLPHWGTCHGTQAAAAYGYLILTSYLVLFISFYIQSYKVKKDKAEKKKANASRKE
                     N"
     gene            complement(<584441..>588721)
                     /locus_tag="ZYRO0B07480g"
                     /db_xref="GeneID:8202426"
     mRNA            complement(<584441..>588721)
                     /locus_tag="ZYRO0B07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495229.1"
                     /db_xref="GeneID:8202426"
     CDS             complement(584441..588721)
                     /locus_tag="ZYRO0B07480g"
                     /note="similar to uniprot|P51862 Saccharomyces cerevisiae
                     YLR371W ROM2 GDP/GTP exchange protein (GEP) for Rho1p and
                     Rho2p mutations are synthetically lethal with mutations in
                     rom1 which also encodes a GEP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495274.1"
                     /db_xref="GeneID:8202426"
                     /db_xref="GOA:C5DRD0"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001180"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5DRD0"
                     /translation="MINGTNIQDRYSIYSEIFGLERRQNSLEYDNNSNGTFTRHSGSS
                     SSTLPDKIEDIQSLGDVVSEEVANDLVYDKQDTQKEDYILSERTHMRNVSDTTSLMSK
                     DSTPHNSPAKIGMSSPPATVGFKNNSSNFGRDPPQRQHIPYPPTPTATDDDDNGFTSP
                     PSATLAHEHPLTHDHTNHNTNPYVSTADGGVIDAIPGSSLPPAASEPDPLDVTHMAPA
                     VPRMISVPPRGPSVAPAVPASTTSGAFHPPPVTTTGTAPSSADVIPQRSKSEFAPRRT
                     PSLPQLAIAGLKKQASFSMSNSGTPTQTKKSPLQGFGLFSRPNSKELHDNLQNQFSNQ
                     HSHSSHNNNQSGGPRSMSLNSSTLKNFASSIQSKTSSGRKVPQKYDNATNPFLEHHGH
                     HNFNFYGGGTHASTSTLGHNSTGNQYGQSSMGLGLKTRNSSNSLASKRFASTSSNTLI
                     QDRRSSGSLPSSRPLLSASTKRPQVYPALLSRVATKFKATIQTDAHKKDGLIYRDAFT
                     GQQAVDAICTIIRTSDRNLALLLGRSLDAQKLFHDVVYEHRLRDSPHEVYEFTDSSRV
                     IGTGTTGMVAHDPMMMLPSSSSQGVNPMASTSTIVTSGSTSSIGSGNDQASTSTLTNY
                     GGSNGSSSARAGRDSKHQDPATMHSVNGVFTLLTECYSPTCTRDELCYSISCPRRLEQ
                     QARLNLKPNGGLKRNISMALDDDEEEKPSWTSSVSREIVEKLSKREIKRQEAIYEVFI
                     TEKNFVKSLEITRDTFMKTLAETNIIPADIRKNFIKHVFAHINDMYSVNRRFLEAISD
                     RQKASPVVRGVGDIMLRFIPFFEPFVSYVASRPYAKYLIETQRSVNPYFARFDDDMMS
                     SSLRHGIDSFLSQGVSRPGRYMLLVREIIKSSDQENDKRDLEDLNKAMDALKDFMKRI
                     DRASGVAQDRHDVKLLKQKILFKNEYVNLGLNDEKRKIKHEGILSRKELTKSDGTVVG
                     DIQFYLLDNMLLFLKAKSVNKWHQQKVFQRPIPLPLLFACPGEDMPSLRKFIGHSPDC
                     FGSVLQPDFAMNNPKNAVTFLYYGAKQRYQVTLYAAQLAGLQTLLEKIKQEQQRIINE
                     TEMFNVTKISDRFFDYTNKINSVASCDGGRKLLIATNSGLYVSNIRRQRSNDSEKKST
                     YFSTPVQLVQRSNINQITVLEEFQSILVLVDKKLYSCPMAILKMEGNGTVYFKKHSKE
                     LVNHVNFFSDGDCSGKRLIVTAHSSSHSIKFFEHDHPLLSESGSGGSSGKKSLKKKIT
                     EVVFDSEPVSISFLKDYLCIGCKKGFQIVSVSQNAHEPLLDPADTSLDFALRDTLKPM
                     AIYRVGNMFLLCYAEFAFFVNNQGWRKKDSHIIHWEGEPQKFAIWYPYILAFDNNFIE
                     IRKIDTGELVSSVLGEKIRLLQTSSQEILYVYEDSRGYDTVASLDFWG"
     gene            <589365..>589847
                     /locus_tag="ZYRO0B07502g"
                     /db_xref="GeneID:8202427"
     mRNA            <589365..>589847
                     /locus_tag="ZYRO0B07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495230.1"
                     /db_xref="GeneID:8202427"
     CDS             589365..589847
                     /locus_tag="ZYRO0B07502g"
                     /note="highly similar to uniprot|Q05933 Saccharomyces
                     cerevisiae YLR370C ARC18 Subunit of the ARP2/3 complex
                     which is required for the motility and integrity of
                     cortical actin patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495275.1"
                     /db_xref="GeneID:8202427"
                     /db_xref="GOA:C5DRD1"
                     /db_xref="InterPro:IPR007204"
                     /db_xref="UniProtKB/TrEMBL:C5DRD1"
                     /translation="MVGNFVILPLNTKYRGPAFPANSDYDIIDECLDLFRANSFFKNF
                     EIKSPADRVLIYGILFVNEVLAHLRPHTNYNEAVKIATNVALDSFTIPGTPGFPLNTV
                     YSVPVQDHNAMELLRTYIQQFRQELAMRLLERLYRDSRDHPSKFWLAFTKRRFMNKTL
                     "
     gene            complement(<589898..>591841)
                     /locus_tag="ZYRO0B07524g"
                     /db_xref="GeneID:8202428"
     mRNA            complement(<589898..>591841)
                     /locus_tag="ZYRO0B07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495231.1"
                     /db_xref="GeneID:8202428"
     CDS             complement(589898..591841)
                     /locus_tag="ZYRO0B07524g"
                     /note="highly similar to uniprot|Q05931 Saccharomyces
                     cerevisiae YLR369W SSQ1 Mitochondrial hsp70-type molecular
                     chaperone involved in the synthesis and assembly of
                     iron/sulfur clusters into proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495276.1"
                     /db_xref="GeneID:8202428"
                     /db_xref="GOA:C5DRD2"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="UniProtKB/TrEMBL:C5DRD2"
                     /translation="MFRVQNLFKLSNKNVFARGFSSKVIGIDLGTTNSAVAYIRDSND
                     RRSATIIENDEGQRTTPSVVAFDKYGKALVGAAAKRQAAINPENTFYSTKRLIGRHFE
                     DEDIQKDAKSLPYRVVKNEPNGQAYVSTTAGDVKSAGEIGSAILKYLKGTAENYLSED
                     IDKAVITVPAYFNDSQRQATKDAGRLAGLKVLRVINEPTAAALSFGLDDAKNEGIIAV
                     YDLGGGTFDISLLDIEDGVFEVRATNGDTHLGGEDFDNVVSKHIIDSFVKSNPGEDRE
                     AIFRNREMMQRVREAAEKAKIALSRVKEYTIEIPFFQGNKHVYLTMTEEELDNMTLHL
                     INRTIEPVKKVLKDADIEAEDVDDLLLVGGMTRMPKIRNVVRDIFGKEPNTTVNPDET
                     VALGAAIQGGVLSGEIKNVLLLDVTPLTLGIETYGGVFSPLIPRNTTVPVTKTEMFST
                     GVDGQTGVDIKVYQGERGLVRDNKNIGDFTLTGIPPQPKGVPQIAVTFDIDADGIINV
                     SASEKSTGQEKSITVIANSGLTEEDIQRIVKEANANKERDSKLKQRLEVIARSDVMIA
                     DTENAFEKFKDILSLDESYPQVCSDLKEIRSFVDEYKNNETDFSLDLEKLKAVSDGIQ
                     MRALQLFQTASKIQAELRKKQQH"
     gene            complement(<592044..>593789)
                     /locus_tag="ZYRO0B07546g"
                     /db_xref="GeneID:8202429"
     mRNA            complement(<592044..>593789)
                     /locus_tag="ZYRO0B07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495232.1"
                     /db_xref="GeneID:8202429"
     CDS             complement(592044..593789)
                     /locus_tag="ZYRO0B07546g"
                     /note="weakly similar to uniprot|Q05930 Saccharomyces
                     cerevisiae YLR368W MDM30 Protein involved in determination
                     of mitochondrial structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495277.1"
                     /db_xref="GeneID:8202429"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C5DRD3"
                     /translation="MLLPVQIYAMTNLDGLPKEIWIEISGWLGPSDILQLRLCNRSLC
                     KKLSSRAIWRPRCYEKWLTHLQHDPFCIELKPKDHTWFYHYRFRNHIESRISKEILNA
                     LASSEPYHELFPRFVHYKPSHVIPLLHGVLKNGCLDGAADKGTGMDIVTICHHLLMCM
                     RHKHVYELIGQNEMEYVHDAELMIFLRLSAMDSSFDLLLHHRDRVLRRVHSLVKLEWD
                     EFIKLPATIRIDRLVGYLMQALNHNKPWPVGGPGQLYLEDFILLRVYAGETQGHPLLI
                     LAIVQTLASFYGVETALCGSYLIIRDPKLRAGETYLTISAEGNPKIFTKKRLVQSLTR
                     ILNTSEGIVVNQILPSILQPLAYKELVSTIFRELLPLYNKSKWSAAPLPKNPPLYKQL
                     YPHSRQPMSAEIVHYFTCVYKAYEMQSRIEMRISSLYAVAFKEVFRLVSRLYPGDYSY
                     AAKLLHGRGVDFGEHLLKYDEWIFQLHSIAIESSDELGTFVSSTRDSYPMCVVGVRTF
                     NNGNVYYTLMNYCGEFFVELSNNLQEYDAKGNQEVILEFLETSGFSDLGLVFSQLDRN
                     DWKLIPNERIKKLLL"
     gene            <595114..>596964
                     /locus_tag="ZYRO0B07568g"
                     /db_xref="GeneID:8202430"
     mRNA            <595114..>596964
                     /locus_tag="ZYRO0B07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495233.1"
                     /db_xref="GeneID:8202430"
     CDS             595114..596964
                     /locus_tag="ZYRO0B07568g"
                     /note="some similarities with uniprot|P53243 Saccharomyces
                     cerevisiae YGR067C hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495278.1"
                     /db_xref="GeneID:8202430"
                     /db_xref="GOA:C5DRD4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DRD4"
                     /translation="MPSQQRKYVCSFCSKAFSRSEHRARHERSHTGMKPFECKVCRHA
                     FVRRDLLQRHIRTVHRELLLMKKGMEEGGNKSDLIVELLVNSMIKVTKREGSGLRGEK
                     AEILSRLIGGFLPESNLGAEAAGKMFDCGVRCVERRMHSQFAAQVAAQISGPLASSAR
                     AQQFVRLCTSSPLILAVAALGACASGEGCAADLWQVGWSSCLKTSTSDRYLSLNVLVF
                     ALLDFGIKPNFADVFSVYQHTCYAVMVDSPGHEHFPEKWTVFHQWVILMRFAETQTEL
                     TPILYAWFERQELTLGKTLKDCLITLEEAGSTVAEAIFCNWILGYNTTPLDRAVELFS
                     RNNSGNNGGHLVVSQSHWLLLETAWFEFVKGLEPSGFHTSSRMGWFRNCYVRGPQTRI
                     QRDCIDEKLMKIVLPVLVAMDHEIGSRRVALIADVTLFLLRFAEEMDPNVMTDNENVQ
                     NLIYILQRRADSKERLSFMDLQSGIISYLHGVALVLANLPSIDSDVRVPLMVAVQGSP
                     LPRKSQSSSSPSPVWLLSPTSACSAADEKPKRTRSHSGSSIILPPLQMRPGSYAYDHA
                     EYVPQAPIAAPFASNTTSTTSPTMETSVSWPTSRGFKVRLPPPSELFHIS"
     gene            <597398..>598038
                     /locus_tag="ZYRO0B07590g"
                     /db_xref="GeneID:8202431"
     mRNA            join(<597398..597530,597779..>598038)
                     /locus_tag="ZYRO0B07590g"
                     /product="40S ribosomal protein S22"
                     /transcript_id="XM_002495234.1"
                     /db_xref="GeneID:8202431"
     CDS             join(597398..597530,597779..598038)
                     /locus_tag="ZYRO0B07590g"
                     /note="highly similar to uniprot|Q3E7Y3 Saccharomyces
                     cerevisiae YLR367W RPS22B and highly similar to
                     uniprot|P0C0W1 Saccharomyces cerevisiae YJL190C RPS22A
                     Proteins component of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S22"
                     /protein_id="XP_002495279.1"
                     /db_xref="GeneID:8202431"
                     /db_xref="GOA:C5DRD5"
                     /db_xref="InterPro:IPR000630"
                     /db_xref="UniProtKB/TrEMBL:C5DRD5"
                     /translation="MTRTSVLADALKSITNAEKTGKRQVLVRPSSKVVIKFLQVIQKH
                     GYIGEFELIDDHRSGKLVVQLNGRLNKCGVISPRFNVKIGDMEKWTANLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGYVY"
     gene            <598538..>600364
                     /locus_tag="ZYRO0B07612g"
                     /db_xref="GeneID:8202432"
     mRNA            <598538..>600364
                     /locus_tag="ZYRO0B07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495235.1"
                     /db_xref="GeneID:8202432"
     CDS             598538..600364
                     /locus_tag="ZYRO0B07612g"
                     /note="highly similar to uniprot|P53241 Saccharomyces
                     cerevisiae YGR065C VHT1 vitamin H transporter H -biotin
                     symporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495280.1"
                     /db_xref="GeneID:8202432"
                     /db_xref="GOA:C5DRD6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DRD6"
                     /translation="MVAGWKRFIPHLRVLPEDLELNDDTQESSVNQDSSTEIEEQDKT
                     VERVEVKGDADVQDLEKSSQSSEAPCKSPSNLESHPLGLQRDYPYELRDESGRKWWKY
                     FDEYEYRLNKEYKKSRKWYEFLYPNHATQTKAERTLLYKLDVILAFYFLVLNWSKSLD
                     TNNYTNAYVSGMQQDLHMKGNDYINTSTITNVGSIVLQLPFMYILPRFPAHIVLPVMD
                     LGWTWFTFACYRANNLREFRGYRFIEFSFGAAYYPMSQYLLGTWYAPDEISSRVALFF
                     AGQMLGGITSGLLQSRIFRSLNGTNGIAGWRWMFIIDSMAISLPTVIMGFFLIPGIPS
                     KCYSLFLTDDEIRAARNRNKRTGITDGLDKRQLKPLWDRGIWKTVLFTSTFWVLVVFD
                     TCSWNNMTAFSGSYTLWLNSNKSYSVEKVNNYSVLPACLGLAYVFFCAFGADLFRCKW
                     GFMVFSQVMNTISCAILIKWDVSNSTKWYAFLTTYFSVAASPSLWSFINDFLRFNPQV
                     KAVTWIAIYSISQSTYAWIPKLAWPTTDAPRFKRGYVVSIVFGTIYLLWTFVVLFFYK
                     RNEKKHALGNGIILYNSDKGEEPPAWLETEMEERNGFYYLKE"
     gene            complement(<600410..>600739)
                     /locus_tag="ZYRO0B07634g"
                     /db_xref="GeneID:8202433"
     mRNA            complement(<600410..>600739)
                     /locus_tag="ZYRO0B07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495236.1"
                     /db_xref="GeneID:8202433"
     CDS             complement(600410..600739)
                     /locus_tag="ZYRO0B07634g"
                     /note="similar to uniprot|Q05926 Saccharomyces cerevisiae
                     YLR364W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495281.1"
                     /db_xref="GeneID:8202433"
                     /db_xref="GOA:C5DRD7"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DRD7"
                     /translation="MSSELVPKVLELLKSHKVLQFSASWCPDCRYANSVWKKLGIENK
                     IYVFDIASFPRPDQEQWRSAFQQVTGSRNLPSIYYNGTLWGTESQLHAFENNGTLRDE
                     LRKIGLL"
     gene            <601114..>601422
                     /locus_tag="ZYRO0B07656g"
                     /db_xref="GeneID:8202434"
     mRNA            <601114..>601422
                     /locus_tag="ZYRO0B07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495237.1"
                     /db_xref="GeneID:8202434"
     CDS             601114..601422
                     /locus_tag="ZYRO0B07656g"
                     /note="highly similar to uniprot|P32914 Saccharomyces
                     cerevisiae YGR063C SPT4 Protein that forms a complex with
                     Spt5p and mediates both activation and inhibition of
                     transcription elongation and plays a role in pre-mRNA
                     processing in addition Spt4p is involved in kinetochore
                     function and gene silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495282.1"
                     /db_xref="GeneID:8202434"
                     /db_xref="GOA:C5DRD8"
                     /db_xref="InterPro:IPR009287"
                     /db_xref="InterPro:IPR016046"
                     /db_xref="InterPro:IPR022800"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:C5DRD8"
                     /translation="MSSDRACMLCGIVQTTNEFTNDGCPNCQGIFEEAGVSTIECTSP
                     SFEGLIGMCKPNKSWVAKWMSVDQYIPGMYAVKVDGRLPIEVVDLLPYYKPRDGSQVE
                     "
     gene            <601586..>602497
                     /locus_tag="ZYRO0B07678g"
                     /db_xref="GeneID:8202435"
     mRNA            <601586..>602497
                     /locus_tag="ZYRO0B07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495238.1"
                     /db_xref="GeneID:8202435"
     CDS             601586..602497
                     /locus_tag="ZYRO0B07678g"
                     /note="similar to uniprot|P53239 Saccharomyces cerevisiae
                     YGR062C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495283.1"
                     /db_xref="GeneID:8202435"
                     /db_xref="GOA:C5DRD9"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:C5DRD9"
                     /translation="MFVKSIQRLPNRIGKRHFSSFQNVADTFVTLHEATSVPWMVLIP
                     LTTIGLRTCLTLPLSIWQRKRLVKQQELRKVVQAVPPVTKLRLAAATNAASKANDEIT
                     SSGSIVKEEEHPIQTKPQRLTPDQITLLAVKETRKRQKRLFGKYNVQMWKNAVLPLVQ
                     IPLWITVSMGLRNLTEKRLLETNNWSLTEYLFPENLDLSLPWDDMPMVAPLILGTISL
                     INVEYNGRVMTSTSTSRVGIETAPNEYSRMSQGIKSILNVSRLSCVFMMGISSQASIL
                     LSLYWISSQFYSLIQNIFLDWFWPYQR"
     gene            complement(<602592..>602858)
                     /locus_tag="ZYRO0B07700g"
                     /db_xref="GeneID:8202436"
     mRNA            complement(<602592..>602858)
                     /locus_tag="ZYRO0B07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495239.1"
                     /db_xref="GeneID:8202436"
     CDS             complement(602592..602858)
                     /locus_tag="ZYRO0B07700g"
                     /note="similar to uniprot|Q3E747 Saccharomyces cerevisiae
                     YLR363W-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495284.1"
                     /db_xref="GeneID:8202436"
                     /db_xref="InterPro:IPR019034"
                     /db_xref="UniProtKB/TrEMBL:C5DRE0"
                     /translation="MPQKSLRVNKKQKDPRRITKKQKNPKRAAPLQIKSKKKSLNKFK
                     ELNKTVSLTAATEKIIASRVGHLELVKGNRKEIEKEKQKNNNKK"
     gene            <603408..>607469
                     /locus_tag="ZYRO0B07722g"
                     /db_xref="GeneID:8202437"
     mRNA            <603408..>607469
                     /locus_tag="ZYRO0B07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495240.1"
                     /db_xref="GeneID:8202437"
     CDS             603408..607469
                     /locus_tag="ZYRO0B07722g"
                     /note="highly similar to uniprot|P38972 Saccharomyces
                     cerevisiae YGR061C ADE6 Formylglycinamidine-ribonucleotide
                     (FGAM)-synthetase catalyzes a step in the 'de novo' purine
                     nucleotide biosynthetic pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495285.1"
                     /db_xref="GeneID:8202437"
                     /db_xref="GOA:C5DRE1"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR010073"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DRE1"
                     /translation="MSHHILVGPQALSQFRVDNLVKSINEYSNSTSIIKAVRSCYVHY
                     VDAKEPALSPKDKELLEALLTYDSPLNTKDDHLSRLLVDAVVNNVDDPVLEEDTYLVR
                     ITPRSGTISPWSSKATNIIEVCGLDSKINRVERGLALVIKVIPGFPQLENLNEVSLKT
                     VFDRMTQEMHLHSAPSTKELFAHHQPKELVHVPLVSNAAKVPPETTLASANKEFGLAL
                     DKGEMDYLIKAFAETLGRDPTDVELFMFAQVNSEHCRHKIFNADWTIDGLKKEFTLFQ
                     MIKNSFKKTPDFTISAYSDNAAVIDTGHAAYYFTPNPESKLWTATEENVPMLVKVETH
                     NHPTAVSPYPGAATGSGGEIRDEGATGRGSKSKCGLSGFSVSDLNIPGHKQPWEINIG
                     KPHHIASSFDIMIEAPLGSAAFNNEFGRPCINGYFRTLTTKVKNAKGNEEVRGFHKPI
                     MVAGGLGTVRPQFALKNKPITAGSHLIVLGGQSMLIGLGGGAASSISSGEGSAHLDFA
                     SVQRGNPEMERRCQQVIDTCVALNTKNPIQSIHDVGAGGLSNALPELVHDNDLGAKFD
                     LRKVLSLEPGMSPMEIWCNESQERYVLGVSSGDLPVFEEICRRERAPYAVVGQATAEQ
                     RLIVEDPLLKDTPIDLEMPILFGKPPKMSQQTTTQNLKLNSPDLSVIPSVKDALERVL
                     HLPAVGSKSFLITIGDRTVTGLVDRDQFVGPWQVPVADVGVTGTSFGPKIVTSGEALA
                     MGERPTNALISAAASAKLSVAESLLNLFASDVKSLKHVKLSANWMSPASHPGEGAKLY
                     EAVQALGLDLCPGIGVSIPVGKDSMSMKMKWEDKEVTAPLSLDITAFAPVNDTNKTWT
                     PVLNKNVPNTVLVLVDLAATVSEKSLGGSSLLQVYNQVGDTSPTVHDNATLKGFLEAL
                     LELHTTDLVHAYHDRSDGGLIVTLLEMAFASRCGLTVSVDDTEEPSPLLPLFNEELGA
                     VFQVSESKLLDFKLILSRHGISARHVSTVARPEFDSQLIKIEDSQGKLLYENTRGEVQ
                     QMWASTSFHMQSLRDNPKTAEEEFTAIKDDRDPGLHYTLTFDPLDDLGLGNKLTQPGP
                     RVAILREQGVNGQMEMAWCFEQAGFSAVDVTMTDILEGRANLDDFIGLAACGGFSYGD
                     VLGAGAGWAKSVLYNEHARKQFVRFFQERQDTFALGVCNGCQFLSHLKEIIPGCEDWP
                     IFERNLSEQFEARVSMLQLINQEDQSGSSTFLKGMGGSHLPIAVAHGEGRAVFQDKEQ
                     LQRFESSRLCCMRYVDNRGNVTEKYPFNPNGSVGGIAGIKSPNGRVLAMMPHPERVCR
                     LAANSWYPEEKFSEWQGYGPWIRMFKSVREYVR"
     gene            complement(<607633..>608556)
                     /locus_tag="ZYRO0B07744g"
                     /db_xref="GeneID:8202438"
     mRNA            complement(<607633..>608556)
                     /locus_tag="ZYRO0B07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495241.1"
                     /db_xref="GeneID:8202438"
     CDS             complement(607633..608556)
                     /locus_tag="ZYRO0B07744g"
                     /note="highly similar to uniprot|P53045 Saccharomyces
                     cerevisiae YGR060W ERG25 C-4 methyl sterol oxidase
                     catalyzes the first of three steps required to remove two
                     C-4 methyl groups from an intermediate in ergosterol
                     biosynthesis mutants accumulate the sterol intermediate 4
                     4-dimethylzymosterol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495286.1"
                     /db_xref="GeneID:8202438"
                     /db_xref="GOA:C5DRE2"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:C5DRE2"
                     /translation="MSAIFANATVVDLVKDKTFMGTLHNIQRLPQLNVAEQYWAAWYV
                     YLSNDILATGLLFFLLHEVMYFGRSLPWFIIDQIPFFRRYKIQPTKIPSAKEQWFCLK
                     SVLLSHFLVEAIPIWTFHPLCVKLGISVQVPFPHWKKMALQIGLFFLGEDMWHYWMHR
                     LFHYGVFYKYIHKQHHRYAAPFGLTAEYAHPAEALTLGFGTVGMPIFYVLYTGELHLF
                     TLCLWITLRLFQAVDSHSGYDFPWSLSKFLPFWAGAEHHDLHHHYFIGNYASSFRWWD
                     YTMDTEAGPEAKAAREERMRLQAESKAKKRV"
     gene            <609405..>610058
                     /locus_tag="ZYRO0B07766g"
                     /db_xref="GeneID:8202439"
     mRNA            <609405..>610058
                     /locus_tag="ZYRO0B07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495242.1"
                     /db_xref="GeneID:8202439"
     CDS             609405..610058
                     /locus_tag="ZYRO0B07766g"
                     /note="similar to uniprot|Q12129 Saccharomyces cerevisiae
                     YLR363C NMD4 Protein interacting with Nam7p may be
                     involved in the nonsense-mediated mRNA decay pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495287.1"
                     /db_xref="GeneID:8202439"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="UniProtKB/TrEMBL:C5DRE3"
                     /translation="MGDLNEYNFILDASSLEKGLGNIKRWCQEARGKIVLRLYIPTYT
                     LQELDFLKYKRKSFGAREALKFIDQATSEYPDIIVEFPETLDVVLWSEITSSVDDKHA
                     DMLNRLPRRFKNLLKSCIYKCQLEENRLKWILVAEDPKVKELADICSIPCSSLVIAES
                     TLSRETNRRQYHEGQKFNNMIQVKGNGESLIGGKKVVRTNFDNTVYASRGKGSLWEP"
     gene            complement(610120..610243)
                     /gene="SNR48"
                     /locus_tag="ZYRO0B07788r"
                     /db_xref="GeneID:8202440"
     ncRNA           complement(610120..610243)
                     /ncRNA_class="snoRNA"
                     /gene="SNR48"
                     /locus_tag="ZYRO0B07788r"
                     /product="snR48"
                     /note="C/D snoRNA monocistronic SNR48"
                     /transcript_id="XR_002648386.1"
                     /db_xref="GeneID:8202440"
     gene            complement(<610538..>612313)
                     /locus_tag="ZYRO0B07810g"
                     /db_xref="GeneID:8202851"
     mRNA            complement(<610538..>612313)
                     /locus_tag="ZYRO0B07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495243.1"
                     /db_xref="GeneID:8202851"
     CDS             complement(610538..612313)
                     /locus_tag="ZYRO0B07810g"
                     /note="similar to uniprot|P41901 Saccharomyces cerevisiae
                     YGR059W SPR3 a sporulation-specific homologue of the yeast
                     CDC3/10/11/12 family of bud neck microfilament genes
                     regulated by ABFI septin protein involved in sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495288.1"
                     /db_xref="GeneID:8202851"
                     /db_xref="GOA:C5DRE4"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRE4"
                     /translation="MSLDLSMVVSEKPIDADEQEENFQPEEINEIIIEPNDDFPDYSP
                     PATPTEDINQDPTESESESEESESLSDQDDVGFTVEEPEEESEENDQPIESGSEQHVL
                     VMSTDLLPKEEQEPDEKDVSSPSERTDVSSNPGSTSHSVNVCLPSMETLVVDVPNRVA
                     GYETGISNLPTQRERMVARDGVKFNFMVSGQAGLGKTTFVNTLFDTCLLPSNRVTRDV
                     KTVETRCLEIHRAVLETADVKLDLNIIDTPGFGYKSNSTFDWVPLINYIDEQIRSYIF
                     QEEQPNRSNLRDDRVHCCLYFVEPTGKGLNALDVIAMRELSKRVNLIPIIAKADGLSK
                     EELCAFKREIRNVMHAQDIKVCQFLEEDNAFYSDIFEMAPFAVVGSEMKIIGQDGEPL
                     HVRKYRWGTVEVENVDHCDFTLLKNVLISNHLVDFVRTTESYCETCRSSILKTRILKA
                     RDSIDNADFPVELRDELQKLNYDELDLNGLKNYVCYSVFGKKDMDVLVVEWSPEFVQR
                     RWESRKRFNEVITLEDQKFQEWKMALQNKQVKFNQELELLSRNIDDLQLECHDLETQI
                     MAAKAVQRTRSKLGTISRGEKRAAA"
     gene            complement(<612634..>613626)
                     /locus_tag="ZYRO0B07832g"
                     /db_xref="GeneID:8202441"
     mRNA            complement(<612634..>613626)
                     /locus_tag="ZYRO0B07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495244.1"
                     /db_xref="GeneID:8202441"
     CDS             complement(612634..613626)
                     /locus_tag="ZYRO0B07832g"
                     /note="some similarities with uniprot|P53238 Saccharomyces
                     cerevisiae YGR058W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495289.1"
                     /db_xref="GeneID:8202441"
                     /db_xref="GOA:C5DRE5"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:C5DRE5"
                     /translation="MREGRRRIEHEKQKKQRQHRYQQQQRHHHKTDSRSSTGSSADSD
                     IRRQGTPPVAVVPPPVSYGSQNPSTSSIPLPSSQSQIPLRNQYSYIPSHGDSPRAHPP
                     TLNRVKPPPMVASSTPPIASAARLPNSPPMGSTPSSGGSRSSGDMMEETKNIQIATQL
                     FHNHDIRQKGRLTAEELRNLLQNDDSTHFCISAVDALINLFGATRFGTISQAEFVSLY
                     KRVKYWRKVYVDNDINGSYTISVMEYHNSLQELGYLIPFEVSENIFDQYAEFINSTVN
                     GKELKFDKFVESLVWLMRLTKSFRKYDMNQEGIATIHYKDFIDTVLYLGRFLPH"
     gene            complement(<613992..>616007)
                     /locus_tag="ZYRO0B07854g"
                     /db_xref="GeneID:8202442"
     mRNA            complement(<613992..>616007)
                     /locus_tag="ZYRO0B07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495245.1"
                     /db_xref="GeneID:8202442"
     CDS             complement(613992..616007)
                     /locus_tag="ZYRO0B07854g"
                     /note="similar to uniprot|P23561 Saccharomyces cerevisiae
                     YLR362W STE11 Signal transducing MEK kinase involved in
                     pheromone response and pseudohyphal/invasive growth
                     pathways where it phosphorylates Ste7p and the high
                     osmolarity response pathway via phosphorylation of Pbs2p
                     regulated by Ste20p and Ste50p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495290.1"
                     /db_xref="GeneID:8202442"
                     /db_xref="GOA:C5DRE6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR029458"
                     /db_xref="UniProtKB/TrEMBL:C5DRE6"
                     /translation="MDCTFVEEFLKEIKCEKYLEKFVSCKLISPEEIKFLDKEVLIAL
                     GVTNLGDRLRILRKSKSLHRQKSQQECTEQLNDIIRRISSLSAGGVAVSEELVTEKHS
                     VIFILNDGSAKKVNVNGCFNADSIKKRLLKRLPPWIDGEELRSVQDYDVFVVDYVKNV
                     LHLLYDVELVTICHSSDRMEKNRLIFVSKNQTPSDKAIFTSKKLYLKTLSVINQIITM
                     PHDGANAFAGNQLRIENGKDKIRKIFNQRPPSELISTNLAGYFPHANMKHLESTLKES
                     FRQSARLSKIEHKIHNSDSNKIGDILLKHSNAVDSVLLQSLEYDGTASDYNRAVERKR
                     DPVPGAKRDNRVDLKSPGSEVELDDDEENDLVSIPTKIMAPKTWLKGARIGSGSFGTV
                     YLGMNARTGELMAVKQVELQSSTVAAGVVNMAEDRSKPENWDPKQEQKLKNASRVHRK
                     LIDALQHEMSLLKDLHHENIVKYFGSSQEGGNLNIFLEYVPGGSVSSMLNSYGPFEES
                     LITNFTRQILIGVVYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNQNQN
                     KRASLQGSVYWMAPEVVKQTATTEKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIG
                     TSTTPEIPSWATEESRDFLSKTFQLDYKMRPSAIELLQHPWLEAHIV"
     gene            <616300..>616551
                     /locus_tag="ZYRO0B07876g"
                     /db_xref="GeneID:8202443"
     mRNA            <616300..>616551
                     /locus_tag="ZYRO0B07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495246.1"
                     /db_xref="GeneID:8202443"
     CDS             616300..616551
                     /locus_tag="ZYRO0B07876g"
                     /note="weakly similar to uniprot|Q05924 Saccharomyces
                     cerevisia YLR361C-A Identified by expression profiling and
                     mass spectrometry"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495291.1"
                     /db_xref="GeneID:8202443"
                     /db_xref="UniProtKB/TrEMBL:C5DRE7"
                     /translation="MSDPSHTHNDQPKDPQFAQKEAHLEEDPTLKLERAGKIKELNAA
                     SLRKPHARSFGKSFQVPDERQERNNAGGLLRNDGHRPGN"
     gene            <616796..>618547
                     /locus_tag="ZYRO0B07898g"
                     /db_xref="GeneID:8202444"
     mRNA            <616796..>618547
                     /locus_tag="ZYRO0B07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495247.1"
                     /db_xref="GeneID:8202444"
     CDS             616796..618547
                     /locus_tag="ZYRO0B07898g"
                     /note="similar to uniprot|Q05924 Saccharomyces cerevisiae
                     YLR361C DCR2 Protein involved in cell cycle regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495292.1"
                     /db_xref="GeneID:8202444"
                     /db_xref="GOA:C5DRE8"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DRE8"
                     /translation="MSIISKRYLRYLPYILLFVFIEKSILFVPWRQSNFPFHKRVDHI
                     RTHSNVREWLRSNSLEHIDEYDHVAVNVGIVQCFHLGDWWSRCSVRNELRKDAISSRR
                     KVIWKDLLGPTRFKWVGFSDYLFYDTLSVYDLSQLEEEDKGKQVLLISISGEPVEGEG
                     NSEIVDTFYVNYVPLQIENLVNGRPVISDISVLFGEDCVDPRKNWELDRSWVFKMGEF
                     PSFITTRRLSTKYLEDWRPRLTVGEDGAYKIVQLADLHFGVGKGECLDEFPAHDHCEA
                     DPKTTKFVEEVLDIEQPDMVIFTGDQIMGSRSKQDSETALLKTLAPVISKGIPWAMVW
                     GNHDDEGTLNRWELSKFVNDLPLSLFMVGPKDTADNTFGVGNYFHQVMDFENRQPVLT
                     FYFLDSHKYSTTGKIFPGYDWIKEDQWDYFKRIYDEKLYQHIRNTQKPHLSMAFFHIP
                     TPEYLHEASRERPGESNPIIGNPMEGVTAPRYDSKAAAALAHMNVQAASCGHDHSNDY
                     CLLDDSSPQKIWFCYGGAVGEGGYGDHNDGYERRVRIYHFETKDGNIYTWKRLNSSPI
                     NYFDYQLIASGGVSKTG"
     gene            complement(<618513..>619772)
                     /locus_tag="ZYRO0B07920g"
                     /db_xref="GeneID:8202445"
     mRNA            complement(<618513..>619772)
                     /locus_tag="ZYRO0B07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495248.1"
                     /db_xref="GeneID:8202445"
     CDS             complement(618513..619772)
                     /locus_tag="ZYRO0B07920g"
                     /note="similar to uniprot|Q6B1J7 Saccharomyces cerevisiae
                     YLR360W VPS38 involved in vacuolar protein targeting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495293.1"
                     /db_xref="GeneID:8202445"
                     /db_xref="UniProtKB/TrEMBL:C5DRE9"
                     /translation="MGQYLLKRRLRHVRSVKISNLCVGQRNSQQLMWFPSYFIVIENG
                     KGQTLYVSEVQQGSLYSVQFNELPPQDSPLTHFTLRLVAELPERLSPSPDEKLWFDFR
                     TYKVDLNQVKHVSADDIIESYNAPVLELVDGDYVLPNVSMLTVPKESIRTHKRANSSI
                     KIKKSFTFNYALKLNKILEYTSQVMEESQQISERVERQIQDEHKRHQWFVTHLRDYNH
                     QLKVRIQKKQLDLRRLRDSVEHFAESEEKDSQPHSLNDYYGNTYPNLIQSRNRLESMR
                     AKKLAQLIGIFQTTDLFHVRAGFVTFNRTLLDSSSSLYDRLTLDLLNKTKLLELATDG
                     SEASKKLTSTCLGYYTLFVTLIATSICSIPLPHELMYCGSTSTVNGTTPLYLDNIKDI
                     ELLSQAIDCFNGNIIQVIQFLKHRRTQ"
     gene            <619937..>620662
                     /locus_tag="ZYRO0B07942g"
                     /db_xref="GeneID:8202446"
     mRNA            <619937..>620662
                     /locus_tag="ZYRO0B07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495249.1"
                     /db_xref="GeneID:8202446"
     CDS             619937..620662
                     /locus_tag="ZYRO0B07942g"
                     /note="similar to uniprot|P53237 Saccharomyces cerevisiae
                     YGR057C LST7 Protein possibly involved in a post-Golgi
                     secretory pathway required for the transport of
                     nitrogen-regulated amino acid permease Gap1p from the
                     Golgi to the cell surface"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495294.1"
                     /db_xref="GeneID:8202446"
                     /db_xref="InterPro:IPR021713"
                     /db_xref="UniProtKB/TrEMBL:C5DRF0"
                     /translation="MASMLISLSHFCDKHGPRILLVTQAAINGSTGDELLVPTYPTDS
                     YCDSCLLHFPKSSTNDIRSLKSNIGSQCFVSTQYSSIRYQLLTHIIRRSFSEETMIYD
                     GMPLVFYDDIRGLNLVMGFKLNDENARGNERRYCIIFTIDSKDHKSSMKLLSENWNFI
                     TGGFDKMIKYICNSHRQEIERQNNVNDERSNFNLLGRTYLRGNKVKVPRNLAELTHDE
                     LLFVRLHKWNAYLLNSCMKSRVE"
     gene            complement(<620761..>622209)
                     /locus_tag="ZYRO0B07964g"
                     /db_xref="GeneID:8202447"
     mRNA            complement(<620761..>622209)
                     /locus_tag="ZYRO0B07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495250.1"
                     /db_xref="GeneID:8202447"
     CDS             complement(620761..622209)
                     /locus_tag="ZYRO0B07964g"
                     /note="highly similar to uniprot|Q05911 Saccharomyces
                     cerevisiae YLR359W ADE13 Adenylosuccinate lyase catalyzes
                     two steps in the 'de novo' purine nucleotide biosynthetic
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495295.1"
                     /db_xref="GeneID:8202447"
                     /db_xref="GOA:C5DRF1"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR004769"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR019468"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:C5DRF1"
                     /translation="MSDFDKYLTPLSARYASKEMSGIFSMRNRFSTWRNLWLNLAIAE
                     KELGLDVITDKAIAEMKEHLTITDEEIAQASAQEAIVRHDVMAHVHTFGETCPAAAGI
                     IHLGATSCFVTDNADLIFLRDAYDVIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPA
                     QLTTLGKRVTLWIQDLLWDLRNFDRARNDIGLRGVKGTTGTQASFLALFHGNHDKVEE
                     LDQRVTELLGFETVYPVTGQTYSRKIDIDVLAPLASFAATAHKMATDIRLLANLKEVE
                     EPFEKTQIGSSAMAYKRNPMRCERVCSLARHMGSLFNDAVQTASVQWFERTLDDSAIR
                     RISLPSAFLTADILLSTLLNISSGMVVYPKVIERRINSELPFMATENIIMAMVEKGAS
                     RQEVHEKIRVLSHQAAAVVKEEGGDNDLIERVKNDPFFKPIHTQLATLLNPSTFVGRA
                     PQQVEKFVGKDVKKALQPFEKHINDVDVKLNV"
     gene            complement(<622477..>625167)
                     /locus_tag="ZYRO0B07986g"
                     /db_xref="GeneID:8202448"
     mRNA            complement(<622477..>625167)
                     /locus_tag="ZYRO0B07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495251.1"
                     /db_xref="GeneID:8202448"
     CDS             complement(622477..625167)
                     /locus_tag="ZYRO0B07986g"
                     /note="similar to uniprot|Q06488 Saccharomyces cerevisiae
                     YLR357W RSC2 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex required for
                     expression of mid-late sporulation-specific genes contains
                     two essential bromodomains a bromo-adjacent homology (BAH)
                     domain and an AT hook"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495296.1"
                     /db_xref="GeneID:8202448"
                     /db_xref="GOA:C5DRF2"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="UniProtKB/TrEMBL:C5DRF2"
                     /translation="MSEADSLKELQSRIRAEYEALFTLKEENGLEIYPIFNVLPPKKE
                     YPDYYALIRNPVSLNTLKKRVPHYTDAQSFINDVVQIPWNAKTYNTKESAIYKYAGIL
                     EAYSKEKLVPKLQEYYPEVEYPYLGPLPDEIESMKAQGITPPEIPQPPPSKLRMKTKT
                     EDDDEVDGQDDEDYSEGGGRRSMPQLRLTLHRGMQNASQSYQGGRSQSGTPKPLYGRH
                     QQQRTHMRRGRPPVIDLPYVQRIKNVIKMLKKEIDDDNEPLTLPFERLPDELREPRYY
                     TVISNPVCLEDIRKRVKTRKYKDFQTFQNDFQLMLTNYRLYNRTEPQALKKAAMLEKK
                     YNALVRHELSKPDRDYMPEGELRYPMDEVEVNGNTYRIGDWVLLENPNDATKPTVAQI
                     FRLWSTSDGRRWLNACWYLRPEQTVHRVDRLFYKNEVVKSGQYRDHLVEELVGKCYVV
                     HFTRYQRGDPDVKLEGPLFVCEFRYNEADKIFNKIRTWKACLPEEIRDQDENTIPVNG
                     RKFLKYPSPLKNLLPPNATYDDPMPQPTEGAVNAPPLIGGVYLGPKLERDDLGEYSSS
                     DDCPRYIVRPGDPPEEGRIDFETGTIITNTQTATALPKTGQTSQRLASLKQSKSISGL
                     NSLRNGVYTPPLGGATPGSVNADVIGSPSPNLITPTGLVPGQQLTVQGLKQHQLNKQQ
                     LQFQQQQQHKRSQASGYNLTTVVNNLAAQASRNSLGHISVDSPSAYVLPVSITKNVDV
                     LQRTDYASQVRRLGKEQVPRKKRNKGEVLWFKGPSVAIEERLLNSGDERLQPSLNRWF
                     SKNINKRPKLDLDYEVVEEPADEMDATAQSQDAHHNGVDQQGNGFVEDEDNYSFSEDD
                     SDEENETQTLPDSYPLGLRPSAKFMAFKLASRDKLSAESD"
     gene            <625699..>626736
                     /locus_tag="ZYRO0B08008g"
                     /db_xref="GeneID:8202449"
     mRNA            <625699..>626736
                     /locus_tag="ZYRO0B08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495252.1"
                     /db_xref="GeneID:8202449"
     CDS             625699..626736
                     /locus_tag="ZYRO0B08008g"
                     /note="weakly similar to uniprot|P53685 Saccharomyces
                     cerevisiae YOL068C HST1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495297.1"
                     /db_xref="GeneID:8202449"
                     /db_xref="GOA:C5DRF3"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DRF3"
                     /translation="MSDESSQDDELIDDPQLKSFHTYLKQCRKILCVVGAGLSQSSGI
                     PTYQLQRGTWKGYTSIDLATPEAFQTNPGLVWLFYSNRRYIAMKARPNEGHFALAELA
                     KRMKERRREAFVVTQNVDGLHQRAGQEDADLCELHGSLFQLRCTSFFCTYKGKNTKDL
                     FLTPTLREFTPRDVGVKRRLRDQLPTLGKRRKKSSTPIQKKEYVENEDSVSSSDFDPL
                     PEIKEENLPHCPVCHEGLLRPGIVWFGEPLPLMDMVKVDEFFAPQEEGANDHIDLVLV
                     IGTSGKVWPAMGYVERCKQNGGRVAIFNTHIEDKDKVRKDRTVWGFEGEASEWLPRAL
                     EPFIGKQFKRS"
     gene            complement(<626820..>628556)
                     /locus_tag="ZYRO0B08030g"
                     /db_xref="GeneID:8202450"
     mRNA            complement(<626820..>628556)
                     /locus_tag="ZYRO0B08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495253.1"
                     /db_xref="GeneID:8202450"
     CDS             complement(626820..628556)
                     /locus_tag="ZYRO0B08030g"
                     /note="similar to uniprot|P50276 Saccharomyces cerevisiae
                     YGR055W MUP1 High affinity methionine permease integral
                     membrane protein with 13 putative membrane-spanning
                     regions also involved in cysteine uptake"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495298.1"
                     /db_xref="GeneID:8202450"
                     /db_xref="GOA:C5DRF4"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C5DRF4"
                     /translation="MIDIREKVVSAFDIRNLWKSNQEGYEEETEELGEDGQFVNQLDK
                     NKKQLGIISSIFLISNRMLGTGVFATSSEIYTLCGSVGLALIMWVIGGIISLAGLYVY
                     MEYGTAIPKNGGEKNYLEFIFKKPRFLVTSMYAAYVFFLGWAAGNSINTAVMFLTAGD
                     AKITEWNQRGIGVAVIFFAFAVNFINVKVGLYLQNILGVIKVGIVIFIAVSGWVALAG
                     GTNHGHHTNNLKNAFEGTENASAYGVVNALYNVIWSFVGYSNVNYALGEVKNPVRTLK
                     IAGPVSLITIAILYIFVNISYFAVVPKEKLISSKLVLAADYFDIIFHGKGREVAAAFV
                     GLSALGNVLSVIFSQGRIIQQLGREGILPFPNLFASSKPFNTPMVGLFQHFLVCMVTI
                     LAPPPGDAYNFVLNLISYPMNIINFVISTGLIWIHWQAKQGKLEWNPPIKAGVWIAGF
                     FSLANAYLIVAPYVPPTNGQSVYNSLPYWIHCVVAWAIFAFGGCYWLLFARVLPKLGH
                     YSLDIKEELGDDGFWRTKIIKSYDDKPFSDDDLDATTNTSNSEQVIETLDDINSKEGF
                     KATQTQFVRDSF"
     gene            complement(<629120..>631057)
                     /locus_tag="ZYRO0B08052g"
                     /db_xref="GeneID:8202451"
     mRNA            complement(<629120..>631057)
                     /locus_tag="ZYRO0B08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495254.1"
                     /db_xref="GeneID:8202451"
     CDS             complement(629120..631057)
                     /locus_tag="ZYRO0B08052g"
                     /note="similar to uniprot|P53235 Saccharomyces cerevisiae
                     YGR054W yeast homolog of mammalian eIF2A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495299.1"
                     /db_xref="GeneID:8202451"
                     /db_xref="GOA:C5DRF5"
                     /db_xref="InterPro:IPR011387"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DRF5"
                     /translation="MASQFFLKTSQDIELFQGYPRFNQSVANSIGGGVTSSILSPCSR
                     FLALSTKEEVKIYTGDLFDHELLSLPLSNVYDLHFSPSGNYLGTWERPSAQDASHLNC
                     KVWYLNKQLDSQDVEPIYQFQAKTQNGWNLQFSKLDNYAIRQFGKELKVVKLEQTNPV
                     FDFDHPFATLSHKQESESQVFGTFLISPAEHPTICTFTPEKSGKPAHLTIWPIVEGQI
                     TKKIVTKTFFKADSCQLQWNSLGNAVLCVAITDFDSSNQSYYGENTLYLLSFQGVNGS
                     LGGNSVRVPLSKEGPIHDFTWSPTSRQFGVIYGYMPATITFFDLRGNIVHSLEAQAKN
                     TMLFSPSGRYILIAGFGNLQGAVDILDRHDKFKRVSHFDAANTSVCKWSPGGEFIMTA
                     TTSPRLRVDNCIKIWHVTGKLVFVKEFKELLKVDWRTFCPYKTMANSHIIKDWQEPKN
                     DISQSLDPKLASANQLQIHESAEQYAAKHPKSNGSQGVGSQSKGAYKPPHARRAGANG
                     GRNVPGMNVVNAKPQPRAQIPGLVPGATQQQGGGKSAAKNKKRANKRKEDPQPNQKEQ
                     QQRGQQQESSSAQEPTLKETSSPEEKKIRSLLKKLRAIEALKLRQSNGEKLEDTQVLK
                     IQSEEKVLSELKFMGWQEESS"
     gene            <631480..>632202
                     /locus_tag="ZYRO0B08074g"
                     /db_xref="GeneID:8202452"
     mRNA            <631480..>632202
                     /locus_tag="ZYRO0B08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495255.1"
                     /db_xref="GeneID:8202452"
     CDS             631480..632202
                     /locus_tag="ZYRO0B08074g"
                     /note="weakly similar to uniprot|P53234 Saccharomyces
                     cerevisiae YGR053C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495300.1"
                     /db_xref="GeneID:8202452"
                     /db_xref="UniProtKB/TrEMBL:C5DRF6"
                     /translation="MNTIPSRRMGLTIDRLLSQAIRSAGRRFYSERHSNLGHITTYLT
                     TDGVPNLLQRPLLNEYLDAHITLRLLPTTHPYIPVLQGQGKYRASMNAIRLLATKFVL
                     QDKAKLKIDKVITLLREEKTNYNCITSNDKLVIKWQSCNESDGSDKSVDSSGKDVELG
                     QVRNVGEVDTSSPVFNHILNPTKNKLTSEIDYTRQPPRFVRGIFIFEFNEDNSRILVH
                     TIDSVEMVDFDKRIQTDALASV"
     gene            complement(<632301..>632921)
                     /locus_tag="ZYRO0B08096g"
                     /db_xref="GeneID:8202453"
     mRNA            complement(<632301..>632921)
                     /locus_tag="ZYRO0B08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495256.1"
                     /db_xref="GeneID:8202453"
     CDS             complement(632301..632921)
                     /locus_tag="ZYRO0B08096g"
                     /note="similar to uniprot|Q45U35 Saccharomyces cerevisiae
                     YGR049W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495301.1"
                     /db_xref="GeneID:8202453"
                     /db_xref="GOA:C5DRF7"
                     /translation="MSVCLGVTKGIAVSSLGIYAGILTTGTICTYMVPVDVITKHLNS
                     VVCRVGEVASALGLLSTGFFSLSYFGAPSHLRHPYLIYSALVAPASALYLWAISRCNH
                     KCHAKSKIAEQGKTNGDNKTQSPPLGDSVVDLGADSKVPSGHPPVKEGAKCPMGNAVV
                     TNEPSSTDYARPAGCQSKFAKHLAVVTGVAIIGFLQSVIGVYGEPA"
     gene            <633497..>634705
                     /locus_tag="ZYRO0B08118g"
                     /db_xref="GeneID:8202454"
     mRNA            <633497..>634705
                     /locus_tag="ZYRO0B08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495257.1"
                     /db_xref="GeneID:8202454"
     CDS             633497..634705
                     /locus_tag="ZYRO0B08118g"
                     /note="highly similar to uniprot|P06168 Saccharomyces
                     cerevisiae YLR355C ILV5 Acetohydroxyacid reductoisomerase
                     mitochondrial protein involved in branched-chain amino
                     acid biosynthesis also required for maintenance of wild-
                     type mitochondrial DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495302.1"
                     /db_xref="GeneID:8202454"
                     /db_xref="GOA:C5DRF8"
                     /db_xref="InterPro:IPR000506"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013023"
                     /db_xref="InterPro:IPR013116"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016207"
                     /db_xref="UniProtKB/TrEMBL:C5DRF8"
                     /translation="MFRNAASRTASRFICNSRVVTAKRTFALASRAAAVNAVRPAARQ
                     FIKPMVATRGLKQINFGGTVETVHERADWPREKLLDYFKNDTFALIGYGSQGYGQGLN
                     LRDNGLNVIVGVRKNGSSWKAAIEDGWVPGENLFDVTEAVQKGNIVMNLLSDAAQSET
                     WPTIKPLLTEGKTLYFSHGFSPVFYDLTRVEPPTNIDTILVAPKGSGRTVRSLFKEGR
                     GINSSYAVWKDVTGKADEKALAMSVAIGSGYVYQTTFEKEVNSDLYGERGCLMGGIHG
                     MFLAQYEVLRENGHSPSEAFNETVEEATQSLYPLIGSLGMDYMYDACSTTARRGALDW
                     YPIFKDALKPVFQDLYESVKNGSETKRSLEFNSQPDYRAKLESELETIRNMEIWRVGK
                     EVRRLRPENQ"
     gene            <635368..>638322
                     /locus_tag="ZYRO0B08140g"
                     /db_xref="GeneID:8202455"
     mRNA            <635368..>638322
                     /locus_tag="ZYRO0B08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495258.1"
                     /db_xref="GeneID:8202455"
     CDS             635368..638322
                     /locus_tag="ZYRO0B08140g"
                     /note="highly similar to uniprot|P16861 Saccharomyces
                     cerevisiae YGR240C PFK1 Alpha subunit of heterooctameric
                     phosphofructokinase involved in glycolysis indispensable
                     for anaerobic growth activated by fructose-2
                     6-bisphosphate and AMP mutation inhibits glucose induction
                     of cell cycle-related genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495303.1"
                     /db_xref="GeneID:8202455"
                     /db_xref="GOA:C5DRF9"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:C5DRF9"
                     /translation="MGLAHEACYGVAFRSVVTNSVELFKETIHFYHKLGFSTVKDFDK
                     FKHGENLLLSSGCSQDSIREMWLEAFKLSEIDANGFRVPQQEADNKNQSQGALLKVRF
                     VIGEAPKGVENFTTTYFSTELDEVVKRFPKAEKVSDKLVVLTDPLGNRVGFTSFANAL
                     DTEPTSKEQFLGPSSQHEAELAGSKPDANAVKELKNSLARSQKKKKIAVMTSGGDSPG
                     MNAAVRAVVRTGIHFGCDVYAVYEGYEGLLKGGKYLRQMHWEDVRGWLSEGGTLIGTA
                     RCKEFRERWGRKQAAYNLISEGIDALIVCGGDGSLTGADLFRGEWPSLVADLVKDGTF
                     TSEQVEPYKNLTMVGLIGSIDNDMAGSDSTIGAFSALGRICELVDYIDATAKSHSRAF
                     VVEVMGRHCGWLALLAGIATGADYIFIPERAAPRGKWQAELKEVCQRHRQKGRRNNTV
                     IVAEGALDDELNHISADDVKNVLVELGLDAKVTILGHVQRGGTAVAHDRLLATLQGVD
                     AVKAVLEMTPETPSPLIGILENKIIRKPLMESVELTKSVATDIENKNFDKAIMLRDTE
                     FMELYDIFVSTTIKDDGSEMLPVTQRLNIGIVHVGAPSAALNPATRAATLYCLSRGHK
                     PFAIMNGFSGLIQTGQMRELSWNDVENWHNLGGSVIGTNRSLADTDMGTVAYYFQKNK
                     LDGLIILGGFEGFKSLKELRDNRERYPVFNIPMVMIPATISNNVPGTEYSLGVDTCLN
                     ALVKYTDEIKQSASATRRRVFVVEVQGGHSGFIASFTGLVTGAVSVYSPEDQINLPAI
                     KEDLELLCENFRHDKGENNNGKLLIRNEQASNIYSTQLLADIIAESSKGNFGVRTAIP
                     GHAQQGGMPSSKDRVIASRYAVKCVNFLEEWNERNKGNDADTKVLRFQYDVHGEKKPT
                     VQHEDDSAAVICVNGSKVSFKPIAELWENETNVALRKGEDIHWKEFTHIGDILSGRLR
                     LRAEVASRSATA"
     gene            complement(<638905..>639393)
                     /locus_tag="ZYRO0B08162g"
                     /db_xref="GeneID:8202456"
     mRNA            complement(<638905..>639393)
                     /locus_tag="ZYRO0B08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495259.1"
                     /db_xref="GeneID:8202456"
     CDS             complement(638905..639393)
                     /locus_tag="ZYRO0B08162g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495304.1"
                     /db_xref="GeneID:8202456"
                     /db_xref="UniProtKB/TrEMBL:C5DRG0"
                     /translation="MNDSMLSSAAVVRQEVVNDSTINRLICSFFFHLHIYNDWGTHRV
                     APVEAEWNLRSRENFNSRRAEISETFPLKKRSWGKPPSSLKKKKAEDDFRMSHPRMFS
                     SENLAVNRGRRKTRSRRNRTGLSVALVTTSEIVGREEDGSGMETKGRGVVGSTALISA
                     AR"
     gene            <639421..>640236
                     /locus_tag="ZYRO0B08184g"
                     /db_xref="GeneID:8202457"
     mRNA            <639421..>640236
                     /locus_tag="ZYRO0B08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495260.1"
                     /db_xref="GeneID:8202457"
     CDS             639421..640236
                     /locus_tag="ZYRO0B08184g"
                     /note="some similarities with uniprot|P50091 Saccharomyces
                     cerevisiae YGR239C PEX21 Part of a two-member peroxin
                     family (Pex18p and Pex21p) specifically required for
                     peroxisomal targeting of the Pex7p peroxisomal signal
                     recognition factor and PTS2-type peroxisomal matrix
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495305.1"
                     /db_xref="GeneID:8202457"
                     /db_xref="UniProtKB/TrEMBL:C5DRG1"
                     /translation="MSACQANPLTQFVTKGEQHPGFIHRFSHENSNQHQLHINAPEGV
                     FLYGQDVAAGNRFMGGIHQGPAPITTAVPVVPPVQQQQQLHHQQVQREQQALHQSSGN
                     GSWLSQFHSMKIEDPLEFSQDYKKMYSSYEKSTAPMVRFPMTTYQPNYNMISRDVTKR
                     EVPGEKQDAFAAEFNALEKELEDVEKKRPIFDQEQEEFQKLANEIVDSCSTSPSTKLR
                     SSKFMGLMKGIGEGSVTLNKQKSKHATELHSPYTEQRVGNEYFPVKDSTLHYE"
     gene            complement(<640354..>641622)
                     /locus_tag="ZYRO0B08206g"
                     /db_xref="GeneID:8202458"
     mRNA            complement(<640354..>641622)
                     /locus_tag="ZYRO0B08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495261.1"
                     /db_xref="GeneID:8202458"
     CDS             complement(640354..641622)
                     /locus_tag="ZYRO0B08206g"
                     /note="some similarities with uniprot|P38854 Saccharomyces
                     cerevisiae YHR159W Protein of unknown function that
                     localizes to the cytoplasm potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495306.1"
                     /db_xref="GeneID:8202458"
                     /db_xref="GOA:C5DRG2"
                     /translation="MNKFDEFVEATDKELHVDTSTRNTTINVSSPGSSNDSTSSPKSP
                     SGEVLSRKEMKMKQFTPKKLNYQDHPLKDHSTGGSLPITRRTSRSSTIHKRKSLLQPI
                     VAPQTPDKSGPSWRSNGGSPSGSFNRQRSTSGASMHSRSSSQSLSLDSTFDVSLQNLA
                     NKELELLESKRRIEELKKQLQLEEQSYQKRVEELKELKSQVSNDLQINSQHQQQQQQQ
                     QQQQQQHHLQPHSKKREEHTRDKSRGKGSGTGSSSVWSKPLAFFNQFDQIIQHELERS
                     LRWDDTPEDKIMQPEPYEGAAAVQNSQLRQPQVEIPTSNSQSNVNNTDNNDNKINNNT
                     NNTSNNKNGHDDNNNNNDSSNNNNNNDGNNKNLWSFFNDVKTGLLGIEEEEETPQRTI
                     AGSAKNDNGIKEFKTAKKTRDPVEMTDFQK"
     gene            <641988..>645869
                     /locus_tag="ZYRO0B08228g"
                     /db_xref="GeneID:8202459"
     mRNA            <641988..>645869
                     /locus_tag="ZYRO0B08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495262.1"
                     /db_xref="GeneID:8202459"
     CDS             641988..645869
                     /locus_tag="ZYRO0B08228g"
                     /note="similar to uniprot|Q75AR9 Ashbya gossypii ADL149W
                     ADL149Wp and some similarites with YHR158C uniprot|P38853
                     Saccharomyces cerevisiae YHR158C KEL1 Protein required for
                     proper cell fusion and cell morphology functions in a
                     complex with Kel2p to negatively regulate mitotic exit
                     interacts with Tem1p and Lte1p localizes to regions of
                     polarized growth potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495307.1"
                     /db_xref="GeneID:8202459"
                     /db_xref="InterPro:IPR006652"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="UniProtKB/TrEMBL:C5DRG3"
                     /translation="MAPFKFAKKLTKDKKPNNSNPTSNHVQGTPPKAPRASQSSQNDG
                     STGSQSTHNGSSGSHDQNQHQFHMQNSPNMKGQLNNPLPPPPPQNQQHGLQQSHQQQQ
                     PLHHMSNPQSRVFPSPAQQRNVSGASTSLPQHQKEYTPWNRVKLQNSPFPRYRHVASS
                     NCSEDNSLYVIGGLHDQSVYGDTWIISTNDNGTQFQSKTVEISETTPPPRVGHAATLC
                     GNAFVLFGGDTHKVNSEGLMDDDLYLFNVNSYKWTIPHPIGPRPLGRYGHKISIMAAN
                     QMKTKLYLFGGQFDDTYFNDLAVFDLSSFRRPDSHWEFLKPTTFSPPPLTNHTMISYD
                     NHLWVFGGDTLQGLINQVFKYDVANNDWSIAETTGTKPPPMQEHAAVVYKHVMVVVGG
                     KDEHDTYLNSVYFLNLKTHEWFKLPTFKAGIPQGRSGHSLTLLNNDKLLIMGGDKFDY
                     ARPGEYDLNTSTTDMGKGTLLYTLDLSRIEEICPGVLKTTERQAATFVPVTPPINPQQ
                     QAKLSQPPQPNILTPYLQEGQLTPNDNRVPSQPKQLTPSKVPHAPFDNEARERFNQFS
                     NPPHQYSQQQPPFHQPVPRQTPQSHQQQFAGSSQFTPQRNSPQYTPQQQPHGQPQHPY
                     YKKGHARQPSDLKKPVSPIPELERTKSNNNEDGPRVASMGSGPSGPSGLGGPSGLGGP
                     SGLGGPSGHGGPGGTGAPSGPSGLNGPTGFDGPVGIKGPSGSDGPADIEKPANIEKPA
                     NIEKPANIEKPANIEKPADIEKPANTEKPANTEKPADIERPADTERSADIERSADIER
                     SIDTNGTQENKSRPDSMAGEVGIATVASSPLKGDVKLENSDQTSAYSSHENYYEDREH
                     LSFRGTENGLSEPVEITKRDSASSTTLTKGDITASNGSGQNKPFGVGPPPAIPSTHPM
                     NPSGSSASNAATVNGSDFDMSRMSSKETVNKEVIHRLRSQLEELRIITEDKALQASEH
                     IKELEVEVQRLRNEPSRDIKTADFIKLQSHCDVMEANHNLMEERIHELENMLTAKFAD
                     TEVLNKIIRVQSSKLDDLEQEIPFQEQLQELQTRYDNLAAENESLKTKLAGSETEFRQ
                     SVKQYSLQLNNFMEQWREHNPLRETGELDADGRPKRELVPGGSYHEAAMQKLQQRLDD
                     LLQTNEELTQSRHKLTDDHRELTTKHGELNENLEARQRELEEIQSNYQEVLNSANNSS
                     KALEMSQSELDKYKQINKKLQNELDELRFVREPSTGNDSASNIGIAGNNHYSMKINDL
                     KAELYIFKQERDNLKDEVLQLKKKLLSMGEQ"
     gene            complement(<646017..>646541)
                     /locus_tag="ZYRO0B08250g"
                     /db_xref="GeneID:8202460"
     mRNA            complement(<646017..>646541)
                     /locus_tag="ZYRO0B08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495263.1"
                     /db_xref="GeneID:8202460"
     CDS             complement(646017..646541)
                     /locus_tag="ZYRO0B08250g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495308.1"
                     /db_xref="GeneID:8202460"
                     /db_xref="UniProtKB/TrEMBL:C5DRG4"
                     /translation="MYDQQDQLPDRQEYHKYVVVCVDDFCQKYGIRNSVRSKFGLSNQ
                     VDSIDEDSFERIKGELGCGKRMGEDEKVEDGVYKRHCHELENSIMEGSTLEVLSQDLL
                     WSQQEFPSELIVSEDINMVTMENDDTNVLWDPSMTILESERQQASQDPEPEPELLQSD
                     EFHRVSSPPSAVNF"
     gene            <646895..>648961
                     /locus_tag="ZYRO0B08272g"
                     /db_xref="GeneID:8202461"
     mRNA            <646895..>648961
                     /locus_tag="ZYRO0B08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495264.1"
                     /db_xref="GeneID:8202461"
     CDS             646895..648961
                     /locus_tag="ZYRO0B08272g"
                     /note="some similarities with uniprot|P50089 Saccharomyces
                     cerevisiae YGR237C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495309.1"
                     /db_xref="GeneID:8202461"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DRG5"
                     /translation="MTVNMTQTEWAPHVSFDDLAPSIVDDELQDGKNGVCLFGGSRNS
                     HYIHAPRHSNQLYSSQHSSNASGEWSSPPSSFQGFGTWKSTLKPRQPPLPETSSMKPT
                     EPASTDKLERWDSTRDYDLETMDWQDERQMERDTDLNTERNSGSRHGYTQAAFLQLHE
                     PEDNVAKPRKKSFAGMSDEDLARLEDFYNSKSRSTKKPTMDKFDFHEQRSLVLDKPPC
                     KNRGVQCAIVDPLALVYPTRPVITHRAISLTTQNADFDEPRRVVSCYISGRRHTWSAA
                     DWYVENQSRDGDHLIIVTSISNFENRIMENNASKRNPQLTRSLSATDNWSNPSSSSHG
                     SHSPSYLGIQPRDIHRKAKATCRNILNYYAFRLNHRVIRITVEMVKEDSCKDTITKTM
                     ALYKPDLQIVSTVSTNVQIKFKNGKVKLPNFIIRHYSVPTCIVPHEFIDPRLLREDAG
                     TPFAEDRTLSPEKQWLLPPKNLRDRLQQLDQIINRTLVNPFDPKDTEPGYSDASVEEY
                     FPISNEQERKMESFEQLGYVRPKPSRPDMCLDWGVSPDTPNGSCKSSRSPSVVSRSSR
                     LYENSVPAYKVKSLVDLDYDNGDNDDNGDGNRNCPSVEANRNHHRHSKKITRPHLERS
                     KTTTAATKSTSTSDHSIPIVEKGKNIYKKKAMSTQSSPTSPAGNRHSEKKQKGTFGSF
                     FKKMFG"
     gene            <649110..>649370
                     /locus_tag="ZYRO0B08294g"
                     /db_xref="GeneID:8202462"
     mRNA            <649110..>649370
                     /locus_tag="ZYRO0B08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495265.1"
                     /db_xref="GeneID:8202462"
     CDS             649110..649370
                     /locus_tag="ZYRO0B08294g"
                     /note="weakly similar to uniprot|P50088 Saccharomyces
                     cerevisiae YGR236C SPG1 Protein required for survival at
                     high temperature during stationary phase; not required for
                     growth on nonfermentable carbon sources"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495310.1"
                     /db_xref="GeneID:8202462"
                     /db_xref="UniProtKB/TrEMBL:C5DRG6"
                     /translation="MKLNPDISSELRQASRMPTMRYWFVGLFGAVVPAIYLRSYMLRG
                     TTAAGQQISSGPPRRSLWQKLSDSYDKIPEDEATTVIFSSIM"
     gene            <649685..>649867
                     /locus_tag="ZYRO0B08316g"
                     /db_xref="GeneID:8202463"
     mRNA            <649685..>649867
                     /locus_tag="ZYRO0B08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495266.1"
                     /db_xref="GeneID:8202463"
     CDS             649685..649867
                     /locus_tag="ZYRO0B08316g"
                     /note="similar to uniprot|P81450 Saccharomyces cerevisiae
                     YML081C-A ATP18 Subunit of the mitochondrial F1F0 ATP
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495311.1"
                     /db_xref="GeneID:8202463"
                     /db_xref="GOA:C5DRG7"
                     /db_xref="InterPro:IPR006995"
                     /db_xref="UniProtKB/TrEMBL:C5DRG7"
                     /translation="MYKKFPTPLVKPYWPFYLSGAVMFYAIGKAANSSANTPAFINDP
                     RNPRFARGEKPVELKN"
     gene            complement(<649933..>651855)
                     /locus_tag="ZYRO0B08338g"
                     /db_xref="GeneID:8202464"
     mRNA            complement(<649933..>651855)
                     /locus_tag="ZYRO0B08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495267.1"
                     /db_xref="GeneID:8202464"
     CDS             complement(649933..651855)
                     /locus_tag="ZYRO0B08338g"
                     /note="similar to uniprot|P47164 Saccharomyces cerevisiae
                     YJR130C STR2 Cystathionine gamma-synthase converts
                     cysteine into cystathionine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495312.1"
                     /db_xref="GeneID:8202464"
                     /db_xref="GOA:C5DRG8"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DRG8"
                     /translation="MISTRVGESIPPNTKHAVSVCLPTWETTVGYEEGKPEVIESLTT
                     GYPRFFIHKAIQRLCQVLQDKYAKENETCLCFPSYEVAKRCREYIAVKSVSMNNGRPA
                     PKVRILQLATSKPVTPEEAKWKRESKVAVVFVDKQYWPLMKQYWQHAGEILSSRLAEY
                     VLHELFIVEKSSKTRQDRESRVEVRDEEEFIEQRFGRNLDFSYADTAKSLIKRRIATK
                     VVDGEADSHEEPPRATEQFVEHVVDAEDVTPGVASTIPAEPYHEPSSSATRTGLHVNP
                     DKDVYLFPSGMASIFTAHRLLLHLDAQRVQRSRLGQHSTPSSSRQGSGIQSPLPRESI
                     GYGEPYKKTVMFGFPYTDTLSILEKFNHTYFLGSGDSKAMEELKKILHSGEQILALFM
                     EAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNIDVLPFADIVCSSLTKIFSG
                     DSNVIAGSIVLNPQSKLYSFAETFMEQQYEDCLWCEDALYLERNSRDFVARTLKVNQN
                     TERLLNKVLLPQEGKLFKKIYYPSLTSKETKKNYDAVRGHQGGYGGLFSLTFYNLDSA
                     KTFFNTLQLCKGPSLGTNFTLACPYAIIAHYQELDRVAKYGVESNLVRVSVGLEREDE
                     LCKVFQTAIDEASKNI"
     gene            <652058..>653689
                     /locus_tag="ZYRO0B08360g"
                     /db_xref="GeneID:8202465"
     mRNA            <652058..>653689
                     /locus_tag="ZYRO0B08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495268.1"
                     /db_xref="GeneID:8202465"
     CDS             652058..653689
                     /locus_tag="ZYRO0B08360g"
                     /note="similar to uniprot|P32906 Saccharomyces cerevisiae
                     YJR131W MNS1 Alpha-1 2-mannosidase involved in N-linked
                     oligosaccharide biosynthesis catalyzes the removal of one
                     mannose residue from Man9GlcNAc to produce a single isomer
                     of Man8GlcNAc integral to the ER membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495313.1"
                     /db_xref="GeneID:8202465"
                     /db_xref="GOA:C5DRG9"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:C5DRG9"
                     /translation="MMVKSLAGSLTAALVAVVWYWSMGTRITYGDASQVRSLIEEAFL
                     TSWEDYEAYGWGSDEYSPLKRTHKNMGASDAPLGWIIVDSLDTMMMMYNSSGSSRLLA
                     GILKAQTWIDNELNYDLDSEVSLFETTIRMLGGLLSAHHWSSQMRVGNEQMYLDKAID
                     LADRLSMAFLQSKSGIPYSSINLHTGEAVKNHVDGGASSTAEFTTLQLEFKYLSYLTG
                     NKSYWELSEQVYKPLYSLNGLVGPQWDGLAPIYTYPDTGEFRGNHIRFGSRGDSFYEY
                     LLKQYLLTHEKLYYDLYRASIEGMKKHLLGTSKPNGLVYIGEKQFGLRSELDPKMDHL
                     VCFMGGLLAMGATEGLPIKKARKQPFWDTTRESDWKLAQDLTYTCYQMYAQIPTKLSP
                     EIVVFNKEDAVGRSNWISESGDFYVKPADRHNLQRPETVESLMFLYHLTGDNKYRQWG
                     WEIFQGFQQHSLKPRMRRPGKVYTSLKDCIQSPTQPLDNLESFWLAETLKYLHLLFQD
                     DVDLTKIVFNTEAHAFPVLDTRSLRDMKLKTGWSP"
     gene            complement(<653727..>654110)
                     /locus_tag="ZYRO0B08382g"
                     /db_xref="GeneID:8202466"
     mRNA            complement(<653727..>654110)
                     /locus_tag="ZYRO0B08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495269.1"
                     /db_xref="GeneID:8202466"
     CDS             complement(653727..654110)
                     /locus_tag="ZYRO0B08382g"
                     /note="similar to uniprot|P38877 Saccharomyces cerevisiae
                     YHR191C CTF8 Subunit of a complex with Ctf18p that shares
                     some subunits with Replication Factor C and is required
                     for sister chromatid cohesion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495314.1"
                     /db_xref="GeneID:8202466"
                     /db_xref="InterPro:IPR018607"
                     /db_xref="UniProtKB/TrEMBL:C5DRH0"
                     /translation="MPSVNVSKRQLQALLQSDQLQTSVSTPLGNMMLEIQGDLEAPQQ
                     WHEDPRFSMDGEHPLVRWGLLHIDTSRNNATLFVGRKQRLLGSLVKLDTPLGLIKFNQ
                     QDGTVDMQDIFYYKVLFKSRPLPIM"
     gene            <654270..>655019
                     /locus_tag="ZYRO0B08404g"
                     /db_xref="GeneID:8202467"
     mRNA            <654270..>655019
                     /locus_tag="ZYRO0B08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495270.1"
                     /db_xref="GeneID:8202467"
     CDS             654270..655019
                     /locus_tag="ZYRO0B08404g"
                     /note="weakly similar to uniprot|P38878 Saccharomyces
                     cerevisiae YHR192W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495315.1"
                     /db_xref="GeneID:8202467"
                     /db_xref="InterPro:IPR019273"
                     /db_xref="UniProtKB/TrEMBL:C5DRH1"
                     /translation="MMWLRGKRKTLVEKYTEELTDITSQIHQLDQKLKSSQEASDKLQ
                     SQLNYYGLATAALVLGYMHMIYHSVLPYSIASAIATLALAGLIKSLASKIDQWQRERQ
                     SRRLNRLRASHQQKLNKLKEETNFHATNSVIQRFSQGEDQTEDAMLLMDDEIVKKYQE
                     LKNLQEELNQFRKTGNSKDKQERDKWFDKVLNVLAGGDIPRPIVCTQCHKHSGAYTVG
                     DGPLVYICPLCGWREPPLEEKRKEEDEVSSK"
     gene            complement(<655066..>655584)
                     /locus_tag="ZYRO0B08426g"
                     /db_xref="GeneID:8202468"
     mRNA            complement(<655066..>655584)
                     /locus_tag="ZYRO0B08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495271.1"
                     /db_xref="GeneID:8202468"
     CDS             complement(655066..655584)
                     /locus_tag="ZYRO0B08426g"
                     /note="similar to uniprot|P38879 Saccharomyces cerevisiae
                     YHR193C EGD2 Alpha subunit of the heteromeric nascent
                     polypeptide-associated complex (NAC) involved in protein
                     sorting and translocation associated with cytoplasmic
                     ribosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495316.1"
                     /db_xref="GeneID:8202468"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="InterPro:IPR016641"
                     /db_xref="UniProtKB/TrEMBL:C5DRH2"
                     /translation="MSAIPEEANVSILNKNEKKAKDLIIKLGLKQLPGISRVTFRKKD
                     NQIIAIDHPEVYRSAGGNYVVFGEPKVDNFTQKLAAAQQQAQTTGAIPAAGEASKNPE
                     DIKKDMHVAAANPEQPQKELGDDEEVDATGVNPDDIELVAEQANVPKNKATKALKDHN
                     NDIVNAIMSLSK"
     gene            <655835..>657535
                     /locus_tag="ZYRO0B08448g"
                     /db_xref="GeneID:8202469"
     mRNA            <655835..>657535
                     /locus_tag="ZYRO0B08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495272.1"
                     /db_xref="GeneID:8202469"
     CDS             655835..657535
                     /locus_tag="ZYRO0B08448g"
                     /note="highly similar to uniprot|P38880 Saccharomyces
                     cerevisiae YHR194W MDM31 Mitochondrial Distribution and
                     Morphology"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495317.1"
                     /db_xref="GeneID:8202469"
                     /db_xref="GOA:C5DRH3"
                     /db_xref="InterPro:IPR012571"
                     /db_xref="UniProtKB/TrEMBL:C5DRH3"
                     /translation="MLSSRFRIALGRLIRPRFNVGNNNIRLATYSSLLNLRFKSTSSR
                     DTHLPPKRDDNSTRFKFITERDRRLAQATSVYEKLKINVKWILTKSSRPFNSDDIGAF
                     ISWLLLSNALIIAIWTTTFASLVIYLVNTVFAQEYVATKVGNFLTRNSALSVVFESAI
                     VPDWSSGKITFNKVFVSRRPKLSHSFTKGSVKEALQRTELALSERLLVSREDFDDGNY
                     TQYDLTIDQVEISLSFSKWFNGKGILDEVSLQGLRGVVDRTHVVWLPNDDPRKYKNTH
                     RPGDFEISKFSMSDVLFTLYQPSGFRPILVSIFNCQLPQMRQHWLFYDFLNANSVSGT
                     YDNSMFTIHRKFNVEKTPFSSSDSSPWKRVTRLRVDNLDVDHLNAGMDGPFGWITEGK
                     VDMIGDVLLPDREADDRMLTEMLTEIGERLFKEAKRKTMAVPGPSPDVEGMDPDNYFI
                     MDFSLKLHNVRAEVPLFTPEFGYINNALIRPIVAYINSKRTYIPIRCRVVKNLEDFEG
                     SWTIYDSLLMNDLSAQVYDAFAEYVADDREKSTRLKRVTFWSLQIVLQVILMSLGAIA
                     "
     gene            <657893..>658777
                     /locus_tag="ZYRO0B08470g"
                     /db_xref="GeneID:8202470"
     mRNA            <657893..>658777
                     /locus_tag="ZYRO0B08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495273.1"
                     /db_xref="GeneID:8202470"
     CDS             657893..658777
                     /locus_tag="ZYRO0B08470g"
                     /note="weakly similar to uniprot|P38881 Saccharomyces
                     cerevisiae YHR195W NVJ1 Nuclear envelope protein that
                     interacts with the vacuolar membrane protein Vac8p to
                     promote formation of nucleus-vacuole junctions during
                     piecemeal microautophagy of the nucleus (PMN)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495318.1"
                     /db_xref="GeneID:8202470"
                     /db_xref="UniProtKB/TrEMBL:C5DRH4"
                     /translation="MARHPVVHGVLSISGTFGAAKGFQKLLQRYLSNEWLFENEKDKI
                     SPTSLVPSILESSSQDLSNKSKELDWTGVLSFVVDQIANVDVRLAVAIVVLAVMGPVL
                     PYAFGYGKVDAASTESEIIASHLDPAQRALLQFGKSKSEPVLFGYVSMELDELEEHGS
                     SEHVLHLRRQLQLEDQHFVKELRDEVNIAEQLVQRQESKELEKEEEQEVVVAHSCSRS
                     HSGSPQVEESDTSADGKPSSSTRSEYTLPSAQTSPLDHRDSCVSHSNTCIQLSPIKTS
                     NLDAQLTSEQAYSQPFTY"
     gene            <658948..>662013
                     /locus_tag="ZYRO0B08492g"
                     /db_xref="GeneID:8202471"
     mRNA            <658948..>662013
                     /locus_tag="ZYRO0B08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495274.1"
                     /db_xref="GeneID:8202471"
     CDS             658948..662013
                     /locus_tag="ZYRO0B08492g"
                     /note="similar to uniprot|P46970 Saccharomyces cerevisiae
                     YJR132W NMD5 Karyopherin a carrier protein involved in
                     nuclear import of proteins importin beta homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495319.1"
                     /db_xref="GeneID:8202471"
                     /db_xref="GOA:C5DRH5"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DRH5"
                     /translation="MDVNVLLQCFAGTLDQNAQVRSQAEGQLKQISFTPGFLGATLDI
                     ISAEQTPENVRLSASLYFKNKCVNGWTGKYNGKNELLDYVVDQDEKPVIKDMLIRTLI
                     VCVKVSPGSTRVLKNALSIIIYEEYSQGRWDDLLTQSIKLLSGSDVDGAYVGLLCLSG
                     IFRTYRWKENDSRQGLELLIIQYFPDLLKYGETQLLAQGANLNDAKLGEMLLLLIKIY
                     KFVTYLDLPFTLQRQESFIPWANFFVAIIQLPLPAEFTTLYDNESRAKNPWVKCKKWS
                     YAILYRLYQRYASDSLTRKFEYEEFKPLYRDQFLPQLLQLLFQQIEQWGDGSLWLSDE
                     SFYYILCFIEQTIVQKATWKLVQPYYETLLEHVIFPLLCPNDDKLEVFETDPQEYIHR
                     NLELWDENYSPDLAAVSVLTTAVTKHGKTTLQPTIQFVIATLQANLGNSTNLSSAVKI
                     ESAFRIFSSIIDRLTTKDSPYLNELETFLNSFVFPFFESPFGFLRTRVCEICSKLGTI
                     DFQRATLVDTIYKGIMFCMNDTTGCLPVQLMAALALQAFIHVPEFQTALSSSVLPTMQ
                     RLLNISNEFESDTISGVMQDFVEQFADQLQPFGVDLMNTLVQQFLRLVIELHEASNVD
                     PNSLLDESDIPDESDKQMAALGILSTTISILLSFENSPEMVKSLEQSFYPAAEFILKY
                     EVEDFYHECCEFVENSTFLLRSISPISWKILELIGESNRSENSMVSFYLEDCIYALNN
                     YLLYGTDELKKNEFYSKILYEIYDRASRDEDKALSDFTTVFDLSQKMILSLNHQLPET
                     YGHRIINDAAQAIVANQEELKNNIVFGVTTFNVVVSGLVYFPQLTLEILQSSQCLEVF
                     FKTWLEFYVPNVKRVFDIKLSILALLSLMTEIPQPTLDTLFGGPIFPKLGKILIGLAS
                     RFPQAQRLLQEKRMGFSTGSFSLDDLEDMKNDSSTLKFVNGESLDTEEDFEDLEEDSL
                     SGSLLDTIDIYASIKLFAINLRNTDQHKSTTVVSEMTPDEQETFKKIIL"
     gene            <662143..>663930
                     /locus_tag="ZYRO0B08514g"
                     /db_xref="GeneID:8202472"
     mRNA            <662143..>663930
                     /locus_tag="ZYRO0B08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495275.1"
                     /db_xref="GeneID:8202472"
     CDS             662143..663930
                     /locus_tag="ZYRO0B08514g"
                     /note="similar to uniprot|P38882 Saccharomyces cerevisiae
                     YHR196W UTP9 Nucleolar protein component of the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495320.1"
                     /db_xref="GeneID:8202472"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DRH6"
                     /translation="MPIFFQCSSHRTEKENSVTYTYMPLSDYYQPLKRLWNLLPIDHS
                     MPQMIPSMDIVASFSRNVTQFAFQANLSQKNAIDIYSLDPSNDYSINSSLVNRVDYEG
                     NDLKASEVFFIGWCTSSEENSTTKTKRTQSDENRVTKDENFLVNGFPDGKIVVFSSTG
                     KQIVNIIQNKKQILHIDTESEFIWILDSESTVKKLPYTQTKPVKSFQLIDGRDEEITS
                     FRVLPRQKKNVYLALSTKDALFIIDPTNSKPRTVLKLGLTDCKYCQLFYQNGEKLVVT
                     TDDRVLVFNVSDGELIQEWNLQVKKLRIFGDVVLALDTQGTISALKIGNDQNLSQIEI
                     PQSQVIDFIPLKDILLIAWLNVNEPNFKVIPLEKINSGEKIVIDDLQMDTETQDLDGK
                     VNHQLDDGNGGPKYEKKKVSRAEQDELSQSLINFLEKSDSEGVLETISSQNWTEQRIK
                     SFVVFHVNNYETARLIFEVISSNFQREVWNKESSLAEWLRWLLTLRGDSLDSKHMKKN
                     TKHLRSTLKNSGESLPTLIGIQGRLELLRKQAQLREDLANLNVAEDDDKVETVNHENA
                     AVVGDGEGQDDSVQFINGESDTYVDAQEK"
     gene            complement(<664054..>666126)
                     /locus_tag="ZYRO0B08536g"
                     /db_xref="GeneID:8202473"
     mRNA            complement(<664054..>666126)
                     /locus_tag="ZYRO0B08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495276.1"
                     /db_xref="GeneID:8202473"
     CDS             complement(664054..666126)
                     /locus_tag="ZYRO0B08536g"
                     /note="weakly similar to uniprot|P47166 Saccharomyces
                     cerevisiae YJR134C SGM1 Protein of unknown function
                     required for wild-type growth rate on galactose and
                     mannose localizes to COPI coated vesicles and the Golgi
                     apparatus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495321.1"
                     /db_xref="GeneID:8202473"
                     /db_xref="InterPro:IPR022091"
                     /db_xref="InterPro:IPR022092"
                     /db_xref="UniProtKB/TrEMBL:C5DRH7"
                     /translation="MTDTSKKLTLEERLSLAAKKSKKKNKKSPSPAAIVPTEVEQTTE
                     KTEKSDKAEIDEKVNEKSDEKDDKVSNAATASAPQLTASSENNLVPEQEDSEGNNLEE
                     ENNWKRQIQLLNSLKDKEPWSQWLTKATQFSNVDDFLKTFEPALRSIYEELQNYKKQE
                     DVANESTTDKEKDELIAQLRYEGEKLAATELRQNNAIKSLRKKLAGMENDIKVTQEEL
                     FKKISSYEQLFDSHEDLQTQLQNCEVIIKNLRQDNAQLKDSESQLENKKEEVESLRST
                     LEMEHQKFEQREKDMIIEIDTLKSSSQEQVTQLETSLEQLRIKLDSSSKKDQKEPVPN
                     YKENEEILRKELESLKFSSSQLENSLTGKISDLETKLNQLQQSSSQLEGQLQSVRQLN
                     ESLEIRLSDESKNREQNAVKLQELQRENEKLRNSLQDSIEDYNLLQRKYEIRQTHLES
                     NVESNLVPTEKESKPSQSLDVPHNQKDGTVPPSPAEEDWMYPPNVSQISSMGPPMDFE
                     SSSLQKEVDEISDRPPIEDDKLSINGMDIPEEAAAMGSHVHELHSTSRQTNSMNYRRR
                     STQVDSTGQMNAHMISKLGAEIRRYEAELVSLQNSCERLQKEKMEASNEILKLLEDNE
                     RVQVLSKEKDELTRKLEETQSKLETSLQILGEKTERVEELENDVADLKEMMQQQVQQM
                     ADMQERLR"
     gene            <666600..>668855
                     /locus_tag="ZYRO0B08558g"
                     /db_xref="GeneID:8202474"
     mRNA            <666600..>668855
                     /locus_tag="ZYRO0B08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495277.1"
                     /db_xref="GeneID:8202474"
     CDS             666600..668855
                     /locus_tag="ZYRO0B08558g"
                     /note="similar to uniprot|P38883 Saccharomyces cerevisiae
                     YHR197W RIX1 RIbosome eXport essential protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495322.1"
                     /db_xref="GeneID:8202474"
                     /db_xref="UniProtKB/TrEMBL:C5DRH8"
                     /translation="MSSEILPLTTLAKQLEYCEGSQFQLILKKLTSPAYIDEQLLKTE
                     LPLVATKIQKLLRSNQDYDIWKGCHASVVLCSYNPLALCVHGGQLLTVIYSRLEQKTE
                     YHSASSEAFSEKIVLKSLTSALSILMDLMRGKPTLSRESLVPKLKAIIPCLVDLTALE
                     PELCLPILKELLLKNSTTFRPYANKYRQVLSKLISQEYGNLDPNVQSLVCENYAYLHL
                     IKLQAQNSQDEHQAHHKPFHDETWRIGILSILAQFKPILELCDEMLDLDHDQDLKKLI
                     KSLQYDNLYPTDLPTSDKLLPGLKVDLNEPMTLWEIPQRLNLLIDLLSPFLSLPTPYA
                     VRIPLGACISVFEGLLGMTRNFLPLRREIRRDAELVSVIYDVLSHVQFSGVRLLNVLV
                     QNFGKCCLSMLPSILGSLEFFIPLQLKSKSIDIKRCKLMKSEFLQYFQLLNSIFPHIG
                     YQLQELDFFQKLVEVALALSEDENLANLLTNEGPAKTQSNKAGKKQRKDNSVGALSDM
                     YTHADQFILRTSLAWYDQINLFLSGLLSNLKLPSSQQVKIIRYGVQKSLGWKQQVGHI
                     PESFVELLRAIVVNPGNERVSILPIAVSLLKGSSDELFDLLCHPRLPVNLIHNVKGLA
                     NSIEEQNQEELLSNEDLEEAADEPEEEESQEKEENVEIESNTKRQIPETESEPEPPKR
                     QRLNTNVPLFQAQNTEILKVDNEPPVVLKEEKQVEVVQEQQPASAQEEASDSESEMVI
                     PQIQLSDDDEE"
     gene            complement(<668857..>669561)
                     /locus_tag="ZYRO0B08580g"
                     /db_xref="GeneID:8202475"
     mRNA            complement(<668857..>669561)
                     /locus_tag="ZYRO0B08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495278.1"
                     /db_xref="GeneID:8202475"
     CDS             complement(668857..669561)
                     /locus_tag="ZYRO0B08580g"
                     /note="similar to uniprot|P47167 Saccharomyces cerevisiae
                     YJR135C MCM22 Protein involved in minichromosome
                     maintenance component of the kinetochore binds to
                     centromeric DNA in a Ctf19p-dependent manner"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495323.1"
                     /db_xref="GeneID:8202475"
                     /db_xref="UniProtKB/TrEMBL:C5DRH9"
                     /translation="MNGSPVNQDLLEVYINTIEQQIDNKKFFVKQARDAIGSLQTGGM
                     DVHSISSEQWQNFMKRPMFFPERSDPIGLGLASTGFVSRQQSSEQWLEHMEVQLNDMQ
                     TMIRNQQQMNHEMTVLLELLLHKLETPSEDNTIQETPVQRNHTLRNELKNFIRDFLSL
                     DLADSQNTAEQVCSDVMVVIERLINYDTNLTTTDFPPSTKGLFRLLLRGNLITLNEVG
                     DKRYVKLTDFASTEVV"
     gene            <669780..>670043
                     /locus_tag="ZYRO0B08602g"
                     /db_xref="GeneID:8202476"
     mRNA            <669780..>670043
                     /locus_tag="ZYRO0B08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495279.1"
                     /db_xref="GeneID:8202476"
     CDS             669780..670043
                     /locus_tag="ZYRO0B08602g"
                     /note="highly similar to uniprot|P57744 Saccharomyces
                     cerevisiae YJR135W-A TIM8 Mitochondrial intermembrane
                     space import protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495324.1"
                     /db_xref="GeneID:8202476"
                     /db_xref="GOA:C5DRI0"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:C5DRI0"
                     /translation="MSSITTADLANLNDSSKKEIATYLEAENSKQKVQMSIHQFTNTC
                     FKECIQSTNNTDLSSQEEQCLGNCVNRFLDTNIRIVKGLQSLQ"
     gene            complement(<670102..>671358)
                     /locus_tag="ZYRO0B08624g"
                     /db_xref="GeneID:8202477"
     mRNA            complement(<670102..>671358)
                     /locus_tag="ZYRO0B08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495280.1"
                     /db_xref="GeneID:8202477"
     CDS             complement(670102..671358)
                     /locus_tag="ZYRO0B08624g"
                     /note="similar to uniprot|P47168 Saccharomyces cerevisiae
                     YJR136C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495325.1"
                     /db_xref="GeneID:8202477"
                     /db_xref="InterPro:IPR018870"
                     /db_xref="UniProtKB/TrEMBL:C5DRI1"
                     /translation="MEELKAFVTKFDGAHLPTIDDDDLRQTCSHLRDHATDDVNTSLQ
                     VIQCLSYFTMDKEPRGSKCLETIKIVVDKLTNDTNWSYDELLTWLIDRLRPLLLRTKE
                     SSRQSNKNENNALKPKVGQSYKEDEQRQAWRNEGGLKSIPFFYVVLFNLKNRHVSSNL
                     WWITPGILNILDDTTDIVGVKLKGVILLRVFLENCFEDQKNWVSFSDLGLYELYSPIL
                     WNLCYYLPPSYDSNTSLSILQTVFPTLNSLYRLQFISSDLKYKYHLGKFLSEILLQNL
                     IPRVNFISEPLTAYALDVCCRCVRILGVSSAVHLQRMIYVLGEYLVRNPFFTAFDSLM
                     DNTLSLIHTMIVECPAERVVAHKYDFYGLLLISFGKCKQEGKLTQEIMRKFKRIRESM
                     KATGCDPNEDKDEILANHRYMEEFFN"
     gene            complement(<671570..>672508)
                     /locus_tag="ZYRO0B08646g"
                     /db_xref="GeneID:8202478"
     mRNA            complement(<671570..>672508)
                     /locus_tag="ZYRO0B08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495281.1"
                     /db_xref="GeneID:8202478"
     CDS             complement(671570..672508)
                     /locus_tag="ZYRO0B08646g"
                     /note="similar to uniprot|P38884 Saccharomyces cerevisiae
                     YHR198C FMP22 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495326.1"
                     /db_xref="GeneID:8202478"
                     /db_xref="GOA:C5DRI2"
                     /db_xref="InterPro:IPR016087"
                     /translation="MLLNPLLKRSRVSSKSAIRNISLLSTRRAYHPQNVQIPRPFTKG
                     RQTYYGLSLAGLTAAWAINSQLHAADNDANVNDDAENTVMVDKNISPFPVHIGPPKYP
                     FSTDYSLLGYGYRYVTFISFKVYDLGIYIADQDKHLVPEVLSSKFLSTAFVDTDHSKS
                     HKENVNAALNDSEKSAVLIGNLLDTGCRMLAKITPVRNTDFNHLKDGLVKTILAHPEA
                     KNNQEILNSGLKELKEAFTKKGKVPKDHDLFLELQANGALQVAYYDRKKDKTFRLGLV
                     NEPLVGKFLFSQYMGGPKPLSPTTQKSVAEHIVAML"
     gene            complement(<672733..>676995)
                     /locus_tag="ZYRO0B08668g"
                     /db_xref="GeneID:8202479"
     mRNA            complement(<672733..>676995)
                     /locus_tag="ZYRO0B08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495282.1"
                     /db_xref="GeneID:8202479"
     CDS             complement(672733..676995)
                     /locus_tag="ZYRO0B08668g"
                     /note="highly similar to uniprot|P47169 Saccharomyces
                     cerevisiae YJR137C ECM17 Sulfite reductase beta subunit
                     involved in amino acid biosynthesis transcription
                     repressed by methionine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495327.1"
                     /db_xref="GeneID:8202479"
                     /db_xref="GOA:C5DRI3"
                     /db_xref="InterPro:IPR001094"
                     /db_xref="InterPro:IPR005117"
                     /db_xref="InterPro:IPR006066"
                     /db_xref="InterPro:IPR006067"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR009014"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DRI3"
                     /translation="MTTSNACTLSEALLKYAQAVDSFKFFFTTAIKDTKSEFASFPHA
                     VQLLNNADPLGEVIEQISKDRLTTLVTDEATLVKSLPHLQGLQGHPIVINVDLSLQDY
                     SVIPFFKDLSIPILISSNEKIFDVNAQRSLDIASKCLRPVLHFINFKNLKHKVEADVK
                     PTQLAEEPADLDALDLGSKFDIISTSKTPTTAVINYSACDFSSVLPNDTSLVQINVYR
                     PWSIQDLLTALPNSIKKVVVAQSATQKSEQNGFEPLLLDFFQDFDSLIEKGIDQVIIS
                     NIGLVTDLSAVLGEIISNVNSKEPNLSLFVGEQVKEKETIEELSSLKNVLDLENAYMK
                     VIRQLFTSNSNFLNEYTSETVQQNNPEYGYGLFLNQNKRREELVALARRSLDPSLYGT
                     TDAVSFVQLLGKWVSYHDQSLDESALKEANVVSQQVFEFLQKHGDSKKASEFLQLGSD
                     EESYVFKSTWLVGSDAWSYDLGNSGVHQVLSGKKNINVLLIDSEPFEHRKETQQRKKD
                     VGLYAMNFGHVYVASVAVYSSYSQLLTAFIEASRYNGPSIVLAYLPYHSERDTPLEIL
                     KETKKAVGSGYWPLFRYDPSKEDDEAFVLDSSVIRRELQTFLDRENRLTLLSKKYPDF
                     SRNLVQSASDKVTKKQERRAKQAYEQLLEGLSGPPLHVYFASDGGNAASLAKRLSNRA
                     AARGLKATCQSMDEIDLEDLPGEENVIFITSTAGQGEFPQDGKGFWDALKGSTGMDLG
                     SLKFSVFGLGDSLYWPRKEDKHYYNRPSRELFKKLEILAAKAIVPLGQGDDQDADGYQ
                     TAYGPWEEELWEALGVSGANVADEPKPWTNEDMKINSDFLRGTIVPGLEDESTGTIHA
                     HDQQLTKFHGCYMQDDRDVRDVRKAQGMEPYYAFMARIRLPGGKANPEQWLILDRLSN
                     ESGNGTMKLTTRATFQLHGIVKRNLKHTIRGMNSTLMDTLAACGDVNRNVMLSAIPHN
                     AKIHQQISDFGYKVSEYFLPNTTAYHEIWLNGVDDRDYDPNWPSIFENRKDGPTKKKT
                     KVSGGALVDVEPLYGPTYLPRKFKVNIAVPPYNDVDVWSSDVGLVTIVDPETQEVTGY
                     NMYVGGGMGTTHNNKKTYPRTGSLFGYLPVSDVIKAIEGVMIVQRDNGDRNDRKHGRL
                     KYTIDDMGVDIYKSKVEEHMGRKFEPGRPFEIKDNHDYFGWVKDETGMNHFTAFIENG
                     RVEDTVELPQKTGMKKVAQLMQKHGSGHFRLTGNQHVVICDIKDEHLDEVKKVLHKYK
                     LDNTDFSPLRLHSASCVGLPTCGLAMAESERYLPELISKVEDILEELGLRHDSVVMRM
                     TGCPNGCARPWLGEVALIGKAPETYNLMLGGGYYGQRINKLYRASVKEEEILEILKDL
                     FKRWSQEREEGEHFGDFLIRVGVIAPTLEGKYFHDDIPEETV"
     gene            complement(<677439..>677615)
                     /locus_tag="ZYRO0B08690g"
                     /db_xref="GeneID:8202480"
     mRNA            complement(<677439..>677615)
                     /locus_tag="ZYRO0B08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495283.1"
                     /db_xref="GeneID:8202480"
     CDS             complement(677439..677615)
                     /locus_tag="ZYRO0B08690g"
                     /note="some similarities with uniprot|Q03661 Saccharomyces
                     cerevisiae YMR219W ESC1 Protein localized to the nuclear
                     periphery, involved in telomeric silencing; interacts with
                     PAD4-domain of Sir4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495328.1"
                     /db_xref="GeneID:8202480"
                     /db_xref="UniProtKB/TrEMBL:C5DRI4"
                     /translation="MIKDEMTTQQVRQLENDKLNELDRAAQAQLDYNNSVSNDSLTVR
                     EILELERNGTTTVD"
     gene            <678315..>679136
                     /locus_tag="ZYRO0B08712g"
                     /db_xref="GeneID:8202481"
     mRNA            <678315..>679136
                     /locus_tag="ZYRO0B08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495284.1"
                     /db_xref="GeneID:8202481"
     CDS             678315..679136
                     /locus_tag="ZYRO0B08712g"
                     /note="similar to uniprot|P38886 Saccharomyces cerevisiae
                     YHR200W RPN10 Non-ATPase base subunit of the 19S
                     regulatory particle of the 26S proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495329.1"
                     /db_xref="GeneID:8202481"
                     /db_xref="GOA:C5DRI5"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR027040"
                     /db_xref="UniProtKB/TrEMBL:C5DRI5"
                     /translation="MVLEATVITIDNSEYSRNGDFPRTRFEAQIDAVEFIFQAKRNSN
                     PENTVGLILSAGSNPRVLSTFTSEFGKILSGLHDTHIEGSIHLGTAIQIAALTLKHRQ
                     NKVQHQRIVVFVCSPIQDDRQELMKLAKKLKKNNIAVDIINFGEIEHNTAIVEEFIET
                     VNNSQEESSHLLNIQPGPRLLYEHIAGSRIILEEGAAGGSGFDGDSAGGDNGFMDFGV
                     DPSVDPELAMALRLSMEEEQQRQERLRQQQEQQEQQQQQQESQGQGQEQEQENKS"
     gene            <679354..>683949
                     /locus_tag="ZYRO0B08734g"
                     /db_xref="GeneID:8202482"
     mRNA            <679354..>683949
                     /locus_tag="ZYRO0B08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495285.1"
                     /db_xref="GeneID:8202482"
     CDS             679354..683949
                     /locus_tag="ZYRO0B08734g"
                     /note="similar to uniprot|P47170 Saccharomyces cerevisiae
                     YJR138W IML1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495330.1"
                     /db_xref="GeneID:8202482"
                     /db_xref="GOA:C5DRI6"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027244"
                     /db_xref="UniProtKB/TrEMBL:C5DRI6"
                     /translation="MARDGPLFVGLRGKNQRPVSSTVSSGPKVNNTTHVNSISLSAGN
                     LIVGAKDNTNLRGNVLSTPSTTFVNDNNKINTNSPAILAPESAGIIDKNRSRQVELCY
                     HESRYSNDLVELDLSAIPGAKQGDLFEMKTYRKTPGSKDKKIYFVAKDFSPDIRRRTK
                     NAQISILSGQLQSLLDLPSRSKVWIRLKSKRLTEADLVELNIKDCLINRGDMWCLNSQ
                     LVGQCVFSGQKLTFLDTIRATVNGIYREGKKTLSGYIGENTRVVFRSESARLIFLIQI
                     TEEMWNFEETGEQLFQKMVNSFFPKIFKKWKDIGTHHSITIAFAVSMDTSHVPFRELE
                     PGTILKNTTDYFRIVVDQVLVIHWVEIMETLRKEFQALRRNLLNVQTEDGYSVVKGRF
                     SPVIKSNILELVNFASTLITDPFRQSDLRHTTTHIMIISPGSGLYDVDYDLLRLTGKK
                     LLSLEMTMDLICLSRAPLHVVPLFRYLDYESKLHHCSPTWLSIFFWNDSMNGTDDWRP
                     RCKIYDLQMMGLTENDVLGKIDIDYLKPGKGVESIQQFMDQYDTDVFNFEKCNDNLQK
                     GNSNCDKSEGGVQLNQKQSLQNPSTFAWNAPKFSTPVLEDIQKPKVFADLSTQRSSGL
                     RDDEGSDKIQLSDSAFRTQQSSLAVDTLKGITKKNLVKDLTQRIVGRIMPDREVKRDM
                     STHEPVEDRTDGVERSPVQKPALSPRNSSEHVPVIKKNLSTLNHLDNQNGSPFGIDGF
                     PLYASAHNLESPVDHGASETKPLFTVDDRKTPLQESAAHNSGSSPTEVRTWIEIKNPS
                     VPVNEDLAGMMYPTRWKDVLPRYVPKRYSKWRSFTTPAELPITISDFPSKLDFENNFF
                     FRNHSVNLNIDQEAYKQTSKDLLRNMIYVRLLAGFQLCVGENVKNVERSKGVENNESP
                     VAKFIDGTWVNIRIYMTIDSEIHRISCGMDGVIDVQRYMRKNEENPFEQVSSYAPLVK
                     TRYENLYRKAKIDPLHAARSPLNWNQIDQVLAGYGEYGLDKNECGFRSKLVVLPADIP
                     TNTYSSVINGRNETLTQEEIRLEGLNRLISSISKSRLLTAKEKQMKKNKREEIQPEIL
                     FYTGSLFDFIREQKSSLDRSVLSYKDSIFADRKQLKKDVDIKELAHEIQHGNNPLTLV
                     NRKWHWKRHQNSFIGSEMVNWLLRNLSDIDTREEAVEYGQSLMDRGLFKHVLNKHGFL
                     DGHYFYQITPSYLVDARTLEKVNSDSKSSNDQRRAAGENSSSGISETNVLPLTMVNSN
                     STSNISNDNQSDTRNNASERPVKSSVMLSNSLVIDVDPAGKSYKMETCTVHYDRVHNP
                     DHCFHIRLEWLTTTPKFLDDLVGNWSRLCERYGLRLVEIPWRELCTIPAVDPFHSFVE
                     IQLAINPWEDPEFKDEELLSESKYYYHMHLLQVSGFLLDNRASKVIQDIHCDFEIMYS
                     WGKPEFKYAQYIHNTGAYIAEVRESGELFLAPNNIYISRAIPGKIVAKSQFSTQFAVD
                     AQKVMLNFKKVCTNYNELRVIFLDAKDKWLKGQHVDE"
     gene            complement(<684020..>685105)
                     /locus_tag="ZYRO0B08756g"
                     /db_xref="GeneID:8202483"
     mRNA            complement(<684020..>685105)
                     /locus_tag="ZYRO0B08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495286.1"
                     /db_xref="GeneID:8202483"
     CDS             complement(684020..685105)
                     /locus_tag="ZYRO0B08756g"
                     /note="highly similar to gnl|GLV|KLLA0B03872g
                     Kluyveromyces lactis and similar to YJR139C uniprot|P31116
                     Saccharomyces cerevisiae HOM6 Homoserine dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495331.1"
                     /db_xref="GeneID:8202483"
                     /db_xref="GOA:C5DRI7"
                     /db_xref="InterPro:IPR001342"
                     /db_xref="InterPro:IPR005106"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019811"
                     /db_xref="InterPro:IPR022697"
                     /db_xref="UniProtKB/TrEMBL:C5DRI7"
                     /translation="MTGREVNVAIIGCGLVGSAVLRQLQAAKSSVTYNLILLSSSKKS
                     LISDDYKPLDIGSNWKETLNTSSKEPLPLESLLSYLIRSPKPVILVDNTSNESIPEFY
                     PKFVENGISIATPNKKGFSSQLSLWKRIFSNKSTNGLVYHEATVGAGLPIIGTLNDMV
                     NTGDQVQKIEGIFSGTLSYIFNEFSTVEPNSVQFSDVVKKAKDLGYTEPDPRDDLNGL
                     DVARKVTILARLSGLEVESPTSFPVQSLIPKPLESVASADEFLAKLPQYDSDLTKLKE
                     EAAKENKVLRFIGKVDVASKQVSVGIEKYDASHPFASLKGSDNVVSINTQRYPNPLVI
                     QGAGAGAEVTAAGVVADVIKIAERIQA"
     gene            complement(<685232..>690220)
                     /locus_tag="ZYRO0B08778g"
                     /db_xref="GeneID:8202484"
     mRNA            complement(<685232..>690220)
                     /locus_tag="ZYRO0B08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495287.1"
                     /db_xref="GeneID:8202484"
     CDS             complement(685232..690220)
                     /locus_tag="ZYRO0B08778g"
                     /note="similar to uniprot|P47171 Saccharomyces cerevisiae
                     YJR140C HIR3 Transcriptional corepressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495332.1"
                     /db_xref="GeneID:8202484"
                     /db_xref="UniProtKB/TrEMBL:C5DRI8"
                     /translation="MSAFNALNITPHDEQLEAEEHSRELEIEECFKIFQSALFELKTK
                     RYKEADSKFEELLSRDVIKPDKWGVYYYSSPTLDRLRYLSYRNRGMYHYSYLLDHRSS
                     ISSQDIVDCIIKVIENLLESIQHNDADSTVTELLIQIFQSYKSKRLERMVLEYELTRS
                     ENNLLLLGRKKRSILPKLRQIIGQYSDLLQEIRDNEPTRTNMKLLQNLAHPKQLPELN
                     SVLLQIRDMKTQDEHIMKELDVLEVTLESFTWEALAESLKGLLPQTKSTNLLNKSLDP
                     YADLEEPIEGIKFVLAQNDKVEPEPENNKPEEETIKEQITPSLDNTNDVKEQEPVAEK
                     EAQELDTSTNKRPIDQVESSKPAQRSSKRFKDKDQEVSENETSITNHVAFLEELASLL
                     ELLGYEPSSDQWKSLLEAQSDTNEEHLPHRDLLDCLKDWSSWHTDIFAQNDSGSNNTV
                     SNGGDTLQLNALLKSNVFADKDNDVNPLEDLPEEKLSSFINAINETPIHFQEVRFRFL
                     HMLLTNGGQGEQRPIIDCSWSRPLFQAVEWLFLSIEQNLFEFACNNHDSCAYLALSLY
                     ELLVNMMGGICEEISSKKLQGHRTTELKTQRNKLVIKHDKWLDLLRSYHKVSTKWNLH
                     FQWAHYCFLQYTCEVFDDQLPSNLYMIEEMLNELHEPFDAVYPNYRYIPRLNLSSLHS
                     QIRKISIIRRISVVDIANEEAKTEDTDQNMDILERILLQSVQPGKEVLPEDQEMLSFI
                     QNSPFLLKLKLWEALFSYYVKNQNVVSAMNCYFYVLKLLSNIVLSDRYSQQAEKQRHQ
                     ILLTVLITVGNFTSKFIKLLSDSNWSNLRISEVPESEQLLVKFFILFNSVLYFENRKD
                     LFGRSFFRKAAKSSAKVKDIIANLTTLLIYFFDSELSSKRPEQRGYLMSNFIWSSHSL
                     LGSFGFCDASNGNFLKLSEHLLCQFIDQESLVQLKQILWCRYHYIIAGDNFTPEQHRT
                     RAIEMDKRNSLPLGIYLIKLQYQGKNPLLASGNKASLKPVLDNIIELVGDPISLGNHV
                     VARNKYLIEEYLDSPLTANILRKAFKGGGQLALTTPRDELQEATDAGLFYVSSIQAFN
                     LYRIRKKSMQARPSELDYIVAMLKNDILYNTQRFESWLLLGQCFAFMVEDDLIWTSDK
                     LSVPEKKYCTAQTQRQAILCYIMSVAIYYDKPLKTADDNLIIQKAFEALGSEMMSGYL
                     KPMEKLCYFGSLSGPLLKLDEEGEIIKQDQFSMRTISDFNVEQAILFSFQQAINFENG
                     DDTNEGVNSSKWIYYYNIGRFLFKIARTEHGMVASKNLLKSCRLASSVSSHKDPIIEP
                     HYSFINICYKLVKNDTLSPHKALSLVSKDKDFFEEDDQFWQMDNSLAEDYQKKFFYQK
                     VVKLLHFLLSVDRKKWHHRPRYRIAKIHFEDFDDVDTAITEIEIVMSVKSAHKNLVNI
                     WKPDFERPGKHFVYTYQYVMFYLDLLFCKNDFNSIGRVCKKIRRFGSGMAYVNKAIEH
                     ALMLYTQCTRSKLQLNEKECVEHLMPSLNYQVFLKVSEDLQNGFSEENYSEELLSGLK
                     IAYQLKKGNNGIAFDGICISIYFKYFYLPVAPIDVEPDASINGQDQDREDTATHAPSQ
                     TPEPPVNQGPKPVTQSTNGQPMSNKFSIPRKRVSKKDAFDRIRLLVEKITCN"
     gene            <690324..>691421
                     /locus_tag="ZYRO0B08800g"
                     /db_xref="GeneID:8202485"
     mRNA            <690324..>691421
                     /locus_tag="ZYRO0B08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495288.1"
                     /db_xref="GeneID:8202485"
     CDS             690324..691421
                     /locus_tag="ZYRO0B08800g"
                     /note="similar to uniprot|P47172 Saccharomyces cerevisiae
                     YJR141W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495333.1"
                     /db_xref="GeneID:8202485"
                     /db_xref="InterPro:IPR019193"
                     /db_xref="UniProtKB/TrEMBL:C5DRI9"
                     /translation="MSFIRTIQETGTMADSIRFLVEFLPRIGTTSVVLDGIKEPSLKY
                     SDSGKITVQDGRGERLDIALPYNPGKVNSKRLVKVGGSDRDEYLLTLKSEDVPMDKSR
                     NDVLMMPQMKWSKRQLNGLKNFKLCCIQCDMDIIDHDNCFRLNEMPSEFWMELMDYWH
                     CHKPQDKTSEFYSLQKNSLSPCLNEILIGDSFFQALEDTFAGRTTVVDENIAMCSNCK
                     KPLGRRTSDRMLRIPKWQLRLKSDGVCDDVFPAESEIISILLNCNRANSTRYILLRSG
                     NTQLYIWLFSMGIEVTLANGKSLHNCLKIFYSDVIPSNVGFKANIDEEQVDKVPLDKF
                     VDALETTNSILPSSKQRFGTWKISYLSAAVE"
     gene            complement(<691397..>692545)
                     /locus_tag="ZYRO0B08822g"
                     /db_xref="GeneID:8202486"
     mRNA            complement(<691397..>692545)
                     /locus_tag="ZYRO0B08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495289.1"
                     /db_xref="GeneID:8202486"
     CDS             complement(691397..692545)
                     /locus_tag="ZYRO0B08822g"
                     /note="similar to uniprot|P38698 Saccharomyces cerevisiae
                     YHR201C PPX1 Exopolyphosphatase hydrolyzes inorganic
                     polyphosphate (poly P) into Pi residues located in the
                     cytosol plasma membrane and mitochondrial matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495334.1"
                     /db_xref="GeneID:8202486"
                     /db_xref="GOA:C5DRJ0"
                     /db_xref="InterPro:IPR001667"
                     /db_xref="InterPro:IPR004097"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ0"
                     /translation="MTTTIKSFLQFLKNDHLCNLTPSSALRVVFGNEAADFDSVVSTL
                     TYAFCSYQKDPANPLVPIINIPRAELPLRRDVMRSLNRLNVTEDLLFFNEEFKRYKTL
                     CGSVNAILVDHNEVEMNSRALVNIVTGIIDHHKDQKLHLEAHPRIVQTTGSCSSLVFN
                     YWRDIILKSESEGFKEVALLSLGAALLDTSNFRYKVEAPDLEALKYYESILSDIDREE
                     YYKQLKSDKDDLEGMHIKDIFKKDYKEFTFEQDPHKIKVGIASVGKPLEWLNKQCGTV
                     DVFNSECIEAQKERNLDIFVVMTAWQDGSEFKREILVISPVKDHSERIMNKISSELKL
                     ESTDQINTASLDHHSYYFNAFNQLNVLASRKQVVPLLGDAFHSTAADK"
     gene            <692620..>693753
                     /locus_tag="ZYRO0B08844g"
                     /db_xref="GeneID:8202487"
     mRNA            <692620..>693753
                     /locus_tag="ZYRO0B08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495290.1"
                     /db_xref="GeneID:8202487"
     CDS             692620..693753
                     /locus_tag="ZYRO0B08844g"
                     /note="similar to uniprot|P47173 Saccharomyces cerevisiae
                     YJR142W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495335.1"
                     /db_xref="GeneID:8202487"
                     /db_xref="GOA:C5DRJ1"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ1"
                     /translation="MIEKYKFAFSIILYNATKLTQATERMVKAVQCQGKEVLLRTAED
                     DKNNFSFLNVMDRVDQFPDEYEEDKQFKEEVLYLTSHDNIRIGFTLLFAVKEMLRCCG
                     QELFDGTFTIKQNEGSLAELKFNDDKVDIRNAKIDRIARILYEKSELKEIKGWRDEKY
                     AVYVHGSPYVLVERAMAGVLGIVTYGIHVNGYLIDTKTNGIKFWIPRRSATKPTWPLM
                     LDNIIAGGIGYPHGINDTVIKESMEEANLSKTDIERRIRAAGVLSYFYFPQRFDQVNF
                     DSESAYIVGEVEYIFDLALSEDVVPKPNDGEVDSFNLLTLQETIDAIARKEFKPNCAL
                     VMTDFLIRHGYITSENEPNFLELVNRMHRKLPFPQPNFYGHKS"
     gene            complement(<693861..>696164)
                     /locus_tag="ZYRO0B08866g"
                     /db_xref="GeneID:8202488"
     mRNA            complement(<693861..>696164)
                     /locus_tag="ZYRO0B08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495291.1"
                     /db_xref="GeneID:8202488"
     CDS             complement(693861..696164)
                     /locus_tag="ZYRO0B08866g"
                     /note="similar to uniprot|P46971 Saccharomyces cerevisiae
                     YJR143C PMT4 Transfers mannose residues from dolichyl
                     phosphate-D-mannose to specific serine/threonine residues
                     of proteins in the secretory pathway dolichyl
                     phosphate-D-mannose:protein O-D-mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495336.1"
                     /db_xref="GeneID:8202488"
                     /db_xref="GOA:C5DRJ2"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ2"
                     /translation="MGSKKKDQTTVSGGNNTKNSDTASISKSKPSTPSSSGFSFSTEK
                     WLLRDPPDAANCYRFWLWAVTGLAFCARFYKIWYPKEVVFDEVHFGKFASYYLERSFF
                     FDVHPPLAKMLIAFIGFLSGYDGSFKFDEIGHSYVQNPAPFLQYRCFNAFLGTITVPL
                     LFNTLKEFNFKAITCAFGALLVAIDNAHVTETRLILLDAFLNFTVALSVYTYVKFYKA
                     QLTSPFSLKWNLWLYATGLSLSLVISTKYVGVLTYAMIGSAVAINLWQLLDVRAGLTI
                     RQFASHVVKRLNGFIFAPFLVYLFWFWVHFAILTKSGSGDNFMSGEFQETLGDSPLAK
                     ESRQVNYHDIITLRHRDTNGLLHSHLSRYPQRYEDGRISSQGQQVTCYFYEDANNQWE
                     IVPVKELPSPSGQPLLLNEAFRLRHVMTNSYLLTHDVASPYYPTNEEVVTVSEEEANG
                     ADYQQTLFMFQGLSKRDAGSIVKSKGTFFRIFHVDTAVALWTHNDVLLPEWGFNQQEV
                     NGNKKVTDPDNNWFVDTIVNIDEERKAYVPREVKTLPFFTKWAELQRLMFEHNNKLSA
                     DHPFASQPYSWPGSMNGVSFWTKDSERKQIFFIGNIIGWWLQVISLATYIGIVIADLI
                     SRQRAYYALGRITREKIYGPLMYFFVGWGCHYFPFYLMGRQRFLHHYLPAQLIASMFT
                     AALWEVIFSDCKSLDPEKDEEQPNTNYNNTPEVKTKVLYIFFGIMAVAIVWCFWFFSP
                     FVYGDVTLTPQQVVARKWLNMELNFAK"
     gene            <697087..>697842
                     /locus_tag="ZYRO0B08888g"
                     /db_xref="GeneID:8202489"
     mRNA            <697087..>697842
                     /locus_tag="ZYRO0B08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495292.1"
                     /db_xref="GeneID:8202489"
     CDS             697087..697842
                     /locus_tag="ZYRO0B08888g"
                     /note="similar to uniprot|P32787 Saccharomyces cerevisiae
                     YJR144W MGM101 Protein involved in mitochondrial genome
                     maintenance component of the mitochondrial nucleoid
                     required for the repair of oxidative mtDNA damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495337.1"
                     /db_xref="GeneID:8202489"
                     /db_xref="GOA:C5DRJ3"
                     /db_xref="InterPro:IPR009446"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ3"
                     /translation="MSLPLLSLRRFNARGAMRLRMVRWIGFERPPPPPPAPPHSHAGP
                     LRSNPSLASANSNKPLEQGLGGKPLEGENPIGSSRTVDWSTSWHGFGAKPFADEVQKK
                     LSETLGPLDIEIKPDGMIYLPEIKYRRILNKAFGAGGWGLVPRSQTIVTPKLVTREYG
                     LVCHNQLVSVARGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKKFK
                     TENCVEKFVEHVTTKKKKKIWLRKDRQVEYPYK"
     gene            <698409..>700400
                     /locus_tag="ZYRO0B08910g"
                     /db_xref="GeneID:8202490"
     mRNA            <698409..>700400
                     /locus_tag="ZYRO0B08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495293.1"
                     /db_xref="GeneID:8202490"
     CDS             698409..700400
                     /locus_tag="ZYRO0B08910g"
                     /note="similar to uniprot|P43606 Saccharomyces cerevisiae
                     YFR029W PTR3 Component of the SPS plasma membrane amino
                     acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
                     external amino acid concentration and transmits
                     intracellular signals that result in regulation of
                     expression of amino acid permease genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495338.1"
                     /db_xref="GeneID:8202490"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ4"
                     /translation="MNPDEIINDIRQSLVLPKEILSLHRNEITDDYNIKVRSGLVDDS
                     SMLSCGCCISENLYTKLQALMGGSGIRCPNCQSVDVTMVGAVQPLRNISSLLQLYQRN
                     PRESGNDFGQSIHSDKLTTDDSATTHKSLLIPENASLAATGIPSQYESSRSENFGRSP
                     NKQYSLLSLFHAVATRLNNESLENSSSTDPMNQPPVGMALEGNDRELGSAEDLKVLDN
                     ASNTRTIPVSQDSATGSIKNDLQNLTVSVSTNEEKEYYFAKCFPVYRRRTQFNTHQKF
                     LKTKSKLFVNMAISPDCTKFALVTEHSWEVYDIPKEISKQNPTLLFCGKSTGEYGPDF
                     DNLRYPEDKQVLLSKGEKSQNGSWEHYYCKLSNDFLVISGTKRRLRIFDLNQGGQPVY
                     SYLSSFPIRCIDIDPNSNLLACGITGKDRNTGSEQALIAFHSITRNKVTSEPEFLSPF
                     TITLPYRDPINTIQFSNDGLYLSCSTALESRFLVISLRKVNEPRLVMKSLRSIDTSME
                     SEGITDTKLFPGNPNLMCVTSMAFNSPPIVINTKIQNMEGLQSVAQPTMLMRLDELGS
                     KIHKCEISPRNDSIAFLERNGSVYIIFAPTMMDNEKRRIVLVDMVANAYRAKESAALR
                     FSPDGHKLFVLDRKGILYVEDFSYGLPQGHEVTKCKQIN"
     gene            complement(<700461..>701660)
                     /locus_tag="ZYRO0B08932g"
                     /db_xref="GeneID:8202491"
     mRNA            complement(<700461..>701660)
                     /locus_tag="ZYRO0B08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495294.1"
                     /db_xref="GeneID:8202491"
     CDS             complement(700461..701660)
                     /locus_tag="ZYRO0B08932g"
                     /note="similar to uniprot|P47051 Saccharomyces cerevisiae
                     YJL046W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495339.1"
                     /db_xref="GeneID:8202491"
                     /db_xref="GOA:C5DRJ5"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004562"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ5"
                     /translation="MSLFASRGLRLGLPLRLSLQCRRRLVQQTPFDLDEGEDEKYRSL
                     NNMYVDMFTQKNGEKASANVGEARNPVNELDEVNQEIDQLYNVGYDSVTALELENLVK
                     SEGRFVLQSLSTDPYYNLALEDYVFRHTPINDNFSSHRLLFYKNDNCVVIGKNQTVWK
                     EVFLNNLVHRGYEFIRRLSGGGAVVHDLGNVNYSFITSRKEFDREFFNKLIVKWLTNK
                     YPEMALHLNSRGDITLNGDKVSGSAFKIAKGKAYHHGTMLIHSNLQNFKGLLKPDHID
                     GLTWSCNSVDSVRSKVTNMSLKSAQEFIDTCVAGFQNHFPLVNNMIPVYYCDQSVAIN
                     DDIQNTMSKLKSDEWKYLSGPNFRVNIDEGNHDISVQKGIIVDSTIPSTVGMSFEDFA
                     QDFPQLL"
     gene            <702154..>703002
                     /locus_tag="ZYRO0B08954g"
                     /db_xref="GeneID:8202492"
     mRNA            <702154..>703002
                     /locus_tag="ZYRO0B08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495295.1"
                     /db_xref="GeneID:8202492"
     CDS             702154..703002
                     /locus_tag="ZYRO0B08954g"
                     /note="similar to uniprot|P38336 Saccharomyces cerevisiae
                     YBR257W POP4 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends binds to the RPR1 RNA subunit
                     in Rnase P"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495340.1"
                     /db_xref="GeneID:8202492"
                     /db_xref="GOA:C5DRJ6"
                     /db_xref="InterPro:IPR002730"
                     /db_xref="InterPro:IPR016848"
                     /db_xref="InterPro:IPR023534"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ6"
                     /translation="MDRTQQFIKECLFTKNFEDPNKPISDNRLQETLLILPTDGGVHQ
                     SLRRNKSKLKVTIGTVAEADAAAASSIKHPNYRKITKNARVALKDYINRCKSSVRNAK
                     RIAREQNITEKNTLMDYLKVNHPKVWEDLPNFDKFKPMHEQLWIGYIKEMLNIPVEVR
                     DTSKFNINRSQALFKLSMADYNGSFLKIVKSVNKNMIGIEGIVIWDSQKNFIMMTEGA
                     LVDEIKCIPKKGTIFALEIPLNDEDALQFSILGDRFKYRSSDRAGRKFKARRVDDMLY
                     YADPSF"
     gene            complement(<702981..>703391)
                     /locus_tag="ZYRO0B08976g"
                     /db_xref="GeneID:8202493"
     mRNA            complement(<702981..>703391)
                     /locus_tag="ZYRO0B08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495296.1"
                     /db_xref="GeneID:8202493"
     CDS             complement(702981..703391)
                     /locus_tag="ZYRO0B08976g"
                     /note="similar to uniprot|P38337 Saccharomyces cerevisiae
                     YBR258C SHG1 Subunit of the COMPASS complex which
                     methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495341.1"
                     /db_xref="GeneID:8202493"
                     /db_xref="InterPro:IPR007870"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ7"
                     /translation="MTDYNADDARKLADEFKREGYFDQLKRDILTQKHDNDELPLEQS
                     IRNNVASVVRKMVTDDENLIFKNRGSTSALIEAQLFKQGYKRLGEGEDGIQLEEYLNK
                     VLNDSELTQGIKDKLNGLRPTDGGNESIQNDGSA"
     gene            <703503..>705263
                     /locus_tag="ZYRO0B08998g"
                     /db_xref="GeneID:8202494"
     mRNA            <703503..>705263
                     /locus_tag="ZYRO0B08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495297.1"
                     /db_xref="GeneID:8202494"
     CDS             703503..705263
                     /locus_tag="ZYRO0B08998g"
                     /note="some similarities with uniprot|P38338 Saccharomyces
                     cerevisiae YBR259W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495342.1"
                     /db_xref="GeneID:8202494"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ8"
                     /translation="MALDVEEAISSYKQLLRRYLRSTNRIQWRRTAQELDYLARYAID
                     NRDGTTVEFFEGQLYEVLSPCNFSPYISLEHYRNFVTFYNGFFTKLQYLKGHIGDEWL
                     KSCKVKYLSLAIDGLPLLLNRCCDDYIFKDENCLHDGTCIFECIRYYESSLRSKYEDP
                     PSKLTGFDEELICRVVNWVSKYEKDFGRIYVMWKKTEEFLKSYGSDMLLNSPAFQLFS
                     DNRHLLVPKTLENYILPPDTVFSVYGRGGCDGSYEFDSHDVEHYYSNKGLHWEQDFDL
                     LLRKVILVDDFRCARLWQRSTLRRQFEQSLSNVDEFHVELFNYMHEKFQSNYDAIRKS
                     PHKTLSKLEEIWINALSTFLIHYLVSLDDFMHLILRKSILPQILALCGRFKPFYQHKA
                     CLERRVFDNVCKTAPGSVLEFKESIDWILASPIDSNKINGNGPIIEKVFMSSQIAEQF
                     NLSSEGEPIWPNQDFKDCWNEQLESFSSEGKTLHGCFSKHLIIMKLPIPSSNTNRITL
                     ITNLSIAGILNLYNDDARLTMDEIRMKLAIDESKEPILQENLQKLLSFGLIVLTRDSF
                     YIFNYKFKKTSSSEKFLKLV"
     gene            <705472..>707814
                     /locus_tag="ZYRO0B09020g"
                     /db_xref="GeneID:8202495"
     mRNA            <705472..>707814
                     /locus_tag="ZYRO0B09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495298.1"
                     /db_xref="GeneID:8202495"
     CDS             705472..707814
                     /locus_tag="ZYRO0B09020g"
                     /note="weakly similar to uniprot|P47050 Saccharomyces
                     cerevisiae YJL047C RTT101 Cullin family member subunit of
                     a complex containing ubiquitin ligase activity binds HRT1
                     and is modified by the ubiquitin like protein RUB1
                     Regulator of Ty1 Transposition Regulator of Ty1
                     Transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495343.1"
                     /db_xref="GeneID:8202495"
                     /db_xref="GOA:C5DRJ9"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:C5DRJ9"
                     /translation="MMESSHFLEDHQAAYRTLNDQLDKVFEMANGVCRQLTNLDAKVQ
                     PADEIIDLYAHYENCDRIMRSLTQLKVYEPVENDEYSGSSSGGGRKRLQLVNQSKFIS
                     NLCEMLFMKLNTFTDDYVKHILNLIGDLDSTYNLQRLMLYWKHISSIYRESTIMLTEL
                     YEYVRHNFPQVKRNLDTFADITTMLLINFFQSHMGSKFVNLIEVFVNNGRSENHLDTK
                     ISGSFLKKLYHHNVLIDKDRDQHFQDFYFEYLSKYVENKVVIPMNIDYMKNLKKQLEL
                     NAKLTLSISPTMIEKANDIFLQHTILKAETASQLMEVEKDNIKFYSVKAPERYFPFPK
                     ENFSLLKIAFESRGRTMELERVFKKLSRKLLKRAHPDLERLFSEACKLILLVSGYPNF
                     GAISREEITKILGGPLNTMELYVRFCESSIRKVNRDKNLRDHYVGSPSIFQAPILLEI
                     NAAVLDLYSRSLFRRAIMQGANSVLKSLKDPDSLEFQLINFFRDIYGTSSEFRNLEAT
                     TEIVLKAFYLNSSFEQSSSNKNKFIQPLVFEKKMVPEIYQRGDNEDIVLPPELVESWE
                     EFMKHFNSTDKKPELKKVHPVHHLQHCEVSTPYKLKSGKGLSLELTLYQTCLLSLFND
                     YEELEFNEIMSKLRMTKSTLDVVLKSFTDVGLLILQGNTKYTLNKNYSPDKRKIKDGK
                     LRIPLLRPISSSGRSDSNGSVVISSQHHEGHSSQWKQELLKACIVRSLKGESNGLNLP
                     ELFNKVESQLRGISIGEFKDALDKILKDRFIRYRNDRYLY"
     gene            complement(<708008..>710032)
                     /locus_tag="ZYRO0B09042g"
                     /db_xref="GeneID:8202496"
     mRNA            complement(<708008..>710032)
                     /locus_tag="ZYRO0B09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495299.1"
                     /db_xref="GeneID:8202496"
     CDS             complement(708008..710032)
                     /locus_tag="ZYRO0B09042g"
                     /note="similar to uniprot|P38339 Saccharomyces cerevisiae
                     YBR260C RGD1 GTPase-activating protein (RhoGAP) for Rho3p
                     and Rho4p possibly involved in control of actin
                     cytoskeleton organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495344.1"
                     /db_xref="GeneID:8202496"
                     /db_xref="GOA:C5DRK0"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5DRK0"
                     /translation="MVASSSSGRDKVSKGDKPQDIQLLDKQEIQNVLNSDVAINALLG
                     RLKQSLLTCEEFIKFLRKKVFFEQEHVEELGKQFKHFFMDTTNSSPSLKRRIHDILEY
                     DGKLAKVKKSYVSALQKMYDEMSALLFTMTKMRKSVKENSRRLEKEVSDAIHTAEKSQ
                     SRYNSLCQDWDKLRLSDPTKTKLTLRGSKTTKEQEEELLRKIDTADLEYKQKVDHSTS
                     LRATFINKERPKIVSELKDLILETDTALSIQLQKYTIWTENLILNSGVTVAPMEASKS
                     MRSVASSVTNAKDLYLYLNKYNSSGKTGAMVNKNLIPVNYKKHPSMIKISGPSPSTNT
                     NSLSKTTTPSFSVDTGKSSKNKKTLESPHTQSNTSNLGASTSSTKTAASTSGAALGAA
                     AGAAANTTPHVVNSASSKEQEKDKGLLLEEPPNDFKTLDPGNSNAARIPSVATDLTMA
                     TSESDRPLSQVQTNTSMPPGTQKNFKTFGVPLETLVEYEQDMVPAIVRQCIYVIDKYG
                     LDLEGIYRKTANITEMSKLKEEIDKEPDNIAMILPSKNYKEDDIYLVASLLKAFFASL
                     PDTLLPAEITEDVKSCLSIPDEKTRRNFMHGLIYKLPDAQYWTLRALLFHLKRVVSHE
                     PINRMGTKQLFIIWGPTLISPHDEEPNDVGFQIKTMEVLYDVADQAFEQD"
     gene            710942..711086
                     /gene="SNR60"
                     /locus_tag="ZYRO0B09064r"
                     /db_xref="GeneID:8202497"
     ncRNA           710942..711086
                     /ncRNA_class="snoRNA"
                     /gene="SNR60"
                     /locus_tag="ZYRO0B09064r"
                     /product="snR60"
                     /note="C/D snoRNA monocistronic SNR60"
                     /transcript_id="XR_002648387.1"
                     /db_xref="GeneID:8202497"
     gene            complement(<711111..>711809)
                     /locus_tag="ZYRO0B09086g"
                     /db_xref="GeneID:8202854"
     mRNA            complement(<711111..>711809)
                     /locus_tag="ZYRO0B09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495300.1"
                     /db_xref="GeneID:8202854"
     CDS             complement(711111..711809)
                     /locus_tag="ZYRO0B09086g"
                     /note="uniprot|Q9UVE4 Zygosaccharomyces rouxii
                     Hypothetical protein highly similar to YBR261C
                     uniprot|P38340 Saccharomyces cerevisiae YBR261C Putative
                     S-adenosylmethionine-dependent methyltransferase of the
                     seven beta-strand family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495345.1"
                     /db_xref="GeneID:8202854"
                     /db_xref="GOA:C5DRK1"
                     /db_xref="InterPro:IPR008576"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DRK1"
                     /translation="MSQDKPDSHINYNDAIEYWSQTPATVNGVLGGYGEQTVVPTMDV
                     LGSSHFLRKLKSRMVVEPGYKKISADIGAGIGRVTKNFLSKHCDVVDLVEPVGPFVDQ
                     MQTELKELIQENKIGQIYDVGMQDWNPQDGKYWLIWCQWCVGHLPDEELIEFFKRCIK
                     GLQPNGTIIVKENNTPTDCDDFDPEDSSVTRSDSKLKQVFEQSGLKLIATDRQKGLPQ
                     ELYPVRMYALKPKN"
     gene            complement(<712017..>712310)
                     /locus_tag="ZYRO0B09108g"
                     /db_xref="GeneID:8202498"
     mRNA            complement(<712017..>712310)
                     /locus_tag="ZYRO0B09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495301.1"
                     /db_xref="GeneID:8202498"
     CDS             complement(712017..712310)
                     /locus_tag="ZYRO0B09108g"
                     /note="uniprot|Q9UVE5 Zygosaccharomyces rouxii
                     Hypothetical protein similar to YBR262C uniprot|P38341
                     Saccharomyces cerevisiae YBR262C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495346.1"
                     /db_xref="GeneID:8202498"
                     /db_xref="GOA:C5DRK2"
                     /translation="MSKLIKLTSITAVSSTLAASYYFYFVDRDGFHYQNSQWKKIGDK
                     VQGIIDGSENINPSTPSNSNQVIVVKRPMTETMKDLWNEQIRNTANWFYSWGK"
     gene            <713092..>714579
                     /locus_tag="ZYRO0B09130g"
                     /db_xref="GeneID:8202499"
     mRNA            <713092..>714579
                     /locus_tag="ZYRO0B09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495302.1"
                     /db_xref="GeneID:8202499"
     CDS             713092..714579
                     /locus_tag="ZYRO0B09130g"
                     /note="highly similar to gnl|GLV|KLLA0F01210g
                     Kluyveromyces lactis KLLA0F01210g and similar to YBR263W
                     uniprot|P37292 Saccharomyces cerevisiae YBR263W SHM1
                     Serine hydroxymethyltransferase mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495347.1"
                     /db_xref="GeneID:8202499"
                     /db_xref="GOA:C5DRK3"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:C5DRK3"
                     /translation="MLSRLARNTTSVRLLSTRSVLASAAASKNQLLLSKHVQEVDPEI
                     HQILKDERHRQKHSITLIPSENFTSKSVMDLLGSEMQNKYSEGYPGERYYGGNEFIDK
                     AESLCQKRALEVFGLDPNEWGVNVQPLSGAPANLYTYSAILESGDRLMGLDLPDGGHL
                     SHGYQTASGTKISFISKYFQTMPYRVNPQTGLIDYDALESTSKLFRPKVIVAGASAYA
                     RALDYERFRKIADGCGAYLMSDMAHISGLVAAGVTESPFNYSDIVTTTTHKSLRGPRG
                     AIIFFRKGIRKVTKKGKEIPYELEKKINFSVFPGHQGGPHNHTISALAVALKQASTPE
                     FKQYQTEVVENARILGEELTKRGFKLVSGGTDTHLVLIDLSQLNIDGARLEAILERLN
                     IAANKNTIPGDKSALFPSGLRVGTPAMTTRGFGVAEFSKVAEYIDTAAKLAVVLKGEE
                     SPDNKDSRAKLANFKQLCRDSPDVESLAQEISQWVGQYPVPGELQ"
     gene            complement(<714608..>715279)
                     /locus_tag="ZYRO0B09152g"
                     /db_xref="GeneID:8202500"
     mRNA            complement(<714608..>715279)
                     /locus_tag="ZYRO0B09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495303.1"
                     /db_xref="GeneID:8202500"
     CDS             complement(714608..715279)
                     /locus_tag="ZYRO0B09152g"
                     /note="similar to uniprot|P36019 Saccharomyces cerevisiae
                     YNL093W YPT53 Involved in vacuolar protein sorting and
                     endocytosis GTP-binding protein of the rab family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495348.1"
                     /db_xref="GeneID:8202500"
                     /db_xref="GOA:C5DRK4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRK4"
                     /translation="MHRKVGSIFKLKGHSKNTRLHDMSSEAQEVYVANLKLVLLGESS
                     VGKTSIVTRYTTGNYQKTNATIGAAFFTKAINVPSEDGVVRKVNVEIWDTAGQERYRS
                     LTPVYYRNTDAAFIVFDVTKPESLEKAHSWIEELNEYCSSDRPENEINTIVVGNKIDL
                     DHGPFETDLQYVLVSAKTGEGIVKLFEKLAQSVLNEKYVREETLEDLPKDPFKMKRRK
                     ETCSC"
     gene            <715928..>720916
                     /locus_tag="ZYRO0B09174g"
                     /db_xref="GeneID:8202501"
     mRNA            <715928..>720916
                     /locus_tag="ZYRO0B09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495304.1"
                     /db_xref="GeneID:8202501"
     CDS             715928..720916
                     /locus_tag="ZYRO0B09174g"
                     /note="weakly similar to uniprot|P29539 Saccharomyces
                     cerevisiae YBR275C RIF1 Protein that binds to the Rap1p
                     C-terminus and acts synergistically with Rif2p to help
                     control telomere length and establish telomeric silencing
                     deletion results in telomere elongation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495349.1"
                     /db_xref="GeneID:8202501"
                     /db_xref="InterPro:IPR022031"
                     /db_xref="UniProtKB/TrEMBL:C5DRK5"
                     /translation="MSSSSNQSSEKRMRAIDRLDQHMMKRSMKNSKSSSPSGPFLPWL
                     SHKLPSNSQSDSNGSQNHEISSPSPKRRKTASLSPIRNVESTIDGPSNTFPIEARVVT
                     SVQSSPIKKTVAFSDRVESSPTQQTPRSSPRPSSLQKPVKSILRNTDALRKCVSDISF
                     KRPPFLNQNIDRNKTDRTAGIDPHRLDFWVGGEVHSMLDPYNVHEFFNIIDGGLRILS
                     EKTDECVVKRFEIYATFNNIMPPSSTKGLNDINERKVNVLIDQMEFIVNVCLPHLKEE
                     QQKLLSTGEKKDPFSLRLYVQIVRFFNFILSNFKLLKWLSNKPQLQTNIKSIYEFSIE
                     ALTHDNTNKVMVAAQVALLGDSKFGSFFLNDDEITSLIRIIPSIKEIQSTNLINEKLI
                     LIRSLIAKYPRLMIDQVSIWFCGEVLPRILIENELNSTKIVATAVSTTLDLLKKCLDF
                     SKGHEEIYRCVEVLFVKDVVPKKLLTKLTPSQDDNLDSIAQQTLGQLLRKQIRYLIVA
                     KQEYKLAMDLWLALTGLLYNNIDRLDYLSTHIDNEWLSLNLLCFHASSAQAKLLSIKV
                     WRVLTYSICTHLEHETVKNIRIVNLLQRPFEFTQQEQYEFNVMEGLIFHLTGIIYTAF
                     SGHSTISGEKFSLLWEHVVKPVYMRKIFPSTSIQLRNRAIVLLLRLLGSKVMEQQANQ
                     QHQQEKQQPHTHRNITKNGAHPIRVIASAGVSARDIQPLSANVIGTNFETIKDLIFEA
                     IRSNSSNLSQNSELITALLKQMPSKFVNENSLEDFAELIREISIQRKDDKNVGSHFVQ
                     LTCCLMSQFTPLLFEDRKNFEAYLRKFEFIFSVNPDTKVKLLKELIMGLRGKVPEFFL
                     IESFLEPQNGAIRKYVSNWIGSMLLSPTIPYEHFCSLVRIVNAVPTTEVLQNFLNLTS
                     KVPFEVDLFHLLNLKSWDDKELTLFLKNSIIKNLKPNRPELYSFLENILRENEQLFST
                     LLPLLCQLGHYEVLRLVLTHRPTFLSHTLGVDEESFDQILPLEKLSFFLKNLLNYETF
                     FQLRTIRWALKHNQINILFENSSVLQKCLFQQCTSSEDTMKKEKLLLDLLSVTVLGEK
                     WHYLSLLVIWCMENNEIGHLTTCFSKENLTPLIHLSPQALALMINKCGSLNPTLIEAV
                     KRSFFTNDTQFNIGLIEELIVHNKFQLFILCGKEIVTFFLDNSSSLSGVEQDGVLSIF
                     EKLLVSLMGQKKSLVLDFVEEISEKLPEAPDAYLLKIITILVEQLQVNGKKLKKENRF
                     SQALQRLVELHYNGIKNQSYEDHHENQERIRETQSSSENVPTPKGFNDPRISESPSEK
                     IQEINEVQVYATQEKHKVQNEPVKLSHQTEGQVSLVASEPSSDKKNRPILEEAVIDPR
                     SGRGLSSEDAIDVEDLEPESRRENSNMHSPDILTNNLETQISSNGKGSFLNGNGKALL
                     PYDAVRDARNRDINENEEHVFSRILGATEFRTFPKDEARETKEVREEKTDNLEERPQT
                     VKDDDAMASVENKDESQVLGIRIPIFNSSKLQNKPKSKDSVHENDLSERKRKRVDGND
                     EEGNDYDEHEVETAREVDPISTQPEDLASSPDNESTFLQDSRRSDWASQNSAPSLRLH
                     FPTRKSRKLVSKLRGFSLDDISRISLEEKRNLRIELLDFMMKLEHESLAEEL"
     gene            complement(<721019..>722569)
                     /locus_tag="ZYRO0B09196g"
                     /db_xref="GeneID:8202502"
     mRNA            complement(<721019..>722569)
                     /locus_tag="ZYRO0B09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495305.1"
                     /db_xref="GeneID:8202502"
     CDS             complement(721019..722569)
                     /locus_tag="ZYRO0B09196g"
                     /note="similar to uniprot|P38147 Saccharomyces cerevisiae
                     YBR274W CHK1 checkpoint kinase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495350.1"
                     /db_xref="GeneID:8202502"
                     /db_xref="GOA:C5DRK6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5DRK6"
                     /translation="MDSHLPAIKDVVLDDTIGHGTFAQVKSAHLEIDTSVIIAVKFVH
                     IPTCQKYGLSEKDVVGEVILQSKCCKHHNVLKVIDCNIAHDYLWIAMEMADGGDLFDK
                     IEPDVGVDSEVAQFYFQQLVSAVSYLHEDCGVAHRDIKPENLLLDKNGNLKLADFGLA
                     SKFRRKDGSKRLCYDQRGSPQYMAPEILHYDEYYADVTDIWSIGVLVFVILTGELPWD
                     LPVFEDENFRCFMENNGKLNVGPWAKIDFTHLNLLRKLLQPNPLERVTLKNIQRHPWF
                     NSKVTFADDRGLCKNPTILAKKLLSNLKISLTDDDYMKFTQTGYGSEGVISSTQPVKT
                     DIAAIEHDSANVEAFAFTQRLLSQYNVGAGPAMTQEPRWTQYLNKDIAFSQFRNDDPL
                     LPYGQQLFNPLKLTKFYTVEEMELVLPMLEKALRFANINVRPDLNGRFTDLCNKLGYN
                     GAFPLHMNLRTTDRRGANLHGFVSITLIEENLKCISFERKSGDPLEWRRLFKKIALFC
                     RELVLMPN"
     gene            <722807..>724204
                     /locus_tag="ZYRO0B09218g"
                     /db_xref="GeneID:8202503"
     mRNA            <722807..>724204
                     /locus_tag="ZYRO0B09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495306.1"
                     /db_xref="GeneID:8202503"
     CDS             722807..724204
                     /locus_tag="ZYRO0B09218g"
                     /note="similar to uniprot|P38349 Saccharomyces cerevisiae
                     YBR273C UBX7 UBX (ubiquitin regulatory X)
                     domain-containing protein that interacts with Cdc48p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495351.1"
                     /db_xref="GeneID:8202503"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DRK7"
                     /translation="MDGELFISSVEQAVSLSLGSQKSLVVYNGREEDDHGWLEKWLKN
                     NDLLGLLRDKAVWLKLRPGSEQFKYFEQLFPSVVVPSVYVIKQGQIAAVIQGPQASAN
                     QLAGALGVSLGGNGDDTGRSSSASGAGGAGGASGANSVNSVNTPSNGNSTANKSFKDE
                     VAETTQRKHLEEVKRQKQMAREERERILQLVQADRAERKAMEFHSDRNDDVHDNIKDL
                     NRLHAKTCVLMIRLTNSSTLTGHFDSKETLNNVRKWVDDHRTDGDCLYAFHRNIPRVT
                     FTDSEELKSLGDLQLLPRSVLILKPLENSYTNVAEAKGPGLLGKVFTGLSSWLSRGGG
                     GDSGDTRNADGPGSASNSNKSVNHSAKQDPRPENAEERDITGHSGIETSPHASFSNNE
                     ELTIDSPVSSRFESPVPHATDHHVISTSNPSDLNLPSRCVTPNVYQFINKDDDEKEKS
                     TYNGNTINLEKKDDD"
     gene            complement(<724267..>725523)
                     /locus_tag="ZYRO0B09240g"
                     /db_xref="GeneID:8202504"
     mRNA            complement(<724267..>725523)
                     /locus_tag="ZYRO0B09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495307.1"
                     /db_xref="GeneID:8202504"
     CDS             complement(724267..725523)
                     /locus_tag="ZYRO0B09240g"
                     /note="similar to uniprot|P47048 Saccharomyces cerevisiae
                     YJL049W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495352.1"
                     /db_xref="GeneID:8202504"
                     /db_xref="GOA:C5DRK8"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DRK8"
                     /translation="MELPSSRLGSLYKDFRPLKELNPDGYAANISTWKEYLKNRFLNR
                     KCLFTSGTELLQELSNDVYGFPKSLDVVIDTLVQEGYLISSDDFYGQRMYSKEYPKLM
                     QWIGLGKNRFFKSRRNEDGYYLKELQLIVKSNVEVKFKSIASRINDRIIKSATGITDL
                     VMPLEEFFTKTGFHEIVDNDDDQEILLFYMAHYTGTIFKESNFIKIIDPTRDNKDLTE
                     NDRRIADLKLAISSVSKQVKKMQNEKMDYSKILTQSMRDGASRDTQRKFLQARKIAER
                     YLNRLLEYQNNLLEIKSQIEMSITNEILVTTLSDANETLKSVTKYSMSVEQVEGLLDE
                     LKDHREQNDEIGRMLSGTDEIIDEKELDAELESLDKKIEDQESTSEVLDRLSHLKLGE
                     TTEQTPVSETPRKEEANSKQLITEYD"
     gene            <725741..>726769
                     /locus_tag="ZYRO0B09262g"
                     /db_xref="GeneID:8202505"
     mRNA            <725741..>726769
                     /locus_tag="ZYRO0B09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495308.1"
                     /db_xref="GeneID:8202505"
     CDS             725741..726769
                     /locus_tag="ZYRO0B09262g"
                     /note="highly similar to uniprot|P40335 Saccharomyces
                     cerevisiae YJL053W PEP8 Vacuolar protein sorting protein
                     that forms part of the multimeric membrane-associated
                     retromer complex along with Vps35p Vps29p Vps17p and Vps5p
                     essential for endosome-to-Golgi retrograde protein
                     transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495353.1"
                     /db_xref="GeneID:8202505"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR028934"
                     /db_xref="UniProtKB/TrEMBL:C5DRK9"
                     /translation="MSLFFKSPLDIEVLLDGEESRKHVEVPNNTASDTKALRDRLPLY
                     EDGESISGIVTLRVKEGKRVEHLGVKVSVIGSIDMIRTHGNGNGGSSKRLTNSSSGLS
                     DARKNSVEQFLCFSYDLCPAGELQHSQSYNFMFKDLAKRHESYRGKNVDVSYYVKVTV
                     IRKAADITKLKKFWVYLYNNVSLPPTSVVNQRQIENGEENGLVRNEPKPVKLDIGIEN
                     CLHIEFEYSKSQYSLKEVIVGRIYFLLTRLKIKHMELSLIARESSGLQPSNYLIDSTV
                     IRYEIMDGSPVKGDTIPIRLFLGGYELTPDMSCNYFNIKNYLSLVIIDEDGRRYFKQS
                     EIVLYRSR"
     gene            <727287..>729701
                     /locus_tag="ZYRO0B09284g"
                     /db_xref="GeneID:8202506"
     mRNA            <727287..>729701
                     /locus_tag="ZYRO0B09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495309.1"
                     /db_xref="GeneID:8202506"
     CDS             727287..729701
                     /locus_tag="ZYRO0B09284g"
                     /note="weakly similar to uniprot|P47046 Saccharomyces
                     cerevisiae YJL051W Protein of unknown function localized
                     to the bud tip mRNA is targeted to the bud via the mRNA
                     transport system involving She2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495354.1"
                     /db_xref="GeneID:8202506"
                     /db_xref="UniProtKB/TrEMBL:C5DRL0"
                     /translation="MYRSVHRAFYQIPLVLFSSLISFTVGSLCIALVATYHQEETVLI
                     VIACSTILYGISSLPLTLILRNAHSQFLFLKFPCILFQLTTLGASIEYFNRTTKRAIE
                     NDTYRHKNLLIGLDSLLLCSFLANGFALGCTRGPVGDLQETKDLESHEPKAFVTNLDD
                     KIEQYVPMKHSAQTLIPEIDALRNLRQTPSWNVGQDSAMQLRGTESMSSVVQHKLQSM
                     DLPRAATSEDNTKAKLPNLKALMTSPKLKRSFVFKFNSPKALTRRNGLGLRKRKNSTL
                     WERENGNRSVSSRNMGRLSTIPDLSHSVLNYSGTSLNSKSGHRFDKSADSVVDPSHFR
                     GLRKRASSAPTIELERNAIERINSALLPPCLKISEPLTASSSVPMLDFPLRALSPVTS
                     DVSADNSIERNDLEDIPQVPQLPDETASNFLAEQDKPNMDIPLNVTLDTWEKNKENFL
                     KRAATMQEHNNRSGCNNNGNLLPALQFESEQKPPVLEIPDLQTKDNFSFPVQKPLEVQ
                     TKFEDNNYDTISALEQYFSDIDEEEQREGINIEDGFQYHNKSPSFHSQRFSKDLQRNS
                     IKHSPTKSLISMISGRESLGGHQRSQTLLVNNNINNNNSDGSPTKSSPSRSQRLKRMG
                     KKLSLSNISDTMINITGNTENGNEFRSPFKDGRVRGKSVDFSYIYNLQSNHSPTKSTS
                     GISSNHGSIYKDRRNSVATEKSMGKGVSGFQLANANATSNATSNANANTNANTTADAK
                     VAEAIVECRTPPPPNRIPSTESSQVSAASTTNYPDIVMSEYDRERWNTLLSLQLINSK
                     GQFNTG"
     gene            <730191..>733388
                     /locus_tag="ZYRO0B09306g"
                     /db_xref="GeneID:8202507"
     mRNA            <730191..>733388
                     /locus_tag="ZYRO0B09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495310.1"
                     /db_xref="GeneID:8202507"
     CDS             730191..733388
                     /locus_tag="ZYRO0B09306g"
                     /note="highly similar to uniprot|P47047 Saccharomyces
                     cerevisiae YJL050W MTR4 Dead-box family ATP dependent
                     helicase required for mRNA export from the nucleus
                     co-factor of the exosome complex required for 3' end
                     formation of 5.8S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495355.1"
                     /db_xref="GeneID:8202507"
                     /db_xref="GOA:C5DRL1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011254"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR012961"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016438"
                     /db_xref="InterPro:IPR025696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRL1"
                     /translation="MSGGDLFDVFNEEPVQLPEVSEVPKIEDDKEDNKRPLETETDVE
                     DGQKSSKKAKGDKKKLSEEDKKKAVVPVVTDAFEQEASREVDPSAGLMNNVNEQLEKE
                     GRLKLMHQVRHQVALPPNYDYKPIGDHKRMNEARTYPFTLDPFQDTAISCIDRGESVL
                     VSAHTSAGKTVVAEYAIAQSLRDKQRVIYTSPIKALSNQKYRELLADFGDVGLMTGDI
                     TINPDAGCLVMTTEILRSMLYRGSEVMREVAWVVFDEVHYMRDKERGVVWEETIILLP
                     DKVHYVFLSATIPNAMEFAEWICKIHVQPCHIVYTDFRPTPLQHYLFPAHGDGIYLVV
                     DEKSTFREENFQKAMASISSQSGEDSGAVDSKGKKGQSFKGGASKGDSKGDIYKIVKM
                     IWKRRYNPVIIFSFSKRDCEELALKMSKLDFNNEDEKVALTKIFNNAVALLPETDREL
                     PQIVHLLPLLKRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTV
                     VFTSVRKWDGQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKG
                     QADRLDSAFHLGYNMILNLMRVEGISPEFMLESSFYQFQNVISVPIMEKKLAELVKEV
                     DSIHVDDEENVKDYYEIRQTLEGYNDDVRQVITHPANILSFLQPGRLVQVVIGGKYSY
                     GWGAVVEFVKRVNRRNPTAVYSDHESYIVNVVVNTMYADSPMNLVKPFNPNFPEGIRP
                     AQEGEKSICTIIPITLDSIRTVGNLRLFMPKDVKASGQKETVGKSLMEIQRRFEKGIP
                     LIDPMKNMKIEDDDFKKLLRKIEVLESKLFSNPIAQSVRLKELYEKYSKKSALNNDIN
                     NLKHKITESQAVIQLDDLRRRKRVLRRLGFCTQNDVIELKGRVACDITSGDELLLTEM
                     IFNGNFNDLKPEQAAALLSCFSFQERCKEAPRLKPELAEPLKAMREAAAKIAKIMKDS
                     KLEIVEKDYVESFRHELMEVVYEWCRGANFTQICKMTDVYEGSLIRMFKRLEELVKEL
                     IDVSNTIGNSALREKMEAVANLIHRDIVSAGSLYL"
     gene            complement(<733488..>734936)
                     /locus_tag="ZYRO0B09328g"
                     /db_xref="GeneID:8202508"
     mRNA            complement(<733488..>734936)
                     /locus_tag="ZYRO0B09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495311.1"
                     /db_xref="GeneID:8202508"
     CDS             complement(733488..734936)
                     /locus_tag="ZYRO0B09328g"
                     /note="similar to uniprot|P38348 Saccharomyces cerevisiae
                     YBR272C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495356.1"
                     /db_xref="GeneID:8202508"
                     /db_xref="UniProtKB/TrEMBL:C5DRL2"
                     /translation="MSEKGISHTRELFDMLNTALEAAPLPTEINDLLEKGALDLSTHT
                     YSQEDPKRLLSNIKRILVEQNPDSQLDYDLLLQLLNNIISICSFEDVLATFTIDDLEM
                     ALTSSVAPLVVAACKVIAKSYPRGIFANSVICDILLKLFFDANVSISIVNSIEQTIAT
                     LSSDELIRRRVLVNNSPLLMAIRKQFEPISSARLLELLNIEAAYLTNSEFNEKLFVIR
                     SEEISKSLEVDIVMFIHITAYYTKLLEEVFTQGLSQTHPRKWLLKYILPIIPSFGKIY
                     EKREEFTDVKFFAKSYLFKLFRKVSYLDDESVFASLDRDYIHISKENEHINDFLSFVN
                     PEYLYNHYQSLIIELTSVVPSHLGILRNLIANERCFSLIKDQLTASAILAMPYMEQMV
                     LLQKLSQFSHSVHYLLEYLPKVMSSLLYNENGEVTETESANLRREILENLLKYDKDTL
                     NVWYSPVRDEYKRIVQGTSSNEAQVNLASSYL"
     gene            complement(<735165..>736433)
                     /locus_tag="ZYRO0B09350g"
                     /db_xref="GeneID:8202509"
     mRNA            complement(<735165..>736433)
                     /locus_tag="ZYRO0B09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495312.1"
                     /db_xref="GeneID:8202509"
     CDS             complement(735165..736433)
                     /locus_tag="ZYRO0B09350g"
                     /note="highly similar to uniprot|P23542 Saccharomyces
                     cerevisiae YLR027C AAT2 Cytosolic aspartate
                     aminotransferase involved in nitrogen metabolism localizes
                     to peroxisomes in oleate-grown cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495357.1"
                     /db_xref="GeneID:8202509"
                     /db_xref="GOA:C5DRL3"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DRL3"
                     /translation="MSQAILNNVEKLPADALFDIKQRFSKDPREVKVDLGIGAYRDEN
                     GKPWVLPSVRSAEKLVQEDPSYNHEYLGINGLPTLTSNAAKIILGEDSPALAEDRVIS
                     VQSLSGTGALHIAAKFISKFLPNRTLYLSNPTWANHHAIFQTQGVKTAIYSYWDSKTK
                     SLDLEGYLQSIKNAPNGSIFVLHACAHNPTGLDPNQEQWNQILDAIAAKDHIAIFDSA
                     YQGFASGDLNRDAFAVRLGIQKLSKVCPIFICQSFAKNIGLYGERVGCFHLVLPQQND
                     ASANLVSIKTAVSSQLSKMIRSEVSNSPAYGAKVAAKILSTPHLTEQWHKDMITMSSR
                     INKMRASLRDKLVSLKTPGTWDHIVGQCGMFSYTGLSPDMVERLESQHAVYLVSSGRI
                     SIAGLNDGNVDHVAKAIDEVVRNQAASSKF"
     gene            736663..736781
                     /locus_tag="ZYRO0B09372r"
                     /db_xref="GeneID:8202510"
     tRNA            join(736663..736700,736738..736781)
                     /locus_tag="ZYRO0B09372r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8202510"
     gene            complement(737078..737197)
                     /locus_tag="ZYRO0B09394r"
                     /db_xref="GeneID:8202511"
     tRNA            complement(join(737078..737121,737160..737197))
                     /locus_tag="ZYRO0B09394r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8202511"
     gene            <737365..>738285
                     /locus_tag="ZYRO0B09416g"
                     /db_xref="GeneID:8202512"
     mRNA            <737365..>738285
                     /locus_tag="ZYRO0B09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495313.1"
                     /db_xref="GeneID:8202512"
     CDS             737365..738285
                     /locus_tag="ZYRO0B09416g"
                     /note="similar to uniprot|P50947 Saccharomyces cerevisiae
                     YNL097C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495358.1"
                     /db_xref="GeneID:8202512"
                     /db_xref="GOA:C5DRL4"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="InterPro:IPR024610"
                     /db_xref="InterPro:IPR028651"
                     /db_xref="UniProtKB/TrEMBL:C5DRL4"
                     /translation="MSVPANLYAGLNDIVDVLEEFPVESSRYLTLLHEIDAKCVHSTP
                     QLNKEIDRFISKSNVSNASQNLANINQLFQELMPSLEEKMHVSSIMLESLQHLTSRLE
                     LDYEIAIKNQEIPSKLRVGVDNHPAMHLHYELMSKIDAKNHHAQGANNGGNGNGSRSS
                     QALKSESRREAMVANKKPLPIQDTPLMATTPDEDFKDDPNTKKRANIALPPRNVGPPD
                     KKRKRRANVSTVAIPSTSPPVSSVDPGNPKINEFGEPLYCYCNQVAYGEMVGCDGASC
                     ELEWFHLPCIHLDHLPKGKWYCDDCKRKKS"
     gene            <738659..>739555
                     /locus_tag="ZYRO0B09438g"
                     /db_xref="GeneID:8202513"
     mRNA            <738659..>739555
                     /locus_tag="ZYRO0B09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495314.1"
                     /db_xref="GeneID:8202513"
     CDS             738659..739555
                     /locus_tag="ZYRO0B09438g"
                     /note="similar to uniprot|P01120 Saccharomyces cerevisiae
                     YNL098C RAS2 GTP-binding protein that regulates the
                     nitrogen starvation response sporulation and filamentous
                     growth farnesylation and palmitoylation required for
                     activity and localization to plasma membrane homolog of
                     mammalian Ras proto-oncogenes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495359.1"
                     /db_xref="GeneID:8202513"
                     /db_xref="GOA:C5DRL5"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRL5"
                     /translation="MSLNKSNIREYKLVVVGGGGVGKSALTIQLIQSHFVDEYDPTIE
                     DSYRKQVVIDDKVTILDILDTAGQEEYSAMREQYMRTGEGFLLVYSVTSRTSFDELLT
                     YYQQIQRVKDSDYVPVLVVGNKSDLDEERQVSYEDGLHMAQQMSAPFLETSAKQAINV
                     EEAFYTLVRLVRDDGGAYHKSGRRRMTQGQANDNTNYVGAAGAAGGGSVDGYPGAADS
                     GNFAGNTSYTQASTVPDSVVRKQTGNPTSAAAGSGQQTGSQAGANSAANDSKQTRAQQ
                     SQAPGNTMKESKSGSSKCCVLQ"
     gene            complement(<739885..>740286)
                     /locus_tag="ZYRO0B09460g"
                     /db_xref="GeneID:8202514"
     mRNA            complement(<739885..>740286)
                     /locus_tag="ZYRO0B09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495315.1"
                     /db_xref="GeneID:8202514"
     CDS             complement(739885..740286)
                     /locus_tag="ZYRO0B09460g"
                     /note="similar to uniprot|P46964 Saccharomyces cerevisiae
                     YOR103C OST2 Epsilon subunit of the
                     oligosaccharyltransferase complex of the ER lumen which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495360.1"
                     /db_xref="GeneID:8202514"
                     /db_xref="GOA:C5DRL6"
                     /db_xref="InterPro:IPR003038"
                     /db_xref="UniProtKB/TrEMBL:C5DRL6"
                     /translation="MTPKPKKITKTASTASSTANTVTQDFKEAYRLALKSYKEQVSSD
                     ARLKLIDIFCAFLVVIAGVQTLFMALIRDTFPFNAFLSGFIICVGQFVLLISLRLQVQ
                     EPFEGVPKNRAFGEFVIASLILHFTTLHFIN"
     gene            <740467..>741123
                     /locus_tag="ZYRO0B09482g"
                     /db_xref="GeneID:8202515"
     mRNA            <740467..>741123
                     /locus_tag="ZYRO0B09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495316.1"
                     /db_xref="GeneID:8202515"
     CDS             740467..741123
                     /locus_tag="ZYRO0B09482g"
                     /note="similar to uniprot|P50946 Saccharomyces cerevisiae
                     YNL099C OCA1 Putative protein tyrosine phosphatase
                     required for cell cycle arrest in response to oxidative
                     damage of DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495361.1"
                     /db_xref="GeneID:8202515"
                     /db_xref="GOA:C5DRL7"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR020428"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DRL7"
                     /translation="MSPQDTLSGESISNEVSQEKYHGESNENSDENQILVGQAPAKRI
                     VPPLNFCPVERYLYRSGQPSPVNFPFLLDLNLKTIIWLANEEPQDSLLVFCDRHDIQL
                     QFAAINPDGGEDDNPWDGLTEHSIINALQTIVDQDNYPLLVCCGMGRHRTGTVIGCLR
                     RIMGWNLASVSEEYRRFTGSRGGRILVELLIEAFDTNSVKIDHNRAPPWLLTALEQPE
                     "
     gene            <741284..>741916
                     /locus_tag="ZYRO0B09504g"
                     /db_xref="GeneID:8202516"
     mRNA            <741284..>741916
                     /locus_tag="ZYRO0B09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495317.1"
                     /db_xref="GeneID:8202516"
     CDS             741284..741916
                     /locus_tag="ZYRO0B09504g"
                     /note="weakly similar to uniprot|Q12057 Saccharomyces
                     cerevisiae YOR104W PIN2 Protein that induces appearance of
                     [PIN ] prion when overproduced"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495362.1"
                     /db_xref="GeneID:8202516"
                     /db_xref="UniProtKB/TrEMBL:C5DRL8"
                     /translation="MPICFARDLLARSSFSNDVQNTAKSFSSWDSCMNDKPCKIIAIV
                     GIALASIVAIWLIGGLLTCFRQGVTGIGGFFCWCCNCKPRSRNTKMQPVNDGYSRSQM
                     VGNPSTVIYQPIQPPESAYSRHGHDTYYDERNKSGEVFELEQEFDLEKQRQKSLKGKH
                     RLPAVVHDNEPSVYEPRSGLTNPWNDYNNNNTSPYPNDDFSYRGYEYQKY"
     gene            complement(<741989..>742690)
                     /locus_tag="ZYRO0B09526g"
                     /db_xref="GeneID:8202517"
     mRNA            complement(<741989..>742690)
                     /locus_tag="ZYRO0B09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495318.1"
                     /db_xref="GeneID:8202517"
     CDS             complement(741989..742690)
                     /locus_tag="ZYRO0B09526g"
                     /note="weakly similar to uniprot|P50945 Saccharomyces
                     cerevisiae YNL100W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495363.1"
                     /db_xref="GeneID:8202517"
                     /db_xref="GOA:C5DRL9"
                     /translation="MSKFFYSSPNELDTEHQNENHNNQEPRLQSELLSTGNQVVQSPP
                     LTERLHEWRNLLIHQYNVVVAEWSNLKSATKNEIDSGREYINRNVLNDPQENNRLLVP
                     SSILSLGAFFCGRVLTNKNNWGYRSIVNRNPSILGRLLTSLPSRTVLPLALAGVVFNQ
                     LTPGTAKNACHTFERDFLSESFVQEYHRIWDQLYVQGIKQGSGQIGETFQNSLQNGIK
                     SIRESISAINDDKKQ"
     gene            complement(<742965..>745121)
                     /locus_tag="ZYRO0B09548g"
                     /db_xref="GeneID:8202518"
     mRNA            complement(<742965..>745121)
                     /locus_tag="ZYRO0B09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495319.1"
                     /db_xref="GeneID:8202518"
     CDS             complement(742965..745121)
                     /locus_tag="ZYRO0B09548g"
                     /note="similar to uniprot|P50944 Saccharomyces cerevisiae
                     YNL101W AVT4 Vacuolar transporter exports large neutral
                     amino acids from the vacuole member of a family of seven
                     S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495364.1"
                     /db_xref="GeneID:8202518"
                     /db_xref="GOA:C5DRM0"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DRM0"
                     /translation="MSSRRRSMEEPLLVPKTAITIPNGRRSSALVAGSLQGRKTSLSR
                     SIPVAQGSKLGKSIDSHAMIDIDSPNFKIEHPEKNEEILNSFRKNYLTNNMGKDSRTS
                     TRSQSATSGTVVMDHRSNHSNSDTESVGKSQDGKLSCAGGDIVRDIYKLANKDCDKTS
                     KGAKSMEDVPLESERQRRQSTASGLNVPGGFRREFIVNKMRQQQQQPRDYGSQPNSSM
                     SSPIEDLEDGLAGENDIDQIPFLTRNFLEFLYVYGHFAGESFEDDFLPEDVKLPKNMG
                     ERASLLLEENGHAATSATAAVKVGITPTSKAFLLLLKSFIGTGVLFLPHAFSNGGLFF
                     SIVMLLFFGLYSFWCYYILIRAKEVVGVTSFGDIGLRLYGPWVKFIILFSLVFTQLGF
                     SGAYVIFTAENLKAFCSNVLHFSENIPILYFMLAQFAIFIPLSFIRNVSKLSLPSLLA
                     NFFVMGGLVIVLFFSLKQLALESHMKPAEGVVLLFNTNRWTMFIGTAIFAFEGIGLVI
                     PVQDSMRHPEKFPLVLGMVIITSTVLFITIGSIGYLAYGYKIKTVILLNLPQANISVN
                     LIQFFYSLAIMLSTPLQLFPAIKIIENKVFPKFIKIYVKKDDNTTGVEMRPNSGKLNW
                     KVKWLKNFVRSLIVGSVILMAYFGADQLDKFVALIGSFACIPLVYMYPPMLHLRSCSL
                     PNHKGGRINWSAGLDYVLIIFGAISMIYTSYQSVTQ"
     gene            complement(<745216..>745422)
                     /locus_tag="ZYRO0B09570g"
                     /db_xref="GeneID:8202519"
     mRNA            complement(<745216..>745422)
                     /locus_tag="ZYRO0B09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495320.1"
                     /db_xref="GeneID:8202519"
     CDS             complement(745216..745422)
                     /locus_tag="ZYRO0B09570g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495365.1"
                     /db_xref="GeneID:8202519"
                     /db_xref="UniProtKB/TrEMBL:C5DRM1"
                     /translation="MGVIYLFAKIDKVHLEGETVRVVYKEDNENLKLRNPLEGFFDRW
                     MRNLAPSNIKKLWELKFIWGQRNL"
     gene            complement(<745515..>749885)
                     /locus_tag="ZYRO0B09592g"
                     /db_xref="GeneID:8202520"
     mRNA            complement(<745515..>749885)
                     /locus_tag="ZYRO0B09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495321.1"
                     /db_xref="GeneID:8202520"
     CDS             complement(745515..749885)
                     /locus_tag="ZYRO0B09592g"
                     /note="similar to uniprot|P13382 Saccharomyces cerevisiae
                     YNL102W POL1 Catalytic subunit of the DNA polymerase
                     alpha-primase complex required for the initiation of DNA
                     replication during mitotic DNA synthesis and premeiotic
                     DNA synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495366.1"
                     /db_xref="GeneID:8202520"
                     /db_xref="GOA:C5DRM2"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015088"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR024647"
                     /db_xref="InterPro:IPR029702"
                     /db_xref="UniProtKB/TrEMBL:C5DRM2"
                     /translation="MSSRAEKLRKLQKLQASHGGNSGNDGNDDRLYDEIDEKEYRHMK
                     YKELLQDDFVEDDDGFGYVDRGVEDVEEDHYSDEDIENDNVNNRKKSKETKAKSANNN
                     NGSSERNIGDMLRLQRASVQLNKPTKKAKDIDEFDDILGEYENEPMVKPTHIRPVLSP
                     PSINRNNTSVKRNIPASQEVSNKRLKVDLENNADEDFEMNSSPLKPRSIKRSQVDLNA
                     EPTKDIGSSPTAPKSSGLQNDNKESNDDDDDDESDDDIFVGRRPVKRVAAKREINLSS
                     KSNFLASPVVAPGTPQSSSKAGSQSQRLSSPEPLNLSTGKLGKDQIVDPETESFQMFW
                     LDFCEVDNTLVLFGKIKARDGSLVSGMVQINGICRELYILPREDKTPQDVHDEIIPLL
                     MGKYGLDNIRAKSEKMKYAFELPDIPREADYLKVLMPINTPKCKYETIPPDLSSDTFY
                     HVFGGKSSAFESFVVQNKIMGPCWLEIKNGDFSALQNASNCSVELAVDRPQNVKPLDA
                     KNIPELNGVSLTIQTIMNVKENKQEIVAITLSSYRGIAVDSPIPEDLQPNDVTTLVRP
                     PVGSSFPSGLKGIADQKLKGQVRFCNNEKILLSCFCALLLRSDPDILIGHRLESLQLD
                     VLVHRLHELNIPTFSALGRRARRAWPDRFGKNNSNLIHFFIQELIAGRLLCDIANDMG
                     QSLTPKCQTWDLPEMYLVACGKDSTPLDINYQNPHYREDADTMAMALRENIKNSMIIA
                     EISFRIQLLSLTKQLTNLAGNAWSQTLGGTRAGRNEYILLHEFSRNGYILPDKENSRN
                     RTSKRPDTTGAPDGDSGNGDPVVSSKKAKYQGGLVFEPEKGLHKNYVLVMDFNSLYPS
                     IIQEFNICFTTVDRNLEDTDELPEVPSNDGGKGVLPRLLANLVQRRREVKKIMATERD
                     PHKRTQCDIKQQALKLTANSMYGCLGYVNSRFYAKPLAMLVTNKGREILMNTRQLAES
                     LELTVVYGDTDSVMIDSKCDNYADAIKVGNEFKKLVNERYKLLEIDIDNVFKKLLLHA
                     KKKYAALTVSLDKEGNERTILEVKGLDMKRREFCPLSRDVSIHVLNTVLSEDDSEKAL
                     SDIYEYLERVRVQMENNEIRVDKYKINTKLSKDPNSYPNGKSMPAVQVALRMRKVGRV
                     VKAGTVITFVITKQDNSELEDKEIPPVPERARALNEVMVKGNNLRPDPAYYLEKQIFA
                     PVERLLERIESFDVVRLTQSLGLDTRRYLNRGQTAENSAGGIDSLQPLETTIPDAERF
                     RDVQPLQIRCPQCDQEFPFGGIASSNHYMMCYNGLQCKHCNHLFTPLQLTCQLERCIR
                     LHISLYYAGWVQCDDRTCNNSVRRQISVFGKRCLNDGCTGVVHYRYSDKQLYNQLLYF
                     DSLFDCEKNKRQQLKPLYVEGDTDFPRDLLTDSSIKALSEQNRDYLDVGRGVVQKYLG
                     DCGRRYVDMSNIFDFMTPAK"
     gene            <750620..>751444
                     /locus_tag="ZYRO0B09614g"
                     /db_xref="GeneID:8202521"
     mRNA            <750620..>751444
                     /locus_tag="ZYRO0B09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495322.1"
                     /db_xref="GeneID:8202521"
     CDS             750620..751444
                     /locus_tag="ZYRO0B09614g"
                     /note="similar to uniprot|Q12241 Saccharomyces cerevisiae
                     YOR106W VAM3 Syntaxin-related protein required for
                     vacuolar assembly PEP12 homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495367.1"
                     /db_xref="GeneID:8202521"
                     /db_xref="GOA:C5DRM3"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C5DRM3"
                     /translation="MSNYDLEAQNGDNSTEVARSLIEELAEQLKKLSRETIKVGTKRD
                     SIEVRSNIETGLIPNCNSIRHKIEKESWGSSSQDRVIQGSKLYNDFVMLKGELQKLQK
                     DYRESKSKHPLKNDNGSATKVVRGDPESNYLSIQVNEQTPLLQEEEQQERQLLQQQQQ
                     QQQQQLWQESNANQDEVDFHTIILRERSQQVTRIHSAVQEVNAIFRQLGSLVNQQGDQ
                     VDEVDANIGQLANNMQKANSQLHRADQNQRKKNRCGLITLTIMVIFVLIVTLLVLS"
     gene            complement(<751476..>753467)
                     /locus_tag="ZYRO0B09636g"
                     /db_xref="GeneID:8202522"
     mRNA            complement(<751476..>753467)
                     /locus_tag="ZYRO0B09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495323.1"
                     /db_xref="GeneID:8202522"
     CDS             complement(751476..753467)
                     /locus_tag="ZYRO0B09636g"
                     /note="some similarities with uniprot|P32389 Saccharomyces
                     cerevisiae YNL103W MET4 Lecine-zipper transcriptional
                     activator responsible for the regulation of the sulfur
                     amino acid pathway requires different combinations of the
                     auxiliary factors Cbf1p Met28p Met31p and Met32p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495368.1"
                     /db_xref="GeneID:8202522"
                     /db_xref="UniProtKB/TrEMBL:C5DRM4"
                     /translation="MSNEGGADGSTYRSEFRNLFGGDSHTDDDNNGRDRAGPDPINSI
                     QPSSLLSQEPMQMFEEQSSGQNNSNITPSILLEQLAYVDNFMPSLEQDFANLDSWILQ
                     DPGSDSTAMALGGNSSSNGQRLNESGLGFDERLAAELSAFADDSFIFPDEDKRQRQSI
                     SGAVSGNSDNNNPDNNDNDLYGNPREFEDGNDANNNDNSERQQGTGRRSAHFLTQRRN
                     TFLTSQYDHSKSRFSSKSREKRDAESQQQQQQQHEEASSSSRNQDNANTTSNVTSNSV
                     TGSPLQDHGGFTNVDIVSGGNGGGAPAGANDDTRSPRFPQHTPNVPSPLSNILASQVM
                     QPYSVSASPVTTTSRPSDSVSVASDPQVPAAAASNQTRPQIHVPDYSTIPTSTLVALL
                     PRVSVPPGAHRTLVNSGFNQEQIHAIAAIIAHHEQEKSKRHTEESVSIESQPNNVNDQ
                     DASRGAEFLLGILSRDSRSQQQQQQQQLQRDQQGFVESLLQLDPRTHDQGGDPIRSES
                     QDGGQGRIKREHSISGIEFEEDEEEEDTEIINPTSSRPLKRSKSTEEALSSSSNAKRR
                     NVSNGVAISPPSTTTSATSAQVQKTHQRRKVKERELENSVTELSELAISLQQKIHTLE
                     MENKLLKNLVRSSGELEGIEKAESIRKQIMDKINGSNDE"
     gene            <754695..>755513
                     /locus_tag="ZYRO0B09658g"
                     /db_xref="GeneID:8202523"
     mRNA            <754695..>755513
                     /locus_tag="ZYRO0B09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495324.1"
                     /db_xref="GeneID:8202523"
     CDS             754695..755513
                     /locus_tag="ZYRO0B09658g"
                     /note="some similarities with uniprot|Q99188 Saccharomyces
                     cerevisiae YOR107W RGS2 Negative regulator of
                     glucose-induced cAMP signaling directly activates the
                     GTPase activity of the heterotrimeric G protein alpha
                     subunit Gpa2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495369.1"
                     /db_xref="GeneID:8202523"
                     /db_xref="GOA:C5DRM5"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:C5DRM5"
                     /translation="MQCHENSSIPSLHEVLTKSVQDEIENDPYTLNKFEQFLLKSHCE
                     ENYEFWRSCDGYLLKYDNDDFDIQKGNSKIYKKFIRANSPMECNLPEDIKQNFRESYH
                     HGSRVPKDTLCRARQHSWSLMKDAYRQYVRQVCKRSGCCNSRSVSRSESPSEVTRIRS
                     DLSHTSLTIPIIELPTLAVTNTSKPTGASHAFRRSSSFSSSGPETSSSSEESPTEPPD
                     AIGAGTQRLFSKGKEFMSRFRLKNRRTSFASQSSTNSIYTNFERRASDRTLYQK"
     gene            <755804..>757642
                     /locus_tag="ZYRO0B09680g"
                     /db_xref="GeneID:8202524"
     mRNA            <755804..>757642
                     /locus_tag="ZYRO0B09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495325.1"
                     /db_xref="GeneID:8202524"
     CDS             755804..757642
                     /locus_tag="ZYRO0B09680g"
                     /note="highly similar to uniprot|P06208 Saccharomyces
                     cerevisiae YNL104C LEU4 Alpha-isopropylmalate synthase
                     (2-isopropylmalate synthase) the main isozyme responsible
                     for the first step in the leucine biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495370.1"
                     /db_xref="GeneID:8202524"
                     /db_xref="GOA:C5DRM6"
                     /db_xref="InterPro:IPR000891"
                     /db_xref="InterPro:IPR002034"
                     /db_xref="InterPro:IPR005668"
                     /db_xref="InterPro:IPR013709"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DRM6"
                     /translation="MIRETAVRLAQNVGRAGKSIPPIKLAYKNMLKDPSIKYKKFQQN
                     PFPQRQWPNRVIEKAPRWLSTDLRDGNQSLPDPMSVEQKKEYFHKLLEIGFKEIEVSF
                     PSASQTDFDFTRYAVENAPDDVSIQCLVQSREHLIKRTVEALTGAKRATIHSYLATSD
                     LFRNVVFKMSQEEAVKMAVESTKLIRSLTKDDPNQQATRWTYQFSPETFSDTPTEFAV
                     EICEAVKAAWEPTEENPIIFNLPATVEVSTPNIYADQVEYFSTHISEREKVSISVHCH
                     NDRGCGVAASELAILAGADRVEGCIFGNGERTGNVDLVTIALNMYTQGVSPNLDFSEL
                     TKLIEVVERCNKIPISPRAPYGGELVVCAFSGSHQDAIKKGFAAQEQRRALGDTIWSI
                     PYLPLDPKDIGRDYAAVIRVNSQSGKGGAAWIILRSLGLDLPRNLQILFSKEVQNTAD
                     SLGRELKSTEICDLFKEKYNFNNEHFNHINLLDYDIVKTGSDRRSLNGQVEINGQVHD
                     IQGSGNGPISSLIDSLSNLLSVRLTVESYAEHSLGSGSSTQAATYVSLAYRRESDNEI
                     TCQWGVGTSEDVGDASFRAILSSVNSIFNAGEITLPKTADSAAGSQ"
     gene            <758100..>762188
                     /locus_tag="ZYRO0B09702g"
                     /db_xref="GeneID:8202525"
     mRNA            <758100..>762188
                     /locus_tag="ZYRO0B09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495326.1"
                     /db_xref="GeneID:8202525"
     CDS             758100..762188
                     /locus_tag="ZYRO0B09702g"
                     /note="similar to uniprot|Q12271 YOR109w Saccharomyces
                     cerevisiae INP53 Phosphatidylinositol 4,5-bisphosphate
                     5-phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495371.1"
                     /db_xref="GeneID:8202525"
                     /db_xref="GOA:C5DRM7"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DRM7"
                     /translation="MIIYLSKRLERRIAIVSESFALIFKSVSVGDADSRRPRCAIELL
                     PKDELSNQGFKKLSSHEIYGFIGLIEVEGLIFVGAITGKSKVAQPTPGETVNKIFAVD
                     FFCLNSSKWDFVEIDSSGYPVSSEGEPNYAESFPRHPCYELKKLLSNGSFYYSSDFDL
                     TSTLQNRGFGDHSLSADNYQEEYMWNYFLMQEIITYRDRLEPHAKQILDDQGFLTTVI
                     RGFAETFVTYLKRLKVGVTIISKQSWKRAGTRFIVRGVDDEGNVANFVETEFIMYSSQ
                     YCYAFSQIRGSIPVFWEQDTSLINPRVQITRSVEATQPIFDEHFSRLVEEYGPVHVVN
                     LLSTKTNEIELSQRYRQHLKNSPKLKLGQDVFLTEFDFHKETSQEGFAGVRKLIPMIM
                     DSMLVAGYFSYDVREKRLISEQQGVFRTNCLDCLDRTNLVQQVLSLTAFKTFLEDFHL
                     ANVKVYVDNEDFVIKHNTLWADHGDQISQIYTGTNALKSSFSRKGKMSFAGALSDATK
                     SVSRMYINNFMDKNKQQNIDTLLGRLPHQQSVQLYDPISEYVDDKLNGLSDQFTSYST
                     TNILVGTFNVNGTSRHADLSKWLFPIGDKFKPDIVVLGLQEVIELSAGSLLNADYSKG
                     SFWENMVNKCLNQYDEKYLLLRVEQMSSLIILFFVKADKAHMVKQVEGATKKTGFGGI
                     TGNKGAVAIRFEYGGTSFCFVNAHFSAGANNIDERRSDYESIVKNIIFTRSKTIPHHD
                     SIFWLGDLNYRIILPNEEVRRELSAKKEGYIERLLRYDQLTQEINTGVVFQGFREPTL
                     KFRPTYKYDNNTDNYDSSEKARTPSWTDRIVYKGTNLHPLAYSDAHLIISDHRPVYAA
                     YRAKITLIDENIRLDLTNRLYREYKQAHPEVAEQHYNHLIDLEEGKSPAKNIPASPGF
                     DLLDLHGTMKPKPSPISSLSSASPEPTVSIRRESSPPLSDTHPGQKLRPPPPPAPRSS
                     SSVRVLQLADTDTSSVSRKSSESSVPSHQDSQSTNSARPPVPQSRRSVPPGFNETILT
                     PKNTSRSSTPVSIPKVEAPAPRKAATFPESTIVASNGSPQPRLAATKTDSDIVATPKK
                     KGPPVPPRSPGLRSHSASSNPEILSLPLELQKKVSTVPSVSNETETQPLESAHTDSSN
                     ANNLLPKRTPPVPPRANASTPELHSDVNTSTSSISSNTNTLVPKKKVPQVPSHINEQT
                     TTKTKSESDVPVKKLPPAALHANELTPLAPAPISLEESEGLISKKRVPPPVPSHSSQS
                     NWSAANTLIPKKKTPPASTTELKSTNTKESNPQLTEDSPALTSTLLSRNKSPAPPVPR
                     QVNEHTEEAEFSNVKKTPPAKPTKKPEVENLSLDSWKPLTPK"
     gene            complement(<762282..>762935)
                     /locus_tag="ZYRO0B09724g"
                     /db_xref="GeneID:8202526"
     mRNA            complement(<762282..>762935)
                     /locus_tag="ZYRO0B09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495327.1"
                     /db_xref="GeneID:8202526"
     CDS             complement(762282..762935)
                     /locus_tag="ZYRO0B09724g"
                     /note="highly similar to uniprot|P53930 Saccharomyces
                     cerevisiae YNL107W YAF9 Subunit of both the NuA4 histone
                     H4 acetyltransferase complex and the SWR1 complex may
                     function to antagonize silencing near telomeres interacts
                     directly with Swc4p has homology to human leukemogenic
                     protein AF9 contains a YEATS domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495372.1"
                     /db_xref="GeneID:8202526"
                     /db_xref="GOA:C5DRM8"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="UniProtKB/TrEMBL:C5DRM8"
                     /translation="MTMSHKKMATGTSKRVKTLSVTRPIVYGNTAKKLGEIKPPNAPA
                     EHTHIWTIFVRGPQNEDISYYIKKVVFKLHDTYPNATRTVEAPPFELTETGWGEFEIN
                     VKIHFVDEANEKMLSFYHHLRLHPYHNVNPDSPQQPDDEISSVFYDEIVFNEPNEQFF
                     KTLLSTPGNLLPSNKSDSCAFSKQLEQEEIDRINLGIKQVDSEIEELKAKVNKQLKE"
     gene            <763061..>764335
                     /locus_tag="ZYRO0B09746g"
                     /db_xref="GeneID:8202527"
     mRNA            <763061..>764335
                     /locus_tag="ZYRO0B09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495328.1"
                     /db_xref="GeneID:8202527"
     CDS             763061..764335
                     /locus_tag="ZYRO0B09746g"
                     /note="similar to uniprot|Q6B220 Saccharomyces cerevisiae
                     YOR110W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495373.1"
                     /db_xref="GeneID:8202527"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR014623"
                     /db_xref="InterPro:IPR019481"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DRM9"
                     /translation="MVVRTIYIARHGYRSNWLPQGPYPLPPTGVDSDVPLAKHGIDQA
                     KELAHYILSLGNQPEMIFSSPFYRCIETSEPIADILELPINVDAGLGEWYKPDREVIP
                     VPAPLESLENFFPQKLNKNWESSVIPSDKGETEEELYLRCKNFWPKFISRVEKDFPNI
                     ETVLLVTHAASKASLGMNLLGFSNWREPLDEDGNIIRSGSCSLDKFELVPSTSDEGEE
                     TLPFESRQWRMTMNGNTEFLTKGEEMNWDYRNAFEAGSDADMKLRREAAAAAATEAAA
                     SAAVEGPYEQPTESVYVSVDLPSNSYRERAEIDRTASLQYSGLNTPHPLFKIGNKLYE
                     GDWKKLVGTELAFLGEAVLNKKSRGEQLDKNDADDAGDEVEGGDGESGAKLESESHQE
                     KDGEMQQEDEEEHSERIYRITDRIALTRVQPM"
     gene            <764405..>765097
                     /locus_tag="ZYRO0B09768g"
                     /db_xref="GeneID:8202528"
     mRNA            <764405..>765097
                     /locus_tag="ZYRO0B09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495329.1"
                     /db_xref="GeneID:8202528"
     CDS             764405..765097
                     /locus_tag="ZYRO0B09768g"
                     /note="similar to uniprot|Q99210 Saccharomyces cerevisiae
                     YOR111W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495374.1"
                     /db_xref="GeneID:8202528"
                     /db_xref="GOA:C5DRN0"
                     /db_xref="InterPro:IPR003697"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:C5DRN0"
                     /translation="MINRVIESIVSQFQIVLGSSSERRYEILQQVMGVPQITIMKPSF
                     EEDLNKSEFSNPVNYVIETSRHKALGIVNDLKDNKTTSAVASPPKLIVCADTVVIDSQ
                     GNIHEKPQYKEIQLKNLKKFCYELNEPLKVVTAVTVVRWNHSGDYEIRDTFTEETKLY
                     MDSQTPLDLLEDYVASGEGTQVAGGFKIQGASAVFIKKIDGDYYNVVGLPLNKTFQAL
                     YRELQNTGTSAI"
     gene            <765258..>765854
                     /locus_tag="ZYRO0B09790g"
                     /db_xref="GeneID:8202529"
     mRNA            <765258..>765854
                     /locus_tag="ZYRO0B09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495330.1"
                     /db_xref="GeneID:8202529"
     CDS             765258..765854
                     /locus_tag="ZYRO0B09790g"
                     /note="similar to uniprot|P53927 Saccharomyces cerevisiae
                     YNL110C NOP15 Constituent of 66S pre-ribosomal particles
                     involved in 60S ribosomal subunit biogenesis localizes to
                     both nucleolus and cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495375.1"
                     /db_xref="GeneID:8202529"
                     /db_xref="GOA:C5DRN1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DRN1"
                     /translation="MVKPSEKVVKSKEPVKEPVESSESDASSSDSELEGLPDAEDDRS
                     HKVKKLSKKPAQKQQQNSSQDEYSGIVFVSRLPHGFQEKELSKYFSQFGDLKDARLAR
                     NKKTGNTRHYGFIEFVNKDDAKVAQETMNNYLLMGHLIQVRLLPKGSKIEKLYKYRHR
                     SFQFASVKKSSEELKERARKKHDERVNKLKKAGIDFKW"
     gene            <765874..>766425
                     /locus_tag="ZYRO0B09812g"
                     /db_xref="GeneID:8202530"
     mRNA            <765874..>766425
                     /locus_tag="ZYRO0B09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495331.1"
                     /db_xref="GeneID:8202530"
     CDS             765874..766425
                     /locus_tag="ZYRO0B09812g"
                     /note="similar to uniprot|P40312 Saccharomyces cerevisiae
                     YNL111C CYB5 Cytochrome b5 involved in the sterol and
                     lipid biosynthesis pathways required for sterol C5-6 and
                     fatty acid desaturation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495376.1"
                     /db_xref="GeneID:8202530"
                     /db_xref="GOA:C5DRN2"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="InterPro:IPR018506"
                     /db_xref="UniProtKB/TrEMBL:C5DRN2"
                     /translation="MRLMYILPIFSQYFPTFFEQHILPTANYWKYIRDIRVSPLYFSH
                     SQSHIQSSFVVEMSKVYTFEQVAEHNTPEDAWLIVDGKVYDVTKFVEDHPGGDEIILD
                     LAGQDGTEAFNDIGHSEDAVNMLKDFIVGSLDPASRPAKSEKVANVAQTSGVTTGGEG
                     NGFLALACAVVFFAVAYYLANMS"
     gene            <766600..>768936
                     /locus_tag="ZYRO0B09834g"
                     /db_xref="GeneID:8202531"
     mRNA            <766600..>768936
                     /locus_tag="ZYRO0B09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495332.1"
                     /db_xref="GeneID:8202531"
     CDS             766600..768936
                     /locus_tag="ZYRO0B09834g"
                     /note="similar to uniprot|Q12453 Saccharomyces cerevisiae
                     YOR112W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495377.1"
                     /db_xref="GeneID:8202531"
                     /db_xref="GOA:C5DRN3"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DRN3"
                     /translation="MFLLTLECKQLPNIKSLSISERRTPATMSFINLFRSISNFQFPY
                     TIEEKPIQETLLWQVFYGSRKSDSLPVTIFKANRNEKTEPLIANAVHKSKILRIPGLC
                     RVLETFESDPQSTFIVTERATPFPWDQLNNYSRNKEALEVGILEILNTLSHLSNFVLG
                     TLSEQSIFIDSKGQWILFGFELCADRKQMDPGIFGSHMRLYNNLNEKPTLSDDPTRVD
                     AMQLGKLITKLLGGTAGVPKDWSTALQSLSQGRTSIQHFNKKLQSTSTWINNPLISLH
                     QQLEEIHIKDSQGKFIVMSNLQIAYFENRSLFHHLLPQFVRGMLIPELTKVINWLIST
                     QSGNPSVLPKIIPLLAIFLDLTIEQEYFPEDSKQLLYSSFALQDRQVRFLLLIYLPKI
                     ITRLEKKEISDKIYPRFSMGLADTDSTLRLQTLKSIPVVVSYITERQLNNELLRYLAK
                     TQVDVDVDIRAWTIIVITKISTMLSSSSGNRANILATAFTKSLKDPDVKARLASLYGL
                     NKTIDLFDVKTIANKILTVIAPGLLDKEPLVRSKAKALFQKYLNKLEDEAKLLQDSDA
                     SAEPQTKDINFDSYCEMDSSNVDELAKQFLSSILITTGPGFSDTDTATSGVMDDDVWA
                     NFGEKNSSTVSDDFGSFPAKVSQAQDSFDDDDVEADFDESGWGDFSFDEPQEIKSPKP
                     VSGKPVKVQRSWNSHLSDDEPTASRSLTQAPDKKTSILNRPKVSSSILTPRSSASHSR
                     SSTPSSLSRTAKPAARASKLQNKPVKDEFDDDAWDTAW"
     gene            complement(<769104..>771401)
                     /locus_tag="ZYRO0B09856g"
                     /db_xref="GeneID:8202532"
     mRNA            complement(join(<769104..769462,770138..>771401))
                     /locus_tag="ZYRO0B09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495333.1"
                     /db_xref="GeneID:8202532"
     CDS             complement(join(769104..769462,770138..771401))
                     /locus_tag="ZYRO0B09856g"
                     /note="similar to uniprot|P24783 Saccharomyces cerevisiae
                     YNL112W DBP2 Essential ATP-dependent RNA helicase of the
                     DEAD-box protein family involved in nonsense-mediated mRNA
                     decay and rRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495378.1"
                     /db_xref="GeneID:8202532"
                     /db_xref="GOA:C5DRN4"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRN4"
                     /translation="MSRDGQYNKNNFGSRNGDFRGNRASDRNNYNRGGNFGGGGFSSY
                     KGGGYTEPQELGKPNWDEELPHLPPFEKNFYVEHEGVRNRSDEDIAKFRKENEMTITG
                     HDIPKPITSFDEAGFPDYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGK
                     TLSYCLPAIVHINAQPLLAPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVY
                     GGVPRGQQIRDLARGAEIVIATPGRLIDMLEINKTNLKRVTYLVLDEADRMLDMGFEP
                     QIRKIVDQIRPDRQTLMWSATWPKEVKQLARDYLTDPIQVQIGSLELSASHTIKQVVE
                     VISEFEKRDRLSKHLEIASEDQDSKVLVFASTKRTCDDITQYLRQDGWSALAIHGDKD
                     QRERDWVLEEFKNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGR
                     AGAKGTAISFFTEGNKGLGASLISIMREAKQEIPADLAQYDRKSYGGHPRYGRGGYGG
                     RGRGGFGGRGRGGGGRGRGGYGGGRGGGYNRY"
     gene            complement(<771644..>772036)
                     /locus_tag="ZYRO0B09878g"
                     /db_xref="GeneID:8202533"
     mRNA            complement(<771644..>772036)
                     /locus_tag="ZYRO0B09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495334.1"
                     /db_xref="GeneID:8202533"
     CDS             complement(771644..772036)
                     /locus_tag="ZYRO0B09878g"
                     /note="highly similar to uniprot|Q755Q7 Ashbya gossypii
                     AFL220C AFL220Cp and similar to YNL113W uniprot|P28000
                     Saccharomyces cerevisiae YNL113W RPC19 RNA polymerase
                     subunit common to RNA polymerases I and III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495379.1"
                     /db_xref="GeneID:8202533"
                     /db_xref="GOA:C5DRN5"
                     /db_xref="InterPro:IPR008193"
                     /db_xref="InterPro:IPR009025"
                     /db_xref="UniProtKB/TrEMBL:C5DRN5"
                     /translation="MSESAKVDPVSQDVDMTKDEQPVEEFEDEPDREKIKILPQATSE
                     DGTCASFQIAEEDHTLGNALRYMIMKNPDVEFCGYSIPHPSENLLNIRVQTYGNVTAV
                     DVLHKGLQDLMDLCDAVEDKFTQKIREL"
     gene            <774974..>776083
                     /locus_tag="ZYRO0B09922g"
                     /db_xref="GeneID:8202535"
     mRNA            <774974..>776083
                     /locus_tag="ZYRO0B09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495335.1"
                     /db_xref="GeneID:8202535"
     CDS             774974..776083
                     /locus_tag="ZYRO0B09922g"
                     /note="similar to uniprot|P36156 Saccharomyces cerevisiae
                     YKR076W ECM4 Non-essential protein of unknown function
                     gnl|GLV|KLLA0F12056g Kluyveromyces lactis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495380.1"
                     /db_xref="GeneID:8202535"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR016639"
                     /db_xref="UniProtKB/TrEMBL:C5DRN6"
                     /translation="MSKQWASRDGSFKRQVSKFQEIISPDHPVFKPAKGRYWLYVSLA
                     CPWAHRTLLTRALKGLTSVIGVSVVHWHLDNKGWRFLPIDEATLEMANQKNLYKDKAG
                     GIVGALSDKSSPVGKVPNDSARLFVDGTFDPNEHAQRLSDLYYKADPEYDARFTVPVL
                     WDTKLKAIVSNESAQIIRVLNSGVLDEVAGDEATKLDLVPKELESQIDEFNSWVYDNI
                     NNGVYKAGFAESAEIYEKEVTNVFQHLDKVEGILKQKYETLKSKYKGLDEVLSRYFTV
                     GEQLTEADVRLYTTIVRFDPVYVQHFKCNLNTIRDGYPFIHLWLRNLYWNYDAFRHTT
                     DFDHIKLHYTRSHSRINPLGLTPLGPSPDIKPLRD"
     gene            <776502..>778013
                     /locus_tag="ZYRO0B09944g"
                     /db_xref="GeneID:8202536"
     mRNA            <776502..>778013
                     /locus_tag="ZYRO0B09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495336.1"
                     /db_xref="GeneID:8202536"
     CDS             776502..778013
                     /locus_tag="ZYRO0B09944g"
                     /note="weakly similar to uniprot|P47084 Saccharomyces
                     cerevisiae YJR003C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495381.1"
                     /db_xref="GeneID:8202536"
                     /db_xref="UniProtKB/TrEMBL:C5DRN7"
                     /translation="MLKRYFTSSVKCLNGKVHFEPVYANLLRQECFKPLAEELPKKYG
                     QLDPYELSEFVNKALAKQSLNTEQVIPIHNKMIEELSRYEYGISTVHAKKLEQIGGQL
                     SEKSLLEIIRNNPGRVHDSWELLKRFPKEFWVDDLLLAAVENTISRKTYEENGKQILP
                     LKSLAQCMILLQNIDHKQNIKQDVLDVLVGHILEGKISNALQPLLQYGTTSLEPFLER
                     IEELTPYQIYQIYKNFPLDSLKTEEGLFFKIVNTLGKFQKPVFSQEEVQTSDEFKKSL
                     QEFGEFSVLNDLSHSEDLSQEYLQLRQYISENELDKKDLKLALNLLRIEGVYRNNLER
                     ALELYHSYLLSHGNKANKLMFEILLSFASQSFKKSNPAMLQYSQVFFPADNSESDTVN
                     IIRTLMLANSKFDVEKSLELYNTNIEAFAKRNEESLESSLLTESLIMAYLANQDLNFA
                     RVIFEGAIREKILTSHAIIKNLKDLFKTYGEAVEKGNVKDVMQEKILQTFETI"
     gene            complement(<778167..>778934)
                     /locus_tag="ZYRO0B09966g"
                     /db_xref="GeneID:8202537"
     mRNA            complement(<778167..>778934)
                     /locus_tag="ZYRO0B09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495337.1"
                     /db_xref="GeneID:8202537"
     CDS             complement(778167..778934)
                     /locus_tag="ZYRO0B09966g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495382.1"
                     /db_xref="GeneID:8202537"
                     /db_xref="UniProtKB/TrEMBL:C5DRN8"
                     /translation="MMRVVKYDPNCPGKGRSRSSLGMQNKCKMRKRSDNQLKSIENNK
                     NISPIMFHHVRVDEMSNNARLDQISQDAEARGGDGRKNQQSPLVIKTDPRYNNSQLEI
                     SMSNKKLNDYAGNKSKKLTFLPSISNRSPTPTATPTSQRHMESDKFSNLGVMNFKEPQ
                     GFNNYRNGLFELPSSLDKEFADERSHSGSEMGTSNKFANNDCLTGLPVFGRKFSSDVR
                     LKLNKNNAQLQTIQGYSTCTFRVKMNGKNRTEHKDYE"
     gene            <779181..>781217
                     /locus_tag="ZYRO0B09988g"
                     /db_xref="GeneID:8202538"
     mRNA            <779181..>781217
                     /locus_tag="ZYRO0B09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495338.1"
                     /db_xref="GeneID:8202538"
     CDS             779181..781217
                     /locus_tag="ZYRO0B09988g"
                     /note="highly similar to uniprot|Q92280 Saccharomyces
                     cerevisiae YLR002C NOC3 Protein that forms a nuclear
                     complex with Noc2p that binds to 66S ribosomal precursors
                     to mediate their intranuclear transport also binds to
                     chromatin to promote the association of DNA replication
                     factors and replication initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495383.1"
                     /db_xref="GeneID:8202538"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR011501"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016903"
                     /db_xref="UniProtKB/TrEMBL:C5DRN9"
                     /translation="MGRRKRSQSEIKAGTAKKRKQEDALLEQGGFGSAGSDISNDDDM
                     YEDAVSKPSDDDDSWDNLEQDYEKRSRNLKHQEDNMVEGLPIKINGKIERKMIRQQPK
                     KNESKDTSDQSEQDEDASERESESKGEKEEEDEEDDENEQVPDTEEKIVQLKEEIADL
                     VEKILEEPEENVPALSRLCRMVKSKNPNTCKFSMLALVPVFKSIIPGYRIRPLTELEK
                     RERVSKEVGRLRHFEQSLVGIYKNYVDILKELSKVPNNDDPLKVQIGALATQAANELI
                     SNASHFNFRTEMFTLIIRRICKPNLRADSMSERSIKTLESLLNDDEDGIISLEIVRIL
                     CKTAKTRKYNVEESVINILLSLDVLSDYDPNTREENEQEKIRMKKKDRVHLSKKQRKS
                     RKEMKQIEEEMRKAEQSVTVEERERNQAEILKQVFSLYLNILKVQNPKLVGAVLEGLV
                     KFGSMANFELLGDFLEVMKELIKDADLNNISSSEVRKVLLCIVSSFSIVSNHSQMKFN
                     VDLSSFVDALYALLPSISLDANIELSHKSMRLADPLGSEIFKPSVNVSTKAELLLKAL
                     DYIFFRSKSGTKQRAAAFTKRIYMSMDHTPEKTSIALLKFLDKLMNKYPEIGGLYSTE
                     DRIGNGNFIMEADTPALCNPESATLWENSLLVNHYCPTVVKGIRFLGTRSKESQ"
     gene            complement(<781421..>783313)
                     /locus_tag="ZYRO0B10010g"
                     /db_xref="GeneID:8202539"
     mRNA            complement(<781421..>783313)
                     /locus_tag="ZYRO0B10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495339.1"
                     /db_xref="GeneID:8202539"
     CDS             complement(781421..783313)
                     /locus_tag="ZYRO0B10010g"
                     /note="similar to uniprot|P47083 Saccharomyces cerevisiae
                     YJR002W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495384.1"
                     /db_xref="GeneID:8202539"
                     /db_xref="GOA:C5DRP0"
                     /db_xref="InterPro:IPR007151"
                     /db_xref="InterPro:IPR012173"
                     /db_xref="UniProtKB/TrEMBL:C5DRP0"
                     /translation="MSNFSDTLKSEPIGILSKEPSQALDLVKSYLDEVLALYKKSGSA
                     AKTELDEIITDGLDANQVWWQAKMVVDNVGGDLMERIYDLKSQTYDDFDEEEGDGSSL
                     EGNDLEQESQESESSGDESNQGSQNEGSEEEEEEEEEEEEDEDEEEDEDDNDTGKVQE
                     IERYDDSAMSGEPADVSEEEGKEELEEKDDYEESDQEGALEESSNEADYSNSEKKDLN
                     DEFFDLNEFNRQTLEAEEGEGNEQDDEEVDYFGDLPSEDEEEALYYNDFFDEPTSQKS
                     TKKEVTSEKPKKKQQAEPDFTEEDYDAAVDSAKLDLFADDDKEPKGGDEDTDSEKKLS
                     TFEKQQLDIQRQIEQLEKEAVAEKKWALKGEAQSKDRPQDALLEEDVEFDRTSKPVPV
                     ITTEVTESLEDMIRRRIKEKGFDDLPRRVVTDSNLKSYKPDFQLSDQKSSKSLAELYE
                     EDYKGVSQDAAVSEELQKEHDEISDMFNNLFYKLDALSSAHFIPKPSKKSLEVRVETP
                     AVSMEDTQPLTMSTEQSLAPQEIYRVGKGENPNEIKLKNGMPVAKEELTRDDKQRLRR
                     AMKRKRANNHVGDQQKKKSKKDATISTLSNAKNVTVINKKGEQHDVRGNVKGTKGNEN
                     INKIKL"
     gene            complement(<783526..>785355)
                     /locus_tag="ZYRO0B10032g"
                     /db_xref="GeneID:8202540"
     mRNA            complement(<783526..>785355)
                     /locus_tag="ZYRO0B10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495340.1"
                     /db_xref="GeneID:8202540"
     CDS             complement(783526..785355)
                     /locus_tag="ZYRO0B10032g"
                     /note="similar to uniprot|P47082 Saccharomyces cerevisiae
                     YJR001W AVT1 Vacuolar transporter imports large neutral
                     amino acids into the vacuole member of a family of seven
                     S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495385.1"
                     /db_xref="GeneID:8202540"
                     /db_xref="GOA:C5DRP1"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DRP1"
                     /translation="MAGTSEEEPLRGENSNQGPVHYISIPVNGNGNNSHGVGESPFNA
                     GSSFSHRRHSILDQPFGSFRGVNSLSRFATSLKRANSFRHIDVHPDVQRNYFEQSNDE
                     LVNPETMEPAPDGRKLSVALGRAGSIAVRPSIANFRDRRVSGPAVQDVDDYGATGMSV
                     ISDSQSQFRDGASVVESVIVPGISNIGTAADNELITLRKVEGKDGEVVTVLAGKSTGP
                     QTIFNSVNILIGIGLLALPLGLKNAGWIPGLCLLCILALATFCSAELLSRCLDTDPTL
                     MSYADLGYAAYGSKGRILISCLFTLDLLGSGVSLIILFGDSLNALIPKYSSNFFKVLG
                     FFAVTPGVFIPLSILSNISLLGITSTIGTVVITALCGFYKKEAPGSLIDRMPTDLWPK
                     DFKSFCLSIGLLSACWGGHAVFPNLKSDMRHPTKFFDCLKTTYKITTITDIGSSVVGY
                     FMFGSLVDDEITRNVLLTEGYPSFVYVLISSLMSLIPIAKTPLNARPIISVLDTLMGV
                     DGIELKNGNNRSKTAELVQLFNRIFVNVAFVTIAIIFPKFDKLIAFLGAGLCFMICLI
                     LPCLFYLKICKSSIKWWERILCYLTISVSMLLATLGIGAAIAS"
     gene            <785969..>788437
                     /locus_tag="ZYRO0B10054g"
                     /db_xref="GeneID:8202541"
     mRNA            <785969..>788437
                     /locus_tag="ZYRO0B10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495341.1"
                     /db_xref="GeneID:8202541"
     CDS             785969..788437
                     /locus_tag="ZYRO0B10054g"
                     /note="uniprot|Q96WU6 Zygosaccharomyces rouxii cr001
                     Hypothetical protein cr001-c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495386.1"
                     /db_xref="GeneID:8202541"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:C5DRP2"
                     /translation="MKLLCYVQIFLSWFGLVLTASSNSNVGIQDNFPFTSVVDILSQN
                     VEFSTFLRAVQRNGFIPYLNELQNYTLMAPVNSAFIDNEPEDKNYKFDIENYLIHDSV
                     LLTSGIDQGISVISEGVKFPYVLEKLSDDTIIVNDVKLVDSDLLPNFQNASVHGIGEK
                     INTPFGLRNFLQKIEHDFNDFHLFNNFTRNIPAVESITTNRTILIPSDYNWHNFFSEV
                     EINYITDAFNSLQRMEGDTRYIWNTDRQNFIQNIIIDKILGGMVPDVHYPENLNGDPL
                     DFQSERNGSVLLVNGSKSSDLSNMAFNRGLVHSFDNLEIIKDIISFTAEKYLHGINCS
                     DFVRELYFRNLQCLIRDSRETQGEEKTIFVPDVPSAAYDGFSRPGLLYHFVGSKIWLD
                     QEFSEENLGKSRMFESKFCDSDENLGGNCQRIKIIKDRGEYFINEKYRVIHEEPFQIG
                     NTLIYLVSDKMKLPGDLTPSINPFYGCSRSLMFLSQLNILDLPLNKEGYTILMPCFDS
                     WEFLELNLQFLENNMTAINSIMKNLIIDGLIYSDSKDTTFETKNLLGDSILVQAERLH
                     NGEGTELNLNLSSVGTKIKIKNDLDLFFSQGVVHPLGQLYLPKSVTVTLIDLIRTTGT
                     TQLIELFEKFDDLSSIIHGNKPYSLLVPTESSLSLVGDILNSTKLLNLLKLHVIEGDF
                     TSSLLHCEGNVTTLLGDSLFCRKDSQENYFLGVLNGAQREVRIMKKGCSSHNSCVFLI
                     DRPISLQWLNRRKIWFGLPRSPLGIAMLTETVILFIGLSLFFFKRKKVPGTNLVSPNN
                     DDAEITRPLIAPGENTSPDGRNET"
     misc_feature    788730..788896
                     /note="Centromere Zyro0B"
     gene            complement(<789250..>791592)
                     /locus_tag="ZYRO0B10098g"
                     /db_xref="GeneID:8202542"
     mRNA            complement(<789250..>791592)
                     /locus_tag="ZYRO0B10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495342.1"
                     /db_xref="GeneID:8202542"
     CDS             complement(789250..791592)
                     /locus_tag="ZYRO0B10098g"
                     /note="highly similar to uniprot|P54861 Saccharomyces
                     cerevisiae YLL001W DNM1 Dynamin-related GTPase required
                     for mitochondrial fission and the maintenance of
                     mitochondrial morphology assembles on the cytoplasmic face
                     of mitochondrial tubules at sites at which division will
                     occur also participates in endocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495387.1"
                     /db_xref="GeneID:8202542"
                     /db_xref="GOA:C5DRP3"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRP3"
                     /translation="MASLEDLIPTVNKLQDVMYDAGIDTLDLPILAVVGSQSSGKSSI
                     LETLVGKDFLPRGTGIVTRRPLVLQLNNISPDSPLIHEYQGSQTAEDVQENGEHEMTL
                     EDHLRKNNKNYQPPTHEEWGEFLHLPGRRFYDFKQIRQEIANETARIAGKDKGISKVP
                     INLKIFSPRVLNLTLVDLPGITKVPIGEQPHDIEKQIKNLLLEYIATPSCIILAVSPA
                     NVDLVNSESLKLAREVDPHGKRTIGVITKLDLMDSGTNALDILSGKLYPLRLGFVGVV
                     NRSQQDIQLNKTVEEALDNEQEYFNRHPVYRTISSRCGTRYLAKLLNQILMSHIRDKL
                     PDIKARLNTLIGQSEQELASLGDTGDITSENRAGLVLQLMNKFATNFISSIDGTSSAI
                     STKELCGGARIYYIYNNIFGNSLRSISPTANLTIMDIRTAIRNSTGPRPSLFVPELAF
                     DLLVKPQIKLLLDPSQRCVELVYEELMKICHNCGTNELARYPKLHSMLIEVVSELLRE
                     RLGPTRSYVESLIDIHRSYINTNHPNFLSATEAMADIVETRKRNGELLAKQKLQQKKE
                     FLQREIRKERDAEGIHESNPESPRVESDSTAESESDEDGDNADMKQSKDSFLKYFFGK
                     EQSSQDHQHHGGTHGHSRQQYSAQNDMNGQTLIDMKNLQINGSGAEQDSSDDSEENKE
                     PQLTEREELECELIRRLIVSYFDIIRQMIEDQIPKAVMCLLVNFSKETVQNRLVTKLY
                     KESMFEELLMEDQTLAQERDKCIQVLATYKKASNIISGTL"
     gene            complement(<791899..>793221)
                     /locus_tag="ZYRO0B10120g"
                     /db_xref="GeneID:8202543"
     mRNA            complement(<791899..>793221)
                     /locus_tag="ZYRO0B10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495343.1"
                     /db_xref="GeneID:8202543"
     CDS             complement(791899..793221)
                     /locus_tag="ZYRO0B10120g"
                     /note="similar to uniprot|Q07794 Saccharomyces cerevisiae
                     YLL002W RTT109 Regulator of Ty1 Transposition Regulation
                     of mitochondrial network Killed in Mutagen sensitive to
                     diepoxybutane and/or mitomycin C diepoxybutane and
                     mitomycin C resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495388.1"
                     /db_xref="GeneID:8202543"
                     /db_xref="InterPro:IPR013178"
                     /db_xref="UniProtKB/TrEMBL:C5DRP4"
                     /translation="MNHNQSQVLARLLESCLPKDEEFQVLQLQSLPTQTHSIVTPVPK
                     SESTPLTVKVQHFFSLFHQEKVIFALEIYVFLTLHNKDAPAERLIFVSKADTNGYCNT
                     KISFKSLTKNLIKYILSIDPNYYLQKVKPRERKYDQEADLLTQRTEVIKSLRILSKRH
                     LSSLDPPSIPNDFYLNLRFPPNYITKISLFTRPEPQYLFAESSRNKQKHCLDGSQLLQ
                     WWLSILDDILCQDFQVTAQARLQIPGEDSAQVNRHLKTVRFAGWQVGDIFGRHVGELA
                     AFTVPLFPDDPKTRFLRQLVEEGRIHTTNLATFWTELAQRQEFRLSVIASVIGVQGTL
                     LQASSHWPTSPLYQNQEEIYVADSKKQFAYIKSYITGEEYDTEEGALEAFANIRDFFK
                     IRLNRPVFSILGAKEPNSTSTDPSQTQTSNLKRVNVITTLQTRKKPKK"
     gene            complement(<793497..>794227)
                     /locus_tag="ZYRO0B10142g"
                     /db_xref="GeneID:8202544"
     mRNA            complement(join(<793497..794079,794163..>794227))
                     /locus_tag="ZYRO0B10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495344.1"
                     /db_xref="GeneID:8202544"
     CDS             complement(join(793497..794079,794163..794227))
                     /locus_tag="ZYRO0B10142g"
                     /note="highly similar to uniprot|P38624 YJL001W
                     Saccharomyces cerevisiae PRE3 20S proteasome beta-type
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495389.1"
                     /db_xref="GeneID:8202544"
                     /db_xref="GOA:C5DRP5"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DRP5"
                     /translation="MNGIQVDVNHLKKGEVSLGTSIMAVSFKDGVILGADSRTTMGPY
                     VANRVTDKLTRVHDKVWCCRSGSAADTQAVADIVQYYLDLYTAQYGEPSTRTAAAIFQ
                     QLCYENKDALTAGIIVAGYDEKNQGEVYSIPIGGSLHKQKYAIAGSGSTFIYGYCDKN
                     YKDGMTKDETVDFIKHSLSQAIKWDGSSGGVIRMVVLTKNGVERLIVYPEEFENL"
     gene            complement(<794448..>797459)
                     /locus_tag="ZYRO0B10164g"
                     /db_xref="GeneID:8202545"
     mRNA            complement(<794448..>797459)
                     /locus_tag="ZYRO0B10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495345.1"
                     /db_xref="GeneID:8202545"
     CDS             complement(794448..797459)
                     /locus_tag="ZYRO0B10164g"
                     /note="similar to uniprot|Q12369 Saccharomyces cerevisiae
                     YLL003W SFI1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495390.1"
                     /db_xref="GeneID:8202545"
                     /db_xref="InterPro:IPR013665"
                     /db_xref="InterPro:IPR018907"
                     /db_xref="UniProtKB/TrEMBL:C5DRP6"
                     /translation="MSFDESTDSILRGADFAQESAGSVSTEALINEDYIGTSTGSLVN
                     KDVRELLDQVFVQVPGRREEDDGVDNDSDNGNDYEDSEDVDRNQPPTSFLLPGSDMYR
                     PLETNGDRPSDLSRKPLTTIAEDMNDAYDQVQNSRKRMGQPQGNPIFSLLFNRIQVFL
                     LRNGMSLEFLKIFKKYIGHMIENGLDPLEDQYFLSLQNELSESFEFTPMMEDILNKFL
                     LRPENLIMKLSLFEHNSAHDLLRRYMKTWKLHGELKRSLAKLAGLWHEYVQRKFLIKW
                     NQKYEEFALHWVHQSQEFNKFTLVSFGFDKWLDKIDSNDARRGLADHYFLNHVFQRIK
                     KRRNALDSRKHRSRDFHDANVMKWTLSKWRLNYRETQFEGTSPSLQRGILERLKQRLQ
                     FYQSMNDRADIFKHNWQISPFLKKWHERTKSLDSQSAHLMELEQKFIKGKTIRIFKDQ
                     LGRRRQEYAVSEHLDTLFVRFVLQELWFKRFQERLHLYSLWSIQNERIEGKFFAQWKK
                     RLFTDLKAVELARTHALKWHLGKWRSELKCKLFIAKRSQRQQEAAFNKFSERAALEKR
                     ARKFQTAFLLKPIFSQWASRRNEDIRLRTIADMSHEQVLKIHFMIYWHHKLIFLRELN
                     QRAEILQRLRAVMMVKKGIAHFQEVKKLGDSFAKLMISKVFLSKHFNIWRGHLALKNQ
                     QRLQDLLQSYEQEQQFQLKSNFFSLWNRKSHFYQDVCISRADEIRQRSLQRVTLKAVR
                     QKLQNYAAQVEVSDNFRNNSVTLSTFYIWIVHLNRLTEMNTRLEVEINRKNLALLLNY
                     LNNWSMRILKSRRNYEAVQVFRNRWDRATVRGLLLVWRTRVEHSPGRQEIVQQDFEVK
                     TPIKKLSPKGSNTIPGSEGVKMHRIEAMKSHYSRVRRAIPSPVKSSLSLNSTAKKKIE
                     NEEDNVFFSSKQKQQQQNQRLPPPPRLSLERINKNLASKIDRINFERIPEVRLEPFIN
                     SDSQFNPIIDRSLLKVEEDEAEFDESPTRRS"
     gene            <797769..>799172
                     /locus_tag="ZYRO0B10186g"
                     /db_xref="GeneID:8202546"
     mRNA            <797769..>799172
                     /locus_tag="ZYRO0B10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495346.1"
                     /db_xref="GeneID:8202546"
     CDS             797769..799172
                     /locus_tag="ZYRO0B10186g"
                     /note="similar to uniprot|P41543 Saccharomyces cerevisiae
                     YJL002C OST1 Alpha subunit of the
                     oligosaccharyltransferase complex of the ER lumen which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495391.1"
                     /db_xref="GeneID:8202546"
                     /db_xref="GOA:C5DRP7"
                     /db_xref="InterPro:IPR007676"
                     /db_xref="UniProtKB/TrEMBL:C5DRP7"
                     /translation="MVQLSLWWLTVFLWSLKSVLCEQFQPPQVWENVEFKRLVDVEHV
                     YTIESLELTIKNIDNNANSEYFLALPKSTFDHLSIFSVQLKDKQVFIDSGFIEQTTQL
                     EDGSEVAYGIIQFPTPIEPNEDVVFNINMSYNVGGVPFPEHIALTDEQHLLLSTTRYP
                     LSAYETKRGTTEFFGSDDFQEFHPAKGYELEKRAPGLIGTWDNIRAFDKGPELQVLYS
                     HNVPMKQVVNLQRDVWVSHWAGTIQFEEYYELLNSGARLNKGFSRLEHMLDQQNMKLS
                     HYCGVLEMNLPEDSSEHYFTDKVGMVTTFRILGDNIYLKPRYPIFGGWKYNFTTGWTN
                     PLTNFLRVSEGGDHSYIISVPLLNGPEDTIYDDVTLSLYLPEGAKVETIGSATPSINT
                     DVTAQKSYLDLNNGHVKVTLNFKNLIDQVGTGELLVKYTYDHETAYKKPLNVAIYIFT
                     ALMGFFFLKSVNLNVSN"
     gene            complement(<799330..>801240)
                     /locus_tag="ZYRO0B10208g"
                     /db_xref="GeneID:8202547"
     mRNA            complement(<799330..>801240)
                     /locus_tag="ZYRO0B10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495347.1"
                     /db_xref="GeneID:8202547"
     CDS             complement(799330..801240)
                     /locus_tag="ZYRO0B10208g"
                     /note="highly similar to uniprot|P54790 Saccharomyces
                     cerevisiae YLL004W ORC3 Subunit of the origin recognition
                     complex which directs DNA replication by binding to
                     replication origins and is also involved in
                     transcriptional silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495392.1"
                     /db_xref="GeneID:8202547"
                     /db_xref="GOA:C5DRP8"
                     /db_xref="InterPro:IPR020795"
                     /db_xref="UniProtKB/TrEMBL:C5DRP8"
                     /translation="MNVNEFADAQRSHYTVYPTLKKRKKGGRRIPFVELLDGKELTQN
                     VERRWELYHQLHSHFHDQVTNIVENIEVDLKGEISNILFNENKRRDSKPCFNTLFLLG
                     SDSTTKIELPPTDSNVFKVLVELTPKESPNVRMMLRRSMFKLFTSADAELHSKAPVKR
                     ELNHESVSDYEESVEVKDEITGEGFQDEDDGAGQADVSYDLSLVENFKTLFGKNLNMV
                     FNFKDVDSINFHTLDNFIAVLKNALKNEHLQINLVFNINTNMSNIEKNLTQSTIRFLR
                     RNYHTLDVSSNKGFKYGNRIFQSFLDTVDGKLNLSSRFVDFLLSKMANNSNHNLQLLV
                     KILDYSLMSYFFHNPFSVFIDPVNIDFLNEDYLDMLIRCPTFMFFVEGLIKQNAPSEE
                     IRSLLTNKDSALAEFFAEFLVRENPINGYAKHVAGILENELHIYNYNLIELYYNLLVG
                     KLESYLERWPAYRNSEQKLKFEPIDTIFQELFTLDNNNELLSQALFPCYKSNLENDML
                     HWEHTLPLGQSKANNETLIKLDNSMAPVVGHMFKLYREANSLINVYDFYTTFRDTLPK
                     KEIMDFLDETSDIDSNIHRFFLNNEKDIVFDKVSLALFMQAIFDFDHMGIIKTQNNRN
                     YDVIEKCIWRGI"
     gene            complement(<801533..>801889)
                     /locus_tag="ZYRO0B10230g"
                     /db_xref="GeneID:8202548"
     mRNA            complement(<801533..>801889)
                     /locus_tag="ZYRO0B10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495348.1"
                     /db_xref="GeneID:8202548"
     CDS             complement(801533..801889)
                     /locus_tag="ZYRO0B10230g"
                     /note="highly similar to gnl|GLV|KLLA0F13024g
                     Kluyveromyces lactis KLLA0F13024g and similar to YJL003W
                     uniprot|P47081 Saccharomyces cerevisiae YJL003W COX16
                     Mitochondrial inner membrane protein required for assembly
                     of cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495393.1"
                     /db_xref="GeneID:8202548"
                     /db_xref="GOA:C5DRP9"
                     /db_xref="InterPro:IPR020164"
                     /db_xref="UniProtKB/TrEMBL:C5DRP9"
                     /translation="MPLGGRVFRSRRQQSAYEKSLSGRYQKRLNKNPFLYFGLPFCSL
                     VVLGYYWLSGFTAVRYEQHDRRVQELREEDIINVRTNKRPVDLKEEYYRLQGLADEDY
                     DIKRYPRQDGESENVW"
     gene            <802235..>804988
                     /locus_tag="ZYRO0B10252g"
                     /db_xref="GeneID:8202549"
     mRNA            <802235..>804988
                     /locus_tag="ZYRO0B10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495349.1"
                     /db_xref="GeneID:8202549"
     CDS             802235..804988
                     /locus_tag="ZYRO0B10252g"
                     /note="similar to uniprot|Q07798 Saccharomyces cerevisiae
                     YLL005C SPO75 Meiosis-specific protein of unknown function
                     required for spore wall formation during sporulation
                     dispensable for both nuclear divisions during meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495394.1"
                     /db_xref="GeneID:8202549"
                     /db_xref="GOA:C5DRQ0"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ0"
                     /translation="MDANIPASTAISNYLSDYIYTYLDIDDETSLLVLKFNEDKDKPD
                     SEFRNVTSSILSKFLNTTRTTRTGSAHQQAGISVRTFLSSMLVSALYFVVQVLLFTFL
                     RNKLKHLYQAKTVLHPIKNQNDEKLEIRTSGNKNVVQEFFKNTFGWVTMVIFCPIDKY
                     RDLAGLDAYFFQRFLYMLIFLFFSFSVINLPILIPIHYLSGFIDLQGLVDLPRDVQIN
                     TPWLDRINMSNIVLKDPNKLIFHLFLSIFVIVWFHIILISELKHVHEISRKIPLSAEY
                     QSILYVENIPESTQGNKIKITDFFNSISPDCLISIRFLPRRCDRLRKYYRELKDLETK
                     LEKLAMEIILEKYFLVANSKLGVNGDKIKRYWKRYQLFCNRVAFILKTPQRYRGYFKQ
                     TNWKTILYQSHKPWFQVRLKSKQLYIEERYNFFKLTSQKYQSHLKVWQEKCQALEKWN
                     NEQYLLEHKDCKSQVFLSKAFITFSCPAIAHTFDKLLTSGNIREWNNTLVGTNPHDII
                     WSNISVSNATIKFMRSALASTLCFLIIIGWVIPVAFIGLVSQIPYVASIIPLLSQVTT
                     KSELVNDIIAGIFPVVTLVFITEFVPFILRWFSYLKCCRTGAEMEIDIQKWFFVFLFI
                     HVFLVVTISSGISLVVERILYNPVSIPTLLAHDLPKSSNFFCSFVLIRGMAYSGGNLI
                     QLKELLFELFYYKITMYNPHKRWKRMRNIPIFQWGSIYPIFSVLGCIGIIYSVIAPLI
                     LPLCCIAFALVLFSFKYLFIYQVEEGTPSETFGRLYPQALMQLYAGVYCMEFCMMGLF
                     ALSNSYKLCTCMVVAFALTIVAHFKISEMYLSKVHGSPFQTHSQFFDKYDRLEENLNK
                     EFKIPFADGKHNACLWLPQDDAGITGRESAIFTREEITCDLEKCFLSPCGDIILNPQD
                     DCS"
     gene            complement(<804985..>806349)
                     /locus_tag="ZYRO0B10274g"
                     /db_xref="GeneID:8202550"
     mRNA            complement(<804985..>806349)
                     /locus_tag="ZYRO0B10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495350.1"
                     /db_xref="GeneID:8202550"
     CDS             complement(804985..806349)
                     /locus_tag="ZYRO0B10274g"
                     /note="similar to uniprot|P41800 Saccharomyces cerevisiae
                     YLL006W MMM1 Mitochondrial outer membrane protein required
                     for normal mitochondrial morphology and mtDNA stability
                     involved in tethering mitochondria to the actin
                     cytoskeleton and in anchoring mtDNA nucleoids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495395.1"
                     /db_xref="GeneID:8202550"
                     /db_xref="GOA:C5DRQ1"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="InterPro:IPR027537"
                     /translation="MESNYTGMDGNWALNGTVSVGNGTLISVDEFLHNALPMHLQALF
                     QDGNSQGPLLTMEDLEKAIEFKRASQELVNDNVLAPDGLFVELLRQQEKTLPRLISAT
                     SNTQGSFSSWSFAQGLIVGQVSVVLVLIFFIKFFIFSDSSTKTNPNPAKNSSSTNSLS
                     GLSSESRSFISPHFFTSIMNRKGNEQAESNDDENERSRQIDDILEKTYYNVDTHPAES
                     LDWFNVLIGQTIQQLREEAWKKDNIVYSLNAFIERKAQELPSYLDSIKITELDIGHDF
                     PIFSNCRIQYSPNSNGRKLEAKIDIDLNDRLAVGIETRLLLNYPKPLTASLPINVTVS
                     IIRFQACLTVSLTKAEEFVPTSPESVDEDDNDGYFLMFSFAPEYRMEFETQSLIGARS
                     KLENIPKIGSLVEYQIKKWFVERCVEPRFQFIKLPSVWPRSKNTREGKADVDESEPGR
                     ETHY"
     gene            <806663..>808594
                     /locus_tag="ZYRO0B10296g"
                     /db_xref="GeneID:8202551"
     mRNA            <806663..>808594
                     /locus_tag="ZYRO0B10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495351.1"
                     /db_xref="GeneID:8202551"
     CDS             806663..808594
                     /locus_tag="ZYRO0B10296g"
                     /note="similar to uniprot|Q07799 Saccharomyces cerevisiae
                     YLL007C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495396.1"
                     /db_xref="GeneID:8202551"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ2"
                     /translation="MDDAYRVQQLLAQNENLSFDQSRESLKVILRTIDETNDPFQFDF
                     AQFLLNCDGKILCREATPETHFWEIFEETMSESPPETLAICLTRICTLSLRESGVYLE
                     AVVHLCRFLSSSEIILPILCANLSTQRSSIRLNFDILESIDGVLRCLTCLCESDKVNA
                     AIIIPSCFFMFHDCGFWSILISLLPMEELQSEILEVILPLRDKISKFMSALTLKEYAT
                     PLETKMFEAVEDALSLDSSMKEKFEEVNQGYNDLRSIKLINAYHLVVFLKNSNLSFKK
                     TLGEELLFVNNPFPLYKAFFNILDQLDQFLDFKTKDILTTLYHAAFLLSKDAFIYALM
                     DKLLKMWVASQGKTRKDMDSLLETVPIMLDQVDKSMKRPSDISPRGSVIIALETLEGI
                     DYGIARQLQLESIKEKHYNKWSNSIGDFDELLSEQVHDYVRHQRLLQLQKGAWVYSES
                     PLDRHIRSPKVYFMVLSANQINLLVREFPAKAEITPHVEENQIFSNTEKDHAAFEKTV
                     VIPLHNIVDFEVNELQTDNKVPDDARLVNVIRKDFYTGVNFLDKYRRVVLKVYFDTKE
                     DTIVWLDGLKLVSPFKIKQSITDDTQKQMDTLVSIRRNAQMLNLDISDGNEITDSNDD
                     EEYYHADTLKDLTSSFYYE"
     gene            complement(<808717..>810969)
                     /locus_tag="ZYRO0B10318g"
                     /db_xref="GeneID:8202552"
     mRNA            complement(<808717..>810969)
                     /locus_tag="ZYRO0B10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495352.1"
                     /db_xref="GeneID:8202552"
     CDS             complement(808717..810969)
                     /locus_tag="ZYRO0B10318g"
                     /note="similar to uniprot|P32892 Saccharomyces cerevisiae
                     YLL008W DRS1 Nucleolar DEAD-box protein required for
                     ribosome assembly and function including synthesis of 60S
                     ribosomal subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495397.1"
                     /db_xref="GeneID:8202552"
                     /db_xref="GOA:C5DRQ3"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ3"
                     /translation="MVNAVAKKGKLDLDFVPTISDSEDALPDLESSDDDENHMNDTPA
                     KPQASTKKSKKNNKKKSSTDDVEDENVNKDLNPEFRFDLEGNDIVSNLQAWNFVGDEP
                     DGDNVKKDVDLDGIIRRKGGLIKTIRVDGESDEEKNEVEEEEENSEDGGEENSEDDDE
                     LAMDGFGMGAVNKDEEDEEEDENDSGSEDEKDQVEEEDEEDEDQAQKQEEEEDSPEEM
                     AKFYAPQSESEEAKKKVFNNFNSLSLSRPVLKALGDLGYATPSPIQGATIPIALLGKD
                     IIAGAVTGSGKTAAFMIPIIERLIYKPAKVASTRVIVLAPTRELAIQVADVGKKLGKY
                     VNGLTFGIAVGGLNLRQQEQILKTRPDIVIATPGRFIDHIRNSSSFNVDSVEVLVIDE
                     ADRMLEEGFQDEINEIMHLLPSKRQTMLFSATMNSKIKQLVSLSLKRPVRVMTDPPQQ
                     AVSKLQQEFVRIRKRDHLKPSTLFYLIKKLDGAAQKRMVVFVSKKEMVHRLRIILGLL
                     GMAVAELHGSLNQEQRLQSINKFKSLEVPVLICTDLASRGLDIPKIEVVINYDMPKSF
                     EIYLHRVGRTARAGREGRSVSFVGETSQERSIVKSAIKSAQESGEKNLPVGRNVDWNQ
                     IEEINKTVESMSDTVKDILDEEKQEKEILQAEMQLKKGENLIKHKQEIESRPKRTWFQ
                     TETEKKNSKGMGSLPKNTLNSKKRKRQEALEEKTRPYKKTQKNRSEDQERSFRRQNGK
                     KMKDKKKGKK"
     gene            <811259..>811870
                     /locus_tag="ZYRO0B10340g"
                     /db_xref="GeneID:8202553"
     mRNA            <811259..>811870
                     /locus_tag="ZYRO0B10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495353.1"
                     /db_xref="GeneID:8202553"
     CDS             811259..811870
                     /locus_tag="ZYRO0B10340g"
                     /note="highly similar to uniprot|P41544 Saccharomyces
                     cerevisiae YJL004C SYS1 Multicopy suppressor of ypt6 null
                     mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495398.1"
                     /db_xref="GeneID:8202553"
                     /db_xref="InterPro:IPR019185"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ4"
                     /translation="MFTLRRYLRIPRELRLSEIFKQDSLSPAKIALQIILLQIFYYTT
                     ASILFYFWAKLMGYQVEIKKWLFTWEYINYTNTSGISLSMLWLFDALICVIFLTVIVG
                     RSKLAWDFAITIHAINFIVVLTNTHTFPSFSWFFLQILSSLILVFLGTWTTRWKELRD
                     TFFEGLVDPSGITLPEGTQEVRPAGDGNDNQQPIEMKDLEAQK"
     gene            complement(<812053..>818526)
                     /locus_tag="ZYRO0B10362g"
                     /db_xref="GeneID:8202554"
     mRNA            complement(<812053..>818526)
                     /locus_tag="ZYRO0B10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495354.1"
                     /db_xref="GeneID:8202554"
     CDS             complement(812053..818526)
                     /locus_tag="ZYRO0B10362g"
                     /note="some similarities with uniprot|P08678 Saccharomyces
                     cerevisiae YJL005W CYR1 Adenylate cyclase required for
                     cAMP production and cAMP-dependent protein kinase
                     signaling involved in cell cycle control and glucose and
                     nitrogen repression of sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495399.1"
                     /db_xref="GeneID:8202554"
                     /db_xref="GOA:C5DRQ5"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ5"
                     /translation="MFRRGDKSQDAGKKQHRVDTPLARSTSSVSMDSKDLRSTSSRTH
                     GSKRLGDSDDGAVDRPRARSNPNEKGITRGAWAEPESIAPSGEKSINTGGIGGVGGNL
                     DTSHLNTQQQQPRYKTKDSRIRKGPELFKKTLSSLSLSSAASEDDAMPSPQDQTHSQH
                     HQDSQQQQQQQQQQQQPIHTTSSATSDGNVRTHPHSRHGSQNEGAIAPPSRKHSLAGS
                     FFKKLSGAGNSDGESNGKDSSSPHNHKQGYFRSVHPHGGLHTSFYNNIASAAGGIRDT
                     RDTGSNTGASSGTGCTNGSNAGPDGNTTETVPNSLRRKVSTLVHGFGHESEQPSSHSG
                     RRPLHHDKNKGNKRESDNISMVSSARPRLSATSSRRNSATSTFTNNSTAPVQPRSPSL
                     KRESPPKEPAGHLNSTSSAPPAASSGASGASGSGAGSFFPLDTNLENVSDITKAPELS
                     RRPSAAYEGYHNPNDNRASISGAPSQSVTHVNSNSDIAALPTSMTMNSNPLSARQQWI
                     APESWDVDSNVDIRRAKKHNKSVLLQEQLASQRRLKQQHGQQQPQLPSQPEVQQNHQQ
                     QQQQQQQQQQFGKFGDAYFEVPNQNEFTSGISSTNDSDNSSLVDFSDSSSSDLDYASD
                     VENYLEQSADKKTDAGGGSPQLPPDFEQQLQQQKQEVQPPPLKLNYNTGLNSSGDARQ
                     SLGEALNQSPQDMKYYEGLRQQEKRQEAEGVQWNQGMLHEKQMNQQHQLKDQPQGQLQ
                     QQNQQQELAPGKGPFNDLQANLRQPSNPPKTLSKVLGAGTRDQEVMKLSSDDEKHDRV
                     EYELERYYKDFSDLNPKRHYAIRIFNTDDTFTTLSCTPATTVRDILPSLKRKFNVTSQ
                     GSFQISLKVGKLCKILRPLSKPIIIERKLLLLNGYKKTDPLHIMGIEDLSFVFKFLFH
                     PVAPSHLTPGQEQRLMRGDFIHVDLRGMDLTTPPIIFYQHTSEIESLDVSNNANIFLP
                     VEFIESATKLSSLRMVNIRASKFPINICDVDELVSLELQRNFIRRVPHAISQLANLTI
                     LNLQCNELDKLPRGFSQLKNLQLLDLSSNRFVHYPEVVNECSNLLQINLSYNKIHTLP
                     PTTNKLVKLAKMNISHNKLALIPNLSGMKNLRTLNSQHNRVARIKTGAPNLQNLSLTD
                     NRISTFDDVLPKLKTLELQENPITSISYSGFSSMNMTSLSLSKAKLSSLPDELFVELR
                     CLEKLDLSENNLTKLPEGFCQLNKLVHLSVARNKLQKLPKDFHNLKNLKTLDLHSNNI
                     RDFATGMEDLDLTFVNISSNMFGNSCLMGQFCQNISADRRLSKSLEFLVAADNQFNDQ
                     MWPFFNCLTNLKVLNLSYNNFQDISNLKLENLSGLYFSGNKLATVSGDVVLKWKNLRT
                     LMLNGNYLLSLPAELSQLTDLRVFDVGSNQLKYNISNYHYDWNWRENKQLKYLNFSGN
                     RRFEIKSSVNHDIKTDFSDLTVLPNLKVLGLMDVTLNTTKVPDENINFRLRTSGSIIN
                     GMRYGVADTLGKREFVSSRDVTFERFGGKDDECLLCLHDGKNQYADYGHNIARLVRDI
                     YDKILLRQLEKYGDSDMGIRKALRFSFLQLNKEVNGMLSHVDDGSAMANLSSADLLSG
                     ACSTVVYIRGNQIYTANIGDCMAILSKTNGDFQKLTCLHVPYKREEYERIRISGGYVN
                     DYKLDGVVDVSRAVGFFDLLPHIHASPDISMVQLTKADEMLVIATHKLWQYMDFETAC
                     DIARENSSQPMLAAEAMKDHAIAYGCSDNLTIMCLSLHKDDEQQNRFTLNRNSLITRR
                     STFEDATLRRLQPEISPPTGNLAIVFTDIKSSTFLWEMFPNAMRTAIKTHNDIMRRLL
                     RIYGGYEVKTEGDAFMVAFPTPISALVWCMSVQLKFVEAQWPEEITSIQDGCLVIDKL
                     GNKIYQGLSVRMGVHWGCPVPELDLVTQRMDYLGPMVNKAARVEGVADGGQITLSSDF
                     LSEFNKIMNFHETVVKDKCPLKEVYGEEFVGEVLEKEISMLESIGWEFFDHGEQKLKG
                     LETKELITIAYPKSLVSRHNFITKDEEARLLNEEFISRLRSVSRRVESVLSAVSKGSV
                     DEHRKPGRLSSIDENVKSSVRFLNSEKDATAFFDDLITRLESYIALLKLHQVVHKGLR
                     VNDQSAQELGTNIFDLLDAVLEKIQ"
     gene            <820264..>821265
                     /locus_tag="ZYRO0B10384g"
                     /db_xref="GeneID:8202555"
     mRNA            <820264..>821265
                     /locus_tag="ZYRO0B10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495355.1"
                     /db_xref="GeneID:8202555"
     CDS             820264..821265
                     /locus_tag="ZYRO0B10384g"
                     /note="highly similar to uniprot|Q07938 Saccharomyces
                     cerevisiae YLR017W MEU1 Methylthioadenosine phosphorylase
                     (MTAP) catalyzes the initial step in the methionine
                     salvage pathway affects polyamine biosynthesis through
                     regulation of ornithine decarboxylase (Spe1p) activity
                     regulates ADH2 gene expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495400.1"
                     /db_xref="GeneID:8202555"
                     /db_xref="GOA:C5DRQ6"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ6"
                     /translation="MRNSCIRLRQLLRSKMTNSTLPTHFDGEIDLGIIGGTGLYKLDC
                     LEQVAILPEVQTPWGKTSSPITISKVTGGRNPFHVAFLARHGLHHQYPPSKVPFRANI
                     AALKHLRCKAVLSFSAVGSLQSYIKPRDFVLPQQIIDRTKGLRDHSYFNDEGLVGHVM
                     FGDPFSRSFADYIHGFHHVLENPDSPLPCLLHHDRELTVVCMEGPQFSTRAESRMYRN
                     LGAHVINMSVIPEAKLARECELPYQMVCMSTDYDAWKEHEEPVTVESVMSHLANNGRN
                     ANSLASNVVQSMARELPEFMKSGDGLKGSVKFSISTKPEAMSKETLQKLRFLFPDYW"
     gene            complement(<821336..>822406)
                     /locus_tag="ZYRO0B10406g"
                     /db_xref="GeneID:8202556"
     mRNA            complement(<821336..>822406)
                     /locus_tag="ZYRO0B10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495356.1"
                     /db_xref="GeneID:8202556"
     CDS             complement(821336..822406)
                     /locus_tag="ZYRO0B10406g"
                     /note="similar to uniprot|Q7LGY6 Saccharomyces cerevisiae
                     YLR018C POM34 nuclear pore integral membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495401.1"
                     /db_xref="GeneID:8202556"
                     /db_xref="InterPro:IPR012578"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ7"
                     /translation="MVELATPSRPISREQFTSLRQRVAKDSPKLYKNKILSGPNGQLD
                     VHTNQHKLSHTGGKGTPVATTSTVTRSSPPISQVPASTSNEIGSFENPVLHTLAQRTV
                     NKEWETQRLVVNIIAWAIWDLLSKFCSTLAKHSKIGKEWVSWINRELVQRNINSNNSI
                     VGFFNRFYNRYPSLWNKLNWSNLNFMFHLIVIINILFSLRRLLSKVKTDDLPLNENQR
                     QLLGVVDQSDDSIVHHELVKESELVSSKESNTAPPEPPNTPFLFKSLETPMKSRQKQE
                     ADSIISKNVTQSAFVNRVNAFGLSQSALSNRMHPNTKNISNSSTGLFPSGLAATPAGK
                     TGYIPSSKYTYMMNSPTPRKKT"
     gene            <823155..>824603
                     /locus_tag="ZYRO0B10428g"
                     /db_xref="GeneID:8202557"
     mRNA            <823155..>824603
                     /locus_tag="ZYRO0B10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495357.1"
                     /db_xref="GeneID:8202557"
     CDS             823155..824603
                     /locus_tag="ZYRO0B10428g"
                     /note="similar to uniprot|Q07800 Saccharomyces cerevisiae
                     YLL010C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495402.1"
                     /db_xref="GeneID:8202557"
                     /db_xref="GOA:C5DRQ8"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ8"
                     /translation="MGFISSIFCCSSDSSQATSKWDNRQLNPRSQQLKGQQQASNKAN
                     LYSTRGMSTSTNSNLNLKSNSNTTAPSHLPRSKQQPNNSADSNKFTRQPSVKNSADNQ
                     DLQRMEALEKNRDNGTNNNDGISFSSLNSTPKTSEKSDRDERSSRKSKDDIKEKEKDI
                     QAGKEENEKEKELQNHSGSGEVEKQGVYVYAGDTDTSTGGSSYDHHSQLPQSTTATTV
                     TGSNQVSQSPDSQETTTTVQEGENVSSSADDTDVALNQSKSHEDEVDPDMDVDAVPPY
                     GEEEEFVDLTELQLGQYHAAGCNTLLPPQSKHLSGKKCLVLDLDETLVHSSFKYLKGA
                     DFVLPVDIDDQIHNVYVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKHK
                     SVHHRLFREACYNYEGNYIKNLSQIGRPLSEIIILDNSPASYIFHPQHAIPISSWFSD
                     THDNELLDIIPLLEDLSEQSVPDVGKVLDITI"
     gene            complement(<825240..>826688)
                     /locus_tag="ZYRO0B10450g"
                     /db_xref="GeneID:8202558"
     mRNA            complement(<825240..>826688)
                     /locus_tag="ZYRO0B10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495358.1"
                     /db_xref="GeneID:8202558"
     CDS             complement(825240..826688)
                     /locus_tag="ZYRO0B10450g"
                     /note="highly similar to uniprot|P33750 Saccharomyces
                     cerevisiae YLL011W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495403.1"
                     /db_xref="GeneID:8202558"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007287"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DRQ9"
                     /translation="MKIKTIQRNPDDYVPVRNTQESQLPRNLDPELHPFERAREYTKA
                     LNATKIERMFAQPFVGQLGYGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSSSEE
                     LCSFKAHYGIVTGLCVSPVLASKNKNLQYMLSCGDDKTVKLWSVDTDDYADVKDDQNL
                     NTRGLLKTFYGDHSFQGIDHHRSNSAFVTGGAQIQLWDTSRSKSTSNLSWGADNITSV
                     KFNQNDSNILASTGSDNSIVLYDLRTNSPTQKIVQQMRTNSLCWNPMEPFNFVTGNED
                     HNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPTGDEIVTGSYDKTIRIFKTNHGHSRE
                     VYHTKRMQHVFQVKYSMDSKYIVSGSDDGNVRLWRSKAWDRSNAKTSREKNKLEYDEK
                     LKERFKNMPEIRRISRHRHVPKVVKKAQDIKRIELNSIKRRDFNERRTKKDKPFVPER
                     GKQIIGTVHQYEDKPRRKNRDEDEENPSGNEE"
     gene            complement(<827010..>828617)
                     /locus_tag="ZYRO0B10472g"
                     /db_xref="GeneID:8202559"
     mRNA            complement(<827010..>828617)
                     /locus_tag="ZYRO0B10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495359.1"
                     /db_xref="GeneID:8202559"
     CDS             complement(827010..828617)
                     /locus_tag="ZYRO0B10472g"
                     /note="similar to uniprot|Q07950 Saccharomyces cerevisiae
                     YLR020C YEH2 Steryl ester hydrolase catalyzes steryl ester
                     hydrolysis at the plasma membrane involved in sterol
                     metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495404.1"
                     /db_xref="GeneID:8202559"
                     /db_xref="GOA:C5DRR0"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DRR0"
                     /translation="MLRILIDIYYKLISGIILNCFLTAVAILALWHNFVTVHFRRRHD
                     YRDTRSSRTHIKRPTSTTSGGGSRAHRSGSISSSSPLNDEGNLEEDPENNIEFDHTIT
                     SFETRPDEARTFNECNYEGKPTKELEDNPFQDILAAEDLKLVPNLKYYYAQYGIAIEE
                     FEVETDDGFILDLWHLKHDDEKSLHPVLMLHGLLQSSGSFASSGRKSLAYFMHQSGFD
                     IWLGNNRCGLKPKWNKSKFKNDKRRKWDWDIHEMVKFDMKALVNTVLEKTQYEKLTLI
                     AHSQGTTQGFYGLTNGEVLYGDDEFRLADKLENFVALSPACYPGPLIFEKSFIKFMSL
                     GIDHKWCFGNKSFLPMMLFAKKITKGVVIIPFMSYIMFNYLFDWNDSLWDRPLRDRHF
                     LFSPVYISNKLMQWWLSPSKHKVSFKNGADIMFPPDKTWLPVENGAPVEKPVKPHLNS
                     TRQNVSDFPHIMMFIPRQDRLINGEKLINHFIQHESHSLFKIWYIDEYSHLDVLWAHD
                     TIERIGRPLVANLRLPKVSNKEATIEQ"
     gene            <828832..>829305
                     /locus_tag="ZYRO0B10494g"
                     /db_xref="GeneID:8202560"
     mRNA            <828832..>829305
                     /locus_tag="ZYRO0B10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495360.1"
                     /db_xref="GeneID:8202560"
     CDS             828832..829305
                     /locus_tag="ZYRO0B10494g"
                     /note="similar to uniprot|Q07951 Saccharomyces cerevisiae
                     YLR021W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495405.1"
                     /db_xref="GeneID:8202560"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:C5DRR1"
                     /translation="MYHKEFTVEFPKDVLPGGELELHSVHFNNKILLQVRYNGEMDAT
                     YEVVPRGLEPLQRPLAGFSVDEDDFSGDHMSDWQVICRLGDSNDAQLPVVCTQIGELY
                     RRVIIPSNVDGLYQNDEIQSRGLVITMSSKMWKGNDKNFDKLIFVLGSIKQMYNS"
     gene            complement(<829319..>830050)
                     /locus_tag="ZYRO0B10516g"
                     /db_xref="GeneID:8202561"
     mRNA            complement(<829319..>830050)
                     /locus_tag="ZYRO0B10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495361.1"
                     /db_xref="GeneID:8202561"
     CDS             complement(829319..830050)
                     /locus_tag="ZYRO0B10516g"
                     /note="highly similar to uniprot|Q07953 Saccharomyces
                     cerevisiae YLR022C SDO1 Protein required for cell
                     viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495406.1"
                     /db_xref="GeneID:8202561"
                     /db_xref="GOA:C5DRR2"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018023"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:C5DRR2"
                     /translation="MPINQPSGQIKLTNVSLVRLKRERKRFEIACYQNKVQDYRKGIE
                     KDLEEVLQVHQVFTNVSKGDTANKEDLQKCFGTTDQDSIIKEILAKGEIQLSEKERQL
                     EINKINNEMLTIISAKCINPKSKKRYPPSMIHKALVELKFSPVLNKPAKLQALEAIKV
                     LTRTQLIPITRARMKVKVTMNANKPETIEQLKNHVKGTEETSSDAQIWSMTGLIDPVS
                     YRELVSLCEQGGQIQVLDMAVIDST"
     gene            complement(<830311..>831906)
                     /locus_tag="ZYRO0B10538g"
                     /db_xref="GeneID:8202562"
     mRNA            complement(<830311..>831906)
                     /locus_tag="ZYRO0B10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495362.1"
                     /db_xref="GeneID:8202562"
     CDS             complement(830311..831906)
                     /locus_tag="ZYRO0B10538g"
                     /note="some similarities with uniprot|Q07959 Saccharomyces
                     cerevisiae YLR023C IZH3 Membrane protein involved in zinc
                     metabolism member of the four-protein IZH family
                     expression induced by zinc deficiency deletion reduces
                     sensitivity to elevated zinc and shortens lag phase
                     overexpression reduces Zap1p activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495407.1"
                     /db_xref="GeneID:8202562"
                     /db_xref="GOA:C5DRR3"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:C5DRR3"
                     /translation="MQSEAPLSSLRPINFNTIHKLRRRVKIGSVSVFNNKYCNAISNA
                     IGRGHNGKDKNKDDEKEDEKNEAEAEGEDKDEEEDDFYDQDERKPFARSSTPEYLLSQ
                     KVKNTYKNGRLRDSKSITPNDSNISLLSEANTLVGSSTVVNENNSDENNGGRLSWSLN
                     SSSSSPTVHSSSITSGGELCSTDVKTYIRNFNHSAAYQLGHKCHLHYYQLPFPYRENK
                     YIIHGYRFYASHKKSFLSIINWYGWHNETSNIWTHLLGGLYLIYLAFYHFPHSNIWLS
                     DRVPKPAKCIVAVFLAAAIKCMFASVFWHTFNGTHLLRLRSKFACVDYTGITILITAS
                     ILTVEFVTMYDYKISLLFYMICSLALGIIGVSMNWSPKFDRPEARPLRIKFFILLATV
                     GCSSFIRLVFLTNWRYAADLLTPLTNKSVVWYLIGVFFYGSFIPERFRTDILTDKSIP
                     TEKQLSTDLDIVTKHRDIHFREKPTIHPRSQCCQHHAGSFKSLWWVDYVGCSHTLWHF
                     FVLLGVIGHYNAIMDMFTKRWIL"
     STS             831636..831719
                     /standard_name="ha2077"
                     /db_xref="UniSTS:515481"
     gene            <832838..>835597
                     /locus_tag="ZYRO0B10560g"
                     /db_xref="GeneID:8202563"
     mRNA            <832838..>835597
                     /locus_tag="ZYRO0B10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495363.1"
                     /db_xref="GeneID:8202563"
     CDS             832838..835597
                     /locus_tag="ZYRO0B10560g"
                     /note="some similarities with uniprot|Q02601 Saccharomyces
                     cerevisiae YLL013C PUF3 member of the PUF protein family
                     which is named for the founding members PUmilio and Fbf"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495408.1"
                     /db_xref="GeneID:8202563"
                     /db_xref="GOA:C5DRR4"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DRR4"
                     /translation="MSVMSNVDPWFGTRIDDDGDNHLKSNSGNMDAELASIVSSLSAL
                     SNPTHNNNSNNSNNNNNNTSGVSERRGSAQLGGFRRPSLGYTAATATASPVGAPATTA
                     TNPSVAAAAAAAAAAGGSAATTSDQDLLMYSTMGAAGVPEDAASSQSSSPIVTRRTAL
                     SVGTAPPYNSSYHQHRLHHDETTSLSGQHFFGNNNRMNFMGHYSASIAGPILFNHNDG
                     NGSSSNSGGGFFEKFGKSLIEGTKELESGSDNATDVPTVPQPNGYENSVADSQKNLVS
                     PLQGIRRTSVTSNSTASESLEQFTDVNNKSKKNIWNVASAPIFKPDTNISDQFLIPPQ
                     QEQQHQQQQQQQQQQQQTSPNPSPFTAPFLPQFLPSTISPPPIPPPSLSSAATPPPEA
                     SLLQNPYLYLGNDLYPGMSAPPPPLAQDQPVNTLHPVVSPNSTATAQGTRPPVGAPLG
                     KRNVQGKNPSKKHQANPYLDSANNPPTNTTSSRNIGTLPNPFHSKTNSNNGNNNHNGN
                     NNNNNNGGGANNNKRKNNGSNKVNSPLPTNSKLKNGPNSGKWSNYYTVRSPVLDEFRS
                     NPTDKTYKIKDIVGYVLEFCQDQHGSRFIQYELASASPSEREVIFNEIRDQAVELSDD
                     VFGNYVIQKFFEFGSKTQRDILVNQFKGKMQELSMQMYACRVIQRALEFIELEQRIDL
                     VQELSTCVLEMIKDQNGNHVIQKAIESIPMTELPFILNSLDGQIYHLSTHAYGCRVIQ
                     RLLEFGSENDQTRIFREIKDFIPFLIQDQYGNYVIQHVLQQDGSNCLREMAETKQDIV
                     NIVSQTVVEFSKHKFASNVVEKAILYGTRDQRRLIMSKVMPSDESSAANLEENAPLVL
                     MMRDQFANYVVQKLVGVSEGEDKRLIVVAIKSYLEKLNKSDAVGNRNLASVEKLASLV
                     ESITI"
     gene            complement(<835877..>836191)
                     /locus_tag="ZYRO0B10582g"
                     /db_xref="GeneID:8202564"
     mRNA            complement(<835877..>836191)
                     /locus_tag="ZYRO0B10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495364.1"
                     /db_xref="GeneID:8202564"
     CDS             complement(835877..836191)
                     /locus_tag="ZYRO0B10582g"
                     /note="similar to uniprot|Q12431 Saccharomyces cerevisiae
                     YLL014W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495409.1"
                     /db_xref="GeneID:8202564"
                     /db_xref="GOA:C5DRR5"
                     /db_xref="InterPro:IPR008504"
                     /db_xref="InterPro:IPR029008"
                     /db_xref="UniProtKB/TrEMBL:C5DRR5"
                     /translation="MSSIDEITSSDYVLGNKKSLLWVQDSTALVFGIGAGILQLESFK
                     GFAMFVVGYLSVALLYIIWICRLQPAKYYQSPINDIFIESFVRELTGYVMAWTFSYAL
                     VG"
     gene            <836385..>837536
                     /locus_tag="ZYRO0B10604g"
                     /db_xref="GeneID:8202565"
     mRNA            <836385..>837536
                     /locus_tag="ZYRO0B10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495365.1"
                     /db_xref="GeneID:8202565"
     CDS             836385..837536
                     /locus_tag="ZYRO0B10604g"
                     /note="highly similar to uniprot|P48362 Saccharomyces
                     cerevisiae YGR187C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495410.1"
                     /db_xref="GeneID:8202565"
                     /db_xref="InterPro:IPR007205"
                     /db_xref="InterPro:IPR007206"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DRR6"
                     /translation="MPTQLEELVSFLHSPQPAVKQIALDNLVGFSQGPTALVFKYDNC
                     RAIEDLKDLAKENSKILVQQSVTILANLCDDDLLRRRISNDVNFLEYLSWKICDFGNT
                     SADIMCILLSNLAKENTINKIFTFTRSERNEDQEKLPPLDRSIFKSNRVIDCLMDCFV
                     KGYDRKLNKYSTFDYLSYFFADISRFKAGRQYFIDTQEYDGVTPISKLLVFTEKYDSK
                     IRREGVASTIKNSLFDSETHQRLLEDESINLLPYILLPIASAKDSEIDEEDMFNLPEE
                     LQLLPEDKTRDPIPSIICVHLESILLLCTTKTGREFLRSKSVYPLVRELHKNVEDDDI
                     GELCYRIVNVLMRGEPESNQLEELPARSAEDQKNAEDSDDDDDEIVEVA"
     gene            complement(<837663..>839711)
                     /locus_tag="ZYRO0B10626g"
                     /db_xref="GeneID:8202566"
     mRNA            complement(<837663..>839711)
                     /locus_tag="ZYRO0B10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495366.1"
                     /db_xref="GeneID:8202566"
     CDS             complement(837663..839711)
                     /locus_tag="ZYRO0B10626g"
                     /note="similar to uniprot|P41895 Saccharomyces cerevisiae
                     YGR186W TFG1 Largest subunit of the RNA Polymerase general
                     transcription factor IIF (TFIIF) interacts with Fcp1p
                     phosphatase and with TFIIB potentially phosphorylated by
                     Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495411.1"
                     /db_xref="GeneID:8202566"
                     /db_xref="GOA:C5DRR7"
                     /db_xref="InterPro:IPR008851"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="UniProtKB/TrEMBL:C5DRR7"
                     /translation="MAYSRSGNGSSGVSPFIKPDRLRRNFLRARRSRGATPKTTIKKD
                     DPEIQEARERMMLHQGNSTMENGKIKVKEEAPEEFNEFPLRAVAKEELDNMRTHLLKF
                     QSKKGINPTQDFHLPIRLHRKDTRNLQFQLTRAEIVQRQKEITDYKKKQESERTGNKR
                     NNDNVAQNQTGEAVENHVDKRSPGSPPAGTQAGTEASPEDPSGAESPQGQGPSAGENP
                     SKPTEGMPVVTKLEEAGPAADPTKVGMVKYDGEEALDEQDDLATMDPLADVAPDGGGR
                     AKRGNTRRKTRQLKVLDENAKKLRFEEFYPWVMEDFDGYNTWVGSYEAGNSDSYVLLS
                     VEDDGSFTMIPADKVYKFTARNKYATLTIEEAEKRMDKKSGEVPRWLMKHLDNIGTTT
                     TRYDRTKRRLKAVNDQHGNDDGEHSDNSEVELDYDEEFADDEEAPIIDGDEKENKESE
                     QRIKKEMLQANAMGLRDENAPNEDEEDDLFNEKKIDEEGERIKRALQKTELAALYSSD
                     DEEINPYLSESDVENKEQSEQGNKENSEESPSSKKGSPKKNVGSSSSLNAHREPQIKV
                     KSIKDCVIVLKADKKVLTNFPGGDWNPELSKRKREDGTADAAENTPSKKVKLEENATP
                     LIAEQDIIDAIGDGKVNVKDFGKTIRRKYPGPDNKKLMVAIVKKLCRKVDDEHMELKK
                     "
     gene            <840299..>841501
                     /locus_tag="ZYRO0B10648g"
                     /db_xref="GeneID:8202567"
     mRNA            <840299..>841501
                     /locus_tag="ZYRO0B10648g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495367.1"
                     /db_xref="GeneID:8202567"
     CDS             840299..841501
                     /locus_tag="ZYRO0B10648g"
                     /note="highly similar to uniprot|P36421 Saccharomyces
                     cerevisiae YGR185C TYS1 tyrosyl-tRNA synthetase
                     cytoplasmic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495412.1"
                     /db_xref="GeneID:8202567"
                     /db_xref="GOA:C5DRR8"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002307"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023617"
                     /db_xref="UniProtKB/TrEMBL:C5DRR8"
                     /translation="MSFVVDPKESYELITKNLQEVLNPQIIKDVLEKENRPLKLYWGS
                     APTGKPHCGYFVPMTKLADFLKAGCEVVILMADLHAFLDNMKAPLEVVNYRAKYYEFT
                     VKAILRSIDVPIEKLKFITGSSYQLKPDYTLDIFRLANKVSQNDAKRAGADVVKQVAN
                     PLLSGLIYPLMQALDEQYLDVDCQFGGSDQRKIFVLAEETLGSLGYKKRAHLMNPMVP
                     GLTQGGKMSASDPNSKIDLLDSPKQVQKKINSAYCSPGAVEDNGLLAFVQYVIAPIQE
                     LKYGKEEFHFYINRPEKFGGPVAYDSLDKLFQDFKELKLAPPDLKTGVSDAINELLEP
                     IRKEFESSSEWQAALANGYPEVVPQTTKKAKKPKNKGTKYPGGNQQAKNAEGAVEEAS
                     EKLDKTTL"
     gene            complement(<841742..>847243)
                     /locus_tag="ZYRO0B10670g"
                     /db_xref="GeneID:8202568"
     mRNA            complement(<841742..>847243)
                     /locus_tag="ZYRO0B10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495368.1"
                     /db_xref="GeneID:8202568"
     CDS             complement(841742..847243)
                     /locus_tag="ZYRO0B10670g"
                     /note="similar to uniprot|Q07963 Saccharomyces cerevisiae
                     YLR024C UBR2 Cytoplasmic ubiquitin-protein ligase (E3)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495413.1"
                     /db_xref="GeneID:8202568"
                     /db_xref="GOA:C5DRR9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:C5DRR9"
                     /translation="MNYEITNVRDFLVHLPRLASYDYNEVVSYLVFKTLNLLFKCPAE
                     NIDWSSLVAIFESENWRDGTYKRIIQDVDWKSQIFPSTTNANHKGCMCSRICYPTETV
                     YYCFTCTTNPLYEICESCFDESKHVGHSFTAKIVVRPEGRVCHCGDPHVFKEPQFALL
                     CKNAENNGPRNPPNGYNELALEIISAVLDYLIDVTIYFEEQNESCRSTDSIKQIGNGL
                     STHRDHTVLKDSRDQTDEPYPIDMIWTLQIDEEDCQMHYMDLTAKIARILNKPTEYAI
                     SMTNMLENGAQSVTVLKSNDRSKLEQISLQFQNEGAKNHIRRINETFKRDLIEDLIEW
                     LCTIFSDESVSLETRASLRLCMLDKWNSGLLSTKLTSDRLSAFVSKINLLGGFLVSYE
                     QRDSFPWFKPWNFDFDVQDDRLSSVMSDYDNRLKSTDIPDSITRFHAFHGSRFQYILT
                     EFPNFSSRISRHRILKILCAMFTITDDARRCLAAQYLDVYLAVLYSAVASDPTGFKVS
                     MMGIFSQYTLQDPEIANIAIRSGFVQRTLRFAFTLMAFNPEDLVAYLPIPLYYGCKLP
                     IETIRNRRTIICFKDICILMSTNTIPQELMEDEGILNAIVESFSEFNNILPLKRETSE
                     HVEFENFDFSSYYFFFSSILIMTDGYVRSISLLLDPGSRKRTVYKLVNIAMEKEFKLL
                     GHFKRYSPYSSSPKAFIDKKLKNPGLRKVQENICGHTTDVVNFQVGVDTQNFFNPMSY
                     LFKFVLQWSQCGRYAPLPNGLKDCIDFQDLFQDKRKALDMSEASLSTLVLLGQINVGF
                     WVRNGTPITHQARMYTRYSMREFTYMSDIFNVQFSMVLSDPNDFFVTFLSRWGLKHWA
                     NGFPMGDFPDSETTVAMVNQCFLLLIQLFTEIKSLTMVSSIDGFEKTLKAEIIHALCY
                     KNCTYSQIMSNIPEHITKHAAFDLYLAKYTNYTPPSGLMDCGIYTLKPEFRIEIDPFF
                     IGMSSSKRYEAEKCIRLSMATKYKINYDDTFVPPRKVIDFLKNTPYFRLYAISSAETF
                     GLFLKNSLDHINKFEYESLLPAVVHVIHLCVVNNLNEFMKIFWHEYTSMEAADCYYQS
                     VGSILYSFLLKDHFSSVHGAIREIFRYLAETAPHVDATSYLQEQTHPFIADVLWSSNT
                     IKNSKDEEFERKKKMARIRKEKVIRRLNKQQMQFIENNSIPTTDDEEFKESSVESIPG
                     ETIGWEFPEDSCVFCKMPGEDDVFVYFSYQESNICDHNLDFRRVKDVTDAISHPEVGG
                     NFAAEEKKYHPSSLENFTATPQMKLTAQGAVMKTCGHGSHISCLGNHMKSIRAAHNQT
                     TKNVPVAYGFGLLYCPLCNGLCNSFLPKIIGSNCRIAKNFFENNLRYSAGEVPNLLLS
                     TSLKAARICEDLTEDLLASKRKPFEVINQIFVNTILNTELSLRSLPADNAIHEMPNQR
                     LLTLRLMSELKSILFKNRPSDTELVQVVKPSNLFELDEKKNELLLLASEIIESLEQNE
                     YSQSTMTPLSHLKELIKTKIWRDCVSLSKELLKVSFYQNYTGTTPWDVPIKSDEHSEV
                     EATMLVEVLKAQLFCLNPLITSSHLNGLNLIKSHLHQLIAGSFQIFLRRLCMIFYSRY
                     AVEMEYAREVDFSRELDFLLKYLQLPPLASIIQEFCEHDAEQCLESFKETLQGDITSN
                     VIENFAFTSPRTAKLIELPISLSHFALAEGNQVTQRAERDDISICLFCGKACHIQRSV
                     ALHGYVQGECTNHVRNECKIVSTYGVFLMMKSNAIYLSYGHRGCFYPTPYLHKHGEPD
                     ADFKFNNPVFLHSKRYEHLMNGIILGNMIPHIVFRLTDGNSDLGGWETM"
     gene            <848105..>853921
                     /locus_tag="ZYRO0B10692g"
                     /db_xref="GeneID:8202569"
     mRNA            <848105..>853921
                     /locus_tag="ZYRO0B10692g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495369.1"
                     /db_xref="GeneID:8202569"
     CDS             848105..853921
                     /locus_tag="ZYRO0B10692g"
                     /note="similar to uniprot|P19812 Saccharomyces cerevisiae
                     YGR184C UBR1 Ubiquitin-protein ligase (E3) that interacts
                     with Rad6p/Ubc2p to ubiquitinate substrates of the N-end
                     rule pathway binds to the Rpn2p Rpt1p and Rpt6p proteins
                     of the 19S particle of the 26S proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495414.1"
                     /db_xref="GeneID:8202569"
                     /db_xref="GOA:C5DRS0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR003769"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013993"
                     /db_xref="UniProtKB/TrEMBL:C5DRS0"
                     /translation="MSVISEIQSHLQRTLPSIHDIPHFRDVRGPTDRADMDRVLRELV
                     FRYLYFAITKKGEYLEVLFPDGGKGDEPDEFPHSFEDALNEMDASVFRDDSFYKIVEP
                     KFYQHCGRYCGRKFKVGEPIYRCHECGFDETCVLCIHCFNSKDHENHHVYMDICSEFS
                     NGICDCGDTEAFVNPLHCKAEEEDSEPHEDDSPESDVFLTGEMGQLFEVVLAEVFDHF
                     IDVFNQNIEPLPTLQKDITLKLREMIQQGRLTERAQFLNELAYSNDYLKATMPNRDES
                     LGTVEDLKNYTAIIYNDEYHNYSQATTALRQGVPDNKHTDLLTSRIDSEGRAMLKCST
                     DLSAVIGGFFAVQTNGLSATLTSWPEYIHQETCKYLILWLNHCLSIPNSKFQNGFRRA
                     MGEVLCAPYDRASQAVDKTPVVRKYFANKFNEADPYKYADLSILAEGNQIPLGHHKSL
                     PDSSTDSISPTLNVVVSPTSRYYQNSRLQHILYFDNRYWKKLRKDVQNAIIPTLAFNI
                     HYKQLFCHQVVEIFNHINRSVAFMDREPQLTSIRECIVQLFTSPSNAMMVFENGTFDD
                     IMWSVIDIFTEFSKLEGGSLIWQRVQKSNPTKSYGVVFRQGLYAVETLLSKVTDCNII
                     LRPKEFISAVTLFKLFNGAWKIKRKEGEHVLHEDQHFIPYLEYTTSIYSIIQTMEKVL
                     EHSRDNIDESLLLNAIRLLTTFLGHKTLTYKLVYDSHEIIKFEVSKQRVAFMNPVHTL
                     YSFLIEKIGLDKALNATQDCTDFLKVSDFSLRSVVLCSQIDVGFWVRNGMSVLHQSSY
                     YKNNAELSSYSRDIHLNQLSFLREDDDLPRVIYNMLDRWELLDWFSGAADYDHTVYDD
                     KVAAITQQFIAFVYQVLTERQFFKKYSSAKEKRMDNIKNALIYNLCIKPLSYSRLLRS
                     VPDYLTEDSSELESALEEVSDFVEPKGLADSGVLKLKDHLYSKIDPLKLLNMENEFET
                     TAKIIKTHLAKDKISATKIVLHPQILPPSQLDEKAAELGKFTRCDVFAKLIYKLLQVC
                     IDKQEGTFLYELLHLIHGIFKDDELCNGKDSLPQAYLSKPICNLLLSIANSKADVFSE
                     YVMRKADFLLEHMILKRPAEVFDSLITSFGRQYVDDYKTRKMNQGVNIEEDEKARKKR
                     LIKKRQEKLMAKFNTQQSKFMKENEYQFSSQAGNGLDEETDENKISESEEFTCSLCQD
                     NTSPDLFVIPAYHDQTPIFRTGNILNVKEFAVPWQGFYNDDQKLAYDDDNTAQESLGV
                     NGSLGSRKVVVSCNHSIHHGCFKRYVQKKRFSTNSFICPLCQTFSNCVLPIRHVSKVN
                     TGLSTEGLLSEEVSVDVLARLLETFSASDFKNVYSTFNLVALHSHSYDKNARNMPGFQ
                     NSDTAYILSVHWANTISMLEIAARLDEPSRGNLLKNREQKYKTLKNILICIVLMCYSL
                     GKPNPEFRPYENKDGVVWNQNQLFQYIVNKCLFSAEPLRETVTHALVNFSKQLVTEFI
                     KGIDLSNVEHMHEKAVELDGLHQIGNDDLLDTLKGVCALGVSDTELSKKVYDLAYTSL
                     LKNLYPTLRRCLVMLKCFHELLRTSHDEPLCVNGINFEDDEISQSLPHFVDKAMSALT
                     EFDSLNPLLAQGIPNMKPVEDSYLVDIPYEHCGIIKLIDLAKYLNTYVTNSKQIKLRE
                     EHSLRMKNVKNRLDYKICLTCGVKVHLRPDRHEMSKHLLKYCFKPFGAFLVPNTSEVC
                     LFLSQPTSTVFISAPYLNSHGEAGRNAMRRGDLTILNLKRYEYLNLLWVNNEIPGYIS
                     RVMGDEFRVNILSNGFFFAFNRDPRPRRAPAAGNGSDDDEEEDEADEAEFYSGHSSEE
                     DERDIEMGEDRIGGLFGGPEGGNVRGFLQVFENLQNVVGNGINGDDAQFAAPILQFFP
                     PQFGALNAQRNLGADADEDDEVLDDVADVEGDEPTQSE"
     gene            <854298..>854582
                     /locus_tag="ZYRO0B10714g"
                     /db_xref="GeneID:8202570"
     mRNA            join(<854298..854300,854373..>854582)
                     /locus_tag="ZYRO0B10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495370.1"
                     /db_xref="GeneID:8202570"
     CDS             join(854298..854300,854373..854582)
                     /locus_tag="ZYRO0B10714g"
                     /note="similar to uniprot|P22289 Saccharomyces cerevisiae
                     YGR183C QCR9 7.3 kDa subunit 9 of the ubiquinol cytochrome
                     c oxidoreductase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495415.1"
                     /db_xref="GeneID:8202570"
                     /db_xref="GOA:C5DRS1"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="UniProtKB/TrEMBL:C5DRS1"
                     /translation="MSFSTLYRVLFKRNSVFVGTVLASAFVFQASFDSAVTKWYETHN
                     KGKLWKDVKLQLQEGGDDEDEDEDDE"
     gene            complement(<854788..>855108)
                     /locus_tag="ZYRO0B10736g"
                     /db_xref="GeneID:8202571"
     mRNA            complement(<854788..>855108)
                     /locus_tag="ZYRO0B10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495371.1"
                     /db_xref="GeneID:8202571"
     CDS             complement(854788..855108)
                     /locus_tag="ZYRO0B10736g"
                     /note="highly similar to uniprot|P53299 Saccharomyces
                     cerevisiae YGR181W TIM13 Translocase of the inner membrane
                     mitochondrial intermembrane space protein mediating import
                     and insertion of polytopic inner membrane proteins Subunit
                     of mitochondrial protein import machinery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495416.1"
                     /db_xref="GeneID:8202571"
                     /db_xref="GOA:C5DRS2"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:C5DRS2"
                     /translation="MGLSSIFGGSAPSQQQTVNPGSNTMPSGGVTDKVKSQISQELAV
                     ANATELVNKVTENCFEKCLNSPYTDRNEPCVDQCLIKYMRSWNIVSKAYISRIQQAST
                     SGEI"
     gene            855276..855346
                     /locus_tag="ZYRO0B10758r"
                     /db_xref="GeneID:8202572"
     tRNA            855276..855346
                     /locus_tag="ZYRO0B10758r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.56"
                     /db_xref="GeneID:8202572"
     mobile_element  856088..856375
                     /mobile_element_type="retrotransposon"
     mobile_element  complement(856564..857667)
                     /mobile_element_type="retrotransposon"
     repeat_region   complement(857814..858029)
                     /rpt_type=long_terminal_repeat
     gene            858091..858161
                     /locus_tag="ZYRO0B10846r"
                     /db_xref="GeneID:8202573"
     tRNA            858091..858161
                     /locus_tag="ZYRO0B10846r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.56"
                     /db_xref="GeneID:8202573"
     gene            <858531..>859176
                     /locus_tag="ZYRO0B10868g"
                     /db_xref="GeneID:8202574"
     mRNA            join(<858531..858552,858617..>859176)
                     /locus_tag="ZYRO0B10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495372.1"
                     /db_xref="GeneID:8202574"
     CDS             join(858531..858552,858617..859176)
                     /locus_tag="ZYRO0B10868g"
                     /note="highly similar to uniprot|P47064 Saccharomyces
                     cerevisiae YJL024C APS3 Small subunit of the
                     clathrin-associated adaptor complex AP-3 which is involved
                     in vacuolar protein sorting related to the sigma subunit
                     of the mammalian clathrin AP-3 complex suppressor of loss
                     of casein kinase 1 function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495417.1"
                     /db_xref="GeneID:8202574"
                     /db_xref="GOA:C5DRS3"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027155"
                     /db_xref="UniProtKB/TrEMBL:C5DRS3"
                     /translation="MIHAVLIFNKKCQPRLVKFYTPVYLPKQKLLLEQVHELISQRNS
                     DFQSSFLVTPPSLLTTSSDSDSLDDEDIQIIYKNYATLYFTFIVDDQESELAILDLIQ
                     TFVEALDRCFTEVSELDLIFNWQTLESVLEEIIQGGMVIDTNVSNIVSSVDELNRASE
                     QSDGSVARLASSSFSSALQAFASGGFAQWASGQ"
     gene            complement(<859251..>859694)
                     /locus_tag="ZYRO0B10890g"
                     /db_xref="GeneID:8202575"
     mRNA            complement(<859251..>859694)
                     /locus_tag="ZYRO0B10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495373.1"
                     /db_xref="GeneID:8202575"
     CDS             complement(859251..859694)
                     /locus_tag="ZYRO0B10890g"
                     /note="highly similar to gnl|GLV|KLLA0F15246g
                     Kluyveromyces lactis KLLA0F15246g and similar to YGR174C
                     uniprot|P37267 Saccharomyces cerevisiae YGR174C CBP4
                     Essential for the expression and activity of ubiquinol-
                     cytochrome c reductase ubiquinol--cytochrome-c reductase
                     assembly factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495418.1"
                     /db_xref="GeneID:8202575"
                     /db_xref="InterPro:IPR012420"
                     /db_xref="UniProtKB/TrEMBL:C5DRS4"
                     /translation="METPLWIRWLKVWGYGGAIIAGGCLLFKYTTPTDEEIINSLSPE
                     LRMQYEREKSLRQAEQQELMKIVKQTALSDDPIWKTGSIQSPWETSESPQAKNRQQFE
                     KLKADQVQKEELKRINEELAKIRQESTDQTQKIMDHSNKSWWKFW"
     gene            complement(<859995..>861473)
                     /locus_tag="ZYRO0B10912g"
                     /db_xref="GeneID:8202576"
     mRNA            complement(<859995..>861473)
                     /locus_tag="ZYRO0B10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495374.1"
                     /db_xref="GeneID:8202576"
     CDS             complement(859995..861473)
                     /locus_tag="ZYRO0B10912g"
                     /note="highly similar to uniprot|P32476 Saccharomyces
                     cerevisiae YGR175C ERG1 Squalene epoxidase catalyzes the
                     epoxidation of squalene to 2 3-oxidosqualene plays an
                     essential role in the ergosterol-biosynthesis pathway and
                     is the specific target of the antifungal drug terbinafine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495419.1"
                     /db_xref="GeneID:8202576"
                     /db_xref="GOA:C5DRS5"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="UniProtKB/TrEMBL:C5DRS5"
                     /translation="MVDSSLLNANSQVTYDAIVIGAGVIGPAVATGLARKGKKVLIVE
                     RNWSMPDRIVGELLQPGGLRALRSLGMAQSVNGIDAYPVTGYTVFYNGEHVDIPYPYK
                     SSVAPVEKLKDLVKDGNDKILDDSTLSSRDFEEDERERGVAFVHGKFLNNLRRIVGEE
                     PTVTRLQGNCVQILKNEQNEVIGTKVDVEGRGKVDFKAHLTIVCDGIFSRFRKELDSQ
                     HTPTVGSSFVGMSLRDAKNPFPMHGHVILGSNHMPILVYQISPEETRILCAYNSPKLP
                     SNVKSWLIKDVQPYLPDSLRPSFDEALSDGKFRSMPNSYLPAKQNDITGMCVVGDALN
                     MRHPLTGGGMTVGLNDVVLLIKKIGDLDFSDRETVLEELLGYHYERKNYDSVLNVLSI
                     ALYSLFAADNGNLKKLQRGCFKYFQRGGDCVSVPVAFLSGVLPKPFLLARVFSAVVLY
                     TVYLNIEERGFLGLPMALLEGITILFTATKVFTPFLYQELCG"
     gene            complement(<861789..>863393)
                     /locus_tag="ZYRO0B10934g"
                     /db_xref="GeneID:8202577"
     mRNA            complement(<861789..>863393)
                     /locus_tag="ZYRO0B10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495375.1"
                     /db_xref="GeneID:8202577"
     CDS             complement(861789..863393)
                     /locus_tag="ZYRO0B10934g"
                     /note="similar to uniprot|P40992 Saccharomyces cerevisiae
                     YJL025W RRN7 involved in the transcription of 35S rRNA
                     genes by RNA polymerase I member of yeast Pol I core
                     factor (CF) also composed of Rrn11p Rrn6p and TATA-binding
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495420.1"
                     /db_xref="GeneID:8202577"
                     /db_xref="InterPro:IPR021752"
                     /db_xref="UniProtKB/TrEMBL:C5DRS6"
                     /translation="MSAYIRGPICGVGNCPSRLWRIIDGRRTCQYGHVMEGDVEFNDE
                     DEDATNAGVVTRRLNLTTGATGNFQSSFNSSQLQNSQNEEGGKKIFGPEARLLFIRSL
                     QFTLKRQSRWLIEEQKLPQEFDKLVKIIWMKLLKSLENDDNNDEFGEQEDGQTFDSNE
                     DQDRFHELARRRKDKNRYRLSLVSTLAILYMSSVQLGIPIYTCDLIKWTMSGRLPYFK
                     SSEKLPESWRVQLPNYYLGVLEGGKGPQEGQLFTHIARLCTKTDFIKEFNHRVNYECL
                     IFKLVLSNVLPPEFYLFAIQLIRTTSEGHDFELNPDTKPQSWIDLQITAYFLLTIRWV
                     LMYDTESYQVRWIHALIQRQKRQEVSTDTIDQNILKLSQTQKPTQKVFEWTDEEMAQY
                     LSWAEEAFLPLQRNDERLKIDQRIAKRKLHKLFPLESETFNTTSSQVFQSKPSFLNEL
                     QERYAFFQGQFESTDHRREEQRVEDDRIKAINSFENLITQELVTEFSISLQQLRLAIK
                     NISHRCFHRLKQELNDKQTSTTADVE"
     gene            complement(<863654..>865900)
                     /locus_tag="ZYRO0B10956g"
                     /db_xref="GeneID:8202578"
     mRNA            complement(<863654..>865900)
                     /locus_tag="ZYRO0B10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495376.1"
                     /db_xref="GeneID:8202578"
     CDS             complement(863654..865900)
                     /locus_tag="ZYRO0B10956g"
                     /note="similar to uniprot|P53297 Saccharomyces cerevisiae
                     YGR178C PBP1 Protein interacting with poly(A)-binding
                     protein Pab1p likely involved in control of the extent of
                     mRNA polyadenylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495421.1"
                     /db_xref="GeneID:8202578"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:C5DRS7"
                     /translation="MKGNFNNRRRDHGGNNGNVSGGPGASAGGGRSGGSSGGGGPSTF
                     YENSEISKGFNDRLDYLFANSIGSEAIATVTSGAKYSGLLVATNLETTNGIDIVLKYP
                     KVVDTAFTDNVEKLTEQLGDTLLINGEDVAELELKNIDFTLDEKWENSKRQEGEERQR
                     KEKEREFQEENGRKGFKTDTDITRSGKPEVRERELLKWTPDENDGNVNEALEDNAGEW
                     DQFSVNEQKFGVKSTFDEHFYTTKINKDDPNFDKRFKEAERIAKEIESQGVSTNHHLN
                     EERGVAADDSGMDEEDLYSGVDRRGNELLAALKSNAKQGLNQESNKNASSLKNQSQHV
                     DPAIISSSTVKGDQQQQSHQQRKNTDGSTQTKQDPQAVHKSGTNATLGKENVSPAPSN
                     KSPKREPLDGSNRKPHTTTKEAQIEDLKKFSQKFKVPYDVPEDMKDILKKSALKGAPS
                     LPPKPQSSSNRPSVPPTPSSGKTDIRKTNRVNSQEQTPVDSPSGRMSSSSKKRYGNSF
                     FGSKVLSPDNNRRGAFGKNFNMFLRSKEAHDEKQRQKSSESKVMEPFFIEKPYFTAPT
                     WPGTVEQSYKTFFPDERTAVQRAQMNLQQRQMNSMNAAAAAAAANQQMGVVMGNMMRF
                     PMGPGASPTPMMNGLAGNMGMYMPFQPQPMFYPSMPNMMSVMGGDDGGGSPSPQAVSP
                     HMPPAYMSGAPGTPMTFGYPGAMPFQAAMVGGGGPRVGGTGNYRQNYHHHNSHGGHGH
                     HRNNHENH"
     gene            complement(<866332..>867417)
                     /locus_tag="ZYRO0B10978g"
                     /db_xref="GeneID:8202579"
     mRNA            complement(<866332..>867417)
                     /locus_tag="ZYRO0B10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495377.1"
                     /db_xref="GeneID:8202579"
     CDS             complement(866332..867417)
                     /locus_tag="ZYRO0B10978g"
                     /note="weakly similar to uniprot|P53298 Saccharomyces
                     cerevisiae YGR179C OKP1 Outer kinetochore protein required
                     for accurate mitotic chromosome segregation forms a
                     complex with Mcm21p and Okp1p that binds to centromeres
                     via the CBF3 complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495422.1"
                     /db_xref="GeneID:8202579"
                     /db_xref="UniProtKB/TrEMBL:C5DRS8"
                     /translation="MAKRILDQIEANSDTSSVEDVDTEALRLDKIPSPKKLFYEDEDE
                     DEDDDEEAADNEVVIQRESQPIEDPINVKRVRFKRRQRDPVSDAEDPNVRYWDFGPLI
                     RQEFRDKLPSNYEIKRWRRPSKHMVRSVVQLIETNFETAIEQVLDRYNDELKSVVNDS
                     TAVHRQKHILMNDLVFKIRHQLKKTKFPSRISDYDVDIEYIVSKRKYIQSQYALELAN
                     AEKLEDELIREEQKLKELKELCQDLETSNKRKLQDRLLKNDLHPSLTKAMENAYGLIP
                     DSDQAGQGNNIYTKDVQELQLVPSGGTLTNGSEDEDTLDVEKLVPALREYNKVSQSIY
                     SNIEKFMKLNKIESVLDRIDKISGDNE"
     gene            868620..868691
                     /locus_tag="ZYRO0B11000r"
                     /db_xref="GeneID:8202580"
     tRNA            868620..868691
                     /locus_tag="ZYRO0B11000r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove score=66.07"
                     /db_xref="GeneID:8202580"
     gene            869023..869096
                     /locus_tag="ZYRO0B11022r"
                     /db_xref="GeneID:8202581"
     tRNA            869023..869096
                     /locus_tag="ZYRO0B11022r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=67.58"
                     /db_xref="GeneID:8202581"
     gene            complement(<869260..>871740)
                     /locus_tag="ZYRO0B11044g"
                     /db_xref="GeneID:8202582"
     mRNA            complement(<869260..>871740)
                     /locus_tag="ZYRO0B11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495378.1"
                     /db_xref="GeneID:8202582"
     CDS             complement(869260..871740)
                     /locus_tag="ZYRO0B11044g"
                     /note="similar to uniprot|Q01477 Saccharomyces cerevisiae
                     YER151C UBP3 Ubiquitin-specific protease that interacts
                     with Bre5p to co-regulate anterograde and retrograde
                     transport between endoplasmic reticulum and Golgi
                     compartments inhibitor of gene silencing cleaves ubiquitin
                     fusions but not polyubiquitin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495423.1"
                     /db_xref="GeneID:8202582"
                     /db_xref="GOA:C5DRS9"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DRS9"
                     /translation="MSAVNSHDSGEESYSMYPKTSSPPLPTQGSMHFPAYQPPVPIYA
                     YPQMPYMYAGQAPGYPFNLMNQNQMLYQGGGMPQQGGGMGSKKKWSNNGGSSGSGSGS
                     TINGGLSSSKINHYHHHQMSPSFHPASMSNSSSVSSSGVNVQSKASGPRSEQYKFEIS
                     KLTSSNATSVEFPLYFNAAPEEFKEAGSKRHELRLKALGLDQGKNQESNQEEITKKER
                     TTIPVANVTTTAEPKKEEKKEEPKQKTLSKDSPKPNATELNTSASLPAPTPTPAAAPA
                     PAPAPAPTASKTPKLWSAVASGGIAKSRSTATGGANSQGTNGLNSSNQPPQKKDKKYI
                     PPTTKGVETLGSVALRMCFDPDYIDYTLKSAGADKGLCVKSVAPRGIVNRANVCFMSS
                     VLQVLLYCRPFINILNVVSVRNVVARAGPIQSKLLDACLNIYKQFDKDTVELEKKNAA
                     KNGSGNNSNVGSGSIRQSNVVSSISEAIKPDEFYEALSTIPKFKDLKWGHQEDAEEFL
                     THLLDQLHEEFISSICSLGDNEILNLLQSINDEELRIFFVRNLPRYKKAEFLKSSPGQ
                     LKDLISTYGTVSEDNDEEGDGWHEVSGSSKKGKKTKTAAKRTVEMEPSPMSCLFGGQF
                     RSVLDIPNNKESQSITLDPFQTIQLDISDKSVNDLETAFKKFSEYELLPFKSSSGYDV
                     EAKKQTFIDRLPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKIRKKINYEHELI
                     IPIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTADVYHRESDKWYRIDDVSII
                     ELEKEDVLKGGEESGDSRTAYILMYQKI"
     gene            complement(<872041..>872709)
                     /locus_tag="ZYRO0B11066g"
                     /db_xref="GeneID:8202583"
     mRNA            complement(<872041..>872709)
                     /locus_tag="ZYRO0B11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495379.1"
                     /db_xref="GeneID:8202583"
     CDS             complement(872041..872709)
                     /locus_tag="ZYRO0B11066g"
                     /note="similar to uniprot|P38957 Saccharomyces cerevisiae
                     YDR078C SHU2 Suppressor of hydroxy-urea sensitivity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495424.1"
                     /db_xref="GeneID:8202583"
                     /db_xref="GOA:C5DRT0"
                     /translation="METSGEDGSAINHSELFSQLVNKDGQMNDTVASFLYYMFPRELF
                     IRALSLIESCNMFIYVLVPSGVNDKNNQPLKFLEVSDLVNSIYDDSELHRLIVKPSDE
                     DVPTYVDLNNWMCSCQEYTDLMLERLNQMEAGSLASSLLKDIDDSQRFQEDRFAQLDA
                     HSLSMQRYVHCEKLNCPHLLAYSILLRSSTRTLQHFLEKGQILLIQINNMDEWLKLHI
                     NVVE"
     gene            complement(<872804..>874156)
                     /locus_tag="ZYRO0B11088g"
                     /db_xref="GeneID:8202584"
     mRNA            complement(<872804..>874156)
                     /locus_tag="ZYRO0B11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495380.1"
                     /db_xref="GeneID:8202584"
     CDS             complement(872804..874156)
                     /locus_tag="ZYRO0B11088g"
                     /note="similar to uniprot|P10356 Saccharomyces cerevisiae
                     YER152C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495425.1"
                     /db_xref="GeneID:8202584"
                     /db_xref="GOA:C5DRT1"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DRT1"
                     /translation="MSTQDQPADINFFKGHPSFRLLPGKQIAEAAKELLTPDIRDFDD
                     DTRNRHPLTYGSDEGALWVRETICHFNNDEAFRLSPGDRARSKPEHLNLNSGASYGVL
                     SILLETTLAHTGYTRQAFVITPTYFLINDCFIDAGFANKTTAIDELGDGKVDLDSLEK
                     KLEELEKQHEGQDDSKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRR
                     LIEIARKYDMLILADDVYDMLDYEQNVDKSPQPIKRFVHLDRETNEDPNSFGNTISNA
                     TFSKLIAPGLRFGYHESITQKLVFQLSQGGANTSGGTPSQLNSMIVGTMLKNGSAYNV
                     LATLRAAYKQRAIALRQAVITYLPKGTQMEPVKGGYFGWVTLPLGYDAKEIGQRLKSK
                     YGVVLADGSNFEVVGDTRNWGQRSVRISISFLETQDIEKGIELWGQVCKEFAAEKSLY
                     "
     gene            complement(<874346..>875248)
                     /locus_tag="ZYRO0B11110g"
                     /db_xref="GeneID:8202585"
     mRNA            complement(<874346..>875248)
                     /locus_tag="ZYRO0B11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495381.1"
                     /db_xref="GeneID:8202585"
     CDS             complement(874346..875248)
                     /locus_tag="ZYRO0B11110g"
                     /note="similar to uniprot|O13377 Saccharomyces kluyveri
                     PET122 Protein PET122 mitochondrial precursor and weakly
                     similar to YER153C uniprot|P10355 Saccharomyces cerevisiae
                     YER153C PET122 Specific translational activator for the
                     COX3 mRNA that acts together with Pet54p and Pet494p
                     located in the mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495426.1"
                     /db_xref="GeneID:8202585"
                     /db_xref="GOA:C5DRT2"
                     /db_xref="InterPro:IPR008732"
                     /db_xref="UniProtKB/TrEMBL:C5DRT2"
                     /translation="MRSFVVFRRFLTQSTREQVYLDILNKRFDNALQVIRRTPKKELD
                     YTLLQTFLSKSCQWGHIQSVDYIWYKFVMRLPILIVSPNLLCDIGNLALHEEKGFIPD
                     QLYIHYMKFHDKKRSEQDSCKYELMRIRIESFARGTGDKTTFKEKWKKYLEDMDNRLP
                     PTAEIKVRDFPFLTKSMGDSTKQEIMELLFTKGGFPVQNRHSLPLLLNMFLLQPKHHM
                     EFKIACFQRFSEVYSLGLDDSLAILFRQCRNDGYHLSRLMDFARERGITRLSPVASKA
                     FLEGISGTNYHFKTREYIDLLSRD"
     gene            <875492..>876732
                     /locus_tag="ZYRO0B11132g"
                     /db_xref="GeneID:8202586"
     mRNA            join(<875492..875530,875602..>876732)
                     /locus_tag="ZYRO0B11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495382.1"
                     /db_xref="GeneID:8202586"
     CDS             join(875492..875530,875602..876732)
                     /locus_tag="ZYRO0B11132g"
                     /note="similar to uniprot|P39952 Saccharomyces cerevisiae
                     YER154W OXA1 Translocase of the mitochondrial inner
                     membrane mediates the insertion of both mitochondrial- and
                     nuclear-encoded proteins from the matrix into the inner
                     membrane interacts with mitochondrial ribosomes null is
                     respiratory deficient"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495427.1"
                     /db_xref="GeneID:8202586"
                     /db_xref="GOA:C5DRT3"
                     /db_xref="InterPro:IPR001708"
                     /db_xref="UniProtKB/TrEMBL:C5DRT3"
                     /translation="MLRTSLQRSAARITSRTVPRSLVGTASLSLPFSRISTVRFNSSD
                     AGKVPASEIRTELPSVEDLGSSSDIVDQASQALGEASNHVGYLNSIGLAQTWWWPADV
                     IQHALELVHVYSGLPWWGSICVVTITVRLLMFPFYVKSSDTVARNSHIKPQMDKLNAE
                     LMSTTDLAEGQKVALKRKRLLAENGIKNRWMAAPILQIPVALGFFGGIRHMANFPVDG
                     FTNQGIAWFTDLSQADPYLGLQVITAGVLIGFSRLGGETGAQQWSPVMKRVFTIIPLI
                     SIPATMNVSAAVALYFAVNGTCAVIQTLTLRNKWVREKLGIAEVRRYSETELGPQKGI
                     MESFRENMAKSREQAERRQMMKEKDLEEQERVKQLKKNQHIKIVRKSDLHQNSQQ"
     gene            complement(<876991..>883638)
                     /locus_tag="ZYRO0B11154g"
                     /db_xref="GeneID:8202587"
     mRNA            complement(<876991..>883638)
                     /locus_tag="ZYRO0B11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495383.1"
                     /db_xref="GeneID:8202587"
     CDS             complement(876991..883638)
                     /locus_tag="ZYRO0B11154g"
                     /note="similar to uniprot|P39960 Saccharomyces cerevisiae
                     YER155C BEM2 Rho GTPase activating protein (RhoGAP)
                     involved in the control of cytoskeleton organization and
                     cellular morphogenesis required for bud emergence"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495428.1"
                     /db_xref="GeneID:8202587"
                     /db_xref="GOA:C5DRT4"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:C5DRT4"
                     /translation="MKNLIWSSKNKKSSSTSGSNNNNNNNNTSSTNNNNGNSHLSSTS
                     NLKPRTSNASILPGIRSSNNSSHSRDYHTSPTTANSHMTSTVGGSKRKSSPSAAFSLK
                     RYSNAPTSSNTSTNNNNNNNNNNTNNNNNTNNTNTNNTTSGSTPPPSQAPPQGSVGNI
                     YMSEHHSRSSRSVLSSARASSDISLASLPSDGRHNKSQEKINDADTFHDTSSHPMSSS
                     ASNYSSSTLHTNLGSSTTYLAPSAISSNTTAAGTTGGDGGGGNGNHSNNNNNQSHASL
                     LRSNNAQKTAVHLNKDNYDNTVFKVGWLNRSHGNVTLSDGNNNSSTSGNRRESRMFDQ
                     GFPDIAESPTSVPDYKLYRVQLKGPFLNLYKSGLSNNVKCFDPNLGTKDPEEEAADDT
                     IVDVEEDGTSPVTPVAAAASSNNSASTDNNIPTNSTPTITTSSSSSSQLPPSATRSNR
                     MPTIKYLSPRHPHPDLKIDKDDKIVSGTTESLCHAILFAWSQTSLEDTAIPTNRYLIN
                     LLLSLPLLDDFYNYLTMFNQMGLTFTKHSGQISNNATQYCNVPSKIDDRLTNRLALVV
                     KTLLDMFPSFLLDEQMAQQTMKLLEIISLHDSELSNNLKIAVAAKHNDLHKLTAFSRE
                     SAPTKDSCKSMTDLMNPEKFLKMDIKQLAEQVHEINLKFRSQWGPRTDYSLLYDSKYM
                     DSKIIALNPLVFNNNDNIHFLGRLFVSHIFSEATANSPKFRGKLLSKWVDLGVRFEQL
                     GDMVSWLALATIVCSIPVLRLYQAWQYVSEHTIRVIFKDWVPTIAQLNRRQLSSRSTS
                     SVFILAPPNLEDPVIRSNVISYFGDLIIHADDLPSETKLKYLEKKINRTNNAFHKWQQ
                     RLDSLSRGRSDDVIRLRNVDEMTAGVYQFWKYHLSLPPLNMRGLMDLSTKTDPPRVDE
                     KAYSMIGSQRSPLLTGSYLPILFNELLPNYSLFSKQSLIGAAGVISTTMNATTVPSAT
                     SLTRHASIRPKSPMVRSTHNFTISEPISVDVNGNGNSKGNSSIADAGNGNTSPAIPDN
                     KKSGNQITGVENIDGPVVRAMSTKQSNRQHLLKCVRDAFNIDSDIFRVSNDFIFKSCN
                     DLDLMSTNSSTVIENPKRFSQQSYTNANTPGVSRESQDMANTLSKSLENIDFFNKDSE
                     TLKESVIPVVLKSGSLDKIFDLLVLTAGVFSRLVETKDLENYFIHNKERNTSGSFSSD
                     EESRDDTLGLLDFAFIRLSMDNETFTETFFNTYRSFTTTKCVLENLAKRYIGAKSCAL
                     SISKLLNGSSKVKSSELTSINDQKFPIWDMKLPPDEAVNHTNWAKIQVGAAESLCNLV
                     KNHYADFTDDTDSNNTLLDIVKIMEDDVGVEWPRRIEQMKRTANSEDIKETQKFVVKL
                     SELFAGIRSAYQKQMYRPLGINRIQRKVTSLLDSFKSKTIIDYNRVLNSNTLDDSMVS
                     KFHELKYNDYEGILDWVYALDNFILERVKLVTKQDWFATYQVLELFSYGSLTSYFSFP
                     QHSAAYTMITSGSSQLDDLEIMNVFSWISNLTKPNEKHDSYLLNKLPESVQLLIRLHN
                     CLTSFFTVEISNTDKDPDNRLQTCAAILQILNYVRWKNSSLDLFEEEGDSTPKSMSPH
                     IPSFIETAISNAIISPESRFYEHTWRAAHSLLSCKEDDYLPSICRLLENIDDKHVRGF
                     VEHDSIYMAKPKNLCACPGWLILRLIEIAKFVPNMSTMNSKLINFDKRRFVSNIISNI
                     VDLTPASEDYTNTNRDRRSRSFGTCLSLEVVDPNKDYRKSTRFVAASESKMLKFQENG
                     LFNEILSEEVEKTRRDHKKIEALSVQEHDNKRSAVLQKVVQRKPKTSVMVPSLQIPTI
                     PSSPNSSSSPTLGKDKRSSVASLGARSSIVSNSGHNHVGRKLGGFFRRPFSIGGFNSS
                     ASSSSLNSILVPDVQPNGTVAPLNLPSIESSSVNEQKPVYQFKTFEIENIVELMNFKN
                     PGCAYSFKIVMQGGQEIILQATGSADSKQWVKMIKASRRYAYYSKKYKSKTYNKIFGV
                     PLEDVCEREGTVIPNIVVKLLEEIELRGLDEVGLYRIPGSVGSVNALKNAFDEEGGLS
                     NSFTLEDDRWFEINAIAGCFKMYLRELPECLFTNERVQAFANLALRYKSHQMNLEEFI
                     HTMVNLLRTLPLCYYHTLKRIVVHLNKVHQHVENNRMDASNLAIVFSMSFINQEDLAN
                     SMGSTLGAIQTILQFFIKSPRDFFE"
     gene            complement(<884232..>885251)
                     /locus_tag="ZYRO0B11176g"
                     /db_xref="GeneID:8202588"
     mRNA            complement(<884232..>885251)
                     /locus_tag="ZYRO0B11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495384.1"
                     /db_xref="GeneID:8202588"
     CDS             complement(884232..885251)
                     /locus_tag="ZYRO0B11176g"
                     /note="similar to uniprot|P40093 Saccharomyces cerevisiae
                     YER156C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495429.1"
                     /db_xref="GeneID:8202588"
                     /db_xref="InterPro:IPR003226"
                     /db_xref="UniProtKB/TrEMBL:C5DRT5"
                     /translation="MLITRNCCKFMESVKRLKVEMVKTVCTHSGTFHADEALAVYMLK
                     LLPQYKDAKVVRSRQPEDWEKSDIVVDVGGKYDGTKFFDHHQRGFYENFENRETKLSS
                     AGLTYKHFGREIIKTILNKELSQSDLDFLCHKIYQQFIEALDANDNGINCYDEGKPKF
                     IQNGITLPGVISRMNPDWNEDNSPERFDQQFTKASDFIGNVFVDLVKGYGNSWLPAKT
                     LVREAIDNRFKVHQSGQILEFKQFCPWKDHLFDIESELKIENQLKFVLFPDGSGAWRV
                     TTVPVEPGSFQFRQGILEPWRGLRDQELSEKSGIKDCIFVHASGFTGGVRSREGALEM
                     ALRSL"
     gene            <885592..>885912
                     /locus_tag="ZYRO0B11198g"
                     /db_xref="GeneID:8202589"
     mRNA            <885592..>885912
                     /locus_tag="ZYRO0B11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495385.1"
                     /db_xref="GeneID:8202589"
     CDS             885592..885912
                     /locus_tag="ZYRO0B11198g"
                     /note="similar to uniprot|P38958 Saccharomyces cerevisiae
                     YDR079W PET100 Chaperone that specifically facilitates the
                     assembly of cytochrome c oxidase located in the
                     mitochondrial inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495430.1"
                     /db_xref="GeneID:8202589"
                     /db_xref="UniProtKB/TrEMBL:C5DRT6"
                     /translation="MRFPFKYTRAQLEVFRFSFCLLAPVGVMYYVGTDTDKKLNVPGF
                     YPDPESLNKIPKEPYEIKAELARMKKERLEKRLRLEKRLAEQGIDIEAEKDEIRRELQ
                     QGRT"
     gene            <886235..>888502
                     /locus_tag="ZYRO0B11220g"
                     /db_xref="GeneID:8202590"
     mRNA            <886235..>888502
                     /locus_tag="ZYRO0B11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495386.1"
                     /db_xref="GeneID:8202590"
     CDS             886235..888502
                     /locus_tag="ZYRO0B11220g"
                     /note="similar to uniprot|P40094 Saccharomyces cerevisiae
                     YER157W COG3 Essential component of the conserved
                     oligomeric Golgi complex (Cog1p through Cog8p) a cytosolic
                     tethering complex that functions in protein trafficking to
                     mediate fusion of transport vesicles to Golgi
                     compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495431.1"
                     /db_xref="GeneID:8202590"
                     /db_xref="GOA:C5DRT7"
                     /db_xref="InterPro:IPR007265"
                     /db_xref="UniProtKB/TrEMBL:C5DRT7"
                     /translation="MTRTRGDSLVLSIAAHSSGNGSQPLPELLDDSYLMEKLQELSTQ
                     LDSTEDTKEPEEIPKAPAVDPYTKYTNYSKKLGSHIEEYESILRQSHKVNDQLEDAIK
                     MFEDISLSVNRFVDNTKDTHDEYSRLSQLHEQIPQYLAYFDALDPIMRRLNHASTPNV
                     VRKNSFKSMLVNIDESLGFFESHTDLKDAESYRIKFKRCLVRACELIANYLNNLLKQL
                     YVDINEKLASNTSGSSASREALLYNKFASSAEEYQSQVVEIISRVTDDKHHRYYEELK
                     SLLNDCYECYFQTRTKLLHSSIWNRLDEVILRDKELSLVNFIQDGKMYFQQLCYDEYQ
                     LFVKFFPEDVSKIRINQWFVQLCEPLYDTVRIRVLRETDISTLCDSLTLFGQYYEFEE
                     DAEEYQRQFGQIKYDKVFEPIVQRLQATLILRVQNYVQNQIVKYTPTKDSFIIANRKS
                     ARKDLTTAKEKEDPMVLAFVESFQDQANDNTVESHENVLESYYPPLVRGLALLSRIYE
                     MVNSVIFDDLAHHIVQDCMLSLKTAYNKVQSSTSDLNNFEVKLAYLRNLLMLRQQLQN
                     FNIQYSVNETYLDFSGVESFFKSVTEGARTLRFRDSSVLSLARGLVPKVVNNLVDART
                     ELMTHFRNIIKDFTEAAAKNIIEDTLVIDSKEDLSSLVEKNARLRQNVEDKLPRIHAQ
                     ICNFINDEVIVAHLMDAVQETVIQSYSSFHEEVNEKAEKGLLDKEQASELMYEDVFAD
                     FLSKVSGKLPNANKE"
     gene            complement(<888559..>888777)
                     /locus_tag="ZYRO0B11242g"
                     /db_xref="GeneID:8202591"
     mRNA            complement(<888559..>888777)
                     /locus_tag="ZYRO0B11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495387.1"
                     /db_xref="GeneID:8202591"
     CDS             complement(888559..888777)
                     /locus_tag="ZYRO0B11242g"
                     /note="highly similar to uniprot|Q3E7C1 Saccharomyces
                     cerevisiae YDR079C-A TFB5 Component of the RNA polymerase
                     II general transcription and DNA repair factor TFIIH
                     involved in transcription initiation homolog of the
                     Chlamydomonas reinhardtii REX1-S protein which is involved
                     in DNA repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495432.1"
                     /db_xref="GeneID:8202591"
                     /db_xref="GOA:C5DRT8"
                     /db_xref="InterPro:IPR009400"
                     /db_xref="UniProtKB/TrEMBL:C5DRT8"
                     /translation="MPRARRGALIQCDPSIKALIVQIDADKSDIILEELDDTHLLIDP
                     AKVEFIKRELNRLLSKNIYNPMDEEENQ"
     gene            <888911..>891631
                     /locus_tag="ZYRO0B11264g"
                     /db_xref="GeneID:8202592"
     mRNA            <888911..>891631
                     /locus_tag="ZYRO0B11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495388.1"
                     /db_xref="GeneID:8202592"
     CDS             888911..891631
                     /locus_tag="ZYRO0B11264g"
                     /note="similar to uniprot|P38959 Saccharomyces cerevisiae
                     YDR080W VPS41 vacuolar protein sorting component of
                     vacuolar membrane protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495433.1"
                     /db_xref="GeneID:8202592"
                     /db_xref="GOA:C5DRT9"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016902"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DRT9"
                     /translation="MVRQVAVRGAYTELDELENSTNGKDRKDSEYDERADHIKSTKEK
                     TIDKRDEMSGDVKNGKEYESENDEGEEEEDDDDEEDDEEDDEEDDDDEPPLLKFSRIT
                     KLPKTFRRDAISTCLFHEKIFAFGTHAGVLHLTTTDFTPLQTLKCHRSSILSINTNGT
                     FFATASIDGTVAIGQIEDTTNITLFDFKRPVQAVVLDVDYKSSKTFVSGGMAGEVILS
                     QRNWLGSRVDITLSKDHGHILGIYTIDDVIFWMNDAGITFYSIHTRTQLLNVPFPSED
                     SNTQRPGLYRPQVHCPETDRIIVGWANHVWMFKVSLRRAGEHGNNLGAIISSAASSLR
                     AQPDKKVELEHYFTIKMLIAGISSFKDDQLMCLGFEDAVGQGVPTSNIPQISIIDVFT
                     GEDTHTDEIVLKNYEKHSLNEYHLGKYIGESSPEYFLVAPNDAICIQGLSFKDHYDWF
                     MKKGNFMRAWEIGKYVVDDHERLETGLKFINELISSNRIEDSVSALTLTIADTNISND
                     EEFKNFALNKWREAFLRIIDLGGIDTVAKNIPLDPQLDNQVYDSVLEHLLKDCQLKEF
                     INYIQIWPLHHFSVHCFEKELEELIERHDDHENSYRDAIIYLYLEEKRFFKAMPHMLR
                     RRDMRALTVLLNHNFLAQYKDNLLDIVLLPYHGKIEDLSKLPIGEIEQLFSMSLELLV
                     QNRQSLQVQQVINLLSNPKELRVLLFLYLKKLSSVDPLLTALFETDMVELYSEFERSG
                     LLRFLKTKTNYDVEKAIEICCQNNDAYNELIYLWSKVGETKRALSLIIDELNDPKLAI
                     DFVKNLGDPELYDFMVSYSMDKPKFVKALLGSPDEFGKTYLEVIKGMPETMEIDDLHK
                     TLIRIAKENALSSTVSKSIFKIIDDETTEYAIELLNIRSQGKAFYVEDDE"
     gene            complement(<891757..>894231)
                     /locus_tag="ZYRO0B11286g"
                     /db_xref="GeneID:8202593"
     mRNA            complement(<891757..>894231)
                     /locus_tag="ZYRO0B11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495389.1"
                     /db_xref="GeneID:8202593"
     CDS             complement(891757..894231)
                     /locus_tag="ZYRO0B11286g"
                     /note="similar to uniprot|P32896 Saccharomyces cerevisiae
                     YDR081C PDC2 Transcription factor required for the
                     synthesis of the glycolytic enzyme pyruvate decarboxylase
                     required for high level expression of both the THI and the
                     PDC genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495434.1"
                     /db_xref="GeneID:8202593"
                     /db_xref="GOA:C5DRU0"
                     /db_xref="InterPro:IPR004875"
                     /db_xref="InterPro:IPR006600"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5DRU0"
                     /translation="MLSIEHRYNICLMAERHPKWTQLDLARWAYEAFQLPKIPSQGTI
                     SRLLAKKDVYMNCKDSEKCANRIRKPNNLLVRRILQEWVSQSIWNGIPVTSPILQDTA
                     QSVWYRIPAEHREGNGCFSYKWITNFLAKMSVNISSMEEQTPKPPKVWTFEERNELKE
                     YFSQVPPRDIFTLDETFLAYNLPLDYAQYEASQMQRKIEVATVMLCCNLDGSEKLKPL
                     VVGKYNSYRSFRNYFPEEPQDPVSQSLLGGKMARRFGISYHSNRKSWLTSNLFHDWLA
                     RWDKRLVADNRKIWIVLDDSCSHRIINLHLKNIELVYTSANSRFLPFNWGVLDEFKTR
                     YRIQQYQALISLQKQLEKKYHRKVLISFEQSQLTMSNAFKFVREAWKSIPLETIRGNW
                     KSAGILPAEMIQTDESVSMAFKKNEVLEARLNELCNKFYCSKKWDHDMLLDLNLENKN
                     TNFLSTEELVESAIVDPIEPDSQDDKLNRNNNNALPYSYNLDIITDGNVGINVGDIAD
                     NSESDEEDADKTYTRNDVQTAEKAIEYAINAGETSLIGSTNDNGEMDTGYEVNIDKFL
                     GEDFTSKDSQQGKMYNVSTLIDKPNLFMSENGELDLRNVGIDTSMVPSEYFNDVFSAS
                     IQDQPSGTSIPSTNQATTNMASQNIGPAYATATTTEATDTTNTSVPSATSQSQVSSAT
                     AIPPFEDPTLNHILNDPVVPDRPPATSPLNDFTIDTTSLQNLQSNINIAQALGNVLKH
                     TESRELAFSESTINEMKFNYNTLLSKIHKTRKNLSISKVRRGQVQLERFLTNANNPSP
                     SGSEASSTHNIQGQVNLQLPGNATFF"
     gene            complement(<894536..>894988)
                     /locus_tag="ZYRO0B11308g"
                     /db_xref="GeneID:8202594"
     mRNA            complement(<894536..>894988)
                     /locus_tag="ZYRO0B11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495390.1"
                     /db_xref="GeneID:8202594"
     CDS             complement(894536..894988)
                     /locus_tag="ZYRO0B11308g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495435.1"
                     /db_xref="GeneID:8202594"
                     /db_xref="GOA:C5DRU1"
                     /db_xref="InterPro:IPR014306"
                     /db_xref="InterPro:IPR023416"
                     /db_xref="UniProtKB/TrEMBL:C5DRU1"
                     /translation="MAPNPITCHILDTTTGKPAANVVCSIYKVYIGEGNDDQDQLIET
                     QEAQILARARTNDDGRIPLWVFNPDMSQRKLLATNGIQEADQELQWRELKPGYYKIRF
                     QTGLYFKSQGQTNFHPFVDILFHIDNGSRHYHIPLLLSNYGYTTYKGS"
     gene            <895161..>896390
                     /locus_tag="ZYRO0B11330g"
                     /db_xref="GeneID:8202595"
     mRNA            <895161..>896390
                     /locus_tag="ZYRO0B11330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495391.1"
                     /db_xref="GeneID:8202595"
     CDS             895161..896390
                     /locus_tag="ZYRO0B11330g"
                     /note="some similarities with uniprot|P38960 Saccharomyces
                     cerevisiae YDR082W STN1 Protein involved in telomere
                     length regulation functions in telomere metabolism during
                     late S phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495436.1"
                     /db_xref="GeneID:8202595"
                     /db_xref="InterPro:IPR018856"
                     /db_xref="InterPro:IPR024263"
                     /db_xref="UniProtKB/TrEMBL:C5DRU2"
                     /translation="MVGRHDVIHQEGDLVYYSPFVFDKNPYHGVTVPILVVDLLELVE
                     DSKNLCRRHYGNQFRGLFYKNHPLNKISVVGVVVGCRYKCIGDDDYIFMQLDDCSGSA
                     RFLQCKCLEPLAMENGLSWGSICGQKLRISGAFNLWYREMVVEWIDFIPDIIAEIEHW
                     QSAIEFRRKLSIPWVEPVSSEPPTSNYIQQMHTANVMDSLVITSTYEQLSPPSPLPSP
                     SPVDSPPPSPLPQVICNITELKIEFLRGLLKHEGKRAYTTELYSGLSTLLNQLATLRF
                     QNQRVNLPVKPWQQLKSESLYDQLHKLQKSGLLRCHSNDNLVDLKPLKDLHEYSMHRV
                     LTLIKLQCNTGRIDYNHIRDKLKHCEFTKKAIVDIFKESLRRICLLYPQLLVGWWIGA
                     DGGEFSVIHFKYEPHER"
     gene            <896614..>897723
                     /locus_tag="ZYRO0B11352g"
                     /db_xref="GeneID:8202596"
     mRNA            <896614..>897723
                     /locus_tag="ZYRO0B11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495392.1"
                     /db_xref="GeneID:8202596"
     CDS             896614..897723
                     /locus_tag="ZYRO0B11352g"
                     /note="similar to uniprot|P38961 Saccharomyces cerevisiae
                     YDR083W RRP8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495437.1"
                     /db_xref="GeneID:8202596"
                     /db_xref="GOA:C5DRU3"
                     /db_xref="InterPro:IPR007823"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DRU3"
                     /translation="MGLFKVDGWDLKTENVAYYDAKSAKGQEKKKEQKEKRKEQKKQQ
                     NELKNLKHQPEPAQEDVPQKKRKTKDSSSSSTSSVPAPKIERKLTPLQQKMMAKLTGS
                     RFRWINEQLYTISSEDALKMIKEQPQLFDEYHDGFKSQVESWPENPVDVFVEEIRQRS
                     KRPVNAPGGLPGLKNKQIVIADMGCGEAQLALDINKYFAQINKRSKPNHRKSHVVHSF
                     DLKKANDLITVADIKNVPLPDNSCTIVVFCLALMGTNFLDFIKEAYRLLAPRGELWIA
                     EIKSRFADGKGEEFVEALKLLGFFHKKTDNENKMFTRFEFFKPPQEIIEERRAKLERK
                     HKFIETENEREALEDKRLKESEGKWLLKPCIYKRR"
     gene            complement(<897774..>898373)
                     /locus_tag="ZYRO0B11374g"
                     /db_xref="GeneID:8202597"
     mRNA            complement(<897774..>898373)
                     /locus_tag="ZYRO0B11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495393.1"
                     /db_xref="GeneID:8202597"
     CDS             complement(897774..898373)
                     /locus_tag="ZYRO0B11374g"
                     /note="similar to uniprot|P38962 Saccharomyces cerevisiae
                     YDR084C TVP23 Integral membrane protein localized to
                     vesicles along with the v-SNARE Tlg2p green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495438.1"
                     /db_xref="GeneID:8202597"
                     /db_xref="GOA:C5DRU4"
                     /db_xref="InterPro:IPR008564"
                     /db_xref="UniProtKB/TrEMBL:C5DRU4"
                     /translation="MAILDHIKNFYNTILKSSHPLLLAAHLSGKVAPILFYVLGSLFL
                     GFTPQFIVVVLLLAQDFYLTKNISGRRLVQLRWWYDPSSEGIRAFIFESYKQYAPGPP
                     INPIDSKLFWWSMYVTPLVWCVFAFLCIIRFKLFYLLLVLVGVVLTGWNTYGFHCCEK
                     WDPDHDENSSGSWFQMPSIPGLDNIYRLATIQNFFRPSS"
     gene            complement(898651..898722)
                     /locus_tag="ZYRO0B11396r"
                     /db_xref="GeneID:8202598"
     tRNA            complement(898651..898722)
                     /locus_tag="ZYRO0B11396r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=60.23"
                     /db_xref="GeneID:8202598"
     gene            complement(<899074..>901257)
                     /locus_tag="ZYRO0B11418g"
                     /db_xref="GeneID:8202599"
     mRNA            complement(<899074..>901257)
                     /locus_tag="ZYRO0B11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495394.1"
                     /db_xref="GeneID:8202599"
     CDS             complement(899074..901257)
                     /locus_tag="ZYRO0B11418g"
                     /note="some similarities with uniprot|P33304 Saccharomyces
                     cerevisiae YDR085C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495439.1"
                     /db_xref="GeneID:8202599"
                     /db_xref="UniProtKB/TrEMBL:C5DRU5"
                     /translation="MATGMYMHGSIPRSSSTSDLFDASIPHNVNSRRRKAGSGLKNSF
                     SSFDVWSIPASSPTEATSSSSAASIRSTTTTRTARRHQPPPPRPLTPYQLQRKQMKSS
                     FQFPNGENFTPRNKRMTKSSSAIQLATPAVHQQAPIQLPPPSRAQTLNGFRAGRNFTM
                     DGMPRSQSLTSLSPQRTNTPWKNNLLGSHPGIYPFANSNSTETTLSSNGSSRSIRNGV
                     RTSSGSVQSRPTTVSTPDREVAPSFKPFLPTVEPGDSPPKSLGSSNDEDFQSARGSLI
                     EEEQESPQLEPRLSLQVGLEPEQIADDQLDDELSIYQDEVPVQAPEPKPEPVPEPLKK
                     REVREPSVKEHVTRQTVQQLSPLASNDDKVSRKSKVGKFFRRILHNSTPNALRKRKRN
                     QTPSSSSSGSPVIAPLHKARHRNVSVTDEGSPLPSIKSSSVQKTRSNPRQQQKQKQDT
                     RNSRNDTETSFNDTTDKCRQSSLTPSLEAEEDVLMDTDLVFDSLLLKADSNHPSTWNR
                     QRDLQLKLQTLASPKKSPTDEKEGESFSSNSNSLVTRQTDDDESNVDYELIQEFSKLG
                     NYIEGPSNAIEQNKALKNQEIPPSTDLPHTTLPPRRSPRRPNLPNKSLVQSFYGHDDS
                     NTRIIKRLQKNWDNVHFDSAPPLTTNGGAREKSLRFAQDVYVKDTWSPVEYFRSDKLF
                     IKERRRMMQLENSGFVNSIKRELNEYKRDEMAVHIDSAKFTHFFV"
     gene            complement(<902083..>902532)
                     /locus_tag="ZYRO0B11440g"
                     /db_xref="GeneID:8202600"
     mRNA            complement(<902083..>902532)
                     /locus_tag="ZYRO0B11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495395.1"
                     /db_xref="GeneID:8202600"
     CDS             complement(902083..902532)
                     /locus_tag="ZYRO0B11440g"
                     /note="similar to uniprot|P40096 Saccharomyces cerevisiae
                     YER159C BUR6 Protein that forms a heterodimeric
                     histone-fold NC2 general transcription regulator complex
                     with Ydr1p that binds to TBP and represses RNA pol II
                     transcription during assembly of the preinitiation complex
                     homologous to human NC2alpha"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495440.1"
                     /db_xref="GeneID:8202600"
                     /db_xref="GOA:C5DRU6"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DRU6"
                     /translation="MDENVMEDQNQLADAVAPATEAEMTTTTTTTTKVPDEKAVMELQ
                     DVFDKIKTHFPPAKVKKIMQTDEDIGKVSQATPVIAGRSLEFFIALLVKRSSDTARRL
                     GCKRISGEVMKETILTDEKFDFLRENVCGEKFEAEGDDQDQDSSMNE"
     gene            complement(<902774..>903001)
                     /locus_tag="ZYRO0B11462g"
                     /db_xref="GeneID:8202601"
     mRNA            complement(<902774..>903001)
                     /locus_tag="ZYRO0B11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495396.1"
                     /db_xref="GeneID:8202601"
     CDS             complement(902774..903001)
                     /locus_tag="ZYRO0B11462g"
                     /note="similar to uniprot|P35179 Saccharomyces cerevisiae
                     YDR086C SSS1 Subunit of the Sec61p ER translocation
                     complex (Sec61p-Sss1p-Sbh1p) involved in transfer of
                     secretory precursors through the endoplasmic reticulum
                     membrane endoplasmic reticulum protein that is part of the
                     Sec61 trimeric complex and the Ssh1 trimeric complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495441.1"
                     /db_xref="GeneID:8202601"
                     /db_xref="GOA:C5DRU7"
                     /db_xref="InterPro:IPR001901"
                     /db_xref="InterPro:IPR008158"
                     /db_xref="InterPro:IPR022943"
                     /db_xref="InterPro:IPR023391"
                     /db_xref="UniProtKB/TrEMBL:C5DRU7"
                     /translation="MAKPVEKSENNQIDKLAEAPLEFVKEGSQFLNKCKKPDTKEYVK
                     IVRAVGIGFVSVGVIGYAIKLIHIPIRYLIV"
     gene            complement(<903236..>904048)
                     /locus_tag="ZYRO0B11484g"
                     /db_xref="GeneID:8202602"
     mRNA            complement(<903236..>904048)
                     /locus_tag="ZYRO0B11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495397.1"
                     /db_xref="GeneID:8202602"
     CDS             complement(903236..904048)
                     /locus_tag="ZYRO0B11484g"
                     /note="similar to uniprot|P35178 Saccharomyces cerevisiae
                     YDR087C RRP1 involved in processing rRNA precursor species
                     to mature rRNAs involved in rRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495442.1"
                     /db_xref="GeneID:8202602"
                     /db_xref="GOA:C5DRU8"
                     /db_xref="InterPro:IPR010301"
                     /db_xref="UniProtKB/TrEMBL:C5DRU8"
                     /translation="MDTSAFVKQLGSNSKPIRDNALEKLQKYLTSKPAKQSKQMQYNK
                     LWKGLYFAMWFSDRPRPQQRLANELAELHMLYLQDKNKNKDDDELTLNDQAFIKFSRA
                     FWKIMVMEWLQIDRYRLDKYLLLMRRVLYNQLKYLQSRDWSSKLVDTYLEKVMKRIPL
                     SGSPKVSNGIPIHIMDILLDEWQRLFEGEQQSQFVELLSETPLKSFLAIFKELLSNVD
                     NSKVLRNKIKRDFLRDERWGQWGIDVGLPKKADKDGEEEDDDEEEAEEWHGF"
     gene            complement(<904229..>905188)
                     /locus_tag="ZYRO0B11506g"
                     /db_xref="GeneID:8202603"
     mRNA            complement(<904229..>905188)
                     /locus_tag="ZYRO0B11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495398.1"
                     /db_xref="GeneID:8202603"
     CDS             complement(904229..905188)
                     /locus_tag="ZYRO0B11506g"
                     /note="similar to uniprot|Q02775 Saccharomyces cerevisiae
                     YDR088C SLU7 Protein involved in 3' splice site choices
                     acts in concert with Prp18p during the 2nd step of
                     splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495443.1"
                     /db_xref="GeneID:8202603"
                     /db_xref="GOA:C5DRU9"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR021715"
                     /db_xref="UniProtKB/TrEMBL:C5DRU9"
                     /translation="MSEKPKENIHIPRYIKNQPWYYKEAAGKEDDYLVHHRQVKKGTL
                     DIDNNSEPKLGPGIQDEFETVRINKDDVRPRCLNCGSSDHLKRDCLERPKKILKTDDK
                     DLVVKRKAFQAVDWDAKQDRWFGYTGKEYDEVLKNWKTPSHRKSNELQDQDWDTDEEI
                     ELMKLGLYKDHVGALKQDDSQNTQLKASVRLREDKAAYLNDLNSSELRYDPKSRVYKS
                     EELGFIDNDSHMFHRHLTGEAQELQNLNKFSRTHARRMGVRDDEENDAKAKHVLVANP
                     TQYEMLKRQDGEPIKRDRAKDEGQAQRTKGTARSRKDLEDLYG"
     gene            complement(905340..905412)
                     /locus_tag="ZYRO0B11528r"
                     /db_xref="GeneID:8202604"
     tRNA            complement(905340..905412)
                     /locus_tag="ZYRO0B11528r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (ACG) cove score=73.40"
                     /db_xref="GeneID:8202604"
     gene            complement(<905776..>906810)
                     /locus_tag="ZYRO0B11550g"
                     /db_xref="GeneID:8202605"
     mRNA            complement(<905776..>906810)
                     /locus_tag="ZYRO0B11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495399.1"
                     /db_xref="GeneID:8202605"
     CDS             complement(905776..906810)
                     /locus_tag="ZYRO0B11550g"
                     /note="weakly similar to uniprot|P06843 Saccharomyces
                     cerevisiae YER161c SPT2 multifunctional HMG-like chromatin
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495444.1"
                     /db_xref="GeneID:8202605"
                     /db_xref="InterPro:IPR013256"
                     /db_xref="UniProtKB/TrEMBL:C5DRV0"
                     /translation="MSFLSKISNLRKSIPVAPPKANTPSSQPETYQAPSLLPKSYTRE
                     EDPAVRRLKEKRQQELLKKGELSKKATASRRTSASGKGTKKDSDDDNKTVTRFKKKSS
                     SGSSTGSNRPTHISVAQKKKPEPVKKMSFDELMKQAENNAHSNGSSSSKSGSTTPVRA
                     PSETQPRPRPHINKPGFKNPDRRRRAGSQEPVKPVVKNQPTPTVKEPRPAKLSLPKKD
                     FAKPNELIRRRLEAKKNASRVQETQQDDYESDMDDFIEDDEEEDRVAMEKDPGYDRDE
                     IWALFNRGKRRSDYAFDDDEEDDMEANEMEIIEEEERARKMARLEDKREEAWLKKHEM
                     EKKKRKKARD"
     gene            complement(<907092..>909404)
                     /locus_tag="ZYRO0B11572g"
                     /db_xref="GeneID:8202606"
     mRNA            complement(<907092..>909404)
                     /locus_tag="ZYRO0B11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495400.1"
                     /db_xref="GeneID:8202606"
     CDS             complement(907092..909404)
                     /locus_tag="ZYRO0B11572g"
                     /note="similar to uniprot|P14736 Saccharomyces cerevisiae
                     YER162C RAD4 Protein that recognizes and binds damaged DNA
                     (with Rad23p) during nucleotide excision repair subunit of
                     Nuclear Excision Repair Factor 2 (NEF2) homolog of human
                     XPC protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495445.1"
                     /db_xref="GeneID:8202606"
                     /db_xref="GOA:C5DRV1"
                     /db_xref="InterPro:IPR004583"
                     /db_xref="InterPro:IPR018325"
                     /db_xref="InterPro:IPR018326"
                     /db_xref="InterPro:IPR018327"
                     /db_xref="InterPro:IPR018328"
                     /db_xref="UniProtKB/TrEMBL:C5DRV1"
                     /translation="MGEKLSPEYFKLIRDVLREKKDEPQRPLKRKRGRQPPKEPPEVI
                     KVESSSPEPETIEIESTDELFGEPNEKNRNVVKSSNDEHYDEGDDGNYDNDDNDDNDY
                     QSDEFEDVTEPTGSPEPLGDISVSLETRKTDAKVTKKARNVVSNDERHWRRYFHMTCL
                     IGLMVHGYVRNDWINNIKLQKKLCKLVPDKILQNLHPEKDEELPLRSTRKLLDGLKMC
                     MEIWNKHWKITKSYEGTGCYMKLWDEIRVPYNKRSRLTEKEFVKQVLKGVGDRDMAAQ
                     GFVALLRSCNVNARLIMSLQPPDFCDLKVTDTRSRHVSPSTLFKYPIFWCEVWDKFSK
                     KWITIDAINLKTIEQIKTQSKLEPRGTGSYQRNLLRYVIGFDRKKGVRDVTRRYSYWF
                     NCKCIRKRITKDSYGDEWYAKVLKRLHERKRTRMDDYEDEYFQQRDDSEGMPDNIQDL
                     KNHPKYILEKDLRINQIVKPGCKECGYLNVHNKKDLWKVYERKNILDLKSARQWYMEG
                     RILKVGCRSMKKVPKRSRSAKEEDEEENLYSREDTELYVPPLASEPDGKIVKNAFGNI
                     EVFVPSMIPYNCVLIKSDLAVKAARLLHIEHARAVTSFKFEKGRSTKPVIGGIVVARW
                     FKDAVLCAIEGLENTVEQENFERRELENLTRWNLLLVKLRIKSELNTTYGKVEEVSKG
                     VNGNGALDASDHGEDDDDEMMAGGFIVAGNEAAPVPQPEPELEDNHEDEFEEEQEQAE
                     PTHSVDLQDGQDDHDSYDEFMDELNMSEQE"
     gene            complement(<909622..>910296)
                     /locus_tag="ZYRO0B11594g"
                     /db_xref="GeneID:8202607"
     mRNA            complement(<909622..>910296)
                     /locus_tag="ZYRO0B11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495401.1"
                     /db_xref="GeneID:8202607"
     CDS             complement(909622..910296)
                     /locus_tag="ZYRO0B11594g"
                     /note="similar to uniprot|P32656 Saccharomyces cerevisiae
                     YER163C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495446.1"
                     /db_xref="GeneID:8202607"
                     /db_xref="InterPro:IPR006840"
                     /db_xref="InterPro:IPR013024"
                     /db_xref="UniProtKB/TrEMBL:C5DRV2"
                     /translation="MTKSEGLWVLGYGSLIYKPPPHYTLRIPAIIFGYMRRFWQSSTD
                     HRGTEENPGRVVTLICKEDIESNPKFSHDLKLYNDTLMTTGVVYYIPPDRADEVRDYL
                     DVREQGGYTLHEVEVHLETSPDDELHAAVQQLPVHPVVRRKILITQVYIGQVTNDSFI
                     GPEPIEQTSKVIATSVGPSGANYDYLKHLHGSLRAMQLTHENIIIRDEYLDELLNQVE
                     QLKNTK"
     gene            complement(<910480..>912303)
                     /locus_tag="ZYRO0B11616g"
                     /db_xref="GeneID:8202608"
     mRNA            complement(<910480..>912303)
                     /locus_tag="ZYRO0B11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495402.1"
                     /db_xref="GeneID:8202608"
     CDS             complement(910480..912303)
                     /locus_tag="ZYRO0B11616g"
                     /note="highly similar to uniprot|Q03195 Saccharomyces
                     cerevisiae YDR091C RLI1 Predicted ABC family ATPase
                     required for translation initiation facilitates binding of
                     a multifactor complex (MFC) of translation initiation
                     factors to the small ribosomal subunit may have a role in
                     large ribosomal subunit biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495447.1"
                     /db_xref="GeneID:8202608"
                     /db_xref="GOA:C5DRV3"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007209"
                     /db_xref="InterPro:IPR013283"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRV3"
                     /translation="MSEKNTRIAIVNPDRCKPKKCRQECRRSCPVVKTGKLCIEVTPA
                     SKIAFISEVLCIGCGICVKKCPFGAINIINLPTNLEQHVTHRYSANSFKLHRLPTPRP
                     GQVLGLVGTNGIGKSTALKILAGKQKPNLGRYDDPPEWQEIIRHFRGSELQNYFTKVL
                     EDDIKAIIKPQYVDNIPRAIKGPVQKVGELLKLRMEKPQEEVKYYLSQLDLMHVLKRD
                     IGNLSGGELQRFAIAISCVQNADVYMFDEPSSYLDVKQRLNAAQSIRSLLDPTKYVIT
                     VEHDLSVLDYLSDFVCILYGVPSVYGVVTLPASVREGINIFLDGHIPAENMRFRSEQL
                     QFRLADTGDEIKDEATRELSYPSMSKTQGDFKLSVDSGEFSDSEILVMMGENGTGKTT
                     LIKLLAGAIPADNGDKVARSNVSMKPQKIAPKFPGTVRQLFFKKIRGQFLSPQFQTDV
                     VKPLKIDDIIDQEVQHLSGGELQRVAIVLALGIPADIYLIDEPSAYLDSEQRIICSKV
                     IRRFIMHNKKTAFIVEHDFIMATYLADRVIVFDGIPSKAAHSGSPESLVTGCNRFLKN
                     LNVSFRRDPNSFRPRINKLDSQMDKEQKLSGNYFFLDNTGV"
     gene            <913485..>917921
                     /locus_tag="ZYRO0B11638g"
                     /db_xref="GeneID:8202609"
     mRNA            <913485..>917921
                     /locus_tag="ZYRO0B11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495403.1"
                     /db_xref="GeneID:8202609"
     CDS             913485..917921
                     /locus_tag="ZYRO0B11638g"
                     /note="similar to uniprot|P32657 Saccharomyces cerevisiae
                     YER164W CHD1 Sole S. cerevisiae member of CHD gene family
                     containing Chromodomain Helicase domain and DNA-binding
                     domain transcriptional regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002495448.1"
                     /db_xref="GeneID:8202609"
                     /db_xref="GOA:C5DRV4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR023779"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR025260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DRV4"
                     /translation="MGNEVDEEVLENPELYGLRRSHRASAHPTTKYFSEDEDADEDED
                     DGPVMGSRRRKNRQYTDPDADEGDIDEEEDEEDEEEEIGDEEDDDDYFGSPNKSKRRS
                     QGNNHGRKSKPMKAKEENLPTRFSNRTSKAVNYNIDYSDEDLLESDDGGRAKANTNND
                     EIDDEMNSDDEQMYYSTTPQAADEDRGVDLVITHKLKDDIDPQVESQVPELSQCKENY
                     LFLIKWSDESYLHNTWEEYENLKQYRGIKRVDNYCKQFIIQDLEFRLDPYVTAEDLEI
                     MDMERERRLDEFKEYEEPERIVDSQRITDDEGSSQLQYLVKWHRLNYDGATWENATEI
                     VKLAPEQVKHFQNRTNSKILPQYSSSYSSQRPRFEKLSVQPPFIKNGELRDFQLTGIN
                     WMAFLWSKNDNGILADEMGLGKTVQTVAFISWLIFARRQNGPHLIVVPLSTMPSWQET
                     FEKWAPELNCICYMGNQKSRDAIREYEFYTNPQAKGKKNVKFNVLLTTYEYVLKDRYE
                     FSTIRWQFMAVDEAHRLKNAESSLYESLNSLKVSNRLLITGTPLQNNIKELAALVNFL
                     MPGRFTIDQEIDFENQDDEQEQYIRDLHQRLQPFILRRLKKDVEKSLPSKTERILRVE
                     LSDVQTEYYRNILTKNYSALTAGAKGGHFSLLNIMNELKKGSNHPYLFDNAEERVLEK
                     FGDGNRSRENILRGLIMSSGKMVLLDKLLTRLKKDGHRVLIFSQMVRMLDILGDYLSI
                     KGINFQRLDGTVPSNQRRISIDHFNAPDSNDFVFLLSTRAGGLGINLMTADTVIIFDS
                     DWNPQADLQAMARAHRIGQKNHVMVYRLVSKDTVEEEVLERARKKMILEYAIISLGVT
                     DGNQYSKKNEPSAGELSEILKFGAGNMFTANDNQKKLEDLNLDDVLNHAEDHVTTPDL
                     GESHLGGEEFLKQFEVTDYKADVDWDDIIPEDELKKLQDEDQKRRDDEYVQEQLQLMN
                     RRNNALKKIKDSVNGDGSTQVSEDESGTKAARRRDKVNNMEDLEEKEIRALYKAVLKH
                     GDITEMLDTLIADGSLPDKSVEKYEEAYSQMIEDARQYLEKEERKRTHIMEALEDDAR
                     NYRSKLKSGDVKQEDQPKDNPLTRLAAKRKEKKAVLFQFEDMKNLNAESLVNRVEDMK
                     LLKGYIDKHYKDDPFKFKFNSQQPKAVQNWNCRWEKSDDEKLIVGVYKYGYGSWSQIR
                     DDPFLGLENKIFLNDTGGGNAGAGAGAGAGSRPASAAQETSSSADKKAKGSKKVPGSI
                     HLGRRVDYLITVLKDESNETSEPTGPKRRKPASKAGTPDTGNEPPAKRMKPLPRGPAS
                     MSPSRAGSSSSANGKGSKPPKLSNSNGNNNNGKNSGNDGSSSNNKNGPTPPLHLKEYD
                     SMDEEDCMRAMGAMRTSLKRLRRGGKGLDRKEWAQILKTELTAIGNHIESQKTSSNRK
                     NPEKLRKHLWSYSANFWPAAVKSTKLMAMYDKITGSKGKPGA"
     gene            <918547..>920310
                     /locus_tag="ZYRO0B11660g"
                     /db_xref="GeneID:8202610"
     mRNA            <918547..>920310
                     /locus_tag="ZYRO0B11660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002495404.1"
                     /db_xref="GeneID: