GenomeNet

Database: RefSeq
Entry: NC_012993
LinkDB: NC_012993
Original site: NC_012993 
LOCUS       NC_012993            1496342 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Zygosaccharomyces rouxii strain CBS732 chromosome D complete
            sequence.
ACCESSION   NC_012993
VERSION     NC_012993.1
DBLINK      BioProject: PRJNA39573
            BioSample: SAMEA3138235
            Assembly: GCF_000026365.1
KEYWORDS    RefSeq; genomic DNA.
SOURCE      Zygosaccharomyces rouxii
  ORGANISM  Zygosaccharomyces rouxii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygosaccharomyces.
REFERENCE   1  (bases 1 to 1496342)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1496342)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1496342)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928176.
            The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A
            to G). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1496342
                     /organism="Zygosaccharomyces rouxii"
                     /mol_type="genomic DNA"
                     /strain="CBS 732"
                     /db_xref="taxon:4956"
                     /chromosome="D"
     gene            <5577..>6647
                     /locus_tag="ZYRO0D00154g"
                     /db_xref="GeneID:8204489"
     mRNA            <5577..>6647
                     /locus_tag="ZYRO0D00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496398.1"
                     /db_xref="GeneID:8204489"
     CDS             5577..6647
                     /locus_tag="ZYRO0D00154g"
                     /note="weakly similar to uniprot|P43542 Saccharomyces
                     cerevisiae YFL062W COS4 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496443.1"
                     /db_xref="GeneID:8204489"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DWV9"
                     /translation="MEFDKESQKPVLPKQPFKSDSTWSFYEISKHRFPQVISCLCLVG
                     WVSLYGSNLINKIGLTGEMFATLVLGFSVLLSLARLQYSKFYPNTTELVQQVLESNPG
                     VDIEKWAEIANRLNIYFYQEHLWPMPHFFFNNQPVQLVFKDKVLRPYLEGKLDDITDM
                     DKIQSANCYLQSLNEKFELLLKVNLPEPVLNSELPKGTHRNKFSFYATYLSVGFMVCD
                     YQALTLLMIVMAFKSKTFLPLIKAILFQYLTLRIYQDSYCRLYPQMDTMHAMNFLAII
                     IKVSPGKEPAKWDQIAGYMNQYLAEENIGYSKNIFLDGKHCLNCYKTCFEPLSVNNGP
                     SKYCDFKEIVEVTQPSVNGETN"
     gene            complement(<7463..>8326)
                     /locus_tag="ZYRO0D00176g"
                     /db_xref="GeneID:8203687"
     mRNA            complement(<7463..>8326)
                     /locus_tag="ZYRO0D00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496399.1"
                     /db_xref="GeneID:8203687"
     CDS             complement(7463..8326)
                     /locus_tag="ZYRO0D00176g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496444.1"
                     /db_xref="GeneID:8203687"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DWW0"
                     /translation="MSMISDESEMDLEKCVQTYEEEEIELPEDSPGGKLTYFLAPYFF
                     EKTWIDDMIGSLSAAFISPSIVRLPYFILRDFYDDSYELKLLDVLSPLWMIIHYFLCF
                     TFSFWNFIDNRKNVKIEKKVLQQLLKEVAEMDLTEDPVAWQRIASRVNHFSEETGYRY
                     SLFCSGEHCIHFFVREIVKPIECQTYDIRCYQEGSTVVNFWKNPPNKALTERALANYN
                     KSVESFGKLSHTAEKDEFRDGIFEKFHSIFNTSLFYLVIIELGSFMIMMLTFIISMIS
                     CAIFDSFATPH"
     gene            complement(<10848..>11702)
                     /locus_tag="ZYRO0D00220g"
                     /db_xref="GeneID:8203688"
     mRNA            complement(<10848..>11702)
                     /locus_tag="ZYRO0D00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496400.1"
                     /db_xref="GeneID:8203688"
     CDS             complement(10848..11702)
                     /locus_tag="ZYRO0D00220g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496445.1"
                     /db_xref="GeneID:8203688"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DWW1"
                     /translation="MISDESEMDLEKCVQRYEEEEIELPAESSAGKLMYFLDPYFFEK
                     TWISDISFSLFLAFVSLTARLMYFSLRDLYNNITEPELSDLYSPLWIIIHYFLCFTML
                     FADFIHHRKKVDIEKKVLQKLLKEVVKMDLTGDPVAWRKIASRVNRFCEEGGNHYSVF
                     YSGEHCMRFFVREIVKPIERQTYDIRCYFDGEICSNFWKNPPNKALTERAVANYNNSI
                     ENFGELLQTAEKDECRDGIFEKFRNIFNTSMLYLGVIEAALLMIMSLGHLVLFISRTI
                     FDLFATAQ"
     gene            <12246..>13301
                     /locus_tag="ZYRO0D00242g"
                     /db_xref="GeneID:8203689"
     mRNA            <12246..>13301
                     /locus_tag="ZYRO0D00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496401.1"
                     /db_xref="GeneID:8203689"
     CDS             12246..13301
                     /locus_tag="ZYRO0D00242g"
                     /note="weakly similar to uniprot|P53822 Saccharomyces
                     cerevisiae YNL336W COS1 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496446.1"
                     /db_xref="GeneID:8203689"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DWW2"
                     /translation="MESDKESQRPVLPKDLFRNGLTWILYEIFKHYFPSVVSCTFCVI
                     TWVAFSMDAFYQNVPGLYMIGRVVFESAINFPLGWLYYSKSHPDTTLLVQQVLKSNPG
                     LDIEKWDEIANRLNSSFYQEHMWNTPYFFYDGQQGQLAFRNNVLRPYLEGKFEDISDK
                     DKIQSAKFYLQSINENFKLSLKDNLPESFLNSELPRDTYRNKSMLHSRHLFMGIIFLR
                     RQYQILLGIVMGLFQKSFFSLFCCIFWDQIFSRDNWSFYWLVYPEMGIMQGIKFLAII
                     TKVSPGEELDKWDQIARYMNQYLSEEYKHLPNNNFFDGKHCLDCYQACFKPLSVGNSL
                     VYGELKEIVEFTKRRVE"
     gene            complement(<14249..>15109)
                     /locus_tag="ZYRO0D00264g"
                     /db_xref="GeneID:8203690"
     mRNA            complement(<14249..>15109)
                     /locus_tag="ZYRO0D00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496402.1"
                     /db_xref="GeneID:8203690"
     CDS             complement(14249..15109)
                     /locus_tag="ZYRO0D00264g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496447.1"
                     /db_xref="GeneID:8203690"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DWW3"
                     /translation="MSVISDEGEMDLEKCVQAYEEEEIELPEDSTSGKLKYFLAPYFF
                     EKTWISDIGFSLLGTFISSFAPLAYFCLRDFYDNKIETKLSDLFSPLWMIIHYFLCFT
                     FSFLDFIYDRKKVDIDTKALQKLLKEVAEVDLTGDPAAWRKIASRVNLFSKETGYHYS
                     VFYSGEHCMHFFVREIVKPIECQTYDIRCYYEGKMYRNFWKNPPNKVLAERALANYNK
                     SFENFGGLSHTAEKDGCRDGIFERYRNIFNISMFYFMIIETVSFVVMIMAFIISMISC
                     AIFNLFATAQ"
     gene            complement(<17054..>18580)
                     /locus_tag="ZYRO0D00286g"
                     /db_xref="GeneID:8203691"
     mRNA            complement(<17054..>18580)
                     /locus_tag="ZYRO0D00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496403.1"
                     /db_xref="GeneID:8203691"
     CDS             complement(17054..18580)
                     /locus_tag="ZYRO0D00286g"
                     /note="similar to uniprot|O43081 Schizosaccharomyces pombe
                     SPBC947 SPBC947.06c protein and weakly similar to YHR048W
                     uniprot|P38776 Saccharomyces cerevisiae YHR048W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496448.1"
                     /db_xref="GeneID:8203691"
                     /db_xref="GOA:C5DWW4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DWW4"
                     /translation="MNEHADSRDTCSNSQLGDNEDGGNVLDKEHLLDMSSESNTNSLL
                     VEFSEGDPGSPFNWSRGKKLWHTAIYGLATFSAQFNSTTTSPSVSHLGEYFNVSREKA
                     LLATSLYVLGIAFGPMFFAPLSEMYGRKIAIFGSLLVSMVFTLGSASSKDFASLLATR
                     FFAGFFGGSPVVSSGGVLSDFWSIRVRSIAMVFYAMFVVCGTTVGPVICSLLTFQVGG
                     SDEWRWPLWFSCIVQGFIMVVAVFTVSESHSGVLLAYRAKKIRKRTGNWAYHAKHEEW
                     DLDLNEYLSTHLIRPFAMLATPIVFFLALFASYVFGILYLIVTSLPLTFKMTRGWEGT
                     LGNLPMLAVLVGVILGGVANVWGGLRYRRILIANKGVPIPEERFPPMMMFAWLMPTGL
                     FIFAWTSWAHVHWIAPCIGLSCMAFGFFVIFQGCLNYLVDAFTKYAASAIAANTFFRS
                     ILAGVFPLFGSALFGNLGVHWGASTIAFVALGMIPIPFVFYAFGSKIRSKNPYSKRID
                     "
     gene            complement(<22470..>24866)
                     /locus_tag="ZYRO0D00330g"
                     /db_xref="GeneID:8203692"
     mRNA            complement(<22470..>24866)
                     /locus_tag="ZYRO0D00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496404.1"
                     /db_xref="GeneID:8203692"
     CDS             complement(22470..24866)
                     /locus_tag="ZYRO0D00330g"
                     /note="highly similar to uniprot|P40897 Saccharomyces
                     cerevisiae YJL212C OPT1 Plasma membrane transporter that
                     transports tetra- and pentapeptides and glutathione member
                     of the OPT family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496449.1"
                     /db_xref="GeneID:8203692"
                     /db_xref="GOA:C5DWW5"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:C5DWW5"
                     /translation="MSSGLDFKEPALEDTQVLGRSHSSNADTTMSETHEIKNYDARSG
                     TESDLPKELTQVKVEEVTLTETPEGVDDIWEGDPSEMPDSPYPEVRAVLSPTDDPSIV
                     LNHWRTWFLVTVFVVVFAGVNQFFSLRYPSLTIDFLVAQVICYPLGKTLACLPDWKCK
                     LVPFFNLNPGPFTKKEHAVVTIAVALTSSTAYAMYILNAQVSFYNMSVNSGYQLLLVW
                     SSQMLGYGAAGLTRRWVVNPASCIWPQTLISVSLFDSLHSRTIEKSSVNGWKVPRYKF
                     FLFVLIGSFVWYWVPGFLFTGLSYFNIVLWGPKTRHNFVLNTIFGVSSGIGALPISFD
                     YTQISQAMTGSVFATPFWVSANTYASVLIFFVFLLPILYFTNTWYAKYMPVISTSTFD
                     NTQKKYNVTRILNPDFTVNLEKYKSYSPLFVPFSYLLSYALNFAAVIAVFVHCGLYHG
                     KDIYGKLKDANFGGSDIHRRLYQQNYKDCPDWWYLVLQVIMLGLGFAAVCGFDTHFPA
                     WAFVVALLIAFANFIPQGILEAITNQHVGLNVITELVCGYMLPFRPMANLLFKLYGFI
                     VMRQGLSLSRDLKLALYMKIPPRLIFCIQIYATIVSGLVNVGVQEWMRHNIKDFCSPD
                     QSNGFICANGRTVFNASIIWSMPKYLFSSGRIYNPLMWFFLIGLGLPLAIFGLQLLLP
                     KVNFLKYIHTPIFFAGPGNIPPSTPYNYSLFFAMSFWLYIIRRRWPLWFKKYNFVMGA
                     GVEAGVAISVLVIFLCVQYPGGTLKWWGNDVWKNTYDYQSKKYYTVKAGDKFGYDKWW
                     "
     gene            <26055..>27125
                     /locus_tag="ZYRO0D00352g"
                     /db_xref="GeneID:8203693"
     mRNA            <26055..>27125
                     /locus_tag="ZYRO0D00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496405.1"
                     /db_xref="GeneID:8203693"
     CDS             26055..27125
                     /locus_tag="ZYRO0D00352g"
                     /note="weakly similar to uniprot|P43542 Saccharomyces
                     cerevisiae YFL062W COS4 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496450.1"
                     /db_xref="GeneID:8203693"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DWW6"
                     /translation="MPIMEKDSFKSPLVPALPADVFRYRFIWKIYETIKNYPWVTSQL
                     VLYMSFLFVVEPCVEISELFIGVYLTGMFLSMIYILFLLRYICRDDSKPFSNVELLRD
                     TVLAVDPGVDARKWDIVTSKVNYVLYDNGYRRTPYYFFNRSHCWSVSHHYILRFDSEA
                     AERYRQAVNKCFDDFLQDKPYGCGSKLGRELNVKLASDRGFTIPTFICIISFSFSLLS
                     MNDSRKRLKWFTNINKVGLFVFFCVTFVSIYKGRGMVKYKALGVLHRIKFLATAMQHA
                     PGNDLEKWDHIARHMNYYLHEKGVWRRPEENFFDGKECLDFYRSQFEPLASASTKLFY
                     VELRDIVQETNKVCGSPVVGLV"
     gene            27780..27852
                     /locus_tag="ZYRO0D00374r"
                     /db_xref="GeneID:8203694"
     tRNA            27780..27852
                     /locus_tag="ZYRO0D00374r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (TGC) cove score=80.16"
                     /db_xref="GeneID:8203694"
     gene            complement(<29546..>30490)
                     /locus_tag="ZYRO0D00396g"
                     /db_xref="GeneID:8203695"
     mRNA            complement(<29546..>30490)
                     /locus_tag="ZYRO0D00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496406.1"
                     /db_xref="GeneID:8203695"
     CDS             complement(29546..30490)
                     /locus_tag="ZYRO0D00396g"
                     /note="highly similar to uniprot|P28272 Saccharomyces
                     cerevisiae YKL216W URA1 The enzyme catalyzes the
                     conversion of dihydroorotic acid to orotic acid
                     dihydroorotate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496451.1"
                     /db_xref="GeneID:8203695"
                     /db_xref="GOA:C5DUP9"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005720"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024920"
                     /db_xref="UniProtKB/TrEMBL:C5DUP9"
                     /translation="MSASLATTFLNHTYENPFMNASGVHCMDYKELDELDNSNASTFI
                     TKSSTSLRREGNPEPRYFSVPLGSINSMGLPNEGFDYYLKYVSERQQKKPNTNPAFFS
                     VAGMSVDENLKMLRAIQESDFNGVTELNLSCPNVPGKPQVAYDFDLLKEILGKVFEFF
                     TKPLGVKLPPYFDFAHFDTAASILNQFPLVYVNCINSIGNGLYIDTEKESVVIKPKDG
                     FGGLGGEYIKPTALANVRAFYTRLNPSIKIFGTGGIRTGKDAFEHLLCGATMLQVGTE
                     LYKEGVSVFDRIEKELKEIMDKKGYTSIEQFRGKLSSL"
     gene            complement(<31762..>32478)
                     /locus_tag="ZYRO0D00418g"
                     /db_xref="GeneID:8203696"
     mRNA            complement(<31762..>32478)
                     /locus_tag="ZYRO0D00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496407.1"
                     /db_xref="GeneID:8203696"
     CDS             complement(31762..32478)
                     /locus_tag="ZYRO0D00418g"
                     /note="similar to uniprot|P40582 Saccharomyces cerevisiae
                     YIR038C GTT1 ER associated glutathione S-transferase
                     capable of homodimerization expression induced during the
                     diauxic shift and throughout stationary phase functional
                     overlap with Gtt2p Grx1p and Grx2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496452.1"
                     /db_xref="GeneID:8203696"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ0"
                     /translation="MSLPIIRVHFLNESRAFRVLWLLDQLKLDYEIVPYRRDASFRAP
                     EELKKLHPLGKSPLLEVEDRKTGKRKILAESGYIFQYVLKHFDKAKSLDNADSDKSEE
                     IQYYLHYAEGSLQPPLIVDMLFSMDPYGTLPFPLSYIPGMVTQKIVENYSKGEIKNQL
                     DFIEGEIAKNDGYLVGGKLSAADILMSFPIDMAFGGPYGHQFADPKQYPVIDKWLKNL
                     KTLVSYTSAKYKAGANGAQF"
     gene            <33593..>34909
                     /locus_tag="ZYRO0D00440g"
                     /db_xref="GeneID:8203697"
     mRNA            <33593..>34909
                     /locus_tag="ZYRO0D00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496408.1"
                     /db_xref="GeneID:8203697"
     CDS             33593..34909
                     /locus_tag="ZYRO0D00440g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496453.1"
                     /db_xref="GeneID:8203697"
                     /db_xref="GOA:C5DUQ1"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ1"
                     /translation="MVEFGHEFRRKHFPLIEKDVVPINHGSFGVTPSSVIEYQKQRME
                     EEEKYTDAFFSLNSTEKYVEQLKQLGSYMGVDYRNFALVTNATTAVNAVLRSLPWDFS
                     KDKILFHSTTYQACANTVRFLKDYFKLQYDVVELQYPLEDDEVLELFEKKLSTGEYKM
                     CLFDMITSMPGVKLPYQQLISLCQKYNVWSLIDGAHAAGQVDLSFLDRLKPDFMTTNL
                     HKWLFVPKTCAMLYVNPKHHDLIQTFPVSWSYGMKLIESPSTSQEVQHNENLLINKFM
                     FVGTATYAQVLSVSEALKFRSDVCGGEDNIRKYQYDLQKRAIEQVKKVFGPGSESLQN
                     STGSLNPPGLFNVSLPFAEEYMPVLRNLQDDFGYFRVFKYKCDRKMLAENKAYAPFVI
                     HNGKIWVRFSVNLYNELDDYSAGAASVKSVMEQVLHTELENLKLKA"
     gene            complement(<35775..>36008)
                     /locus_tag="ZYRO0D00462g"
                     /db_xref="GeneID:8203698"
     mRNA            complement(<35775..>36008)
                     /locus_tag="ZYRO0D00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496409.1"
                     /db_xref="GeneID:8203698"
     CDS             complement(35775..36008)
                     /locus_tag="ZYRO0D00462g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496454.1"
                     /db_xref="GeneID:8203698"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ2"
                     /translation="MRKENPDSAVTAPPLNKHVVLMADLKAATLAKYSSKTKVILGSN
                     LTDCPLYAHLCRRSQIRLHSLQSFIYVFLIAIS"
     gene            complement(<37639..>39519)
                     /locus_tag="ZYRO0D00484g"
                     /db_xref="GeneID:8203699"
     mRNA            complement(<37639..>39519)
                     /locus_tag="ZYRO0D00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496410.1"
                     /db_xref="GeneID:8203699"
     CDS             complement(37639..39519)
                     /locus_tag="ZYRO0D00484g"
                     /note="similar to uniprot|P36102 Saccharomyces cerevisiae
                     YKL025C PAN3 Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease complex which acts to control poly(A)
                     tail length and regulate the stoichiometry and activity of
                     postreplication repair complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496455.1"
                     /db_xref="GeneID:8203699"
                     /db_xref="GOA:C5DUQ3"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ3"
                     /translation="MSGIGWEKMDWPKDIPCRNVTIYGFCKKEKEGCPFKHDSNDYTN
                     VKVPASAYADNNSSNFNPIVSSNTGSSTSKFNAKASASFTPMSAKTSGFVPLNSGSTN
                     GMGPVAEPPWLSTVPQQPYVSPTYNPYATGSFTPTSSAGNPLNPMGITATDAGTDFNL
                     PMADAAAAMGIGELSQTDTDAKVNLPIMYPPMHSLLQYHLYAPDPPPHLRASLRPNER
                     MAQDLFIPNDLREQLVKRNLASLQIFPLGGAIPSVVQDYFGLVPLDFNKNSGKKDSFM
                     GHKNSLYKVFSNVDGKVYLLRRVHSVANVEPSYISKTFHAWSNVDCNNVVKLVDLFLT
                     TKFGDSSLCAVYDFYPMANSLYEDHFVNFPLKPITQEYLWSYLVQLSNALNSVHSQGL
                     VVDVLDLHKVIVTGSPGRIKIADCGPLDVLKAGKTRDIVAEQQESFGKLGNLLIELAT
                     KLGPEGGAQTESVDNLVVDEKFKDVLKYLLSDKPKSVTELTCMFHDKIFSVINSSLTY
                     AEYTEGVLSKELENGRLFRLICKLNFIYGRMEHRIDVNWSESGDKFPILLFYDYVFHQ
                     VDATGKNIMDLTHVLRCLNKLDAGVLEKIALVTPDEMNCIIVSYKELRDLIDTTFRIL
                     CQ"
     gene            <39693..>40445
                     /locus_tag="ZYRO0D00506g"
                     /db_xref="GeneID:8203700"
     mRNA            <39693..>40445
                     /locus_tag="ZYRO0D00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496411.1"
                     /db_xref="GeneID:8203700"
     CDS             39693..40445
                     /locus_tag="ZYRO0D00506g"
                     /note="similar to uniprot|P40579 Saccharomyces cerevisiae
                     YIR035C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496456.1"
                     /db_xref="GeneID:8203700"
                     /db_xref="GOA:C5DUQ4"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ4"
                     /translation="MVKSVIVTGVSRGIGKSLVEEILDDRESAIVTGIARSESSLKSL
                     KEQFGDKFFYVVGDVTDKNAASALVQEALNKTGKIDSVVANAGVLEPVQNVQRADVDD
                     WKKLFDVNFFSVVTLATLAMPHLIKSQGNLVFVSSGASTKCYSGWGAYGASKAALNHL
                     ALTISKECDGVKAISVAPGVVDTQMQVEIREKFGPTGMTPESLKRFNDLKANGDLLDV
                     KVPARVYAKLALQGIPNELNGEYLRYNDKRLG"
     gene            complement(<40520..>41464)
                     /locus_tag="ZYRO0D00528g"
                     /db_xref="GeneID:8203701"
     mRNA            complement(<40520..>41464)
                     /locus_tag="ZYRO0D00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496412.1"
                     /db_xref="GeneID:8203701"
     CDS             complement(40520..41464)
                     /locus_tag="ZYRO0D00528g"
                     /note="similar to uniprot|P15700 Saccharomyces cerevisiae
                     YKL024C URA6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496457.1"
                     /db_xref="GeneID:8203701"
                     /db_xref="GOA:C5DUQ5"
                     /db_xref="InterPro:IPR000850"
                     /db_xref="InterPro:IPR006266"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ5"
                     /translation="MLRNISCRFLKAPHATSVTFSRAASLSSMSARRTAVFGNARSLI
                     NTRCYSEQSGAKGDSAKNQSSSSPPPQPSNSGKGRLLVVLGLLAIGSTIASINYQKND
                     PAEFLEEKSFQAPEEQPLFSDDQISVIFVLGGPGSGKGTQCAKLVQNHQFVHLSAGDL
                     LRAEQAREGSQYGALIKKYITEGLIVPQEITVQLLKQAIESKYKEGKTRFLVDGFPRK
                     MDQAITFEKVVAPSKFTLFFECPEQVMLQRLLERGKTSGRDDDNIESIKKRFKTFIDT
                     SMPVVEHFAKQSKVVRVRCDEPVDAVYGHVETAIKDKI"
     gene            <41646..>42449
                     /locus_tag="ZYRO0D00550g"
                     /db_xref="GeneID:8203702"
     mRNA            <41646..>42449
                     /locus_tag="ZYRO0D00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496413.1"
                     /db_xref="GeneID:8203702"
     CDS             41646..42449
                     /locus_tag="ZYRO0D00550g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496458.1"
                     /db_xref="GeneID:8203702"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ6"
                     /translation="MDDSAIVAFLLSDDEEEDFEDVICDLREGLQINDVEASKKSKRS
                     KKKKKPFDYSSVGGGFQESSRRGKKFKKGPKSSELEITIEEEKLEIIICEEELFGSTN
                     SGNNRKRSNNKRNGRKNKKIPEENSPILEEPLKSEKKPKNRRNRHKTEEKNDEEFRID
                     DAKPLEEFSINQDKNAIKKSKLRRDVFKPEQEPDKKPKSKKLDAPKSQQKQNSKPKKS
                     DPVPNSNSKPRSNSKPKSKPESNPKPNRKSDPNHKLKDDKKKKKKNEKD"
     gene            complement(<42511..>45547)
                     /locus_tag="ZYRO0D00572g"
                     /db_xref="GeneID:8203703"
     mRNA            complement(join(<42511..44830,45510..>45547))
                     /locus_tag="ZYRO0D00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496414.1"
                     /db_xref="GeneID:8203703"
     CDS             complement(join(42511..44830,45510..45547))
                     /locus_tag="ZYRO0D00572g"
                     /note="similar to uniprot|P09798 Saccharomyces cerevisiae
                     YKL022C CDC16 Subunit of the anaphase-promoting
                     complex/cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496459.1"
                     /db_xref="GeneID:8203703"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ7"
                     /translation="MCQLNLSRIVWVLSNQPMSTHGTPTQHNSTLVISPFITGNAGSK
                     SNANSSQANQVTDGQTTTGPDPRTEEAGNNWRESISHSPYQSIANSPLVQKTNPSVTA
                     ASLATPYHNAAQNDTGNGGNGILTSISKNSLFGSTIPSTLRKVSLQREYKDPTGGDAN
                     NDAPADGGSAAGESGNNQDGMATTTLTTTTTTTATTVAEFDISELSSIEKLRLWRHDA
                     LMQHLYKTAEFIGNKIYTMTGDPNDAFWLAQVFYSSGACIRAVELLTKDMLDSVSIMC
                     RYLLALCLVDLQRYEEALDVVGESNPFYEAADQDAKKQNDGGIKLESSLCYLRGKIYA
                     AQNNFNKSKESYKEAVLVDVKNYEAFEELIAKNLLTPKEEWDLLEALESEFSLLDDNQ
                     EMVKCLYTIRLSKYLNEDKTLDARRQLIEEHNLESNVDILRSQAEIYCTQCKFTQCLE
                     ICEIILERDEFNGEVLPLYISCLYELGAKNKLFLLSHKLAENFAKNSITWFSVATYYM
                     VVEKIEEARKYFSKSSILDPNFAPAWLGFAHTYAIEGEQDQAISAYSTAARFFPGIHL
                     PNLFLGMQYMALNTFSLAEEYFTLAYDTCPQDPLLLNEMGVMYFKRNDLHKAKRYLKR
                     ALEAVKELNPTSRTSVSIQMNLAHAYRRLGENERAIKCFKTVLEVSSKDSDTYCSLGF
                     LYLKTKELQRAIDHLHTALSLKPSNLAAQELLLHALELNVSMNLDADHPLIVNSQLYE
                     SNFDQFISSRKRAPRTLDSVGYAKRMRKTHGPLQMANDDDAMDLE"
     gene            <45944..>47059
                     /locus_tag="ZYRO0D00594g"
                     /db_xref="GeneID:8203704"
     mRNA            <45944..>47059
                     /locus_tag="ZYRO0D00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496415.1"
                     /db_xref="GeneID:8203704"
     CDS             45944..47059
                     /locus_tag="ZYRO0D00594g"
                     /note="highly similar to uniprot|P38998 Saccharomyces
                     cerevisiae YIR034C LYS1 Saccharopine dehydrogenase (NAD
                     L-lysine-forming) catalyzes the conversion of saccharopine
                     to L-lysine which is the final step in the lysine
                     biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496460.1"
                     /db_xref="GeneID:8203704"
                     /db_xref="GOA:C5DUQ8"
                     /db_xref="InterPro:IPR007698"
                     /db_xref="InterPro:IPR007886"
                     /db_xref="InterPro:IPR027281"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ8"
                     /translation="MSVNLHLRAETKPLEARAALTPSTVKHLLNKGFKIYVEDSPQST
                     FNIDEYKRAGAEIVPAGSWVNAPKDRVIIGLKEMPEDDKFPLVHEHIQFAHCYKNQAG
                     WKDVLKRFIDGKGTLYDLEFLENDQGRRVAAFGFYAGFAGAALGVKDWAFKQTHADSE
                     DLPSVSPYPNEQSLIKDISGAYQAALKKGAQKPKVLIIGALGRCGSGATAFLHKVGIP
                     DANILKWDIKETSRGGPFPEIAQADIFINCIYLSQPIPPFINYQLLNQPNRRLRTVVD
                     VSADTTNPHNPIPIYDIATVFPKPTVRVPTTVGPKLSVVSIDHLPSLLPREASEFFAR
                     DLLPSLELLPQRHTAPVWVKAEKLFKKHCRRAEGAKL"
     gene            complement(<47163..>48347)
                     /locus_tag="ZYRO0D00616g"
                     /db_xref="GeneID:8203705"
     mRNA            complement(<47163..>48347)
                     /locus_tag="ZYRO0D00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496416.1"
                     /db_xref="GeneID:8203705"
     CDS             complement(47163..48347)
                     /locus_tag="ZYRO0D00616g"
                     /note="similar to uniprot|P20484 Saccharomyces cerevisiae
                     YKL021C MAK11 Protein essential for cell growth and
                     replication of M dsRNA virus contains four beta-transducin
                     repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496461.1"
                     /db_xref="GeneID:8203705"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DUQ9"
                     /translation="MARNQIRIIVGSYEHNILCLSLDLSLSTPIFTPIFHFQAHTLSV
                     KCMDVSNRYLISGSHDEHIRIYDLQKRKELGTLLSHQGSITSLKFSRKVINSNNEDET
                     QLAKPGAEGKSKWLFSTAEDHKILIWRVKDWEDFGVLRGHTARVNDIDIHPSNRIAVS
                     VSEDHTVRLWNLMTIKKAAVLKLRGYPQNGQFVRWVGSEGKYFAVALLNKVLLYDSST
                     AKVSQEIDVGKRTIMHLETMRWEGQDYIVVGLSNGAVAFYTLDSVLNSEEKEPEFSLQ
                     GHANRVKDFKPFTNEFGTYFIAIGSDGKIVVWDLKSKEQLAIFDSGERLNCLAVCNES
                     VEKESTMKKRDATTAEIDEQSEAEGDEEELKKVLFGEKKGKKKSKKAKKHGKKKVSVH
                     LE"
     gene            complement(<48583..>51831)
                     /locus_tag="ZYRO0D00638g"
                     /db_xref="GeneID:8203706"
     mRNA            complement(<48583..>51831)
                     /locus_tag="ZYRO0D00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496417.1"
                     /db_xref="GeneID:8203706"
     CDS             complement(48583..51831)
                     /locus_tag="ZYRO0D00638g"
                     /note="similar to uniprot|P40578 MGA2 and to YKL020C
                     uniprot|P35210 SPT23, Saccharomyces cerevisiae ER membrane
                     proteins involved in regulation of OLE1 transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496462.1"
                     /db_xref="GeneID:8203706"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR002909"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DUR0"
                     /translation="MLHQVKNESLFPIGSGNGNGEDVNMLESDLLDDFMFGRQDRPDD
                     EDAIFNSFIKTDQLEDPTAVVDGRIFNKPVVEEQQEEVPFVSSGEEQAPASPLQEPQQ
                     PKSPPLTTSDYEKHCQELVDHSLVFGRTEPLHTAYVNPLDYLHIDGNSLPYQLQISGL
                     PDVSRVENQIKLEFRVSPPVKQCMIHLPTDCIARHKFYLEKDVSAYPQEFQDQLLFAE
                     AFLLCSSNDKNTYVCTRCVKREHRRASRRKSGLSDNMLWCNNENRRAIIFNNKQVFVA
                     KGSDGDSTQGDKTFELTARVVCYCRHHKSPDGFKILFVLKNSKGEVLAKTVSSNIMIM
                     DKKPQLNSSESVGNIHSNANSNNNMDSGADTATELFSNTNFGEFPTTTSASEYNSNNI
                     NVVTNSGAPSVDMESTPGKYFSMGELSPPPGGLEMPDGNDNPPDGFNGGNISDHLVAR
                     GVMPSPTSMSEDGSESYLSAMDRRRTSGPLGSGSAAYARTKNYQRKRPRHDTAMDDGE
                     DGGSWSSSSVGIISGKPVVTQRPSTSGPTQTTQEDCPSIQRVIPSQGPINGGIEITLL
                     GSKFKDGLVVKFGENVALSTQCWSETTMVTCLPPASCAGQVFVTVINPAGSSNNAASE
                     VQISNQATFTYMDDTDRQLIELALQIVGLKMNGKLEDARNIAKRIVGNDDSPKGNSPS
                     LSTGNDNNAGGSIQDAFDNKLMYSDENLLVKVIRSLHVNSNLSMCDSLGRTLLQLASL
                     KGYHTLCSVLIKKGARVNDRDSFGFSPLHFACVGGDTKVIRLLLQCKADPTVKAHNGV
                     SCKQLFVVNHGTKKDNYQYVEDVLRIFDEFNQSNSFSKPMRKLSDASFNSSLYDTESL
                     DSLDAGNGPVQASGAVGEYSASDHEESELEEDGDEDLLAEDDSPIPVTSAQPVGTSDD
                     NAIDHSNTQAMDGKLLNKMLSYLNEGLPKYEDLYPNSPQDDANKLREVSRDNNDRPGS
                     TAEESQNSSEDEEDALQLRLNRFFQQRQNFQNDKMLLFFWLPLTVVLLSWYALFKFGQ
                     DGDYVHYFSNMVAEQLRVLLAKIILGNERMKTAFKEQLTMFQNTNILSVNAE"
     gene            <52186..>53115
                     /locus_tag="ZYRO0D00660g"
                     /db_xref="GeneID:8203707"
     mRNA            <52186..>53115
                     /locus_tag="ZYRO0D00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496418.1"
                     /db_xref="GeneID:8203707"
     CDS             52186..53115
                     /locus_tag="ZYRO0D00660g"
                     /note="similar to uniprot|P29703 Saccharomyces cerevisiae
                     YKL019W RAM2 CAAX farnesyltransferase alpha subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496463.1"
                     /db_xref="GeneID:8203707"
                     /db_xref="GOA:C5DUR1"
                     /db_xref="InterPro:IPR002088"
                     /db_xref="UniProtKB/TrEMBL:C5DUR1"
                     /translation="MEGYEDVSPLPLDTGFKDELCQIMYTDEYRMVVGTARALMERRE
                     YSERAKELTGRVIDLAPAYYTAWNYRFDILMHLARGNVELLNQELEWIDEVTLNNPKN
                     YQIWSYKEAVLKNHPSPSFKRELPILQLMLDEDTKNYHVWSFRKWCVLFFGDFSHELG
                     YTESLLERDVYNNSAWTHRMFVLKNTSPSHDHVLEEIEYVKGKIELVPQNISVWTYLR
                     GLYENFLNANYDDEIIQFTSTFTHGVEEEDETDVNVEIESSCALEFIAHVYALRGGAM
                     TRKAINAYKGLATKYDPIRKNLWELKISRVTKS"
     gene            <53385..>54446
                     /locus_tag="ZYRO0D00682g"
                     /db_xref="GeneID:8203708"
     mRNA            <53385..>54446
                     /locus_tag="ZYRO0D00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496419.1"
                     /db_xref="GeneID:8203708"
     CDS             53385..54446
                     /locus_tag="ZYRO0D00682g"
                     /note="similar to uniprot|Q02256 Saccharomyces cerevisiae
                     YIR026C YVH1 nitrogen starvation-induced protein
                     phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496464.1"
                     /db_xref="GeneID:8203708"
                     /db_xref="GOA:C5DUR2"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016278"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR024950"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DUR2"
                     /translation="MIVEREPDLNRILGGIYVGGIQPISEHVPLHGKWEITHILSIIK
                     FEVIPEYLVRKSYTLKNISIDDDLHTNILEYFNESNRFLDNCLYPNELEYDPAKVDFR
                     KKPHGGNVYIHCQAGVSRSVSFTIAYLMYRYRLNLKTALHAVKRKRPMSQPNDNFMEQ
                     LQLYEDMGSRYVDGNNQLYKQWLLKNSVKLDPTGSEILSHDETFKKDEEKDFESMTPE
                     EQTQVKVARCKKCRQKLALSTSFIPHSPPSKQSSEGHFIRRAAGSHRIIGIEASQNQC
                     SHYFVEPMNWMKDELQAKQELEGKFGCPGCHRKVGGYNWKGSRCSCGKWVIPAIHLQS
                     DKVDLMSLRGPSLAPNVTK"
     gene            complement(<54486..>55589)
                     /locus_tag="ZYRO0D00704g"
                     /db_xref="GeneID:8203709"
     mRNA            complement(<54486..>55589)
                     /locus_tag="ZYRO0D00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496420.1"
                     /db_xref="GeneID:8203709"
     CDS             complement(54486..55589)
                     /locus_tag="ZYRO0D00704g"
                     /note="weakly similar to uniprot|P40577 Saccharomyces
                     cerevisiae YIR025w MND2 Subunit of the anaphase-promoting
                     complex (APC); needed for meiotic nuclear division"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496465.1"
                     /db_xref="GeneID:8203709"
                     /db_xref="GOA:C5DUR3"
                     /db_xref="InterPro:IPR008402"
                     /db_xref="UniProtKB/TrEMBL:C5DUR3"
                     /translation="MTSSVPLSGLPLFRDVKENLIQQRNEQQQQHQQQQATHQAKRRN
                     HLKKSSTHHHYMPPLSAYNASEERPYYPGGRFDEMTMRIEMEQRRLNGIRNLGYNYIR
                     PIGVGHTLQMIRERKQLAAKLRVEEAAQQQEQLELQGQEEQEQQLDQIQRPRQQQQHS
                     ILPSAFQENGDRSSHYDFGMVEDVGEDPTGTSPPQPMGQILAPPFNPTVEDEDEEEDE
                     ISYDYEAEFAQVEDEQNEEDEEDEYLDKNQEGRLRMLNPRGATRDFSIQQFVETSHME
                     SHPYDMEDDYENPQLEVETNQGDSGDFTEVPWINISDTVDNVDSPRVSSLNSLVGHRM
                     ISSSTVTTNNNGLRLLPPRARRVSDNNSDQELI"
     gene            complement(<55781..>56092)
                     /locus_tag="ZYRO0D00726g"
                     /db_xref="GeneID:8203710"
     mRNA            complement(<55781..>56092)
                     /locus_tag="ZYRO0D00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496421.1"
                     /db_xref="GeneID:8203710"
     CDS             complement(55781..56092)
                     /locus_tag="ZYRO0D00726g"
                     /note="similar to uniprot|Q3E7A7 Saccharomyces cerevisiae
                     YKL018C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496466.1"
                     /db_xref="GeneID:8203710"
                     /db_xref="InterPro:IPR013726"
                     /db_xref="UniProtKB/TrEMBL:C5DUR4"
                     /translation="MGFNGILHYGFDLTLIAMVLAAIRQNTGYVFAYEQYGIGTYLYK
                     YLGWGEWCYSYLVRFVKFSGKFRKQLPQDKFTQDSSTRIEELDRTERKSSSRRRQSRH
                     Q"
     gene            <56274..>57251
                     /locus_tag="ZYRO0D00748g"
                     /db_xref="GeneID:8203711"
     mRNA            <56274..>57251
                     /locus_tag="ZYRO0D00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496422.1"
                     /db_xref="GeneID:8203711"
     CDS             56274..57251
                     /locus_tag="ZYRO0D00748g"
                     /note="highly similar to uniprot|P36104 Saccharomyces
                     cerevisiae YKL018W SWD2 Subunit of the COMPASS complex
                     which methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496467.1"
                     /db_xref="GeneID:8203711"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DUR5"
                     /translation="MDISKENLSKFRAVKSFRLPENEVLPITSLSFDDHGQYLLSASA
                     SDNMHLYDAVGCRFLNTIASKKYGCHAARFTHSQSECIYSSTMKSFDIRHLNLETNQY
                     LRYFTGHGALVSDLQMSPLNDTFLSASYDESVRLWDMRASKAQAIVPSLVPSCIAYDP
                     SGLVFALGNPQNYEIGLYNLKQLKNGPFLVIKVNPKFDKWNKLEFSNDGKYLLLGSSA
                     GRQVILDAFDGTQLFELSGTKSFPLREFMDSGSACFTPDGRYTMGTDYEGKIAIWNHS
                     ESVSGKTLKPQGYIQAAPESCPRTIAFNPKYAMFVTADEMVDFYVGQDN"
     gene            complement(<57270..>59237)
                     /locus_tag="ZYRO0D00770g"
                     /db_xref="GeneID:8203712"
     mRNA            complement(<57270..>59237)
                     /locus_tag="ZYRO0D00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496423.1"
                     /db_xref="GeneID:8203712"
     CDS             complement(57270..59237)
                     /locus_tag="ZYRO0D00770g"
                     /note="similar to uniprot|P34243 Saccharomyces cerevisiae
                     YKL017C HCS1 Hexameric DNA polymerase alpha-associated DNA
                     helicase A involved in lagging strand DNA synthesis
                     contains single-stranded DNA stimulated ATPase and dATPase
                     activities replication protein A stimulates helicase and
                     ATPase activities"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496468.1"
                     /db_xref="GeneID:8203712"
                     /db_xref="GOA:C5DUR6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004483"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUR6"
                     /translation="MHLADQFLNSISHERDQDVNQTERLLNSLPLTKLVKAGYAITNL
                     NLENLRTGLGGKIYLELGPDNAIDQEIARGDVKVGDIVIIAPVKSKFKDESRCNGVVF
                     KMSSQQLVVSIEESMEEEAVKLYSSRLYVLKTTNTITYQRMESSMRKLKEIESLKGNS
                     IVQYLLEGKPFHASAPDPKVKFHNESLNDPQRQAIRFSLSNEISIIHGPPGTGKTYTL
                     VELIQQLVERGQRVLVCGPSNVSVDTILERLSKVLPGTSLIRIGHPARLLEKNLTHSL
                     DVLSKTGDAGAIVKDISKEIDQTIASIKKSRSFHDRREGWKTVKDLRKELRLRERKVI
                     NDLIMESKVIVATLHGSSSKELLSTYNAIPKLFDTLIIDEVSQSLEPQCWIPLISHKQ
                     SNIGKLVLAGDNKQLPPTIKTEDDKKVQKLLGTTLFDRLIKQYGDSFKQLLTIQYRMN
                     EEIMSFASQEMYDGKLIADKSVATQRLTDLPGVDVNEDTEAPLIWYDTQGDDFPESSN
                     EDEEIAASRFNENEALLLEDHISKLVGSNVPQDAIGVISPYSAQVGIIKKLIHEKYPQ
                     VEISTVDGFQGREKEVIILSLVRSNDTFEVGFLKDDRRLNVAITRPKKQLCIVGNMET
                     LERSRVPFLEHWAHWSEENAEIRYPDIDDLL"
     gene            59660..59732
                     /locus_tag="ZYRO0D00792r"
                     /db_xref="GeneID:8203713"
     tRNA            59660..59732
                     /locus_tag="ZYRO0D00792r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8203713"
     gene            <60373..>62310
                     /locus_tag="ZYRO0D00814g"
                     /db_xref="GeneID:8203714"
     mRNA            <60373..>62310
                     /locus_tag="ZYRO0D00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496424.1"
                     /db_xref="GeneID:8203714"
     CDS             60373..62310
                     /locus_tag="ZYRO0D00814g"
                     /note="similar to uniprot|P32349 Saccharomyces cerevisiae
                     YPR190C RPC82 RNA polymerase III subunit C82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496469.1"
                     /db_xref="GeneID:8203714"
                     /db_xref="GOA:C5DUR7"
                     /db_xref="InterPro:IPR008806"
                     /db_xref="InterPro:IPR013197"
                     /db_xref="UniProtKB/TrEMBL:C5DUR7"
                     /translation="MASVAQSSTPVPNASSTTPAPNASNTPGAQQEDIVMVSSLEQRT
                     LSPEWFLYTELAKSLLGERAAFIVDVLLSLGRLSVGEICSKAPSSMNARSVKATLVSL
                     IQLRCIRYVEESVGSSGRAITYYYFNEEGLLLFLYSGSVIEELGRRVSNPSMASQIVQ
                     NILSLGSLTLNDYLQSCDPQISKRDVISVFVQLCEGGFLTAITKVHYTPVKALWDGLY
                     IKAYNAIPRTSTMSDLKKRNEAKSKAKVEFLQILNSVNDLSKVLTTDPQTSLRTVVGN
                     LPLTINFARFLKIRRSKQLVQLARTRIGSIPSQVYNIALQITEPKSPEPVDPLTLTGL
                     LQDLDEAKSIHEEQELLEEKNAGTTFSAIDIAKYLPESLDLRNTLKTSLRTNKRGPNP
                     NDQLPTKKLKTEDGFVIPPLPNPQQEQEQQEDDNDDDDPIDEDDGNPHSVSLVNGHLK
                     LLASTSIPFLKEIRPGVFYVPYTKVLPILKTLTYDYIIASTLGPSAMRICRCIRENSL
                     VSEKFINSTALMKEKDIRTTIGSLIKYNVIEIQEVPRTADRAASRAVFLFRSKERHAY
                     NFMNQNLAWNVANLLHKKERLKEDNSTLLTKANRDDVKGKETELLLPSELNQLKMVNE
                     RELNIWTRVSRMLSLWEIFKF"
     gene            complement(<62421..>66626)
                     /locus_tag="ZYRO0D00836g"
                     /db_xref="GeneID:8203715"
     mRNA            complement(<62421..>66626)
                     /locus_tag="ZYRO0D00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496425.1"
                     /db_xref="GeneID:8203715"
     CDS             complement(62421..66626)
                     /locus_tag="ZYRO0D00836g"
                     /note="similar to uniprot|P17883 Saccharomyces cerevisiae
                     YPR189W SKI3 dsRNA virus protection family member contains
                     8 copies of the tetratricopeptide (TPR) domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496470.1"
                     /db_xref="GeneID:8203715"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DUR8"
                     /translation="MSNVKDLLKEAKVELSREDYVEAVKICKKVLNADKENYFAHVFM
                     GKSYSNMDNRIQDAIDHYNKAIELLPEELLAWKGLYLVFKESDVIPSIVNFDTYFEFC
                     GGYARALANKGVSQVDLIHDIRVFRKTHTDCEESFLRHMVPGTPTAEQLARHLISAQD
                     AISGLIRILNSKQQDQISKHVSRERLKLSANDPSYQGKINTLSWEVYKDSELDDLYNQ
                     LINITDDDEQRSNLEAQWLEYRLKVLKSTPQNLKGSSFEKLKRMTEDMVLVDHASIRP
                     WKLYFEWQDYENLDSMDMDLIMKFFRKFPIEPLAVILYAWVCSNFSQYDTKKLQTEAE
                     KKSSAQDETNELNEIDESEKRALKEMMEAENDTTTMAEDEVMTALMDNITRAQSSALA
                     HRIVSQYYIYSKENEAALTYVKKGASLVAYEVRDYGAHLVNSKREFTLKLATLYIYID
                     SPKNHSLALSLFEKVLKENPENTQAKMGKGLIFMERQNYTDAKLLLSEVISQYADNLE
                     FLSELAWCEACLGNLDESIGILNKVLTSLQGTDLRTSAFRALNIWRLAKTHVLKQEKE
                     NPEDQKYVKIAFRLLIQSIKVLDTYAPNYSALGDIYNRFYKDGVRAFKCFYKAFELDD
                     SDLMAARYMSENYTELGNWQAARVVCERLVGSERAKRALQTVNWPFRVIGIAYLEGQQ
                     EANSIEWFQSALRVNQSDVEAWVGLGQAYYACGRIEASIKVFEKAIELDSEHHYAKYL
                     KAQSLSLMGQFDEAIDILNALTEILPQETIFQMTKATILVNYAHDLYSQGFLMKSVAT
                     AADAIGIMQFIATELSFYGQALWIGILKALKLFIWVESKVGDLPVEALISTFGAVSTS
                     NQVLNSIDELDGITLDNILSEIEDSSISIACKLLILSAKYAVATTTYEALTRTVRSSL
                     WYNIGTSELSAYHILKNDKFRDSAIASFKKSIQYQSNTVESWMGLGIATMDVNYRVAQ
                     HCFIKCTAMAPKEGSVWFDLALLALQNNDAEFALTVLNKSQSIAPQDSSPWLGNALIL
                     EKQGKIKESCRMFAHAFILSNGRSKAAQLYFAKSVLQNRIGYSGDERDISAVEELSAV
                     VHGLDQYFKKSPSDSFALQCALLALERLRIFPYATGVADRLVRLIESRFEKGQDNDEL
                     YNFAVVKAQIARVQLGLGQYDAVIENADLSRSILVDFENENNTSIFVSNHICLALAYF
                     FSDNFDETLTHLEELLRLSKESKHLVILISKLLYSVGSEDTKTIAIEELTECLSNKNG
                     DLILCLTLAAIALLEGKREDMSIVFGRLRETPLEDVIADEHRDLPYLMDLLYKKLSHG
                     KSTGNGVSWQRSAFFFMNDNKVWTDLSKKIQQRVASDGQNKVTSRQLSDCYWSQKNLK
                     SIQRSIFLCPDNASAVSALNQCF"
     gene            <66798..>67277
                     /locus_tag="ZYRO0D00858g"
                     /db_xref="GeneID:8203716"
     mRNA            <66798..>67277
                     /locus_tag="ZYRO0D00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496426.1"
                     /db_xref="GeneID:8203716"
     CDS             66798..67277
                     /locus_tag="ZYRO0D00858g"
                     /note="similar to uniprot|Q06580 Saccharomyces cerevisiae
                     YPR188C MLC2 Regulatory light chain for the type II myosin
                     Myo1p binds to an IQ motif of Myo1p localization to the
                     bud neck depends on Myo1p involved in the disassembly of
                     the Myo1p ring"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496471.1"
                     /db_xref="GeneID:8203716"
                     /db_xref="GOA:C5DUR9"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:C5DUR9"
                     /translation="MSDNDSLTFSKLTQTHIQRLKDAFQTIDDDGDGAISQKDLDKIF
                     KSIGKQMKPEQLESMLTTANAKDGEGVTFPEFLSIMGETMGKYPEDTEIVNCLKVLSD
                     NNELNVPVDDLLSYLKDAGYPKAEIEFEKLFREFTSDQDFAGKKVFKGKQFMNTISE"
     gene            complement(<67316..>67912)
                     /locus_tag="ZYRO0D00880g"
                     /db_xref="GeneID:8203717"
     mRNA            complement(join(<67316..67793,67893..>67912))
                     /locus_tag="ZYRO0D00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496427.1"
                     /db_xref="GeneID:8203717"
     CDS             complement(join(67316..67793,67893..67912))
                     /locus_tag="ZYRO0D00880g"
                     /note="highly similar to uniprot|P20435 Saccharomyces
                     cerevisiae YPR187W RPO26 RNA polymerase subunit ABC23,
                     common to RNA polymerases I, II, and III; part of central
                     core; similar to bacterial omega subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496472.1"
                     /db_xref="GeneID:8203717"
                     /db_xref="GOA:C5DUS0"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="InterPro:IPR028363"
                     /db_xref="UniProtKB/TrEMBL:C5DUS0"
                     /translation="MSDYEEAFNDGGNENFEDFDVEHFSDEDNFNDVNGNGGAVDGTG
                     LPQGDGPKAENGDNIVASNMGGEEFTSEQNRRKTLKEKAIPKDERTTTPYMTKYERAR
                     ILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYMPDGSFEDWSVEE
                     LIVDL"
     gene            <68162..>69379
                     /locus_tag="ZYRO0D00902g"
                     /db_xref="GeneID:8203718"
     mRNA            <68162..>69379
                     /locus_tag="ZYRO0D00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496428.1"
                     /db_xref="GeneID:8203718"
     CDS             68162..69379
                     /locus_tag="ZYRO0D00902g"
                     /note="similar to uniprot|P39933 Saccharomyces cerevisiae
                     YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
                     putative Zn-fingers"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496473.1"
                     /db_xref="GeneID:8203718"
                     /db_xref="GOA:C5DUS1"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DUS1"
                     /translation="MIPGLAELRSWQQGSKTELESVPGSPQSVRSVSSLSSSSSSRPK
                     IYFCDYEGCNKSFARPSTLTEHQDVVHRGIRPFKCNQCEESFTKQIHLERHLWLHTDE
                     RPFHCSQCGKGVVTQQHLKRHEITHTKSFKCTYPGCNEAFYRHPTLRSHILSTHRKLI
                     CEHCNKELKSPAALRHHETKFHNPNVVNPYQCTFTSCAQGFKTWTALQVHIKNDHPKL
                     RCEVCSKPCVGEQGLKMHMKVHDESLVAKNWKCSICDSETFAKKNELIAHFENNHRDK
                     LPPPSLAQSLLPPKENETSSNECSDHNDEQHRSRKRKISELDHAQQNLEQYFVQGKSG
                     MDLLLNTVGRKKQCYYDKCYRTFKTEERYQQHIGKHKIHDLKMKVLQDKQEEEMRNEN
                     GKQTGTSGKIEEI"
     gene            complement(<69563..>71716)
                     /locus_tag="ZYRO0D00924g"
                     /db_xref="GeneID:8203719"
     mRNA            complement(<69563..>71716)
                     /locus_tag="ZYRO0D00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496429.1"
                     /db_xref="GeneID:8203719"
     CDS             complement(69563..71716)
                     /locus_tag="ZYRO0D00924g"
                     /note="similar to uniprot|Q06628 Saccharomyces cerevisiae
                     YPR185W ATG13 Phosphorylated protein that interacts with
                     Vac8p required for the cytoplasm-to-vacuole targeting
                     (Cvt) pathway and autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496474.1"
                     /db_xref="GeneID:8203719"
                     /db_xref="GOA:C5DUS2"
                     /db_xref="InterPro:IPR018731"
                     /db_xref="UniProtKB/TrEMBL:C5DUS2"
                     /translation="MNSIMGNDKEVVELIDNFFFKSTLLICSTKSNKLQTPLDEVPHF
                     DEEWFLKGTDEELELPEIIKQWSNFDGARELPPLVIETYLDLRNLGPQDSVHLKDEEG
                     NSWSVCRGSKKSEIVLERWLIELDSLSAAFKSHKVSEEESNSLSRQFVLLFRYLYTLT
                     QLLPANDLYLSLSKNVVSHGTLPLISVSTRILDGSKPILSKGRIGLSKPIISAYSNVI
                     NESNVPSHLEQRKITPVWTKYGLLRVSVSYRRDCHFEVHHDNEEEANIATTTTTAGTP
                     AARRPSQNQQQSVSLSPHGHAGSLNSMEQQSLPRKPLSITRQLQPFKVGSVGSAPIPQ
                     PHALTRNPSSSSSILANLQAQRSTNSSMWGPTQQQITPHGGDLHVESTSAGSTSKYSS
                     SFDRLRRHSSVKYNDLPGERPLKPAKMPSDSQPTEDLLDFVKMMNDRPELNIRRSPRA
                     SVDISNSLMKFQNLKPTNDIISENLNLSLSLDPSHTFQSHSHRSNSHSPLPSYSPNFN
                     YPLIPSKFSQPRSLSHDGDSVMGVVTSRRNSSDVLSKNGASNRTRNNSVSSSRRPSES
                     ERGTTTPSFTPGSDFNHENCPRSNYQREESIEDEDEEGLLVNRSGGSSATRIKSMDSI
                     STSISKNRLPIRQPSNYSQPTTTAVPAYAKLHRPGARSAEQQREESSRKLENSITTTA
                     STPNPATTDDSSPHGEDNDDEDLLFFMSDMNLSKM"
     gene            complement(<72410..>76984)
                     /locus_tag="ZYRO0D00946g"
                     /db_xref="GeneID:8203720"
     mRNA            complement(<72410..>76984)
                     /locus_tag="ZYRO0D00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496430.1"
                     /db_xref="GeneID:8203720"
     CDS             complement(72410..76984)
                     /locus_tag="ZYRO0D00946g"
                     /note="highly similar to uniprot|O93808 Saccharomyces
                     cerevisiae YPR184W GDB1 Glycogen debranching enzyme
                     containing glucanotranferase and alpha-1
                     6-amyloglucosidase activities required for glycogen
                     degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496475.1"
                     /db_xref="GeneID:8203720"
                     /db_xref="GOA:C5DUS3"
                     /db_xref="InterPro:IPR006421"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR010401"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029436"
                     /db_xref="UniProtKB/TrEMBL:C5DUS3"
                     /translation="MVLNRTVLLRLDSQGEPVVALSYGQGVLTLPSVPLPPGTPKGTP
                     LFTVRLVVTAGSKVSRDGLVWTNCPPDSETEFDRHKFYKKQIRATFHKDDKIDLDIFR
                     PGPYCFYLSFRNRDGKLETTRKFYFVAPPILHVDGKLVKLDSVALQTVVSKWMGKNWD
                     AVFERIAAKKYNMIHFTPLQRRGHSNSPYSIYDQLEFDPDHFSSTEEVKQMVHRLHTK
                     YKALTLTDVVFNHTADNSKWLREHPESGYNAITAPHLIPAIELDGALLQFSKTMGQLG
                     YPTDLHNSNDLDHVMEGIDVHVLQAIRLWEYYVVDVRGTLDQLQGYWNGLTTDPDLKL
                     PLDSNSPVKEIARYVREHATVKPFGILGSRFVNKVDVIKFGSVLQKLYGKNWDRNILS
                     KAEEILNELNLPLYKDHDNDVNEIRNQLYNRIKYSKLDPSGPRQGPINDIFPLTEPYF
                     TRFKADDGKDYALANNGWIWASDPLIDFASGESKAYLRREVIVWGDCVKLRYGKGPED
                     SPYLWKRISDYVTQSALIFDGFRIDNAHSTPLHVGEYFLDLARKVNPNLYVVAELFSG
                     SEQMDCLYVERLGLSCLIREAMQAWTESELSSLIHKNGGRPIGSYRFVPMDNFSYDRD
                     IQLNRNYCYHDASDGSMKCVSEIMIPRILTAVPPHALLMDCTHDNETPNQKRTVEDTL
                     PNAALVALCSSAVGSNFGCDEIFPKLLNLVTESRTYDIHDSPGIGKVKSLLNDIRKEI
                     NELSMDVEDSEAYVHHDGQYITFHRTDVKSGKGWYLIARMKFGENQGDQKLEPQTFAH
                     TTAKPLFAYSLEKTGEAPNDPKLLKGVPTKLVKLEGFKIQFNENSKITTISLPDYFPQ
                     GSIAVFETQHLGVDQSLDHFIRSGAIQATSGLDLIALNSVLYHSDQEENDITDGSTGS
                     YDVPNFGKLIYCGLQGWISVLRGIVFSNDLAHPLSENLREGTWALDYLVGRLDHYRHE
                     PGVAAVQDWLRSRFDRIKQLPFYLRPSYFALTVAIIYDTCRLRAVQLMPTMIGKSTLF
                     VQSLAMTSIQMVTRMKSTSIYPDHLVPSMAAGLPHFSTGWARCWGRDIFISLRGLLLT
                     TGRFDIAEDHILAFAKTLKHGLIPNLLDSGKNPRYNARDAAWFFIQAVQDYIDIVPNG
                     ESILQKKVTRRFPLDDTYVPVDDPRAFQHTSTIEEIIYEIFSRHANGIKYREANAGPQ
                     LDRVMSDQGFNVEVHVDWSTGFVHGGSQFNCGTWMDKMGESERAGSYGVPGTPRDGAA
                     VEIIGLLKSSLRFVNELSKKGLFKNIEVKRENGSQITFQEWEELVQNNFEKKFYIPED
                     PKDDEKYDIDSNLVNRRGIYKDLYHTGKPYEDYELRPNFTIAMTVAPELFTPELALGA
                     LNIADKVIRGPIGMKTLDPSDYNYHPYYNNGEDSDDFATSKGRNYHQGPEWVFLYGYF
                     LRAFYSFHYKTNPACQSKKDKSPSSYLYQELSHRIDRLSKWIAESPWAGITELTNKDG
                     EFCGDSSPTQAWSTACLLDMYHDLWVSFEQ"
     gene            complement(<77554..>78354)
                     /locus_tag="ZYRO0D00968g"
                     /db_xref="GeneID:8203721"
     mRNA            complement(<77554..>78354)
                     /locus_tag="ZYRO0D00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496431.1"
                     /db_xref="GeneID:8203721"
     CDS             complement(77554..78354)
                     /locus_tag="ZYRO0D00968g"
                     /note="highly similar to uniprot|P14020 Saccharomyces
                     cerevisiae YPR183W DPM1 Dolichol phosphate mannose
                     (Dol-P-Man) synthase of the ER membrane catalyzes the
                     formation of Dol-P-Man from Dol-P and GDP-Man required for
                     glycosyl phosphatidylinositol membrane anchoring O
                     mannosylation and protein glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496476.1"
                     /db_xref="GeneID:8203721"
                     /db_xref="GOA:C5DUS4"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DUS4"
                     /translation="MPIEQSVIVPAYKEKLNIKPLTTRLFAALGNDGSRTTELIFVDD
                     NSRDGSVEEVEKLEKQGYNVRIIVRTDERGLSSAVLKGFYEAKGEYLICMDADLQHPP
                     ESVPLLFQSLRKHPFALGTRYAPGVGIDKDWPLHRRVISTTARLMARPLTTASDPMSG
                     FFGLQKQYLVKCDPREINSNGFKIALELMAKLPLPEGSKLGEIPFSFGVRTEGESKLS
                     GKVIIQYLQQLKELYSYRFGLGNIFLFILCWAILILYALNELAKLVLG"
     gene            complement(<78582..>78980)
                     /locus_tag="ZYRO0D00990g"
                     /db_xref="GeneID:8203722"
     mRNA            complement(join(<78582..78872,78972..>78980))
                     /locus_tag="ZYRO0D00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496432.1"
                     /db_xref="GeneID:8203722"
     CDS             complement(join(78582..78872,78972..78980))
                     /locus_tag="ZYRO0D00990g"
                     /note="similar to uniprot|P54999 Saccharomyces cerevisiae
                     YPR182W SMX3 Sm or Sm-like snRNP protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496477.1"
                     /db_xref="GeneID:8203722"
                     /db_xref="GOA:C5DUS5"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016487"
                     /db_xref="UniProtKB/TrEMBL:C5DUS5"
                     /translation="MSDFTPTNPKPFLGELVNKPIVVTLKFNKTQYKGTLISTDNYFN
                     LQLSEAEEVVDGKNKGKVGNIFIRCNNVLWIGEDLSAKEQPQEKPTTDNAPATTE"
     gene            complement(<79136..>80317)
                     /locus_tag="ZYRO0D01012g"
                     /db_xref="GeneID:8203723"
     mRNA            complement(<79136..>80317)
                     /locus_tag="ZYRO0D01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496433.1"
                     /db_xref="GeneID:8203723"
     CDS             complement(79136..80317)
                     /locus_tag="ZYRO0D01012g"
                     /note="similar to uniprot|P41733 Saccharomyces cerevisiae
                     YLR459W GAB1 GPI transamidase subunit involved in
                     attachment of glycosylphosphatidylinositol (GPI) anchors
                     to proteins may have a role in recognition of the
                     attachment signal or of the lipid portion of GPI"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496478.1"
                     /db_xref="GeneID:8203723"
                     /db_xref="GOA:C5DUS6"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:C5DUS6"
                     /translation="MLLKEKYAVVGCVVVRLAVSLLFPSLQTQLDKSVELSTPMSSYR
                     LLNEGIFLLRNGFPLYDGGVVHHPPLLVAFMSLIEPQYLVALLYALTDGLISYQLICM
                     ARFFSDLGLPTWLPGALYALNPLVLLSCVSQSSVIFTNAFTSTAILCALNGNLLTFAM
                     ALGAASYLSLYQLSLLIPSLYLLSRENNQRSRATLAVLGVFAALLQLSSVVTGGSWKF
                     LQATYWSQMNFEKLFPNLGLWWYFFIEMFDMFIPFFKAAFNIFAISFVLPFSIRFQSQ
                     PFYALVLCIGWITLTKPYPTLGDAGFFLSFLPFFKPLFGYMRCPLLSALLFIHAIILS
                     PIFYHLWVDLGSGNSNFFYAISLVYALALGFILIDLCWSMLRIEFDGGRPNYKLKVTQ
                     I"
     gene            80679..80779
                     /locus_tag="ZYRO0D01034r"
                     /db_xref="GeneID:8203724"
     tRNA            join(80679..80714,80744..80779)
                     /locus_tag="ZYRO0D01034r"
                     /product="tRNA-Trp"
                     /note="tRNA-Trp (CCA) cove"
                     /db_xref="GeneID:8203724"
     gene            <81132..>83405
                     /locus_tag="ZYRO0D01056g"
                     /db_xref="GeneID:8203725"
     mRNA            <81132..>83405
                     /locus_tag="ZYRO0D01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496434.1"
                     /db_xref="GeneID:8203725"
     CDS             81132..83405
                     /locus_tag="ZYRO0D01056g"
                     /note="highly similar to uniprot|P15303 Saccharomyces
                     cerevisiae YPR181C SEC23 cytoplasmic GTPase-activating
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496479.1"
                     /db_xref="GeneID:8203725"
                     /db_xref="GOA:C5DUS7"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DUS7"
                     /translation="MDFETNEDINGIRFSWNVFPSTRTDANKNVVPVGCLYTPLKECE
                     GLSVAPYNPVICAGPQCKSILNPYCAIDPRNNSWTCPICNSRNHLPAQYANMTQENMP
                     AELQNTTVEYITNRPVQIPPIFFFVVDITAEKENLDALKESIITSLSLLPPNAFVGLI
                     TYGNVVQLHDLSSQTIDRCNVFRGDREYQYDQLVEMLTGQRPTNTMGALPNTKITPFS
                     LNRFFLPLEQVEFKLTQLLENLNPDQWTVPAGRRPLRATGSALSIASLLLQGSYKNVA
                     ARIILFASGPCTVNPGLIVSNELKDPLRSHHDIDSDRAQHYKKACKFYNQLAERVAEN
                     GHTVDVFAGCYDQIGMSEMKRLTDSTGGVLLLTDAFSTAIFKQSYLRLFAKDEEGYLK
                     MAFSGNMTVKTSKDLKLQGLIGHASPVKKSDLSNVSDSEIGIGGTSAWKMSSLSSGHT
                     YSIFFEIANTAAAAPVVSDRLRLAYTQFITHYQHSSGTNRVRVTTVANQLLPFGAPAI
                     AASFDQEAAAVLMARIAVFKAESDDGADVIRWIDRTLIKLCQKYADYNKDDPSSFRLA
                     PNFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQPTLTSFSME
                     EDPQPVLLDSVSVKPNTILLLDTFFFILIYHGEQIAQWRKAGYQDDPQYVDFKSLLEE
                     PKLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQDAAHGGSTIVLTDDVS
                     LQNFMTHLQQVSVSGQT"
     gene            complement(<83590..>84636)
                     /locus_tag="ZYRO0D01078g"
                     /db_xref="GeneID:8203726"
     mRNA            complement(<83590..>84636)
                     /locus_tag="ZYRO0D01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496435.1"
                     /db_xref="GeneID:8203726"
     CDS             complement(83590..84636)
                     /locus_tag="ZYRO0D01078g"
                     /note="similar to uniprot|Q06624 Saccharomyces cerevisiae
                     YPR180W AOS1 Nuclear protein that acts as a heterodimer
                     with Uba2p to activate Smt3p (SUMO) before its conjugation
                     to proteins (sumoylation) which may play a role in protein
                     targeting essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496480.1"
                     /db_xref="GeneID:8203726"
                     /db_xref="GOA:C5DUS8"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DUS8"
                     /translation="MEPSQATAERLTRDEIDLYDRQIRLWGMAAQARMRSAKVLLIGL
                     GSLGTEICKNVVLCGLGHLTILDDTVVQEEDLGSQFFIGSEDVGSLKLESAKARIQDL
                     NPRVHLSFDTQSIESKDADFYKGFDLVIGTELNTSQMVKLNELTRKYNIPIYLAGSNG
                     LFAYIFVDLIQFDAEDEKLKGSQPTEKGQISTNTEVTEVKTRTDEDDDKKVFEVINTR
                     HHYKSFQQMIKTASLEGRLNRRQIKRLSSAVPLTLALLRAEHEIGQLNFLTLKEKAVE
                     TCRQLGVPETVLNDTYVEQFTKQEGVQFAPVSAIVGGAIAQDVINILGKRQPPLSNFI
                     VFDGITLDMPIFEF"
     gene            <84898..>86826
                     /locus_tag="ZYRO0D01100g"
                     /db_xref="GeneID:8203727"
     mRNA            <84898..>86826
                     /locus_tag="ZYRO0D01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496436.1"
                     /db_xref="GeneID:8203727"
     CDS             84898..86826
                     /locus_tag="ZYRO0D01100g"
                     /note="similar to uniprot|Q06623 Saccharomyces cerevisiae
                     YPR179C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496481.1"
                     /db_xref="GeneID:8203727"
                     /db_xref="GOA:C5DUS9"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="UniProtKB/TrEMBL:C5DUS9"
                     /translation="MDLLKILDTKPVPAIVDARILSASDNTSGDYWLPTTMCLYQKEL
                     TDQIVSLHYSDILRYFETKNYKDDVVLHSMETLCLNSGYVATHPYLLIDHHLPKSLIT
                     KDIPGHLAETSGKFTVLRDLINLVQEYETNTAIACRPGRTMDLLEALLLANKVNIKRY
                     DGHSIKSKQKFKNFSCTCHLFPSEGLDLVNYPLEVANQFDMLICLDTSVDTNDPNIQT
                     VLQHARDRNSEESRAPIVRLIAINSVDHCELYFEKLHDRKSREFLESVTAAVVVLRDR
                     VGTLPPDLRPIYAQNVRYLMDWLEDPSIPWPLPDLYAIKKYTPMDVEKSLLTEVHYSQ
                     IEDELEAAFSTGKKRVRTRGDKDNAKVVESSSFYDVKRLKNDYSTNPIKQDMGRITGI
                     ADYVVMSNNYHLSTGIITHKLIQSIGQTYLYLKLQREEMAFYDNLNDIQERRKKLYQD
                     EEAAIEKKFKDVNSRHLENLNSSAALESSNQVKMDTIGMKEKALEELLQILDGDRDKY
                     KNMKELFLERRDLENEISKEERLSSSKEMEREYMEKEIDRATKAIQDMETEMKAKTLE
                     AEELQRKMLQAADSTNHQRDEVLERITNLRSQIGSEKLNHEELGVKVGVVTEKLNKMQ
                     TSRVRLANSKSGTGRRMK"
     gene            complement(<86927..>88327)
                     /locus_tag="ZYRO0D01122g"
                     /db_xref="GeneID:8203728"
     mRNA            complement(<86927..>88327)
                     /locus_tag="ZYRO0D01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496437.1"
                     /db_xref="GeneID:8203728"
     CDS             complement(86927..88327)
                     /locus_tag="ZYRO0D01122g"
                     /note="similar to uniprot|P20053 Saccharomyces cerevisiae
                     YPR178W PRP4 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496482.1"
                     /db_xref="GeneID:8203728"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:C5DUT0"
                     /translation="MAAKSNTDSEDLQGKGADNGFAEDLKWLGFQRHEGLRLVPTIDE
                     DVKGSLILLKEPESLAGEDAFSRRERLAELIFKNKHYRDIFEASIYYKDGTDEQNMDE
                     EDEVEEEEEEDFYTPASGSLIDSRKFLIRYSLNKARERLMKESQRFQEFDMTQEIKKR
                     RHFAMKTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNK
                     PQIHMGKIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFH
                     PSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGL
                     VWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAH
                     KSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENASSV
                     VSCGWDRSVKLWTMQN"
     gene            <88457..>89422
                     /locus_tag="ZYRO0D01144g"
                     /db_xref="GeneID:8203729"
     mRNA            <88457..>89422
                     /locus_tag="ZYRO0D01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496438.1"
                     /db_xref="GeneID:8203729"
     CDS             88457..89422
                     /locus_tag="ZYRO0D01144g"
                     /note="highly similar to uniprot|P20133 Saccharomyces
                     cerevisiae YPR176C BET2 Beta subunit of Type II
                     geranylgeranyltransferase required for vesicular transport
                     between the endoplasmic reticulum and the Golgi provides a
                     membrane attachment moiety to Rab-like proteins Ypt1p and
                     Sec4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496483.1"
                     /db_xref="GeneID:8203729"
                     /db_xref="GOA:C5DUT1"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:C5DUT1"
                     /translation="MSTFLRDKHIAYVQSLDKHHESFEYWLSEHLRLNGVYWGLTALC
                     LMDAKEIFNKDEIVQFVMKCYCKSTGGFGPFPRHEAHIHATLSGIQVLATYDALDVLS
                     TEQVEQTVQFIRGNQLSDGSFQGDRFGEVDTRFVYTSLSALSILGKLTPEVVDPAVEF
                     IMRCYNFDGGFGLCPGAESHSAQCFVCLGALAIVGRLNELSEDQLEKTGWWLCERQVP
                     EGGLNGRPSKLPDVCYSWWVLSSLAIIGRLEWIDYEKLREFILKSQDSKKGGISDRPD
                     NEVDVFHTLFGIAGLSLMGFENLISIDPVYCMPYYVTKKFKKYPY"
     gene            complement(<89482..>91542)
                     /locus_tag="ZYRO0D01166g"
                     /db_xref="GeneID:8203730"
     mRNA            complement(<89482..>91542)
                     /locus_tag="ZYRO0D01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496439.1"
                     /db_xref="GeneID:8203730"
     CDS             complement(89482..91542)
                     /locus_tag="ZYRO0D01166g"
                     /note="similar to uniprot|P24482 Saccharomyces cerevisiae
                     YPR175W DPB2 Second largest subunit of DNA polymerase II
                     (DNA polymerase epsilon) required for normal yeast
                     chromosomal replication expression peaks at the G1/S phase
                     boundary potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496484.1"
                     /db_xref="GeneID:8203730"
                     /db_xref="GOA:C5DUT2"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="UniProtKB/TrEMBL:C5DUT2"
                     /translation="MLASGNVLPVKISPPLLRPMAYRVLSKKYGLNLKSDGLAALAEF
                     VGNTFGMDWKKSSESVQFLESFASVWRQQERGLFVDRQGVLEVINEIKERQKTNREEV
                     QQQPQQRPAVKNVPIDQFLKPQNQERDGSSSPPQPPATGTPEPEQMDQDATDDDEDHL
                     DWKEYFKIVNANEQPRFNYDPVKMQFIPSARKSKPLNNEFKLPEIKDYATLFSTRYYL
                     VRDRVMRNENFQNVDTLNPLSSMVGLQQELQNGKSSNSNNMVITQIKNLIGRDGQNFL
                     LLGLLRTNAKGNWCLEDPSGSIEIDISQTLPTSGSYYVSGCFVLAEGIYFTAGNKFHV
                     ASITHPPGERRDFTLNAIGNLDMLGLHSPSNSSLVPRLDKDLKIRLHLLEKELVDHKF
                     VILGGDMFLDQLSTMEALRKVLTILDENPPTVIVFQGSFSTTPVHASLSSKTTSLSTH
                     YKNNFDTLATLLARFENIVENSTLVFVPGVNDPWKSMISLGAAYSWPQRSIPSSFTQK
                     MDKVCKNIIWASNPTRIAYISQEIVIARDDISQRLRRHSVEFPTVEESKEQELIEFQQ
                     QMQRRKEADATSIHELFKSTDQLPAKVKESRKLVKTLLDQGHLSPFTTNVRPVVWDLD
                     HALTMHPIPSTLILDDTTASPFDVTYNGCKAINPGKFISGRRAKYMDYTPSSKKVSQE
                     EVFF"
     gene            <91956..>92996
                     /locus_tag="ZYRO0D01188g"
                     /db_xref="GeneID:8203731"
     mRNA            <91956..>92996
                     /locus_tag="ZYRO0D01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496440.1"
                     /db_xref="GeneID:8203731"
     CDS             91956..92996
                     /locus_tag="ZYRO0D01188g"
                     /note="weakly similar to uniprot|P52919 Saccharomyces
                     cerevisiae YLR457C NBP1 Component of the mitotic apparatus
                     containing a coiled-coil domain essential for the G2/M
                     transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496485.1"
                     /db_xref="GeneID:8203731"
                     /db_xref="InterPro:IPR013743"
                     /db_xref="UniProtKB/TrEMBL:C5DUT3"
                     /translation="MLESVRGFIGDILGYQATDPRKKEYGSLDDVRTSNRQGGSGSHA
                     RLDRNRLRRRRAIASNGDSANSRKYVRPQDGNRVNKMRNPSARTGPGTLSKLMKSIKN
                     VFSTEDQDLTLMQQACGNTNAMLPPAARRGAHQGAEGRKKLRDRIVRSEAFKRKLLEI
                     KYDDRMLEQVRRGRSVSGSRRRIGEGYQGIEPLQDDKVGLLQRKLQELDSKVQDMDKE
                     LQITQKKLKFAQEKNTLLESLLDDANIDSEYVKSRRDIKNLQKENLKPEAELPPSPRR
                     SVNPLFTSSPMRKPPSVQDQEQEQVQGQGQDPTQNFYSKYPKIPETELLVQGRDRTSM
                     SPIRIDYSKYST"
     gene            <93236..>94519
                     /locus_tag="ZYRO0D01210g"
                     /db_xref="GeneID:8203732"
     mRNA            <93236..>94519
                     /locus_tag="ZYRO0D01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496441.1"
                     /db_xref="GeneID:8203732"
     CDS             93236..94519
                     /locus_tag="ZYRO0D01210g"
                     /note="highly similar to uniprot|P52917 Saccharomyces
                     cerevisiae YPR173C VPS4 Defective in vacuolar protein
                     sorting homologous to mouse SKD1 and to human hVPS4
                     AAA-type ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496486.1"
                     /db_xref="GeneID:8203732"
                     /db_xref="GOA:C5DUT4"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUT4"
                     /translation="MSTGDFLTKGIELIQKAIDFDTATQYEEAYTAYYNGLDYLMLAL
                     KYEKNPKSKDLIRAKFTEYLNRAEQLKQHLETEEENKKNGSKNASPSRKVTSDEDSED
                     SKKLRGALSGAILTEKPNVRWEDIAGLDSAKEALKEAVILPVKFPHLFRGNRKPTSGI
                     LLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFAMARENKPS
                     IIFIDEVDALMGQRGEGESEASRRIKTELLVQMNGVGTDSDGVLVLGATNIPWQLDSA
                     IRRRFEKRIYIPLPDQSARTRMFEIDVGETPCSLTKEEFRQLGELTEGYSGSDVAVAV
                     KDALMEPVRRIQSATHFKNVSTVEGQRRLTPCSPGDKGAIELNWVDIEADELQEPELT
                     IKDFLKAVKITRPTVNEEDIKRQLEFTRDFGQEGN"
     gene            complement(<94642..>95238)
                     /locus_tag="ZYRO0D01232g"
                     /db_xref="GeneID:8203733"
     mRNA            complement(<94642..>95238)
                     /locus_tag="ZYRO0D01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496442.1"
                     /db_xref="GeneID:8203733"
     CDS             complement(94642..95238)
                     /locus_tag="ZYRO0D01232g"
                     /note="similar to uniprot|Q06608 Saccharomyces cerevisiae
                     YPR172W Protein of unknown function transcriptionally
                     activated by Yrm1p along with genes involved in multidrug
                     resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496487.1"
                     /db_xref="GeneID:8203733"
                     /db_xref="GOA:C5DUT5"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:C5DUT5"
                     /translation="MSFTEKFPPHLFELIKTSKYVHVATCSKDCIPTISLMNYIYVPI
                     GKSYEKGEDGADKDYIVFATLTNTEKYRNICDNPKVSLLFHDWITAKNLSVRKHSLSQ
                     SPTPDNNDETQEHPSKLLNLLQELNQAELFQMSANLRGSASVVNPSSDESKYYKDLLL
                     RVNPDAHVFIQHANTVVVKVQIESAKVSDTENNTKVYN"
     gene            complement(<95493..>96491)
                     /locus_tag="ZYRO0D01254g"
                     /db_xref="GeneID:8203734"
     mRNA            complement(<95493..>96491)
                     /locus_tag="ZYRO0D01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496443.1"
                     /db_xref="GeneID:8203734"
     CDS             complement(95493..96491)
                     /locus_tag="ZYRO0D01254g"
                     /note="similar to uniprot|Q06188 Saccharomyces cerevisiae
                     YLR455W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496488.1"
                     /db_xref="GeneID:8203734"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:C5DUT6"
                     /translation="MVQELKTGDLVLCKVGYFPPWPAVVFPQRLLRNDVYRKRRPNCI
                     AVCFFNDPTYYWEQPHKLRPFEPKMAENFLQQEASTSQEDLIEAYRQAQSFSSLEDFI
                     VSRLKEEDRFGELKEELNRETILPGEDPFMSKAESKKRKSIPTNTRSKNKRSIKPEEE
                     EEEEQEQENRNINDTQSSVADDKDDSAKLSRSNNTNNNKKRKRSKLDRSRKVEISLLI
                     RRRLQQNLVQRDSPPSKQEILDSHKLLNKISENLACDPPFFDIDALRESKLHKLLKVI
                     VNDPDLDEFHHICKDILIHWVDIIAELKAEKLANDQKQQQQQQQPQDHAPTETTIV"
     gene            complement(<96840..>98846)
                     /locus_tag="ZYRO0D01276g"
                     /db_xref="GeneID:8203735"
     mRNA            complement(<96840..>98846)
                     /locus_tag="ZYRO0D01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496444.1"
                     /db_xref="GeneID:8203735"
     CDS             complement(96840..98846)
                     /locus_tag="ZYRO0D01276g"
                     /note="weakly similar to uniprot|Q06604 Saccharomyces
                     cerevisiae YPR171W BSP1 Adapter that links synaptojanins
                     Inp2p and Inp53p to the cortical actin cytoskeleton"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496489.1"
                     /db_xref="GeneID:8203735"
                     /db_xref="UniProtKB/TrEMBL:C5DUT7"
                     /translation="MGRSAELEEFLKRVEDYDLQRRGNNDVTTTAGATNNEMNGGYSE
                     ESLERARKLLSENGVAIVDGESRKSTLDAPELAYRSAYNYERTFSPKRVTTNSKTYTV
                     SEDDYLLLQRLKAKEKPPAPLPPHEKSRDNDRLRKLLDGVTTPSFPKTTTSLPSSSYY
                     STNLESRKTEAIPAVTSRSRGPPPVPPKSRSRAKDESENIEPEKDVGKPISPPRSPSS
                     SPPSSPTKSPYKVELKSSPKKFNLKAELEPSKKTLALDNGKSSSPNKESPSSLSSHLD
                     FLDSVQRNKVEPNLETPKNKSPIKSSSLHSNQFIDSAAHKSTPPAKPNKPLELANTPK
                     SSLQRTRSGSFINSALKSPVTQPTASSASPTIFKIPSKPSTESFINSALKASPPPPPK
                     PARKPTTIVKPRPLSKPASLRKSSTAPEDGEFRPEKPAGLAQLRPTGSNEKPKPHVPP
                     KKSELVLPKLRHVDRTDSHGNKINSEADFTAKLKKTTPPEVPKKNPSLPEALKRLSNL
                     SKAAPPPKPEEDVPEALTKVGHLSRAAPPPKRAEDVPEALAHLEKLNKVSKQPPVPTR
                     KISMGEALQKAQELKKQQQKQSQSSEGEQKPKDVKSELGAVLMAQKLRASKPLLSGSS
                     STEPSSTNSSTTSLSSSNSSNTLSHANKTRSKGPKRRIPSTIKM"
     gene            complement(<99146..>99616)
                     /locus_tag="ZYRO0D01298g"
                     /db_xref="GeneID:8203736"
     mRNA            complement(join(<99146..99254,99344..99474,99599..>99616))
                     /locus_tag="ZYRO0D01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496445.1"
                     /db_xref="GeneID:8203736"
     CDS             complement(join(99146..99254,99344..99474,99599..99616))
                     /locus_tag="ZYRO0D01298g"
                     /note="similar to uniprot|P0C5R7 Saccharomyces cerevisiae
                     YPR169W-A Identified by fungal homology and RT-PCR"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496490.1"
                     /db_xref="GeneID:8203736"
                     /db_xref="UniProtKB/TrEMBL:C5DUT8"
                     /translation="MRPVVAPGKAWFCTILSAFGVLILTPIAHLFNSNHESFLGSIND
                     PEDGPAVAHTVYLAALVYLIFFVFCGSQVFLASRKRSIALR"
     gene            99774..99847
                     /locus_tag="ZYRO0D01320r"
                     /db_xref="GeneID:8203737"
     tRNA            99774..99847
                     /locus_tag="ZYRO0D01320r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.64"
                     /db_xref="GeneID:8203737"
     gene            100177..100248
                     /locus_tag="ZYRO0D01342r"
                     /db_xref="GeneID:8203738"
     tRNA            100177..100248
                     /locus_tag="ZYRO0D01342r"
                     /product="tRNA-Cys"
                     /note="tRNA-Cys (GCA) cove score=75.27"
                     /db_xref="GeneID:8203738"
     gene            complement(<100357..>101844)
                     /locus_tag="ZYRO0D01364g"
                     /db_xref="GeneID:8203739"
     mRNA            complement(<100357..>101844)
                     /locus_tag="ZYRO0D01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496446.1"
                     /db_xref="GeneID:8203739"
     CDS             complement(100357..101844)
                     /locus_tag="ZYRO0D01364g"
                     /note="similar to uniprot|Q06214 Saccharomyces cerevisiae
                     YPR169W JIP5 Nucleolar protein of unknown function
                     exhibits a physical interaction with Bre1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496491.1"
                     /db_xref="GeneID:8203739"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DUT9"
                     /translation="MAKKKENAGVAINPDSLPLLELRYGEPLFQMACHPSRPLIYSGL
                     ATGHLYCHEYDASILDKLLQERKSQGKEINSKPWLQLDAESADVSGIRIVWKTRRHRG
                     SVRCLCLDAEGEYVYSVGTDNILKKASAENGKVLKKVDLQGHGSKFTKLVHSGTHPYL
                     LLGDEEGNVLVLDNDTLKLKNKIIKIHGGDAINDIFQFTKRSVHKYISLGQTTLAYWD
                     SRVSNEDDTEDTPEEKRKVLVSDDQEDEILCGTFVDPESGDTVVCGMGEGVLTVWKPE
                     KNDLEDQVNRIKVSKGESIDAVVPTLRDDNCVWCGVSNGRLYKVDTKRGQVVEVREHS
                     EMDEVGFLDLDYEYRLVSGGMDSILIWNTDTEQNDEVESEGGSASSDSDSDSDSDAND
                     SDADGSDANDSEANDSDAGGSDSDANGGDSDDSDSGGKESGKVGLSREELIAELDKEI
                     EENEQEKDNGDKQEEDKKISNKRKRKEKLKKNKRPDNGIAKFEGL"
     gene            complement(<102096..>102572)
                     /locus_tag="ZYRO0D01386g"
                     /db_xref="GeneID:8203740"
     mRNA            complement(<102096..>102572)
                     /locus_tag="ZYRO0D01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496447.1"
                     /db_xref="GeneID:8203740"
     CDS             complement(102096..102572)
                     /locus_tag="ZYRO0D01386g"
                     /note="highly similar to uniprot|Q06213 Saccharomyces
                     cerevisiae YPR168W NUT2 Component of the RNA polymerase II
                     mediator complex which is required for transcriptional
                     activation and also has a role in basal transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496492.1"
                     /db_xref="GeneID:8203740"
                     /db_xref="GOA:C5DUU0"
                     /db_xref="InterPro:IPR019145"
                     /db_xref="UniProtKB/TrEMBL:C5DUU0"
                     /translation="MQNAAELAGIQDELQTTEQQVVNIIESFIELGVSVYDFPGTQEA
                     TQGMVTNLRRNVDRLLKLNQRSNDPTSQLHKLNIPMEVLQYIEDGRNPDIYTREFVEA
                     IRRSNQYQRAKMNGLRQLRDSLAEKIAEEFPDLEQSVQGIVERTGGSTNHDTELNA"
     gene            <102929..>103723
                     /locus_tag="ZYRO0D01408g"
                     /db_xref="GeneID:8203741"
     mRNA            <102929..>103723
                     /locus_tag="ZYRO0D01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496448.1"
                     /db_xref="GeneID:8203741"
     CDS             102929..103723
                     /locus_tag="ZYRO0D01408g"
                     /note="similar to uniprot|P18408 Saccharomyces cerevisiae
                     YPR167C MET16 3'-phosphoadenylsulfate reductase reduces
                     3'-phosphoadenylyl sulfate to adenosine-3' 5'-bisphosphate
                     and free sulfite using reduced thioredoxin as cosubstrate
                     involved in sulfate assimilation and methionine
                     metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496493.1"
                     /db_xref="GeneID:8203741"
                     /db_xref="GOA:C5DUU1"
                     /db_xref="InterPro:IPR002500"
                     /db_xref="InterPro:IPR004511"
                     /db_xref="InterPro:IPR011800"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DUU1"
                     /translation="MVESMSYHLNDGTVVTQEQLDHWNQGLSSLQSPQQVLQWALLTF
                     PHLCQTTAFGLTGLATVDMLDKLTDSKMVPLIFIDTLHQFPQTLDLLKKVEDRYYAPS
                     GQKVHIFKPQGCNTEVEFAQMHGDFLWDLDEEKYDFLVKVEPAHRAYKELKCAAVLTG
                     RRKTQGTSRSQLQFIELDALNGIVKINPLALWDFNQVNNYIRENNVPYNELLDLGYKS
                     IGDYHSTQPVKEGEDERAGRWKGKTKTECGLHETSRFAQYLNASRT"
     gene            <104049..>104396
                     /locus_tag="ZYRO0D01430g"
                     /db_xref="GeneID:8203742"
     mRNA            <104049..>104396
                     /locus_tag="ZYRO0D01430g"
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /transcript_id="XM_002496449.1"
                     /db_xref="GeneID:8203742"
     CDS             104049..104396
                     /locus_tag="ZYRO0D01430g"
                     /note="highly similar to uniprot|P10663 Saccharomyces
                     cerevisiae YPR166C MRP2 Mitochondrial ribosomal protein of
                     the small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRP2"
                     /protein_id="XP_002496494.1"
                     /db_xref="GeneID:8203742"
                     /db_xref="GOA:C5DUU2"
                     /db_xref="InterPro:IPR001209"
                     /db_xref="InterPro:IPR018271"
                     /db_xref="UniProtKB/TrEMBL:C5DUU2"
                     /translation="MGNFRFPIKTKLPPGFVNARVIRDNFKRQQFAENEVTQRALKYI
                     ARNTTLPAKARLEAQLRLSAAPNYMRQTQIKNRCFETGNARAVFSDFRLCRTQFREKA
                     KQGDLPGVKKGIW"
     gene            complement(<104471..>105133)
                     /locus_tag="ZYRO0D01452g"
                     /db_xref="GeneID:8203743"
     mRNA            complement(<104471..>105133)
                     /locus_tag="ZYRO0D01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496450.1"
                     /db_xref="GeneID:8203743"
     CDS             complement(104471..105133)
                     /locus_tag="ZYRO0D01452g"
                     /note="similar to uniprot|P06780 Saccharomyces cerevisiae
                     YPR165W RHO1 GTP-binding protein of the rho subfamily of
                     Ras-like proteins involved in establishment of cell
                     polarity regulates protein kinase C (Pkc1p) and the cell
                     wall synthesizing enzyme 1 3-beta-glucan synthase (Fks1p
                     and Gsc2p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496495.1"
                     /db_xref="GeneID:8203743"
                     /db_xref="GOA:C5DUU3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUU3"
                     /translation="MSMSNLPGAAGTQSVRRKLVIVGDGACGKTSLLIVFAKGKFPEV
                     YVPTVFDNYVADVEVDGRHVELALWDTAGQEDYDRLRPLSYPDSNVVLVCYSVDLPDS
                     LDNVMEKWVSEVLHFCQGVPFVLVGCKADLRDDPRIVESLREAGQEPVSHATGQNAAE
                     TMGAVSFCECSAKTGMGVREVFEAATRASLMGKQNNKKSKKEQKQMAKKEQKKKKKCV
                     IL"
     gene            complement(<105651..>106289)
                     /locus_tag="ZYRO0D01474g"
                     /db_xref="GeneID:8203744"
     mRNA            complement(<105651..>106289)
                     /locus_tag="ZYRO0D01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496451.1"
                     /db_xref="GeneID:8203744"
     CDS             complement(105651..106289)
                     /locus_tag="ZYRO0D01474g"
                     /note="highly similar to uniprot|P06780 Saccharomyces
                     cerevisiae YPR165W RHO1 GTP-binding protein of the rho
                     subfamily of Ras-like proteins involved in establishment
                     of cell polarity regulates protein kinase C (Pkc1p) and
                     the cell wall synthesizing enzyme 1 3-beta-glucan synthase
                     (Fks1p and Gsc2p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496496.1"
                     /db_xref="GeneID:8203744"
                     /db_xref="GOA:C5DUU4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUU4"
                     /translation="MSQQVGNSIRRKLVIVGDGACGKTCLLIVFSKGQFPEVYVPTVF
                     ENYVADVEVDGRRVELALWDTAGQEDYDRLRPLSYPDSNVVLICFSIDLPDSLENVQE
                     KWIAEVLHFCQGVPIILVGCKVDLRNDPQTMEALRAEGQQPVSSAEGQSVADQIGATG
                     YYECSAKTGYGVREVFEAATRASLMGRSKQNGKQKKEKAPQEKKKKRKCVLL"
     gene            complement(<107196..>111401)
                     /locus_tag="ZYRO0D01496g"
                     /db_xref="GeneID:8203745"
     mRNA            complement(<107196..>111401)
                     /locus_tag="ZYRO0D01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496452.1"
                     /db_xref="GeneID:8203745"
     CDS             complement(107196..111401)
                     /locus_tag="ZYRO0D01496g"
                     /note="weakly similar to uniprot|Q06211 Saccharomyces
                     cerevisiae YPR164W MMS1 Protein likely involved in
                     protection against replication-dependent DNA damage
                     mutants are sensitive to methyl methanesulfonate (MMS)
                     implicated in regulation of Ty1 transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496497.1"
                     /db_xref="GeneID:8203745"
                     /db_xref="UniProtKB/TrEMBL:C5DUU5"
                     /translation="MVLSNASDLGRVRLDSWFSAGGLEVSEEATHRDTLDRSWFEFEK
                     TICGRKPLRCIPTFMPGDSKGHWNQLLRIKSMTTGATATTFAPQKELEEVFGIVRDPE
                     SLEDSDIDDFLSNSQKIDSHHKFDEGITEIPLHREYLLVSPNSVFKAGDSRQTLLDGG
                     IVDCQVFNTLPGKLGSILLITTPAGYVLSMLLDLEDNKPIILQYWKLRQNSGDWYIVK
                     HQSDEQFVVINKEKGICKFFEFRDPLHFTLVNNLSIDNTKFLSCSFFLNTSKSHYLFF
                     VPSIRYHRMVLFCIEWDSNRPKMKEVHQLTYLNGYEVNYCVPVGYNVCLVSGGCQHYL
                     VSAHQIMSGETSFQHFESNFLEGLCSYFDAPILLEKIKNCHEDLFDQFKKCTVLATFS
                     GNIGICLWDEDGEVAFYSLTRFKGLKDICPVDYQETENNEYEIVVISFGRTLRLTLDV
                     KCIQQLSSDTTISPLNGVLLKHTMDSSTEENSKLMVFSPPKNNSRIPAELWLTSSMAI
                     SHLQTFAPVKKLHGLCKLRQFQVFNNLKVFNCSNFNDNLRETLLQGLEIGNNSEVYLI
                     IASDLISMSKAFLLNVTSSGSNAMELDDLLQSVAGDNVEIFFSPGDNMVQITRDTVYV
                     DSLGSSEDEKIEKYSPGWKIDGAAYCGTRVILWNIDQLKISYINNIDELSETTTFIQS
                     GFFKEILRGTKEDYEENLNREPEKYKDGLCPFFFSFDITQVDDGTVFVYLAHSRGMVK
                     YSWEDLFLSSDRNDTRSLLTCAPNVAFLALKEHVYAKSCDGHIIGADHINSSFRNINV
                     AYNDRDFQIRPFDDNAVIIFSPQEITIVSMSSSSENEGDDKFYELKLPFQSKANPILD
                     VSVDAKSKRVFVLYADGLEVFELFYSTWNSSNYLLRSTKTLKRIFFIEKINRMLVVNL
                     RAREWDCIKLVDGKSLSLDATALKTPKNSKLVDVIEIPSNKEDKNVHLLLHFGNLLKL
                     VRLVPQKGRIIVKVVTQREFDAELFHRIETVEDGKFIVYVASSVSVLGQKPYSQFMLM
                     RISELDQLEEISKLEFPDELHLRDFKLCGKDVAVVSEGYDRLFLFKDFFRLAALKRPM
                     AIAIKMPAASKIEKICPIGTDSFVVAVSCEGRSDHLSELLFCNRDDICLNRESDSDSS
                     KGDVLYDAAVVDDIQRREEGDFYRIELDEDEEDEDDEDEDDDNGGPIGLRLARRGDNW
                     DGNYRDFLDRIINGPRFASNEDWEFDDVDMEYEAGEHEENDRESDSDEDMLDTDDMDE
                     MDETDAFGRRSDYNFPFNTDSTQATGSEALGCLFNTSDLAESISSSRFRKPYQVINLD
                     KSIKDIRYSSEEKKLFVLTMDGSVLIFRGFYQNLQKDHEKIGDGVVNILKKPIAGHVA
                     PKITESGICTIDSEGRVKEWPWL"
     gene            complement(<111728..>119560)
                     /locus_tag="ZYRO0D01518g"
                     /db_xref="GeneID:8203746"
     mRNA            complement(<111728..>119560)
                     /locus_tag="ZYRO0D01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496453.1"
                     /db_xref="GeneID:8203746"
     CDS             complement(111728..119560)
                     /locus_tag="ZYRO0D01518g"
                     /note="similar to uniprot|Q06179 Saccharomyces cerevisiae
                     YLR454W FMP27 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496498.1"
                     /db_xref="GeneID:8203746"
                     /db_xref="InterPro:IPR019409"
                     /db_xref="InterPro:IPR019415"
                     /db_xref="InterPro:IPR019439"
                     /db_xref="InterPro:IPR019441"
                     /db_xref="InterPro:IPR019443"
                     /db_xref="InterPro:IPR019449"
                     /db_xref="UniProtKB/TrEMBL:C5DUU6"
                     /translation="MVTNAVKYLLTYVVLPLLVCNLLLRIFAGITFWLINPLRLEIFH
                     LHIRGKCNVGSLRFSPRHKKIFVENLTIFKPSGDKQKKQDSSETTSTKGFEKKEDARD
                     KKSPRLLEKYLPIALRILNGLQIEIANLTAEHVQLDVEDFRAVVKYQHKSKNFTLNAD
                     VRGARWIAQSICQDFSLNISTKLALHKLGQGIPLENTVTDIKVCDVLVPMDFIQMMKA
                     STPPSQSPLKEQVVQQEHYKESTDPDFDASLDEALQGMGKKVDKVRKIIELVSEVNVV
                     IDKIAVRGISMAPIPELRELDEAMTYNIYASNIKLEIRKFESHMPGFKLLFADEDTPI
                     KMGLTISNFAISLEMKKKCHFLGNQSIKVLETPSISLFGSSNLISQEFELSEESGLKN
                     ALLSLRCNVLSPTFDIDVNHLSFYKTFKRNISVFAGSLQDTSCTPAHLTATVWKKHLM
                     LLFFKRCLPLIDLKFTLEDARLLISDGDDMMIYKLTALLLRYHTERYLLHEAKKVSGV
                     NYDGRLATEVLGMRLEHLNKAQNYEKRIASIESVSLRVAIDVVPEFLMSSSADLNAFH
                     VDVSDLPTMIALNNIFRKLDIQMQAVEQHYFKPLYEKFEERLHIAEKQKAKAQSEMEA
                     PEILPSSFIFKELPSFFDFVKISLSNFSISVGCRSVFMPPEVFSNIDAQSPEDMVNGQ
                     LRKLCHKVNEVEMVFFGNKTQFRQKDEGDRIRMVKSSPDSDYKSYKDDSLDNLSGSDA
                     TEVAHLWNFDLLIDGVSLVVIAESPESVNELTTRRVFELSVFSLKVFPDLDPYDSELG
                     SKVLVRFDTKRIFSVTSLMFGFLIISGVHTLKQIFGRDIAHKDKESMAKSHFMALSEA
                     KKKGCYSNVKWSELKQFLDIQFVVDRFSQVMDLPNGLKTRLEFYSVFLTLENMNDITF
                     MGDYARLCVESPAVKKYWVRLATISQFKVLASISKFKSQAKKDSGRFALFEPSIILEN
                     ESWHFNIPHQFEMYRLFDNISTVVKSFKQMIYSFKTCKSDVVVFPKVVEAPALPKIKL
                     LSQRMHFTIDDDPFEAELSTIFQIGLKEQKIRLAKLKEFDEQIQAELAENAKNQLRGN
                     YKGTNNNKGTDLFHRLVSFGGKTAHKKMFHRNLIPKINVPFNIDDGVKEEEDVDDEPI
                     VMNEEEVILQRAANLFKKLEENFSTSWINRIKQFKHTQRESFYNNFSYLWGSIDYTKL
                     PPDVNHRVLPFSTNPFLSTLTIEEIDIDIFQPSFGVDRTADFIHDVGKKVPRDTEYSI
                     LIPMYLDAKFQEVRWHLRDYPLPFIYIPRLDNSQGCERTSIKIHGDFVVGEDIIRSES
                     ELRTLFIPLIPSIIMENTDCYYSLLIPRTITAMKVFTDLKLDFNSMQTTQVTWGGGYQ
                     PAIQQTMQCFDNFSKPPLDPSGKTGFWDKLRYLFHAKIKISWKNHGRFEVGLKGGKSP
                     HKIGADAAGFLLGFHKNIVLTVNEDGDPRKFVSCSADEIYFSIPNYFAKPLLVWSRPS
                     SQTVFVPIHSEPTLQDYAFFYYLCDLNTTLERIKQVKAMGLHYIEKTGIKLTGGVTLN
                     IGTIFERLISGSRERTFDSVPHYKIRLSNPIYLPDRRNHDSYAGFRSDYIHLSFTLLS
                     ASSSAYNTLQLSPAGLVTFLKWWKSFAGNFPVRSGPLFGLQSISPKFGDHLRTISYRA
                     DVSPLFVSYTAHSVDISRLTKKVQSDVREFAGVKAKATKFVMDLHQRKEVLITFQEEL
                     NRTKQIMKLNFVGGEVLAEKLDIRTVQGKFKPMKTPEDKNSGVFEVFDNDMAWYDVTD
                     FKEAYALGLENYIPHVRIKPFLYTPHFVYRKRASYGDRYQVDPKDHHSIPPFRNDVSH
                     DCTLGHAEHLQLGILKQRVHTLKDLRTKKAQENGDASHKDFMQKLDLEIEKAQNLFED
                     FEHMQNHKGDSADSHEYHYELPNLMKRFLSESYEHRYCVNYALLRWNEDTRDALFKFL
                     HYISLAHQFSQLSATKSLQIIEDVVKQKTESVLTEENHHHGSNPTKKPTKDIDWDALD
                     GSNINYMLSSILEKHMSELEVPVKHILRNNHFVEFLSPQIQMVSHEEPDSCVMLTSSG
                     MKMEVVSFDGDLNGDEYRRNTMLKRYGIHVVNSNVFHFHRKDFMDHPAMYFDIAAYGH
                     VEGTSWPPWVALELCFDSNQVPEEAIIIKDLSFILCYDKLSGLSSYYNIMKERLQNKL
                     GGYFPKVSISSDSKTYASVYRLVKTLCLYSEPDSAELRKQIDKLTIGFDLGNVTEMRN
                     AIQDLHENLRMLSTVESAFLFKRQILDDADRFDFENVQSEKLYHLLKLYIMIEVFISN
                     SRGSDDGEDTLFWDFHVGTIGLHLLMERVKPFLDVNVEGVHIERLESSNGFNNNKVVA
                     NGFHIRDMREGVIFQNVVGPLDSKHLTDDEKAKSAPLVSIEWQMDEPVGGIKVAKSVD
                     TRITGLNLNLENEMITKVVQWFLPDELKNSVLDDSSEDSESSGLVSAIADTEDYDIGR
                     EIALDEHSDLNEMVQRSSDFVILEHLNLNTFKVCVSFRGTGALRLANVTDFVYNFPTL
                     KLQHQTMRVADLLIILKKVLIKDLVKHTGRFLGAKVTRRRDSGSVSGEGNGTTSIMGP
                     MKRLPSFSSSTGSK"
     gene            <120657..>121916
                     /locus_tag="ZYRO0D01540g"
                     /db_xref="GeneID:8203747"
     mRNA            <120657..>121916
                     /locus_tag="ZYRO0D01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496454.1"
                     /db_xref="GeneID:8203747"
     CDS             120657..121916
                     /locus_tag="ZYRO0D01540g"
                     /note="similar to uniprot|P34167 Saccharomyces cerevisiae
                     YPR163C TIF3 Suppressor of translation mutants Translation
                     initiation factor eIF-4B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496499.1"
                     /db_xref="GeneID:8203747"
                     /db_xref="GOA:C5DUU7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DUU7"
                     /translation="MVPPKRATKMDLNSFLNDDTFGSAWEETDVDLSKISIPVENVKA
                     NTIPLEELAAAKGGSNQNFRGGSRLDPALGGGRSFERTEYPVPDRPPYRAIINNIPWD
                     ITPEGVQAWVEDGLHKEDAVEEVDLPRSIKDPTRLKGIAFVTLKGREDLVQTLTFNGT
                     PLNDRTVYVSVAAPRRDGFDWGGARGSSFQSSGDPAADLDWGAMRGSQFKGSRPPREE
                     PDLDWGAMRGAQFKGSRPPREEPNLDWGAMRGAQFKGSKPPREEPNLDWGAARGSQFQ
                     TPRSDSGKKGGKSLFPDNDAKKDEDLDWGNIRNRPARGPKPAEDSGPDLDWGSARGAQ
                     YGKKTGGGSGSAHLRKQIAEKDNVDDKPKIQTSRFGVLSTEDDEEEESTEKETASEEQ
                     VTQLEKETQKLSVDNKETDEWNVVGKK"
     gene            <122543..>124312
                     /locus_tag="ZYRO0D01562g"
                     /db_xref="GeneID:8203748"
     mRNA            <122543..>124312
                     /locus_tag="ZYRO0D01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496455.1"
                     /db_xref="GeneID:8203748"
     CDS             122543..124312
                     /locus_tag="ZYRO0D01562g"
                     /note="similar to uniprot|P54791 Saccharomyces cerevisiae
                     YPR162C ORC4 Subunit of the origin recognition complex
                     which directs DNA replication by binding to replication
                     origins and is also involved in transcriptional silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496500.1"
                     /db_xref="GeneID:8203748"
                     /db_xref="GOA:C5DUU8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR016527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUU8"
                     /translation="MESIDSEFGPVRKAKVKVSPGRIIQDVSVDHEQSSLLQKMTLLP
                     IKRPSSEESNPIDQQDEHREEVSSITTDNKNVNILNNIRLSSKRLKPNASPNEQNLSP
                     KKVQPLDSGFKRFKHFLMRHLYQSLPPDQTRPYSYLRETHQEIDRLLKQSIVQKESHS
                     SILVGPRGSFKTVLLNHELALLSERYHQQFITIRLNGFIHSEQTAINGIATQLEEQLR
                     KLHGRIRKPVNEDTDISNGSLTEVFEKILRLLDSAAVSGSQDKSDNESTKITVVFIFD
                     EMDTFAGPVRQTLLYNLFDMVEHARVPVCIFGCTTKLNILDYLEKRVKSRFSQRIIYM
                     PQIEGFQQFIETVEEMLCPPSCDDGLKFVKSWHSLVHNELSKPNSDVHLLVKFNYETF
                     KSLQHLRNGLIPLIFGAKDYESLENSFKTCSKTKSYNHNLLESSLTTKINSLSNLELC
                     ILICAARTVLKAKDESTNFNLVYAEYEEMIKSINRRIPTMAPTKSNEDTTAVIFDNKI
                     KLWKKRDIKNVWESLLALNFLTEKSAVGLRESAIAAFYASNYQFQGTTIPFDLRRYQT
                     QVTLQGLRRIVPRSSMYHPWTQL"
     gene            <124739..>126688
                     /locus_tag="ZYRO0D01584g"
                     /db_xref="GeneID:8203749"
     mRNA            <124739..>126688
                     /locus_tag="ZYRO0D01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496456.1"
                     /db_xref="GeneID:8203749"
     CDS             124739..126688
                     /locus_tag="ZYRO0D01584g"
                     /note="some similarities with uniprot|P23293 Saccharomyces
                     cerevisiae YPR161C SGV1 CDC28/cdc2 related protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496501.1"
                     /db_xref="GeneID:8203749"
                     /db_xref="GOA:C5DUU9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DUU9"
                     /translation="MSENESSNAKKPEFKYKIGKVKHTPTVQKDERNGLSFIELKPSP
                     DEKVYGCTKFAGHYKEEKKLGQGTFGEVYRGIHLETQRQVAMKRIIVNVEKELFPITA
                     HREITILRRLNHKNVIKLIEMVYDYPPGTNGRAAREMPYQSPSGKPPLMKSFYMILPY
                     MVSDLSGILHNPRINLSLGDIKCIILQLLESLNYIHCQKYMHRDIKTANILIDHNGVV
                     KLADFGLARLYYGAPPSLDFPGGAGSGAKYTSVVVTRWYRAPELVLGDKLYTTAVDMW
                     GVGCVFAECFEKKPVLQGSTDIDQGHVIFKLLGTPTEEQWPLAWYLPGAELTRTNYPG
                     TLKERFGKNLSEIGLDFLRKLLSLDPYKRLTAMSAIQHPFFKEEPLPCEKLILPCEES
                     HEADIKRYKEEMHQAMSQKAPSAPRGHVTESSSESGSVPVFPRAPKPKSHFPTGPAAS
                     SRRPPPAPGTNLSRNHTSRFNYNNTNNNSYGGVNKPPHTSNFQKSRYNSRYGNNNNNN
                     NLPSGPQQMPANPYQHRNGPPPYANPQQQPPSRYQGTNEKFYQHHTHRDPIIHNNNNN
                     KNSSKPRLEEARSSRVSGVSAPLPRGPAMTQAPPPPPSISTPGESIQQNRPQEREQDG
                     GNNQESSKDGSGTSDNNRKDIADLY"
     gene            <127185..>129284
                     /locus_tag="ZYRO0D01606g"
                     /db_xref="GeneID:8203750"
     mRNA            <127185..>129284
                     /locus_tag="ZYRO0D01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496457.1"
                     /db_xref="GeneID:8203750"
     CDS             127185..129284
                     /locus_tag="ZYRO0D01606g"
                     /note="similar to uniprot|P11972 Saccharomyces cerevisiae
                     YLR452C SST2 Protein involved in desensitization to
                     alpha-factor pheromone member of the RGS (regulator of
                     G-protein signalling) family GTPase-activating protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496502.1"
                     /db_xref="GeneID:8203750"
                     /db_xref="GOA:C5DUV0"
                     /db_xref="InterPro:IPR000342"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016137"
                     /db_xref="UniProtKB/TrEMBL:C5DUV0"
                     /translation="MTETEIKTDTLHEQASKSFRRTPNGLIFSEDLRAVFSVFLICLN
                     LQDVDKESKKGVFRFQKTAYPFSFSIHDAAETMKHLELQVDMSVTCISISYTIQPEMA
                     YYLLEVFMAAKLLHTPADRTRSLPKDKVLLQPTPKGVAILQKYVRDTGTKKIPDILTS
                     DFNSMELFSFERSSETDSIIHSDYLIHILFITMMGFSPNVWSPSNPSDKIPCLSKLLE
                     YSNNDDLTFENLQFTNFDQFQATKTEEEFNWQDHISDARLHDENRISPFAHRFFTNPD
                     SDSHVQYYTSNCGLRLFRSKSYGPNKTLIDYSFTTKALWQWLMDCTDIMYPKEAVSVA
                     AIFLKCGLIIPLLDNSSPRSRFYISRSCHYTFSRRGWDVCQWNIDNMGEISSPPSSVD
                     GSGGSKRPKRESNFSDTTTAEENIFLKDTPCSDSDKTIVSPEYRFREFDDVLNDPGMR
                     YLFRRHLENEFCVENLDAFFEIKKFSKKVKLLEKLNNTRKTGGTHRGGKGKVSDIKAV
                     IDTALAKQANECLEIGYHIYASYISVGSPYQLNIDHTLRESISTIMLQPKLPLSKNFS
                     FKIDVQDILSINEGNLGIVTSPLQKPEPALLRESMSKTKTKRRASVTKSVFNPMDVDS
                     EAEGEVSPREVSGTSSFVPEVQEDKTLVTAIDMIRTLSPLFETLNQSLYRLMKVDSLQ
                     KFLNSSVYQGAVSLADI"
     gene            complement(<129634..>131211)
                     /locus_tag="ZYRO0D01628g"
                     /db_xref="GeneID:8203751"
     mRNA            complement(<129634..>131211)
                     /locus_tag="ZYRO0D01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496458.1"
                     /db_xref="GeneID:8203751"
     CDS             complement(129634..131211)
                     /locus_tag="ZYRO0D01628g"
                     /note="highly similar to uniprot|P32481 Saccharomyces
                     cerevisiae YER025W GCD11 Gamma subunit of the translation
                     initiation factor eIF2 involved in the identification of
                     the start codon binds GTP when forming the ternary complex
                     with GTP and tRNAi-Met"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496503.1"
                     /db_xref="GeneID:8203751"
                     /db_xref="GOA:C5DUV1"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009001"
                     /db_xref="InterPro:IPR015256"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUV1"
                     /translation="MSDLQDQEPSIVINGNMEPEEEEPYDMEEQMADELEEETIEKPK
                     KKVTFDKLAEDEEDDEEKRKREFEEGGGLPQQPENPDFSKLTPISPEIISRQATINIG
                     TIGHVAHGKSTVVRAISGVQTVRFKDELERNITIKLGYANAKIYKCQEPTCPEPDCYR
                     SFKSDKEINPKCQRPGCPGRYELVRHVSFVDCPGHDILMSTMLSGAAVMDAALLLIAG
                     NESCPQPQTSEHLAAIEIMKLKHVVILQNKVDLMREESALEHEKSILKFIRGTIADGA
                     PIVPISAQLKYNIDAVNEFIVKTIPVPPRDFNISPRLIVIRSFDVNKPGAEINDLKGG
                     VAGGSILNGVFKLGDEIEIRPGIVTKDEKGKIQCKPIFSNIVSLFAEQNDLKFAVPGG
                     LIGVGTKVDPTLCRADRLVGQVVGAKGHLPSIYTDIEINYLLLRRLLGVKTDGSKKAK
                     VRNLEPNEVLMVNIGSTATGARVVAVKADMARLQLTSPACTEINEKIALSRRIEKHWR
                     LIGWATIKRGTTLEPLF"
     gene            complement(<131688..>134270)
                     /locus_tag="ZYRO0D01650g"
                     /db_xref="GeneID:8203752"
     mRNA            complement(<131688..>134270)
                     /locus_tag="ZYRO0D01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496459.1"
                     /db_xref="GeneID:8203752"
     CDS             complement(131688..134270)
                     /locus_tag="ZYRO0D01650g"
                     /note="similar to uniprot|P08638 Saccharomyces cerevisiae
                     YLR451W LEU3 Zinc-finger transcription factor that
                     regulates genes involved in branched chain amino acid
                     biosynthesis and ammonia assimilation positively regulated
                     by alpha-isopropylmalate an intermediate in leucine
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496504.1"
                     /db_xref="GeneID:8203752"
                     /db_xref="GOA:C5DUV2"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DUV2"
                     /translation="MSKLETISPSPDSDAGGVDYDNNYKKESSVTGSTGSCLSRSRKF
                     ACVECRQQKSKCDAHDRAPEPCTKCQKKGVPCVLKKDFRRTYKRARNEAIEKRFKELT
                     RTLTNLSSEEILKKIEQEQQALLDGQNFTKDKVKRLKQSGITVTPTSTAADGSQRANP
                     LGSDWIYEFEHMQNVKEMTPEQLKCTPKTLGDIYMSSEDIAELFQEFAKRYHPFLPVI
                     DITKGAERIYRLSPCLFWVMILTGLRRKFGATELMTKLSSMVKSILAEITISPIIRYT
                     PSDSDEPVLNVASVYSVQAFLLYTFWPPLTSSLSADTSWNTIGTAMFQAIRVGLNSAE
                     YSREYATANHELISEQVRTWVCCNIVSQYIASSFGFPAYVSFDHTVINVSRESPNDAE
                     HSGVPTSIKQMAQIVHFENQVINTMNSNPSNALGIVGSEQKQPLLKVLNQQLTQLEIN
                     LENNELDSIRKFLFLVAKAHLLTYYFMDAFSTHKKNDNDIRTLSLSEIESNFETKCGL
                     VKVYNASIDLLTHSTNMWQRDPAVIKYFPGVFVLNIWQAACIISKLVHSSLSSVLDVA
                     KGKKAYQDAVSLTFNASVLKHDMAYRSSGIMRSIWSMFAKMHDDWKKDRVSQDEKFAN
                     DFNLGISVKSRMSVSVFFDCLYILREKCGMAKLKRESRKYEDDEEYGEEAIQEGSRLE
                     INRGERERRLSEVKDPEEDARKIIRTIPLDPNPINASNASSTSSLGSPTSQTPDVVLL
                     KDMLSRSSPREEIASRRTSSHQLATLPEARAVSSGPHTSLPSVFSIRKSQEPVRRVPT
                     AEHVRTMASNGGASGAAPSSVPTQPSNESPNAMMEHWDNWESDMVWKDVDLLLNEFAF
                     NPAV"
     gene            <134493..>135791
                     /locus_tag="ZYRO0D01672g"
                     /db_xref="GeneID:8203753"
     mRNA            <134493..>135791
                     /locus_tag="ZYRO0D01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496460.1"
                     /db_xref="GeneID:8203753"
     CDS             134493..135791
                     /locus_tag="ZYRO0D01672g"
                     /note="similar to uniprot|P47159 Saccharomyces cerevisiae
                     YJR124C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496505.1"
                     /db_xref="GeneID:8203753"
                     /db_xref="GOA:C5DUV3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DUV3"
                     /translation="MKLFREFRDSPRDIKLLWGSVFLRLLSYGITNQILTLFLNAIQM
                     SESQIGWFMSLTLVGDVVCSYVLTWYADIWGRRTVLVYGSVMMVLSGLVFCFSTNFYW
                     LLIFAIFGVISPSSDDVGPFKSIEESMLAHLTPHNKRPEIYALHALMGTTGGALGAIM
                     CGALLHLIQKLKWVHTDLESYQAVFLLYALIAVGKVIIMLCLSRQTELDMHHHEPHTT
                     EEDQPLIQHATEPKSANLSPETKSILVKLLVIFMLDSLGYGFMTSSWVIYYYAKYFMM
                     GSMALGTLFFCNQIVSALSSIPSSFIARHMGPVKAMISAQAPSAVFFMLIPLVGHNLV
                     LSILFLVLYSSTTAMDVTPRQILLTNIIKPQDLTKVMGTVNIGKTMARCVGPIFTGIL
                     AQRDHLALCYVISGSLVLAADCVLAFWFFRFDSSIKRQIT"
     gene            complement(<135819..>138467)
                     /locus_tag="ZYRO0D01694g"
                     /db_xref="GeneID:8203754"
     mRNA            complement(<135819..>138467)
                     /locus_tag="ZYRO0D01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496461.1"
                     /db_xref="GeneID:8203754"
     CDS             complement(135819..138467)
                     /locus_tag="ZYRO0D01694g"
                     /note="similar to uniprot|P40017 YER024W Saccharomyces
                     cerevisiae YAT2 Carnitine acetyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496506.1"
                     /db_xref="GeneID:8203754"
                     /db_xref="GOA:C5DUV4"
                     /db_xref="InterPro:IPR000542"
                     /db_xref="UniProtKB/TrEMBL:C5DUV4"
                     /translation="MPSIQELDDNTVSTYAWESSLSQLPLPDVSRTLGQLQDSLTPLY
                     FSDGYYRAPMDHEKLQEFSHSVKDFLNSKLCDKLQSTLESYRTSSNCYLDSLPLEINN
                     NSTRELENDVLPRNPLLMLEDDILPKVSQVDRSAILAHAALRFISALKQRVLPPDRDG
                     SNGLPLTMLPYENLFGTTRCPVLAPGEVESFDLNKPFSDSELDSTYLIGRDEEEDVED
                     SDEWPVNDTFSQHGITMRKYSDSRHLLVISRGQYYTVEVLDDKGNVLYDPSNLTTVFN
                     YILEDSIRNEDSSASTALGSLTSHSFRSWKYARKRLERKFPDELRLIDSALFVLVLDH
                     SSFKDDETTTGGSELQILRDSDENSMVNSARNLKRLFYGTSILNDNGHQMGSCVSRWY
                     DKLQLVVTKDSEAAVIWDCFTCDGSAVLRFTSETYTESILRLAREVNLGDPRFSLWPS
                     INSSSTQSTSNKKTLELDPVKITRKIEWKFSDILNTHIHLSETKLADLISRYDMIRLS
                     IPFGRRDADIWGVKPDAMIQIALQVAHFALYGKIIYGVEPVSTRGFKNSRSCFIDIQS
                     DDLLKLCREFIANSLDDTSKLNKFLIACKLHTQRVRNAKVGDGFEKHFNALRWLFKFN
                     EHYGVSLDSEDRKIGEPIFESPILVPFLVPEFLAANCGNAATTAFAITPDNPNGFGVG
                     YTLKGDCCDLTVTSQFRQGGRLMFMLNWVLSEISRMWKGVTGSTVGKGTGYKISPTVN
                     KLYEMDNALKHIESSGKAIRGYGFFDLHPHWDIVNGSEPNSASNSSVRLSSLDSDIGI
                     PPTSPLKHSSAAHSVLAEREKHDTGFQIRRFNGSEELPQELYEQNMTDGPSRPTSSRC
                     SNVINSKFEIDFDRGMVGKKVTSVFD"
     gene            complement(<138956..>139633)
                     /locus_tag="ZYRO0D01716g"
                     /db_xref="GeneID:8203755"
     mRNA            complement(<138956..>139633)
                     /locus_tag="ZYRO0D01716g"
                     /product="40S ribosomal protein S5"
                     /transcript_id="XM_002496462.1"
                     /db_xref="GeneID:8203755"
     CDS             complement(138956..139633)
                     /locus_tag="ZYRO0D01716g"
                     /note="highly similar to uniprot|P26783 Saccharomyces
                     cerevisiae YJR123W"
                     /codon_start=1
                     /product="40S ribosomal protein S5"
                     /protein_id="XP_002496507.1"
                     /db_xref="GeneID:8203755"
                     /db_xref="GOA:C5DUV5"
                     /db_xref="InterPro:IPR000235"
                     /db_xref="InterPro:IPR005716"
                     /db_xref="InterPro:IPR020606"
                     /db_xref="InterPro:IPR023798"
                     /db_xref="UniProtKB/TrEMBL:C5DUV5"
                     /translation="MSDVEAPVEAQEEFEVVEEFTPVKLATPIPEEVQQGQQEIKLFN
                     KWSYKGVEVKDPSLVDYIQIRQPIFVPHTAGRYANKRFRKAQCPIFERLTNSMMMNGR
                     NNGKKLKALRILKHTLDIINVLTDQNPLQVVVDAVTNTGPREDTTRVGGGGAARRQSV
                     DVSPLRRVNQAIALLTIGAREAAFRNIKTIAETLAEELINAAKGSSTSYAIKKKDELE
                     RVAKSNR"
     gene            complement(<140185..>141540)
                     /locus_tag="ZYRO0D01738g"
                     /db_xref="GeneID:8203756"
     mRNA            complement(<140185..>141540)
                     /locus_tag="ZYRO0D01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496463.1"
                     /db_xref="GeneID:8203756"
     CDS             complement(140185..141540)
                     /locus_tag="ZYRO0D01738g"
                     /note="similar to uniprot|P47158 Saccharomyces cerevisiae
                     YJR122W CAF17 Mitochondrial protein that interacts with
                     Ccr4p in the two-hybrid system 3'-untranslated region
                     contains a putative mRNA localization element common to
                     genes encoding mitochondrial proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496508.1"
                     /db_xref="GeneID:8203756"
                     /db_xref="InterPro:IPR017703"
                     /db_xref="UniProtKB/TrEMBL:C5DUV6"
                     /translation="MKAVTIARRFNHATLQYASNKKSFLKIRGPEAPKFLNGLVTSKL
                     LPAFTKKNLTTINPHQEDKNNQLELDFDETHSNWGVFNEMGYNGSYISRFGTYTGILN
                     SKGRLLTDTLLYPSPLCHGTKKSMAWPEYLLEFDPSIGSTLNKMLDLHVLTSKVKTKL
                     YEGGFTSWDMRILLPGLQAEDENPWISNVLEPSTMTKNPQDAQAFAAGLASALFQGNE
                     AQVIAMYIERRTDQLIEADGSMGQQFRVVTKNGVDLKSILNPQGFPFEFKLEEVDPAF
                     FRRLRFEQGYVDSVQDYTAESLLPLELNFDFLPNAVSADKGCYIGQELTARTFATGIL
                     RKRLVPVTLFNPENYPLPQGKQYPDISMEPDPNETRKPSANSNPFGNTKTPKRQRPAG
                     SLIASEGNKGVAMLRIEHFKRAFHSEEDDKPFYIATEDGKRIGIIPSQPFWLLDHEED
                     L"
     gene            complement(<141916..>143433)
                     /locus_tag="ZYRO0D01760g"
                     /db_xref="GeneID:8203757"
     mRNA            complement(<141916..>143433)
                     /locus_tag="ZYRO0D01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496464.1"
                     /db_xref="GeneID:8203757"
     CDS             complement(141916..143433)
                     /locus_tag="ZYRO0D01760g"
                     /note="uniprot|Q76FP6 Zygosaccharomyces rouxii ZrATP2
                     Mitochondrial ATPase beta-subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496509.1"
                     /db_xref="GeneID:8203757"
                     /db_xref="GOA:C5DUV7"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR000793"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005722"
                     /db_xref="InterPro:IPR020003"
                     /db_xref="InterPro:IPR024034"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUV7"
                     /translation="MVLPKLFPASSRAALQAARRSVPFTGVRGLASAAATNGKVRAVI
                     GAVVDVQFDQENLPEILNALEIERPQGKLVLEVAQHLGENTVRAIAMDGTSGLVRGAP
                     VSDTGAPISVPVGKETLGRIINVIGEPIDEAGPINTTVRRPIHAEAPSFVEQSTNSEV
                     LETGIKVVDLLAPYARGGKIGLFGGAGVGKTVFIQELINNIAKAHGGFSVFTGVGERT
                     REGNDLYREMMETGVIDLKGESKVALVFGQMNEPPGARARVALTGLTVAEYFRDEEGQ
                     DVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLSTDMGALQERIATTQKGSVTSV
                     QAVYVPADDLTDPAPATTFAHLDATTVLSRGISELGIYPAVDPLDSKSRLLDASIVGE
                     EHYNTASNVQMTLQAYKSLQDIIAILGMDELSEQDKLTVERARKIQRFLSQPFATAQV
                     FTGIEGKLVRLKDTIRSFKEVLDGKYDHLPENAFYMVGGIEDVIAKAEKLAAGGN"
     gene            complement(<144407..>145267)
                     /locus_tag="ZYRO0D01782g"
                     /db_xref="GeneID:8203758"
     mRNA            complement(<144407..>145267)
                     /locus_tag="ZYRO0D01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496465.1"
                     /db_xref="GeneID:8203758"
     CDS             complement(144407..145267)
                     /locus_tag="ZYRO0D01782g"
                     /note="similar to uniprot|P32263 Saccharomyces cerevisiae
                     YER023W PRO3 Delta 1-pyrroline-5-carboxylate reductase
                     catalyzes the last step in proline biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496510.1"
                     /db_xref="GeneID:8203758"
                     /db_xref="GOA:C5DUV8"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028939"
                     /db_xref="InterPro:IPR029036"
                     /db_xref="UniProtKB/TrEMBL:C5DUV8"
                     /translation="MGYTLLILGAGVMGQAVLSAVYNAPHVADANKSSQYPSQIITVN
                     NSVKSSERVKQLVQSFGNSPNGISVRCETKLDKSVKPEVVVVGTKPYQLEQVLKDYSS
                     VFREAQQVISLAAGWTIDQIQSKIANPPSVSRVMTNTPAKFGWGSAVISHSTNTSEFQ
                     KQRSQELFQHLGLCVELPEKNMDAATALVGSGPAFALLWMESLMEGGIKMGIPLEQSR
                     RLAATVVEGTSKMLLATGAHPSVLKHQVCTPGGNTIAGLVEMEDRGVKSGIIRGVEEA
                     TRVAAELGKK"
     gene            <145468..>147756
                     /locus_tag="ZYRO0D01804g"
                     /db_xref="GeneID:8203759"
     mRNA            <145468..>147756
                     /locus_tag="ZYRO0D01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496466.1"
                     /db_xref="GeneID:8203759"
     CDS             145468..147756
                     /locus_tag="ZYRO0D01804g"
                     /note="similar to uniprot|P47156 Saccharomyces cerevisiae
                     YJR119C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496511.1"
                     /db_xref="GeneID:8203759"
                     /db_xref="GOA:C5DUV9"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR003349"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DUV9"
                     /translation="MDHVPIISPSESEFANPIDYLSEPSIQRLGRHYGMVKLIPPANF
                     KPPFCINRETFKFHVRVQNLSELNILNRCRLFFIKQLNNYNRASSGKNNANDKTLSNP
                     YVKLSTGETVYLYDLFIEILKYFNDGENNNRKRSRNLQRIINFPSLQEISRDTRLWKN
                     ISHIFKMDYKSLQEIFANYIENYYEYLATQTKNRGSQHLSKLLYQEEYPKSLLSDDDA
                     SGEEEDSEDEEDEGCAVCNRNTKPTKMILCDSCDKPFHIFCLSPPLDSIPKGDWICNN
                     CIIGNGYYGFREETRHYSLEEFQNLWNNNEKSLTTNAATGEPLSIEQLEEKFWQHVDD
                     MENSLTVKYGADLHGEGPGEISGFPSKDYKPPESKIKCSDQDFENYTNHPMNLLNLPD
                     AKGSLLPMFDRKISGMTIPWIYVGSTFSTFCWHLEDQYTLSANYQHEGAPKVWYSIPE
                     GSCDRFNQLMKDLAPDLFEKQPDLLHQLVTLISPYDEKFKKAGIKCFKAVQQPNEYII
                     TFPKCYHAGFNSGYNFNEAVNFTLDSWVPYGVEAVADYRSTGKHCVFDMFELMLNVVI
                     ESVHQSSKFQRSLVENCFREVRQILNSNVKTIEQLLSSVLRKKFVLGRTVRDEFAHRR
                     KGNLVTQDSQYSQEQQQRGSDDDEDFDVFCTKCKTICSLAFVLHYKNGSNRKRRKIQS
                     MTPTQLNELANNNNGELEILCLDDYVKLVYDSDIDDQRTLVKGDDEDIDPFENDELNY
                     VRDPDELYHILNMAGKALLGWT"
     gene            <148060..>148617
                     /locus_tag="ZYRO0D01826g"
                     /db_xref="GeneID:8203760"
     mRNA            <148060..>148617
                     /locus_tag="ZYRO0D01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496467.1"
                     /db_xref="GeneID:8203760"
     CDS             148060..148617
                     /locus_tag="ZYRO0D01826g"
                     /note="similar to uniprot|P47155 Saccharomyces cerevisiae
                     YJR118C ILM1 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496512.1"
                     /db_xref="GeneID:8203760"
                     /db_xref="InterPro:IPR018815"
                     /db_xref="UniProtKB/TrEMBL:C5DUW0"
                     /translation="MAALSSVNGLFLRVAFLLTISFFCFKNVNSILENSYVVLLTHSM
                     NLPMLAMSPYSGQLGIFGVLFLMLAFSDLLPLLESNQKYFYSIVPARLTAYFILTALS
                     YVWTSNLYLHNNAVFLFCFNEVWLNFVIYGSIREERNEEFKRTTQFVNNTEIFQEDGE
                     EEDGEGVPLTSIQEIEQLEDDNEQE"
     gene            complement(<148657..>150621)
                     /locus_tag="ZYRO0D01848g"
                     /db_xref="GeneID:8203761"
     mRNA            complement(<148657..>150621)
                     /locus_tag="ZYRO0D01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496468.1"
                     /db_xref="GeneID:8203761"
     CDS             complement(148657..150621)
                     /locus_tag="ZYRO0D01848g"
                     /note="similar to uniprot|P32569 Saccharomyces cerevisiae
                     YER022W SRB4 subunit of RNA polymerase II
                     holoenzyme/mediator complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496513.1"
                     /db_xref="GeneID:8203761"
                     /db_xref="GOA:C5DUW1"
                     /db_xref="InterPro:IPR019313"
                     /db_xref="UniProtKB/TrEMBL:C5DUW1"
                     /translation="MSENHDESSNDLNLVENGIQLALDPNLITLPLHGSVSSPLTNAP
                     NSNAQTSENGNPDQMDVDSEPAQGNNNAGQSLINNPYGLFGQMPLEHLIPLVLQQKGP
                     GFKFADLSEDALEEEIEKDKSGGDEDARPDLMDVDPSENQVEEVPPEAVEEDNQETTK
                     DGEKEEETITQEQFVRMRREMVEHINIAMNESSLALEFLSLLLSSVRESVALSSMSPF
                     LKKIVPVASLNSDRVSSEPKTVEDQLTMQVIDRGWKIRCLNESRTLLKENHSMLEEKL
                     KNEHRYWKKISQYISNKDVIFKLRDKSTGLRSLGVKYGYEDSGSTYRLDRGVAILKTN
                     PETNTLELVPITGENSPSPHNEKFIRIRIFTKIEFEDDYILSGESSVDNVFLNSDSSG
                     KKDQEDIRSQIEKLKALIFEQELMYQLRRECAQLISYGVTIENEKKVVIELPNEKFEI
                     ELVSLDDASVVNHEQDAPKINDRRANLMLITVRMLLVVMFKKNLRQRLTSSTRNSHLN
                     VDKDILLIRPLLGKMRHQNYKLLLRKILKTHVLDVVETSTFSETVVHPPRHENADDVN
                     LDIHIAKLNQEISTFDRLLTTCKTQFDVKLVNEDKLSLTLESPNYCNLAVRVLYQNAS
                     KNVSFDTRFSEFKEVEEILHFIVNEYIKKT"
     gene            complement(<150833..>152350)
                     /locus_tag="ZYRO0D01870g"
                     /db_xref="GeneID:8203762"
     mRNA            complement(<150833..>152350)
                     /locus_tag="ZYRO0D01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496469.1"
                     /db_xref="GeneID:8203762"
     CDS             complement(150833..152350)
                     /locus_tag="ZYRO0D01870g"
                     /note="similar to uniprot|P40016 Saccharomyces cerevisiae
                     YER021W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496514.1"
                     /db_xref="GeneID:8203762"
                     /db_xref="GOA:C5DUW2"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013143"
                     /db_xref="InterPro:IPR013586"
                     /db_xref="UniProtKB/TrEMBL:C5DUW2"
                     /translation="MSGEKMDVDSPAPEQPEVDVKHAEERAMDEIVAVLSEISKTAST
                     LDTYFVWRGLKEVGTLRKQHLKKEILSALVHVLYPDGSDFKIPLLKAINDNKKSSVNK
                     ADEIRSGYPASFYEVVGEKKIEVAAEVNSFVHLLVVLYLLDSGKYEELENFNKKIVIP
                     KLLEFYNQRFLDLINAKLWFYVVICDEKLGRTSDPVTRAKMIKFFKTASLKHDNETKA
                     MLITLIMRSFLSGGEVEAASDFVNKVEFTPTDVSSPVEARYYFYLSKISAIQLDYTSA
                     NEYIIAAIRKAPNTPNSLGFLQQANKLHCVIELLMGDIPELSFFHQPNMQKSLEPYYH
                     LTKAVKLGDLKKFTLAISKYKSRLIKDGNYQLYVRLRSNVIKTGIRIISLTYKKISLK
                     DICLKLRLDSEQTVEYMISRAIRDGVIEAKINHEKGYIETSGLLNIYDTEDPQEVFDQ
                     RITFVNQLHDESIMAMRYPEDNKNKNNGSQEDEFIDGELLDDISDFSDIDDLGFL"
     gene            complement(<152686..>154179)
                     /locus_tag="ZYRO0D01892g"
                     /db_xref="GeneID:8203763"
     mRNA            complement(<152686..>154179)
                     /locus_tag="ZYRO0D01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496470.1"
                     /db_xref="GeneID:8203763"
     CDS             complement(152686..154179)
                     /locus_tag="ZYRO0D01892g"
                     /note="highly similar to uniprot|P47154 Saccharomyces
                     cerevisiae YJR117W STE24 Highly conserved zinc
                     metalloprotease that functions in two steps of a-factor
                     maturation C-terminal CAAX proteolysis and the first step
                     of N-terminal proteolytic processing contains multiple
                     transmembrane spans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496515.1"
                     /db_xref="GeneID:8203763"
                     /db_xref="GOA:C5DUW3"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR027057"
                     /db_xref="UniProtKB/TrEMBL:C5DUW3"
                     /translation="MKRYRTRYYVDELPSNIPHNTIKKDRDKRTVTIDSTATMSLFES
                     IQSRLDSPVIPWKGIIAGISVAQFAFETYLTYRQYRVLKSKKLPAALENEIDNETFVK
                     STAYSRAKAKFSVVSEAFNLVQKLVAIKFDVMPRLWNFGVHLSQFILPTRWAAVSSVA
                     QSLWFLSVISNFSTIIDLPLSYYQHFVLEEKFGFNKLTKQLWIVDTLKGLALGHALGG
                     PILYGFLKIFERFETNFLWYICGFIFLVQILVITLIPVFIMPLFNKFTPLEDGPLKKS
                     IEDLAFKLGFPLDKIFVVDGSKRSSHSNAYFTGLPFTSKRIVLYDTLVNESSVEEITA
                     VLAHEIGHWQKNHIVNMVVLSQVHTFALFSLFSAVYRNLSLYNSFGFFLGVPSGDLLS
                     SSKQVFTPDFPIMIGLQLFNDLLAPMECVMQFLLSLISRLHEYQADAFAKGLGYTQYL
                     AQALINLQIKNLSTMNVDPLYSAYHYSHPTLAERLTALGFVSRKKAE"
     gene            complement(<154320..>155147)
                     /locus_tag="ZYRO0D01914g"
                     /db_xref="GeneID:8203764"
     mRNA            complement(<154320..>155147)
                     /locus_tag="ZYRO0D01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496471.1"
                     /db_xref="GeneID:8203764"
     CDS             complement(154320..155147)
                     /locus_tag="ZYRO0D01914g"
                     /note="similar to uniprot|P47153 Saccharomyces cerevisiae
                     YJR116W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496516.1"
                     /db_xref="GeneID:8203764"
                     /db_xref="GOA:C5DUW4"
                     /db_xref="InterPro:IPR006634"
                     /db_xref="UniProtKB/TrEMBL:C5DUW4"
                     /translation="MFEVTTEDPLIGWSLFPQSDNLYLKHLHEILGALLFYIVVYQWV
                     APYLNRLIFGKHYTSIEDSKVKVNFDVHTVSNIQCIVTWYAIAPVILTPLSLNVVTYQ
                     DDRCAMATALTVGYFLWDLGVCLLHYELYGVEFMAHCLSSLYVVGLTLKPFCLSWAGK
                     FLLFEASTPFVNNNWFITQLSRGASKPPVPFWFNVLNGLLLMAVFFIVRILWGFAAIV
                     LLVQQMWKVRDQLPIFQTFILLSINMILNTLNVFWFSKMYKIAKKMARGSNKVTKSH"
     gene            <155397..>156515
                     /locus_tag="ZYRO0D01936g"
                     /db_xref="GeneID:8203765"
     mRNA            <155397..>156515
                     /locus_tag="ZYRO0D01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496472.1"
                     /db_xref="GeneID:8203765"
     CDS             155397..156515
                     /locus_tag="ZYRO0D01936g"
                     /note="similar to uniprot|P47143 Saccharomyces cerevisiae
                     YJR105W ADO1 adenosine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496517.1"
                     /db_xref="GeneID:8203765"
                     /db_xref="GOA:C5DUW5"
                     /db_xref="InterPro:IPR001805"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DUW5"
                     /translation="MILSSIKSGIKLKRSSITTVQKSIRRSITANMSHSPQVICLGNP
                     LLDIQADVDAAYLEKYALKANDAILVDANSGDKRMEIYEEVIKKPNVHFVAGGAAQNT
                     ARGAAYVLGPQKVGYFGSVGQDTYADKLLAENETAGVASFYQVQKSVGTGKCAALITG
                     HNRSLVTDLGAANHFTPDHLDAHWDKVEAAKLFYIGGFHLTVSPDAICKLGKHAQESG
                     KPFILNLSAPFIPQFFKSALDQVLPYTTYVIANESEAASYAESYGLTCSKDDLEAIAK
                     HIVGDSTQRTVIFTHGLEPTVVVSNQGTKSVPVKPIAGEKIVDTNGAGDAFAGGFLAG
                     LAQGFDLLKSIDLGQWLAALSLQEIGPSFPKTKVQYNN"
     gene            <156692..>158728
                     /locus_tag="ZYRO0D01958g"
                     /db_xref="GeneID:8203766"
     mRNA            <156692..>158728
                     /locus_tag="ZYRO0D01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496473.1"
                     /db_xref="GeneID:8203766"
     CDS             156692..158728
                     /locus_tag="ZYRO0D01958g"
                     /note="similar to uniprot|P47144 Saccharomyces cerevisiae
                     YJR106W ECM27 Non-essential protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496518.1"
                     /db_xref="GeneID:8203766"
                     /db_xref="GOA:C5DUW6"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:C5DUW6"
                     /translation="MDWVLAVAHPKLLYGDATVSWTFLVPSFLHMATSFVLLGVCASD
                     YLCPNVARLADSNGHGTGTLMAVLLSWCNSSPDLFSNFMSWVTPTNHGSNGGSSMAAS
                     LSIGEVLGACGIILCVVIGSIFTIMASVSVELTKAQRHSFVRDLGFAFVAIGILCYVC
                     LRNRITVLNCCLMVMVYLVYLIFKFKYRVLENALSTDALELDTNHSSEQALIDENTLR
                     SHIKPSIISAMDFNSLLTMLENSKTGSKGRTELEDLANPQGDSRLFVPQRPNTEPTRR
                     GSHSDELADVSNMLAVPQSSPAAFGPYHDDPEIAIQEELAIQEPAATSRPPRKGQFKR
                     LKSGLFRLFLPHLVDLNKKTVVDAILSLLTAPFVILLRLSCPQPFEIAEFDDYSGKYV
                     ISTMDITLLFIQSVICPHICLIILSCIMDHKLSIIYWILAMICSVGLTTLMLQFYKSL
                     LSHNRFSLLRPTLWEQESASESRRVVEKSGTVIAILFTTVGIINSILWISLIANSVIE
                     MMELYQRITHISQAILGLTIFAWGNSISDIISNIAMCRLYRKLPQGESSDSDKVATKF
                     FMISCTSCLGGVMLNSMGGIGISGLVALVFILDGNGKWWFERSVELHSNGAIDYKFIV
                     SCIALVLQILLLALIFGSPSSTHQWFKERMKPLGITMCCIWGVATLCNILLESF"
     gene            <159036..>160136
                     /locus_tag="ZYRO0D01980g"
                     /db_xref="GeneID:8203767"
     mRNA            <159036..>160136
                     /locus_tag="ZYRO0D01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496474.1"
                     /db_xref="GeneID:8203767"
     CDS             159036..160136
                     /locus_tag="ZYRO0D01980g"
                     /note="similar to uniprot|P47145 Saccharomyces cerevisiae
                     YJR107W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496519.1"
                     /db_xref="GeneID:8203767"
                     /db_xref="GOA:C5DUW7"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DUW7"
                     /translation="MVWVAHIFAPFLAAMLVTSAAWTSDTMGLLKRGSEKEEISEVEF
                     TEDVYERLLYFSKVSALVSCISGNGLIPDKTLKEGGCPPHLAFCSDEKVNPTANATRI
                     ELVLTAGKGELGTGCLLVDHTRKVVIVALRASTTRQDWLSDFTIYPTSWEPSSKSCYK
                     NLVESGTIKPCEDCKIHRGFYKFSETLAELFLDKIEHIFSKYPEYNLVITGHSLGAAL
                     ASIAGIELKLRGYDPLVITYAKPLMFNTQMKEWVDELFQTEEVDKDCRKNGKLDFKKG
                     FFRVVHDKDYIPMLPPNYKQAGLEIFIKKKDLPHERFDLEYKGTKSYYDSEPDYNSEE
                     WQGISQSFSNGDWLHRKEHCSYFIYISGCEGF"
     gene            complement(<160267..>161517)
                     /locus_tag="ZYRO0D02002g"
                     /db_xref="GeneID:8203768"
     mRNA            complement(<160267..>161517)
                     /locus_tag="ZYRO0D02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496475.1"
                     /db_xref="GeneID:8203768"
     CDS             complement(160267..161517)
                     /locus_tag="ZYRO0D02002g"
                     /note="similar to uniprot|P10823 Saccharomyces cerevisiae
                     YER020W GPA2 Nucleotide binding alpha subunit of the
                     heterotrimeric G protein that interacts with the receptor
                     Gpr1p has signaling role in response to nutrients green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496520.1"
                     /db_xref="GeneID:8203768"
                     /db_xref="GOA:C5DUW8"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DUW8"
                     /translation="MGVCGSKTKEGVSERPPAHTNATANPKRNHLQNANGKETRNNDS
                     STFEKSDGSDNMRLDGEKQSDTNGNALETSSRSNKGTEFKVLLLGAGESGKSTIIQQL
                     KILHQNGFSQQELIEHKSVVYDNVLEIAKSLLEARNKFGVPLEPSSGITEEDIQLVEE
                     YQYTEEGRTGNYYLANTSQFPAQIASTLVKLWELPSTKELLNSNHRSEFYLMDSASYF
                     VENIDRISQPNYIPSVQDILRSRQKTSGIFDEVFDVGSNLKLHIYDVGGQRSERKKWI
                     HCFDSVTIIIFCVSLSEYDQVLLEDQSQNRFQESLVLFENVVNSRWFSRTSVVLFLNK
                     IDLFAEKLQKVPLENYFPDYTGGQDINKAAKYILWRFVQLNRANLSIYPHVTQATDTS
                     NIKLVFAAIKETILENSLKDSGVL"
     gene            <163231..>163794
                     /locus_tag="ZYRO0D02024g"
                     /db_xref="GeneID:8203769"
     mRNA            <163231..>163794
                     /locus_tag="ZYRO0D02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496476.1"
                     /db_xref="GeneID:8203769"
     CDS             163231..163794
                     /locus_tag="ZYRO0D02024g"
                     /note="similar to uniprot|P36147 Saccharomyces cerevisiae
                     YKR065C FMP18 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496521.1"
                     /db_xref="GeneID:8203769"
                     /db_xref="InterPro:IPR013875"
                     /db_xref="UniProtKB/TrEMBL:C5DUW9"
                     /translation="MFALKNSPLASKATTRLLRPQILSPRFNSTTSKDSQEQLTWANF
                     FDLRKKERRINIGSSAFTAFLGCNASWVYLSTLEIDPLQPIMGFDPLIVISSAIVASG
                     FLGYLMGPVIGTQLFKVSNKRRLTSFEIKNKEFLRKVVANRVNPSSQSFSNPVPDYYG
                     EKIGSIKEYRQWLRDCHAYRRKAKEFL"
     gene            complement(<163926..>164291)
                     /locus_tag="ZYRO0D02046g"
                     /db_xref="GeneID:8203770"
     mRNA            complement(<163926..>164291)
                     /locus_tag="ZYRO0D02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496477.1"
                     /db_xref="GeneID:8203770"
     CDS             complement(163926..164291)
                     /locus_tag="ZYRO0D02046g"
                     /note="weakly similar to uniprot|P14359 Saccharomyces
                     cerevisiae YJL151C SNA3 Integral membrane protein
                     localized to vacuolar intralumenal vesicles computational
                     analysis of large-scale protein-protein interaction data
                     suggests a possible role in either cell wall synthesis or
                     protein-vacuolar targeting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496522.1"
                     /db_xref="GeneID:8203770"
                     /db_xref="GOA:C5DUX0"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:C5DUX0"
                     /translation="MSVYSVNKHDVLLMVLSVFLPPITVWVRRGFFSRDFLLNLLLFV
                     LFFFPAIFHAAYVIYETSEERQSGYESVPAQEDGSEPQQPRNGDFNVDLEAQGTLPRY
                     EEVVDASAAKPHGDNKVQN"
     gene            <165447..>167198
                     /locus_tag="ZYRO0D02068g"
                     /db_xref="GeneID:8203771"
     mRNA            <165447..>167198
                     /locus_tag="ZYRO0D02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496478.1"
                     /db_xref="GeneID:8203771"
     CDS             165447..167198
                     /locus_tag="ZYRO0D02068g"
                     /note="similar to uniprot|P47005 Saccharomyces cerevisiae
                     YJL149W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496523.1"
                     /db_xref="GeneID:8203771"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C5DUX1"
                     /translation="MSENNSDGGPFPLKRLPDELLQEVFSHLPQEDRLTACLIDKRSN
                     KLATKLVYRRIYLNDSNVVRSDYMNLAINWTLLNIPSFLSEDDSRKIANSKLVKLIWT
                     LSVNRFPLNCVQWIRINWDLDSALQRTILAVLCSKGEALQRLENVTDPSCNDIIAYGA
                     VSKHKVTSFDMAPPNSLPELPVPRDYIPNLQKYLRHRISSRLSHMTLFMDPIQLFNYL
                     HPLEQKLQIVDLKLHWRREFYDPRCFMHRLRSRPLTKLSEVFDVRTLKVLTIISWSES
                     LVPREIEMVRDFKEFIYLEDLSLISIKQNFEVLMTFFYNFPHLKRLKMDFLEDFIPET
                     TKPEIFLTILLVCKKLQFIDMRFEGMDSQIISLHENRFILNQKCHCSGCVHTFENILK
                     KKIFLFPEDRLLYDIHDITAKDIFKMMRYLSLLPYSKACDCYPSVRTQPMNLEQFVKK
                     MNRDLFFYRHSRRQLVPNGELDDEEIIDSESMLRKLPHDPLTEEDVIKCYHALIHHYR
                     TTYISFLKGFPELRFLMLNDIPTVVVEEDGERVFQPIFFHCDYKTNLTGWSKLRHKKH
                     RGSDDVNDSVTRKATVF"
     gene            complement(<167354..>169882)
                     /locus_tag="ZYRO0D02090g"
                     /db_xref="GeneID:8203772"
     mRNA            complement(<167354..>169882)
                     /locus_tag="ZYRO0D02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496479.1"
                     /db_xref="GeneID:8203772"
     CDS             complement(167354..169882)
                     /locus_tag="ZYRO0D02090g"
                     /note="similar to uniprot|P36023 Saccharomyces cerevisiae
                     YKR064W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496524.1"
                     /db_xref="GeneID:8203772"
                     /db_xref="GOA:C5DUX2"
                     /db_xref="InterPro:IPR001138"
                     /translation="MVLSQDVRGASVRRRNRPTVVCTNCKRRKSKCDRQNPCSNCVRF
                     GNKDTCHYVQNPKNTESQHGEDTDNKVKKQQPQMIKGKRNGTSSSIVGSKASSISPTG
                     QSLDVPLVLSGKNYVNLSPSGNFVEFKRSAVTMFSYFCKRAIQDRDLYLKALVTFRSI
                     AVEMTTNTLRGTKNYSKNPSLPESFKPLSIFDADGDPLSSDSLFRQHQLIHKSLFDKY
                     GKYRKDEAIKIVDVCELLNDNLPSRSLFIDHILVHFESHVIHMVPIFEMEFLKYDVNN
                     FYDKWEQSREISVKDFDHMVCCVILLITKICILSTKFARLPSELLEHFEKLDTSKYIA
                     IIHYYMFEMKSLRKCTLRQLQILLLLRFYHWCAPEDGDGDSLQHSHILMGTIIASCQE
                     MGISWLCIRDPGIYWFQLFGQSKRVPFILSPEDFKIIYQMIWSYVLHWDRKMFLINGQ
                     ECLIGKSHLYDVTGQELSWHHRMVALDHIIMKMNDILNDSPSRVDIVALKQEWNNALR
                     IFELIRDTKKEHLHLNFEYETTLELFRLCLSHAELTHLEQVNDVESFHLTVQSLWDQI
                     VKLASKCHRYFYGPQEMDPYSRFFTNKIISVVADKLCTLIPAFVLRLNRFGEMGFDQM
                     NMMVKFLFGVCSMYYNELGFDYYRCFESMFTAKISYKILNRPRNKNPWEIILEFLLCQ
                     LEKEGIKDQLRELKIIQNLPVLVSLRESLNLIPEYHRDAVKLWNTDVVPIGHSSVNFT
                     LNLREESLEPFLVDRYSQTFNIFTSFYDHASSQLAEEAEDTSSKIQYNVENSAEQAQE
                     IAETNAVPVEHPLSLEPTNPVNLEESNLELIRNMFEPLDFISFF"
     gene            <170157..>171554
                     /locus_tag="ZYRO0D02112g"
                     /db_xref="GeneID:8203773"
     mRNA            <170157..>171554
                     /locus_tag="ZYRO0D02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496480.1"
                     /db_xref="GeneID:8203773"
     CDS             170157..171554
                     /locus_tag="ZYRO0D02112g"
                     /note="similar to uniprot|P36146 Saccharomyces cerevisiae
                     YKR063C LAS1 Essential nuclear protein possibly involved
                     in bud formation and morphogenesis mutants require the
                     SSD1-v allele for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496525.1"
                     /db_xref="GeneID:8203773"
                     /db_xref="InterPro:IPR007174"
                     /db_xref="UniProtKB/TrEMBL:C5DUX3"
                     /translation="MVHPRIVPWYNEDELKELKDWFYNKELATDMRFRAIQRVKSYQS
                     KGSQYLPHVIDSTAQITNSILLDEERSQYDKFSVKLSYTMSLIRFVNGILDPTQQSQF
                     AIPLHTLAKRVGLPSWFVDLRHWGTHERELPSLEMLRIAAKDALVWLWDHYWNDDELE
                     EEDEEEENVEDEHTVSLRQLIQRGKSLQNLFKEYQWYWEEGSTNLISSTNFQAEESSH
                     GKRRREPTPQEQIDAFVSDCKDVWNNKDHREKFMNVFTLQYTPTLLRVLVMKLQGFSQ
                     EFFQFILQNYKDQLAKTPSVLSQRFSTWESLERKLLSKFVSSVNTNQFVSAWSSWEPL
                     ISENPSLLSYSFCQLMSNRLADNRDSFKKKKKKRQFVSYQEVESGLSEYVAKYSSFIR
                     EAESYNKQVQAHAKAQLKAEVPMQAPATDPIPKDMSDILKDLESLKRRHTDPPKTKAQ
                     WCQHPDWSPRPFGTL"
     gene            complement(171591..171721)
                     /gene="SNR128"
                     /locus_tag="ZYRO0D02134r"
                     /db_xref="GeneID:8203774"
     ncRNA           complement(171591..171721)
                     /ncRNA_class="snoRNA"
                     /gene="SNR128"
                     /locus_tag="ZYRO0D02134r"
                     /product="snR128"
                     /note="C/D snoRNA polycistronic Cluster 5 SNR128 (U14
                     RNA)"
                     /transcript_id="XR_002648399.1"
                     /db_xref="GeneID:8203774"
     gene            complement(171774..171918)
                     /gene="SNR190"
                     /locus_tag="ZYRO0D02156r"
                     /db_xref="GeneID:8204482"
     ncRNA           complement(171774..171918)
                     /ncRNA_class="snoRNA"
                     /gene="SNR190"
                     /locus_tag="ZYRO0D02156r"
                     /product="snR190"
                     /note="C/D snoRNA polycistronic Cluster 5 SNR190"
                     /transcript_id="XR_002648400.1"
                     /db_xref="GeneID:8204482"
     gene            <172232..>172858
                     /locus_tag="ZYRO0D02178g"
                     /db_xref="GeneID:8204484"
     mRNA            <172232..>172858
                     /locus_tag="ZYRO0D02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496481.1"
                     /db_xref="GeneID:8204484"
     CDS             172232..172858
                     /locus_tag="ZYRO0D02178g"
                     /note="similar to gnl|GLV|KLLA0A05973g Kluyveromyces
                     lactis KLLA0A05973g and some similarites with YJL148W
                     uniprot|P47006 Saccharomyces cerevisiae YJL148W RPA34 RNA
                     polymerase I subunit A34.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496526.1"
                     /db_xref="GeneID:8204484"
                     /db_xref="InterPro:IPR013240"
                     /db_xref="UniProtKB/TrEMBL:C5DUX4"
                     /translation="MGDSRSESVDAQTSESSVFSPPSDYKRVKHLKKFHKKNGEQLWL
                     IKLPRSLDVSKLKTLPLDLEGGEQPIPVEEGNDKDDQYSIGEDKTQKGGQDSSNLSLL
                     VPEESRESLKISGHGNSLKFDKVLSVRKTAQIPKIDYEKLTVPRSNVVKVEGLRTRHY
                     ASGYGPEDEDKVEDTSKEEHSERKSKKHKKHSSDEDHSKKKSKKDKKK"
     gene            complement(<172903..>173835)
                     /locus_tag="ZYRO0D02200g"
                     /db_xref="GeneID:8203775"
     mRNA            complement(<172903..>173835)
                     /locus_tag="ZYRO0D02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496482.1"
                     /db_xref="GeneID:8203775"
     CDS             complement(172903..173835)
                     /locus_tag="ZYRO0D02200g"
                     /note="similar to uniprot|P36145 Saccharomyces cerevisiae
                     YKR062W TFA2 TFIIE small subunit involved in RNA
                     polymerase II transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496527.1"
                     /db_xref="GeneID:8203775"
                     /db_xref="GOA:C5DUX5"
                     /db_xref="InterPro:IPR003166"
                     /db_xref="InterPro:IPR016656"
                     /db_xref="UniProtKB/TrEMBL:C5DUX5"
                     /translation="MSSNNDHLLANLNAFKSKVKSSPVLPNKTASPGPNTTNQTPSPK
                     KRPGSQTDGGAKKRLDTRIKEEDIDEDEDDSDDGSSNKKVRPGSIAAAALQASQSDIS
                     KSHDSSKLLWATEYIQKKGKPVQLNELMDYLSIRKDDKILELLKKLDKIGYDPKKATF
                     KYISTYDVHSAQELLNLLRSQVTFKGISCKELKDGWPQCDETINELEEDSKILVLRTK
                     KDRTPRYVWYNNGPELDRIGEDFVLMWENVQLPQFAELPRKLQDLGLKPASVDPATVK
                     RQTTRVEVKKKRQRRGKITNTHMAGVLKDYSQGV"
     gene            complement(<174250..>175293)
                     /locus_tag="ZYRO0D02222g"
                     /db_xref="GeneID:8203776"
     mRNA            complement(<174250..>175293)
                     /locus_tag="ZYRO0D02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496483.1"
                     /db_xref="GeneID:8203776"
     CDS             complement(174250..175293)
                     /locus_tag="ZYRO0D02222g"
                     /note="similar to uniprot|P47007 Saccharomyces cerevisiae
                     YJL147C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496528.1"
                     /db_xref="GeneID:8203776"
                     /db_xref="UniProtKB/TrEMBL:C5DUX6"
                     /translation="MKRAFSNLSSRLLKSESDELKATIQFLTRASKRPSLTSLLDAES
                     GQNHVERVLKVLNSTLPEVDSQKKRVQTHYDILFSQLKDIARQSSQKPLQNGLESSEK
                     LYNYLLLQQYMGKLQTVPQMARIVLSKTFQDFDKLWENLTMFDAKQQLHLSVLLYYRC
                     GNPIIRQQFEDQWLDKYGEMHISVQRLLWKCLTRECQTSAELEHVVQISRQSIRSWSA
                     HDEVVLYQSIYTKCHLLPTPGESLTKNQELFIATLRILARHNVHKRDMLKIVKLSIEN
                     RLANETSEETSVISIYQYRFIRALDLAVQDVYSSCEGKKNANELQNELQQVLASVNDE
                     EQEVKSQMSLKFI"
     gene            <175646..>176908
                     /locus_tag="ZYRO0D02244g"
                     /db_xref="GeneID:8203777"
     mRNA            <175646..>176908
                     /locus_tag="ZYRO0D02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496484.1"
                     /db_xref="GeneID:8203777"
     CDS             175646..176908
                     /locus_tag="ZYRO0D02244g"
                     /note="weakly similar to uniprot|P46958 Saccharomyces
                     cerevisiae YJL146W IDS2 Protein involved in modulation of
                     Ime2p activity during meiosis appears to act indirectly to
                     promote Ime2p-mediated late meiotic functions found in
                     growing cells and degraded during sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496529.1"
                     /db_xref="GeneID:8203777"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DUX7"
                     /translation="MSKDTGFLEDSTGDLARALRRSWSEPQDSKTPYQDSPISTPQCN
                     QYHNVSPGGGSFTSAGSQVASLTGSSDKTHRGSLGDGSPDYHLIERHYSLMEQPNVGN
                     KSTGSGSGGSIDDGMLEQAMQESLPPLMPAPVAMPLRRGSIQEVQRVRHLLNPRSSFS
                     GAPPEEPELQEGCSVSWVTILANSSPEYVEPILVLQESLKSVNSKFGLCVIHNSEVDS
                     SMIREKGIETVAFDKAKLPELFKKSINPHSILMVFMALAGKYDLVCYLSPTCMVLENI
                     DDLLGSEEIGNEIDNETCVLLTNSTPDPQIIILRPLVDVEMCIREFFTVYGDDCDEKS
                     SKLTRMRDYDVLETLFQDSWSRLATDEYCETLPEKPSPSEKSFPHKMVDFELQKPWIM
                     HEKQDMGPLASRWHRLWLQTSRRQANDM"
     gene            <177098..>177982
                     /locus_tag="ZYRO0D02266g"
                     /db_xref="GeneID:8203778"
     mRNA            <177098..>177982
                     /locus_tag="ZYRO0D02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496485.1"
                     /db_xref="GeneID:8203778"
     CDS             177098..177982
                     /locus_tag="ZYRO0D02266g"
                     /note="similar to uniprot|P47008 Saccharomyces cerevisiae
                     YJL145W SFH5 putative phosphatidylinositol transfer
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496530.1"
                     /db_xref="GeneID:8203778"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:C5DUX8"
                     /translation="MAELKFENANERKVFEEVFEELPQLIKTKCKGYDELYGYKLNFK
                     DEDQQVVKKYYDEEIAKHLIFKICKAFQFNKDQVTQRIVDVLNWRREFNPLSAAFLET
                     HNPELEEVGVITQYPEESPNKRVVTWNLYGQLVKRKELFKDADKFIRYRIGLMEKGLR
                     LLQFQSDDNNYMTQVHDYKGVSVFRMDGNIKKCTKQVISIFQQYYPELLWAKYFVNVP
                     AVFSWVYGVVKQFVDEQTMSKFVVLSDGKKLSQYLKSAPSDYGGKQQGLKEQNIQNVR
                     PTEYGLYLLEKQNNEDID"
     gene            complement(<178064..>179176)
                     /locus_tag="ZYRO0D02288g"
                     /db_xref="GeneID:8203779"
     mRNA            complement(<178064..>179176)
                     /locus_tag="ZYRO0D02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496486.1"
                     /db_xref="GeneID:8203779"
     CDS             complement(178064..179176)
                     /locus_tag="ZYRO0D02288g"
                     /note="highly similar to uniprot|P32451 Saccharomyces
                     cerevisiae YGR286C BIO2 Biotin synthase catalyzes the
                     conversion of dethiobiotin to biotin which is the last
                     step of the biotin biosynthesis pathway complements E.
                     coli bioB mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496531.1"
                     /db_xref="GeneID:8203779"
                     /db_xref="GOA:C5DUX9"
                     /db_xref="InterPro:IPR002684"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR010722"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR024177"
                     /db_xref="UniProtKB/TrEMBL:C5DUX9"
                     /translation="MSCLKVLRGFSTSVRQWRAATIDTLEYALSLQEPQHHWTKEQLA
                     TIYHTPLLELVHQAQRQHRKWQDANKVQLCTLMNIKEGGCSEDCKYCSQSTRHDTGVQ
                     ASKMVKYDDVIKEAQEAKRNGSTRFCMGAAWRDMQGRKSALGRISQMVSAVNEMGMET
                     CVTLGMLDELQARQLKKAGLTAYNHNVDTSREHYSKIISTRSYDDRLKTIKNVQDSGI
                     KACCGGILGLGETEEDHIGFLHTLANMTPHPESLPINRLVPISGTAIMEDLNKPDAKK
                     LKFDEILRTIATARIVMPQSIIRLAAGRYTMKDNEQFLCFLAGCNSIFTGKRMLTTMC
                     NGWDEDKALLEKWGLEPMEAFQYDALEQRRKDQKEI"
     gene            complement(<179325..>180254)
                     /locus_tag="ZYRO0D02310g"
                     /db_xref="GeneID:8203780"
     mRNA            complement(<179325..>180254)
                     /locus_tag="ZYRO0D02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496487.1"
                     /db_xref="GeneID:8203780"
     CDS             complement(179325..180254)
                     /locus_tag="ZYRO0D02310g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496532.1"
                     /db_xref="GeneID:8203780"
                     /db_xref="UniProtKB/TrEMBL:C5DUY0"
                     /translation="MLHIITHLLLCTVATAWPIGRKQQLPQQTAPYARIQTLQGRIID
                     SDSSQLVKSLYEHVLTFNAAPSGTLHQSLDDLSQAIELNLATAAILNTTSSSVATLEY
                     FTRLQIAAQEINSHSLFVKNRFSPSYWALEVPFQFTFKSTIAYRCWQLNNLQNHAIHN
                     YNGSLLLQETFDKVRDITILLEASVYMLSQLKTLGFQQLYQTCQPILTNFFQPLLQKP
                     LSQENLHSLQDQLNSLAENDLSRHRYSELALASFLVILLASSTISLIPLMCKQHSDRL
                     MLTRCILYLVGMTWFHMMVFFLYFCKLRRDFEM"
     gene            <180577..>183222
                     /locus_tag="ZYRO0D02332g"
                     /db_xref="GeneID:8203781"
     mRNA            <180577..>183222
                     /locus_tag="ZYRO0D02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496488.1"
                     /db_xref="GeneID:8203781"
     CDS             180577..183222
                     /locus_tag="ZYRO0D02332g"
                     /note="similar to uniprot|P40480 Saccharomyces cerevisiae
                     YIL112W HOS4 Subunit of the Set3 complex which is a
                     meiotic-specific repressor of sporulation specific genes
                     that contains deacetylase activity potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496533.1"
                     /db_xref="GeneID:8203781"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DUY1"
                     /translation="MSDPSETKKRSLSSYLSNVSSRREELEKIKRQQLEEHQRQEQEL
                     EKVRQEQLREKKLKEVKLEEEHLKEQSKENQSREGQTEDQTKEQPEGQPEEQPEGQPE
                     EQPEEQPEEQPEGQLEEQTEKQIEEQPEGQPKDQTEKQIEEQAEAQVDVKDPQVKKEE
                     KRTISRVELHSILKAPEYGSHEDEDEEMDSDAPTEPASPPKPRRGKLVRGDRLTSLSP
                     RQVSFDNGSDSELSDIDELESVNISSSVLHGDSSPTKRHSSPRKAYKPSRQHRKGIYR
                     DAGGRTRLQIACDKGNLEIAKRLIEEDGYDVNDQDNAGNTALHEAALNGHLDIVKLLV
                     NHGADVNVQSYEMFKDTALIDASANGHLPVVQFLLERGADPLVCNAKGLTAYDSIDEE
                     ADLDDEERDIVRQIQECLRDATRKALDHTASTKDPSPTQPRHSDDDYEFYWTDISSRA
                     GREKLLKASKEGKLAYVGAYLENGGKIDVKSFFEAVKFGHEDITSLYLAFGAPVNVSL
                     KDGTTSLMAAVGRGHQGTVKLLLDADADPTKKDKMGHNALYYAKNSLMGIIDSDEVQL
                     LKDALQKRGVEVEENSKKRNLEEVETEPKEQEEEPEPKKQELEPEEPRETPAEREARL
                     KAEEEYFQRRMKNKKKKEQELLKKLALDEQKREEEKEKQRLQELEKMEADKRKRQLEL
                     EENQRQLELQRRKDIRSMYPLGLKLVDFKKTDDLESFLPLYYVSMNNQRYVLDLQACV
                     LLKDSSVLDSNAQAVEPLHREQLWNILKFIFLQGGTENMLSLDAMSLDERMGFERQEF
                     GKFSQLPLHWIPYESIVHKLGSKEQKVRENMVEIVLVDARDVNEARGHRVCPSPIGLN
                     GLPFKFQYRNEILESINLHNAGPLW"
     gene            <183629..>184150
                     /locus_tag="ZYRO0D02354g"
                     /db_xref="GeneID:8203782"
     mRNA            join(<183629,183702..>184150)
                     /locus_tag="ZYRO0D02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496489.1"
                     /db_xref="GeneID:8203782"
     CDS             join(183629,183702..184150)
                     /locus_tag="ZYRO0D02354g"
                     /note="highly similar to uniprot|P00424 Saccharomyces
                     cerevisiae YNL052W COX5A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496534.1"
                     /db_xref="GeneID:8203782"
                     /db_xref="GOA:C5DUY2"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:C5DUY2"
                     /translation="MLRNFSSVTRVTPARFAHTAALSKASIVDLPNRWEAMPAPEQHE
                     IVSKLTERQKLSWAQLSETEKQAAWYISYGEWGPRRPVHGKGDASYIAKGVLVGMVAS
                     VGLFALLRMGAGDPPKTMNKSWQIKSDEYLKSKNANPWGGYSQVQSK"
     gene            <184428..>185423
                     /locus_tag="ZYRO0D02376g"
                     /db_xref="GeneID:8203783"
     mRNA            <184428..>185423
                     /locus_tag="ZYRO0D02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496490.1"
                     /db_xref="GeneID:8203783"
     CDS             184428..185423
                     /locus_tag="ZYRO0D02376g"
                     /note="similar to uniprot|P40481 Saccharomyces cerevisiae
                     YIL110W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496535.1"
                     /db_xref="GeneID:8203783"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DUY3"
                     /translation="MFAFGFEDEDIGGTEPSQNAVNPLDSPHLKDSLPPEWESLDSLV
                     KSLINVRLSFEKFSTLDGNTLFRRALFDIKHQLMVEDDDSQLDILTSEDLRKNVYEGG
                     LKSWECSIDLVDQLSKTNIDENCVLELGCGTALPSLYVFGQRLLHGNGNLKLILSDYN
                     KSVIRLVTLPNLIITWSQLVLTDNQRCQLQKSDQNVVADELLLTPQLLQAFQEDLSTR
                     NIDIQFISGSWGRQFINLVQQHLPPSSSLLNLTSETIYQPENLPVVAETLLQLHQGYL
                     AKSLVAAKDIYFGVGGSIVEFENYLNKCIKSQQLNINFNTLKVNAGLKRSIVYIH"
     gene            <185496..>186653
                     /locus_tag="ZYRO0D02398g"
                     /db_xref="GeneID:8203784"
     mRNA            <185496..>186653
                     /locus_tag="ZYRO0D02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496491.1"
                     /db_xref="GeneID:8203784"
     CDS             185496..186653
                     /locus_tag="ZYRO0D02398g"
                     /note="similar to uniprot|P53951 Saccharomyces cerevisiae
                     YNL051W COG5 Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p) a cytosolic tethering
                     complex that functions in protein trafficking to mediate
                     fusion of transport vesicles to Golgi compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496536.1"
                     /db_xref="GeneID:8203784"
                     /db_xref="GOA:C5DUY4"
                     /db_xref="InterPro:IPR019465"
                     /db_xref="UniProtKB/TrEMBL:C5DUY4"
                     /translation="MSEDLEDFEVFLENEFNAQRFGNDLIKATNTDDSTAELDIDTPI
                     KKINYDIGEIDTRIEKLINDNPLQILDQISRTKASRTTVRDGLKPSLDYLDMSYKRLQ
                     EVLEPYEKAQKLQNVLSKVHQTSILLRDALIYIHLVNSIKVINESNQQLNSQMALELA
                     SLHSQLESGINQSANLKSLRLIKKFDIDVVGPSSKELLNYLSTELNRVCSDTNNLNAN
                     RENVVVLLKALHSFSLQEFANTVHRIVLSHVQASVQALIKTINFVKNFPPAMEIAVKR
                     GYTISFVQSLLRDIKSDNTNFLNEYTSQMKPKPLTPREFYWKQVATSFKKDLDISYKR
                     GGPVGKALQRSREFIEQTIRKTMVNSTDNADYEADMQTMLNSVSVLSTEMH"
     gene            complement(<186684..>187472)
                     /locus_tag="ZYRO0D02420g"
                     /db_xref="GeneID:8203785"
     mRNA            complement(join(<186684..187398,187456..>187472))
                     /locus_tag="ZYRO0D02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496492.1"
                     /db_xref="GeneID:8203785"
     CDS             complement(join(186684..187398,187456..187472))
                     /locus_tag="ZYRO0D02420g"
                     /note="similar to uniprot|P53952 Saccharomyces cerevisiae
                     YNL050C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496537.1"
                     /db_xref="GeneID:8203785"
                     /db_xref="InterPro:IPR018555"
                     /db_xref="UniProtKB/TrEMBL:C5DUY5"
                     /translation="MSDFKVVSRKNLYDSDASDESLPNDNDQQEVYEPPNSFEIVEVD
                     VKKDQDPNDKTESQLQEEFDFPLFSFGNTNESAAGDDEVQEDRGRSEVPLMRISLREP
                     SPDRIVQERPRSYYFAEYTQDDHAKFQQSAIGFDDILKESQLGAHKGWPQFRGRVLDV
                     SENNARIEQLNIRERHCKRRRPGKQQRLARRQGATNVKQREEKEKEIKKMIKKKFHKR
                     GGKKNKKPEFNPLKDAAAKPKFRTE"
     gene            complement(<187845..>190631)
                     /locus_tag="ZYRO0D02442g"
                     /db_xref="GeneID:8203786"
     mRNA            complement(<187845..>190631)
                     /locus_tag="ZYRO0D02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496493.1"
                     /db_xref="GeneID:8203786"
     CDS             complement(187845..190631)
                     /locus_tag="ZYRO0D02442g"
                     /note="similar to uniprot|P40482 Saccharomyces cerevisiae
                     YIL109C SEC24 The Sec23p-Sec24p complex is one of three
                     cytoplamic COPII factors involved in ER to Golgi transport
                     vesicle coat component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496538.1"
                     /db_xref="GeneID:8203786"
                     /db_xref="GOA:C5DUY6"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DUY6"
                     /translation="MSHHKKRVYPAAQMQGYASNGFQQPALVNDGTSGYGAPMGYPAA
                     GQVPMAAGVPPVVGAGAPVAQPQLFTPVQQQLNQQIDQTTAAMGNVQLHNVPIVDPNS
                     YYQAPAQGVSSPYMPAAGAGVPLTPAPAGVATAAAAGVPVRGGKPMNQLYPIDLLTEL
                     PPPIHDLSLPPPPLMVPPEKMLVPSEWSNASPDYIRSTLNAVPKSSSLLKKSKLPFAL
                     VIRPYQHLQDHINPPPLNEDGVVVRCRRCRAYMSPFVTFIDQGRRWRCCFCRLANDVP
                     MQFDQTMAGVPANRYDRNEVKYAVMEYLAPKEYTMRQPPPSTYSFILDVSQNAIKSGL
                     LATATRTIAEMLDSIPNHDSRTRISILCVDNNIHYFSIPPDEDSDQVTMMDVADLDEP
                     FFPRPNSMVVPLKSCRNNLEKVLNLIPEVFQFNIMSKFALGPALKSAYNLIGGIGGKI
                     IVVSSTLPNIGVGKLQKRNESSSVNTAKESAQLLSCQDAFYKSFTIDCSKVQITVDTF
                     LASEDYMDVATLANLGRYTGGQTHFYPGFSATKLTDVTKFTKEFSKHLSMDLSLETVM
                     RARGTTGVRSNTFYGHFFNRSSDLCAFSTMPRDQSYVFEMSIDDSIIGDYACIQIGIL
                     LSLNTGQRRIRVITMCIPTTESLSDVYASVDQLALTAYHTEKAVEKALSSSLQDSREY
                     LNKAVQDVLAVYKKEIVVSNTAGGAPLRLCANMRMFPLLMHSLAQHMALRPGIVPSDH
                     RAAALNNLESMPLKYLVKNIYATVYSLHDMPDDVGFPDENGQLILPEPINASASLFER
                     YGLYLIDNGSELFLWIGGDAVNELIMDVFGTQDIFQVPIGKQELPIVEGSEFNERVRN
                     IIAKVREHDDIISYQSLYIVRGASLSEPVNHISAREVATLRLWATSTLVEDKVLNSES
                     YREFLQSMKMRISK"
     gene            <191069..>193165
                     /locus_tag="ZYRO0D02464g"
                     /db_xref="GeneID:8203787"
     mRNA            <191069..>193165
                     /locus_tag="ZYRO0D02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496494.1"
                     /db_xref="GeneID:8203787"
     CDS             191069..193165
                     /locus_tag="ZYRO0D02464g"
                     /note="similar to uniprot|P40483 Saccharomyces cerevisiae
                     YIL108W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496539.1"
                     /db_xref="GeneID:8203787"
                     /db_xref="InterPro:IPR001229"
                     /db_xref="InterPro:IPR021917"
                     /db_xref="UniProtKB/TrEMBL:C5DUY7"
                     /translation="MLGSPEIEFFNVQDHNQLYTPCLIIHGKVHKGQGVKNIQVKHPQ
                     LPNLTYPVNEHHFKATVILTPGENRFTFVTDTNVNRHLILDYSPLLQDQPVHLCLLVA
                     KDSPLQYDTPEVQRQREGSNEMDLAIRKLRVGARLMQAYTNEQMLRNGFGNRTFNFVE
                     EYGWDTTFSQREAMRNTVKIHVLRADETVSQIRDYNLAQQNPNGSDTGGLFPLAMRAL
                     KKYGGPFTQSEKPVQAAVMFMDAHWDGQMLTGHAALGGGDDQVKLAIFGSHGLYSWAP
                     SMEQLVPYMIDDTRASPDVANDNGECGTHWECYQITLGAFMHEIGHLLGCPHQENGVM
                     LRDYTVLNRSFLTKEAFSVRTNSYGAKPPILPREECTWHRLDLLRFLYHPSFTLPQDY
                     YDPSFMRPGRIGNFTAAKPAIYPLGHESCNISCETGIYCIEVYCGDLAKAHIEYLPKS
                     LGGPGPQRQVVLSLNDLRSRIPPNELGNHGDNFTVKILSVNASELEIHDFPSVIRAEP
                     IAMDRYGFPNGTRGIKSPVLGDPKRGSDVGIIPFDGSKVSAVRVYYGAALDGIRIFFN
                     TGSSAASGSTQGSGGQPPIPPRTYMNKLTNAFKSTSINDTSGESVLFGKETGSYGDVV
                     IPDGDSLAGFNVRCGAWIDAVQVLTTQGRVSESFGNNQGGGLAKLCPPSGQKILGFYG
                     AVGQWVDAVGIVYGAA"
     gene            complement(<193370..>195751)
                     /locus_tag="ZYRO0D02486g"
                     /db_xref="GeneID:8203788"
     mRNA            complement(<193370..>195751)
                     /locus_tag="ZYRO0D02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496495.1"
                     /db_xref="GeneID:8203788"
     CDS             complement(193370..195751)
                     /locus_tag="ZYRO0D02486g"
                     /note="similar to uniprot|P40433 Saccharomyces cerevisiae
                     YIL107C PFK26 6-phosphofructo-2-kinase inhibited by
                     phosphoenolpyruvate and sn-glycerol 3-phosphate has
                     negligible fructose-2 6-bisphosphatase activity
                     transcriptional regulation involves protein kinase A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496540.1"
                     /db_xref="GeneID:8203788"
                     /db_xref="GOA:C5DUY8"
                     /db_xref="InterPro:IPR003094"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR013079"
                     /db_xref="InterPro:IPR016260"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DUY8"
                     /translation="MFKSVEYFKTDKDAPPELEVEPKAELKSKNAGNNKSNREDEEDE
                     DEARDKVQDLHKLPQFQKRPLSDTPVTSGWNSPTDAVTPLTSPEPSCTNLVSLNIPAL
                     HVNSRITTNSTSDNNNINNNINNNNNNNNNNNNNNNNNNPRTAIHQRRIDGTDSPSKF
                     PHPTRRPTTIDVPGLTKSKSSPDGTISKEDPGSKLVIVMVGLPATGKSFITNKLSRYL
                     NFSMYYCKVFNVGNTRRQFAKEHGLNEQDSNFFSPENEKYSKLRDKWALDTLDQLLDY
                     LLDGPGSVAVFDATNTKKKRRREVLQRIRQRSAHLKVLFLESICSDEKVVERNIQLKL
                     FGPDYKGKDPTSSLKDFKERLSNYLRAYEPIDDDEGLQFVKMIDVGKKVIAYEIQGFL
                     ASQTVYYLLNFNLSERQIWITRNGESEDNVRGRIGGNSHLTPRGEKYARALAKFIDQQ
                     RLIFNEKFLRAQQENNKATSSTAQCNEFFVWTSMRDRSVETSSYFDEVDYPMKQMRML
                     DELSAGDFEGMAYPEINEIHPEELEKRHKDKLRYRYPGIGGESYMDVTNRLRPVIAEI
                     ERIEDNVLIITHRVVARILLGYFLNLNKDIITNVDVPLHCVYCLEMKPYGIEWKLFEY
                     HEENDNFSEVPKSEMNITKVQENELVFQERRYSLVPTAPPSASHPGSDGKNSDKTGVT
                     RSSSFTAPADSETFSGYAANVAPSHGAMPCVVEGSGGNSVCGNRTRPTAPNNTVRSSL
                     LANHDADCNPRPATTGTVARNRSNSGHTFEIDKLSEKLSQLRANLNDKEKSND"
     gene            <196633..>197565
                     /locus_tag="ZYRO0D02508g"
                     /db_xref="GeneID:8203789"
     mRNA            <196633..>197565
                     /locus_tag="ZYRO0D02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496496.1"
                     /db_xref="GeneID:8203789"
     CDS             196633..197565
                     /locus_tag="ZYRO0D02508g"
                     /note="highly similar to uniprot|P40484 Saccharomyces
                     cerevisiae YIL106W MOB1 Mps One Binder (putative)
                     transcriptional regulator involved in mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496541.1"
                     /db_xref="GeneID:8203789"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:C5DUY9"
                     /translation="MSFLQNFHLSPGQTIRSTRGFKWNTTANHGDALPSPQKDRPLSN
                     VPINGEVADPWSTPTKTPRYSQQPPSGLDNLATLQEFRTQQGHQHGADGNVTDFNYTP
                     SHQKPFLQPTEGTTVTSHQDLKQIVEMTLGSEGVLNQAVKLPRGENENEWLAVHCVDF
                     YNQINMLYGTITEFCSPQSCPRMIATNEYEYLWAFHKGQPPVAVSAPKYVECLMRWCQ
                     DQFDDETIFPAKTSGQFPSNFISKYVVQMLRRLFRVYAHMYCHHFNEILELNLQTVLN
                     TSFRHFCLFAQEFELLKPADFGPLLELVIELRDR"
     gene            <197755..>199485
                     /locus_tag="ZYRO0D02530g"
                     /db_xref="GeneID:8203790"
     mRNA            <197755..>199485
                     /locus_tag="ZYRO0D02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496497.1"
                     /db_xref="GeneID:8203790"
     CDS             197755..199485
                     /locus_tag="ZYRO0D02530g"
                     /note="similar to uniprot|P53954 Saccharomyces cerevisiae
                     YNL048W ALG11 Alpha-1 2-mannosyltransferase catalyzes
                     addition of the terminal alpha 1 2-Man to the
                     Man5GlcNAc2-PP-dolichol intermediate during
                     asparagine-linked glycosylation in the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496542.1"
                     /db_xref="GeneID:8203790"
                     /db_xref="GOA:C5DUZ0"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ0"
                     /translation="MIELSSLAIILATTSIILIGLTRGLIIILPDLFLKPPARYRVRI
                     NNVMKKVEVEPRKNVQMDFGWKHGSVRRQMILAAAKPCEYGNGPTSNNQISIGVSDKL
                     QREQFINSLVPQLRSSPRTLYGFFHPYCNAGGGGEKVLWKAVQSTLARNHGNVALIYT
                     GDTDATPQEILHSVSKRFDYELDKDRIVFIYLKKRRFVDSKMWPHFTLLGQALGSALL
                     TAEALYKCPPDVWCDTMGYPFGYGVVHYLTNIPIITYTHYPVISTDMLNKLKLSQGSK
                     LIKTVKYCYWSLFMMCYRYVGSFVTTAVTNSTWTNNHIKKIWSTKTPRIIYPPCSTEK
                     LVLKHDNWERKNQVVVIAQFRPEKRHELIIGSFAQFIATLNNKFDAPVLILIGSTRSQ
                     EDRDYVRQLSSWAHDELSIPKELLKFHTDCPYEQIKKYLSESTYGINAMWNEHFGIAV
                     VEYVASGLIPLVHASAGPLLDIVVPWDVEHRCQVKHNTTETRTGFFFKDQSDPDYDEL
                     LDAKKYPTLSELFVTVINLTAKEKKDISKRGRECVLHKFSDFKFHQDWSLVLEQLESR
                     SSVISNKKRK"
     gene            complement(<199643..>201754)
                     /locus_tag="ZYRO0D02552g"
                     /db_xref="GeneID:8203791"
     mRNA            complement(<199643..>201754)
                     /locus_tag="ZYRO0D02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496498.1"
                     /db_xref="GeneID:8203791"
     CDS             complement(199643..201754)
                     /locus_tag="ZYRO0D02552g"
                     /note="similar to uniprot|P40485 Saccharomyces cerevisiae
                     YIL105C SLM1 Phosphoinositide PI4 5P(2) binding protein
                     forms a complex with Slm2p acts downstream of Mss4p in a
                     pathway regulating actin cytoskeleton organization in
                     response to stress phosphorylated by the Tor2p-containing
                     complex TORC2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496543.1"
                     /db_xref="GeneID:8203791"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ1"
                     /translation="MSNHNKLRNISDVTSQQNSNLQQFQNLHTISTSSSNRSQVQEQE
                     EDGEEEEGEEQEEDGEGDELQQSETAVPQQPLHDSSLTERLSGSDSPKQHLQEPVVLT
                     SGTLQPSPAMQKQNSLDHHHNYHQQQVQAPYLNNEYVNGNGARASPSSSQLPKLSTSF
                     SRTPKSGSGSAGGSVGGSSAIMTPRRSKKSDPRNPLVVLMPASAQPTEVLASRFSAWR
                     SVIRSIITYLTETASIQDEIVRQQLRLTHAVQFPFFVAEGQKPNSNEEKTAQNFFMPA
                     GSGSIQELPSILNQYHGTVASHASRMSKELTNDVIPRLEDLRRDLLVKIKEIKALQSD
                     FKNSCFKELQQTKVDMKHYLEAIEEAHHGAPKHDPYLAKIVLDRQIRKQLSEENFVHE
                     AFDNLESSGSELENVVVMEIQNSLTIYARLIGEESQLVFDILLSRLDGGFLSRNPEFE
                     WSNFIKRDPNFIAPNLPMRKLKEISYKYQYDPLSYEIRSGVLERRSKFLKSYSKGYYV
                     LTPNFLHEFKTSDRKKDQVPMMSLPLGECTVTEHSKPGSSDDKFVLHAKQNGIIHRGH
                     NWVFRTDNFDSMMSWFEDLKVLTSLNGLKEKNRFIQDRLNLTSDGRPKEMLMATSPST
                     GLPRNSTDRSLRGHISGSTSGYSGPPLQNDLNGNPSAPRLDNQTNTTTNSSLPDTNKL
                     DISSDSMGNVYASSLENETKT"
     gene            <202822..>204741
                     /locus_tag="ZYRO0D02574g"
                     /db_xref="GeneID:8203792"
     mRNA            <202822..>204741
                     /locus_tag="ZYRO0D02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496499.1"
                     /db_xref="GeneID:8203792"
     CDS             202822..204741
                     /locus_tag="ZYRO0D02574g"
                     /note="similar to uniprot|Q10740 Saccharomyces cerevisiae
                     YNL045W Similar to human LTA4 hydrolase but in vivo
                     substrates not yet defined."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496544.1"
                     /db_xref="GeneID:8203792"
                     /db_xref="GOA:C5DUZ2"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR012777"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR015211"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ2"
                     /translation="MLSRSTKNLVRKMTLPSLVESRRPKTSPDIDPSTLSNYQQFQIQ
                     KTTLNLEVSFDQRIINGSVLYQLRSLQAQEEATNRLCLDTSYLQIHNVTLGGSKNLQW
                     ELKPRQEPLGSQLVLEYSKDKNEEHSLQIDFSTTERCTALQWLSGKQTSGKPYVFSQL
                     EAIHARSLFPCFDTPSVKSVITANIASRYPVVFSGRIAADPSDGQNGNKIYHFEQPVP
                     IPFYLIGIASGDLESAPIGPRSSVYTEPFRLKDAQWEFDGDVEKFIQAAEKIVFPYEW
                     GTYDVLINVDSYPYGGMESPNMTFATPTLIAHDKSNIDVIAHELAHSWSGNLVTNCSW
                     NHFWLNEGWTVYLERRIVGALHGEPARHLSALIGWNDLSESINAMSDPERFSKLLQDL
                     GTKGDPDEAFSSVPYEKGFNLLFHLENKLGGPENFDPFVKHYFQKFAKQSLDTYQFLD
                     TLYEFYQDKREILDSVDWETWLYKPGMPPKPKFDTSLADDVYELAGKWFKAAQSGDYN
                     GFTPDDLNKVSTVQLVLFLDTLVQSENSVDWSKHADAARHLLEIYHEKVVNSQNAEIV
                     FRKFRFQVESRIEGSYKELAQWLGTVGRMKFVRPGFRLLNKVDRPLALETFQELKDTY
                     HPICKALVKQDLGLS"
     gene            <204882..>205503
                     /locus_tag="ZYRO0D02596g"
                     /db_xref="GeneID:8203793"
     mRNA            join(<204882..204905,204997..>205503)
                     /locus_tag="ZYRO0D02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496500.1"
                     /db_xref="GeneID:8203793"
     CDS             join(204882..204905,204997..205503)
                     /locus_tag="ZYRO0D02596g"
                     /note="similar to uniprot|P53633 Saccharomyces cerevisiae
                     YNL044W YIP3 Interacts with YPT proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496545.1"
                     /db_xref="GeneID:8203793"
                     /db_xref="InterPro:IPR004895"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ3"
                     /translation="MNQLGALGQFSRFTENLSSERIKGEFQNLQSKLSTVRPPQEFFN
                     VKNFSKPQNFAELQSRVSYNVKYYQSNYGIIIGALSVYSLLTNLLLLFVISLVVLGVA
                     GISRLRGEDWVTPVGTFKVNQLYTALTCVAVPLGFLASPFTTILWLVGASAVTVIGHA
                     SFMEKPIQVVFEEETV"
     gene            <206320..>207561
                     /locus_tag="ZYRO0D02618g"
                     /db_xref="GeneID:8203794"
     mRNA            <206320..>207561
                     /locus_tag="ZYRO0D02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496501.1"
                     /db_xref="GeneID:8203794"
     CDS             206320..207561
                     /locus_tag="ZYRO0D02618g"
                     /note="weakly similar to uniprot|P53958 Saccharomyces
                     cerevisiae YNL042W BOP3 Protein of unknown function
                     potential Cdc28p substrate overproduction suppresses a
                     pam1 slv3 double null mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496546.1"
                     /db_xref="GeneID:8203794"
                     /db_xref="InterPro:IPR021216"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ4"
                     /translation="MNTLGMTDNDSGENYYNENGSNDVQTSILEIVYGTKVHLQGLNE
                     DAVVRALEFKVEQERTKQQFYRLENIAKSIELFKLASEMGVPANHIASIFANDNNPSP
                     PLAEQLQQQLRQGQQEEQREQSPRSQSRPPVSYKFPPAGSNLPPKPMSFPSLNVNRAH
                     SPAKIGANAVAVLNENVALKEEIDNRVTPCRRNDEFDNDYDSSNDNSHHSHSSRSSNN
                     EPENNTNINTSTGGNKVFQRNFSVPGSKYSSPQIPIGATPIINLNRAEKSNQRLKQQE
                     SLQRSQQQQQQQLPPLQLQQQQGNSGSWKKLGMVGKKHRRTKSGSSFGVIDLNILESS
                     KQPQETPKPNQQQQQQQQQQGPQSQQNTSQQPPQAPGISRSPNLNSHDEKTCSENSSR
                     NPSPVRNTREVNSVAKLLNSS"
     gene            complement(<207572..>209041)
                     /locus_tag="ZYRO0D02640g"
                     /db_xref="GeneID:8203795"
     mRNA            complement(<207572..>209041)
                     /locus_tag="ZYRO0D02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496502.1"
                     /db_xref="GeneID:8203795"
     CDS             complement(207572..209041)
                     /locus_tag="ZYRO0D02640g"
                     /note="similar to uniprot|P40486 Saccharomyces cerevisiae
                     YIL104C SHQ1 Essential nuclear protein required for
                     accumulation of box H/ACA snoRNAs and for rRNA processing
                     interacts with Naf1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496547.1"
                     /db_xref="GeneID:8203795"
                     /db_xref="InterPro:IPR007009"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ5"
                     /translation="MITPKFRITQDDDFVHIKVNVSSLRFNAAGLEMVVEENVFVFHL
                     SPYYLRLRFPHNLVDDENSTARYESKDESIDIKLPKEVKGQFFEDLDVPTKLLARQGD
                     ILGASNVESASEAPQKGPLIQEVGGDDNNSGDHRIESLEEQGEAFNWEIEQKPAETTD
                     GILKTKYGFDNFYDTIISVSLANGNDINELDDPEHTGSNDRVKERLEKEKLKFDAEYY
                     VSEYMVYKYGSPEELEINGIKEVLQNTPPVVKQYLKWYKSTEEKNSTMPIEFSDKEQT
                     QMQNNIPRKEYLIQDSKTPYVTVLNILFGYIFEQIENDGIHNTESAWTIGRLVPQISF
                     LDQQLLLEEDLGTVSIIKAAVITGTRRSLCYPLHRNFELILRAWNFVYYLLRGGHRLI
                     ARCILDVHEVFRFHDVYYVYNKILLDDLCSWFLSKGNENVIRSLAVELKKEIDAISKD
                     QIEFDCLAGIDETTGEPTWENLTLKEMELIAEQQYRESQ"
     gene            <209265..>210548
                     /locus_tag="ZYRO0D02662g"
                     /db_xref="GeneID:8203796"
     mRNA            <209265..>210548
                     /locus_tag="ZYRO0D02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496503.1"
                     /db_xref="GeneID:8203796"
     CDS             209265..210548
                     /locus_tag="ZYRO0D02662g"
                     /note="highly similar to uniprot|P40487 Saccharomyces
                     cerevisiae YIL103W DPH1 Protein required along with Dph2p
                     Kti11p Jjj3p and Dph5p for synthesis of diphthamide which
                     is a modified histidine residue of translation elongation
                     factor 2 (Eft1p or Eft2p) may act in a complex with Dph2p
                     and Kti11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496548.1"
                     /db_xref="GeneID:8203796"
                     /db_xref="GOA:C5DUZ6"
                     /db_xref="InterPro:IPR002728"
                     /db_xref="InterPro:IPR016435"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ6"
                     /translation="MSTEKPAVPKRRFVGARKIVGNKESVVTKDVSAVTHKPRSKVSV
                     GRAINHIPDEIMNDKELNEAIKVLPSNYNFEIHKTVWNIKKHNAKRVALQMPEGLLIY
                     SLVISDILEQFCGVQTVVMGDVSYGACCIDDYTARALECDFIVHYAHSCLVPIDVTKI
                     KVLYIFVTINIEEQHIMRTLQKNFPKGSRLATFGTIQFNPTIHSLKDKLLNDEDHMLY
                     LIPPQIKPLSKGEVLGCTSERLNKEQIDAMVYIGDGRFHLESAMIHNPDIPAYRYDPY
                     SRKFTREYYEQKELVKLRSDAVEAASKGKTFGLILGALGRQGNLATVQNLEKSLTAAG
                     KTVVKIILSEIFPQKLSMFENVDVFVQVACPRLSIDWGYAFNKPLLTPYEANVMLQRD
                     IGFNQDYYPMDYYEVNGYGRGKIPAHAIHKEQDVQ"
     gene            complement(<210609..>213128)
                     /locus_tag="ZYRO0D02684g"
                     /db_xref="GeneID:8203797"
     mRNA            complement(<210609..>213128)
                     /locus_tag="ZYRO0D02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496504.1"
                     /db_xref="GeneID:8203797"
     CDS             complement(210609..213128)
                     /locus_tag="ZYRO0D02684g"
                     /note="similar to uniprot|P53959 Saccharomyces cerevisiae
                     YNL041C COG6 Component of the conserved oligomeric Golgi
                     complex (Cog1p through Cog8p) a cytosolic tethering
                     complex that functions in protein trafficking to mediate
                     fusion of transport vesicles to Golgi compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496549.1"
                     /db_xref="GeneID:8203797"
                     /db_xref="GOA:C5DUZ7"
                     /db_xref="InterPro:IPR010490"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ7"
                     /translation="MDFLEYHALAALDAPNETSQELPEPSSTLNLSSFPTSGTEEDAF
                     KLPDLIGGTSSNNNSNNNNNNNNINNKDEENRNLYDKMTHYANLSMKKLNIDDARVPT
                     IPTIPTREASSSQFVEPTRAKLSLPDNLNNRNKPTDATDVVLSKKLSKVLNDYSLSNY
                     QSRSQLRKSLQSLERNRDKLNIDEKRLINPGYLGILERKSLRSDLENELLKDHLTVLE
                     EFRPIVRRINRWSNSVNNIKETGQQLVEETEADQSNEDDSVTDRVNQLRADAKSLELK
                     KQLLIALRDQFTLNQLEDDIIANGEVDLEFFKIVDKALQIKERATYLLALPSSRAGSS
                     LISQTNQTLSFVNKKVFNHLVDFLHNYESNSQLLGERSFDPDDKNFILFQKSLIYLSN
                     DLEHFNEFLKRVTSVRSKSVLDEFLSQFDFNPKDSKPILLSAQDPLRYIGDVLANIHS
                     SIANEADFVKSLFKFQLDDSAITVPQFNKEYLQGLDEKLLNETVQSLANSCRIRVEQI
                     VNFEEDPVVNLEIARLLNLYQLMFERKGIRRNSALISNLHKLECSARGKIPEYYVKFL
                     KELASLPVEPSDDLLPPDWLSEYIGKIVDLFEVYQQANTEESHKVIDLAFLQKVVENP
                     IKDILIKRIQTAFPLAKKNETSRFSSLTMQINCFDLIKTRFQPFTTTVFAQDDQVSSI
                     FQMIENRLNSLVSQLLELQQKLLFENTGMGLYYNLFNMIFPVTSVQDELDYDMYLSLC
                     ENPLMDLSTIEKNVHEKLNTYIPQALTDVQENMLFKLASPTIADYICETCFSTLSLFY
                     VTFRKVLMHLYPEQKESVQRFLNFSEQEFNTLVGIDQGNSE"
     gene            213294..213366
                     /locus_tag="ZYRO0D02706r"
                     /db_xref="GeneID:8203798"
     tRNA            213294..213366
                     /locus_tag="ZYRO0D02706r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8203798"
     gene            complement(<214075..>215586)
                     /locus_tag="ZYRO0D02728g"
                     /db_xref="GeneID:8203799"
     mRNA            complement(join(<214075..215102,215343..>215586))
                     /locus_tag="ZYRO0D02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496505.1"
                     /db_xref="GeneID:8203799"
     CDS             complement(join(214075..215102,215343..215586))
                     /locus_tag="ZYRO0D02728g"
                     /note="weakly similar to uniprot|P40489 Saccharomyces
                     cerevisiae YIL101C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496550.1"
                     /db_xref="GeneID:8203799"
                     /db_xref="GOA:C5DUZ8"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ8"
                     /translation="MYPIHRFDVNSVTLSKSPLDDYQRLYFGTLLSYSQERQPNVDIK
                     SVSYKSNVAELFRQGKGNTLDCYEYSLPDVRNGMQQNDVMRGLSSLPRIGENQRNAAE
                     MCREELEFITTKAFYDGHSLERRRRRHSSGGELDQNTNKQGGPAAYSDLHWNGISRDL
                     KRQLVETYRNHLIHSGVPFAEASKVSLSDVMQRIRGGYIKIQGTWLPLDMAKLICTWF
                     CFPIRYLLVPIFGPDFPQLCENARNHGFKRNDFEMVHPLQNLFEQPKTRSMSWTPGMT
                     QREPTVAGNSSERYPERLPPISTIIDSITVDNYGYDRREPTVQTLSNLASFYNTHGHR
                     YSYPGVHATQRQWRRPSWEDVRRPSMESTRSSGSIGWEHEFTYAPEKTSPRITDGAIT
                     DRFNERRPIPNDWRRPDQRNSREWRAQEGGS"
     gene            complement(<216145..>216759)
                     /locus_tag="ZYRO0D02750g"
                     /db_xref="GeneID:8203800"
     mRNA            complement(<216145..>216759)
                     /locus_tag="ZYRO0D02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496506.1"
                     /db_xref="GeneID:8203800"
     CDS             complement(216145..216759)
                     /locus_tag="ZYRO0D02750g"
                     /note="similar to uniprot|P53615 Saccharomyces cerevisiae
                     YNL036W NCE103 Carbonic anhydrase poorly transcribed under
                     aerobic conditions and at an undetectable level under
                     anaerobic conditions involved in non-classical protein
                     export pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496551.1"
                     /db_xref="GeneID:8203800"
                     /db_xref="GOA:C5DUZ9"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="InterPro:IPR015892"
                     /db_xref="UniProtKB/TrEMBL:C5DUZ9"
                     /translation="MFTLSHESQLTDLLQANQDWTKATRQEHPDLFPTNGRGQQPHTL
                     FIACSDSRVNENCLGVLPGEVFTWRSVANICKPDDLTTLSTLEFAVDCLHVNKIVLCG
                     HTDCGGVATCINGKLNDLHENNCNHLAHYLQELEDTRVSYQDEIAASQDPYRLLTIRN
                     AQRQYVNVKSNPTVQRALKEGRLQVHAVLYNVGTGLLEKLDSTE"
     gene            <218061..>219920
                     /locus_tag="ZYRO0D02772g"
                     /db_xref="GeneID:8203801"
     mRNA            <218061..>219920
                     /locus_tag="ZYRO0D02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496507.1"
                     /db_xref="GeneID:8203801"
     CDS             218061..219920
                     /locus_tag="ZYRO0D02772g"
                     /note="similar to uniprot|P08019 Saccharomyces cerevisiae
                     YIL099W SGA1 Intracellular sporulation-specific
                     glucoamylase involved in glycogen degradation induced
                     during starvation of a/a diploids late in sporulation but
                     dispensable for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496552.1"
                     /db_xref="GeneID:8203801"
                     /db_xref="GOA:C5DV00"
                     /db_xref="InterPro:IPR000165"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR011613"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="UniProtKB/TrEMBL:C5DV00"
                     /translation="MVSKEKRSKDSDSKMIEKKRSNSRGLGKLPLPLPLPLIAFVLFV
                     CATYKYILPLKVEMVGWPSQFSPPFNETNRIIIQDFFKPYDPSYPTSLPTTTYYRRIN
                     LRPLSAHRISRANFTLWLEEQTSISFEKILENIGDSDINDLYQQNVAEGAVIASPSKD
                     KPDYFFQWPRDAAITVNTVISNLMGSDNAINLTLAKTIVKYLNNSAILQRIPNPSGEG
                     VGGTDPQLKGLGEPKFEVDNKAFEGNWGRPQNDGAPLRLIATFHFLEKLAKQKIPLSQ
                     LLSNLKIDGLSFHDEDSLFENLIRYDLEFVLNNWKVDSFDLWEEVKGRHFFTSLVQLS
                     ATKLGIDFMKSNPDRQKDPLLKELQRTSTELNDFLTLEGGFLNPHKNYIVETPSSLNS
                     RSGLDTAVLIASLLTHADDGETSPYNLPFGVNDSGILNTLHALTSIMAIIYPVNHQRY
                     SPRMGVALGRYPEDVYDGVNTSEGNPWFLCTSTAAQLLYQLIHKIYAEESDLEIPVNT
                     WESKFWTSIFEGFEAYPSSLFIGGNNGSDGAFRLVIPYNSPAFHQTMASLLDYGDSFL
                     DKLREHVSDNGSMSEQFNKYTGIMQGARDLTWSHGALWSSSHFREQVLPLLSN"
     gene            complement(<219994..>220467)
                     /locus_tag="ZYRO0D02794g"
                     /db_xref="GeneID:8203802"
     mRNA            complement(<219994..>220467)
                     /locus_tag="ZYRO0D02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496508.1"
                     /db_xref="GeneID:8203802"
     CDS             complement(219994..220467)
                     /locus_tag="ZYRO0D02794g"
                     /note="similar to uniprot|P40491 Saccharomyces cerevisiae
                     YIL098C FMC1 Mitochondrial matrix protein required for
                     assembly or stability at high temperature of the F1 sector
                     of mitochondrial F1F0 ATP synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496553.1"
                     /db_xref="GeneID:8203802"
                     /db_xref="UniProtKB/TrEMBL:C5DV01"
                     /translation="MKPELQTYKSLIKAFVRADRTARIAQRAAERKQQLALLTYRRMN
                     IAREQAKKDIDPSTRMKLIKDMATLNKRVEILKQKAPENDKKLLFVQDTSFLRDQILS
                     AQDDRHIQHLEDIAAFVDNQREYDELIERYNPGARMSQEEKVKRTANKVGFQMPS"
     gene            <221712..>222743
                     /locus_tag="ZYRO0D02816g"
                     /db_xref="GeneID:8203803"
     mRNA            <221712..>222743
                     /locus_tag="ZYRO0D02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496509.1"
                     /db_xref="GeneID:8203803"
     CDS             221712..222743
                     /locus_tag="ZYRO0D02816g"
                     /note="similar to uniprot|Q02895 Saccharomyces cerevisiae
                     YPL088W Putative aryl alcohol dehydrogenase transcription
                     is activated by paralogous transcription factors Yrm1p and
                     Yrr1p along with genes involved in multidrug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496554.1"
                     /db_xref="GeneID:8203803"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DV02"
                     /translation="MPEVAPQVKFGNTGLKISPILVGCMSYGSKSWSEWVVEDKQRIF
                     SILKHCYDRGLRTFDTADVYSNGMSERLVGEFLRHYNINRETVVILTKVYFPVDESIQ
                     LTHSNIASTDNGLTLANQRGLSRKHIIAGVKGSVERLGTYIDVLQLHRLDHDTPMEEI
                     MRALNDVVTQGDARYIGASSMLATEFAELQFIAEKHDWVKFVSSQSCYNLLYREDERE
                     LYPFAHRHNIALIPWSPLARGALSRPLGANTQRGSTDKGFQRFGFAELEAHEQEIVKR
                     VEKVAKDKGISMATLGTAWVLSKGCYPIGGFSSEERVDEALKALDVKLTDEEIKYLEE
                     PYKPRPLAV"
     gene            <223132..>224217
                     /locus_tag="ZYRO0D02838g"
                     /db_xref="GeneID:8203804"
     mRNA            <223132..>224217
                     /locus_tag="ZYRO0D02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496510.1"
                     /db_xref="GeneID:8203804"
     CDS             223132..224217
                     /locus_tag="ZYRO0D02838g"
                     /note="similar to uniprot|P28834 Saccharomyces cerevisiae
                     YNL037C IDH1 Subunit of mitochondrial NAD()-dependent
                     isocitrate dehydrogenase which catalyzes the oxidation of
                     isocitrate to alpha-ketoglutarate in the TCA cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496555.1"
                     /db_xref="GeneID:8203804"
                     /db_xref="GOA:C5DV03"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C5DV03"
                     /translation="MFRHSLTKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVT
                     DSVVSIFKAENVPVDWDRVDISGVDRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGH
                     GSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVV
                     ESLKIMTQDNIERIARFAFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEY
                     PELQVGNIIVDNASMQTVANPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGANYGR
                     DVALFEPGSRHVGLDIKGQNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEG
                     KSVTRDIGGTASTTEFTEAVINKLATL"
     gene            <224474..>225991
                     /locus_tag="ZYRO0D02860g"
                     /db_xref="GeneID:8203805"
     mRNA            <224474..>225991
                     /locus_tag="ZYRO0D02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496511.1"
                     /db_xref="GeneID:8203805"
     CDS             224474..225991
                     /locus_tag="ZYRO0D02860g"
                     /note="similar to uniprot|P40492 Saccharomyces cerevisiae
                     YIL097W FYV10 Protein of unknown function required for
                     survival upon exposure to K1 killer toxin involved in
                     proteasome-dependent catabolite inactivation of fructose-1
                     6-bisphosphatase contains CTLH domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496556.1"
                     /db_xref="GeneID:8203805"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:C5DV04"
                     /translation="MGSLFNEPSTDFHLKLNEQLFQIPHELLRENVRLVQKLIDKETQ
                     GLNEDFQEMNALLAENELDQDKVALTKLGEIIKRVDSFEKKLNKRLNEDLQLLNRIRT
                     RVSFFQDLEDAKTLGDHSKLTQWYQDYTNLLIGDYLIRNSKIRGKELSEGKYGGDEDD
                     DERNWNPGVMFLRQQHLEQLIDYDILLAANRISKSLTEEHDLSPLIEWIGENKNFLKR
                     NCSILEFEVRLQEYVEFLKNGQYKNAIECFQCFLLQFMETNFADLKLASGLLVFIKSC
                     EPPSPPSTDGIIDPQIIAGDEFAKDGNLVLKSKADVHRHFFHRKAFKSADTPTMSNAF
                     KFNNLTKNMDFARYTDLLDAKRWTAISELFLKEYYSMYGISHLDPLLMYLSLGISTLK
                     TKECLHEREFSSSDFHKLDGFIHQGVLRNTCPVCSSEFAPIAKDLPYAHHTQSKLFEN
                     PIMLPNGNIYDMKKLKTLAATLLRENLYPLKDNEVLDPIDKQVFSETDFVTMYPT"
     gene            complement(<226065..>227000)
                     /locus_tag="ZYRO0D02882g"
                     /db_xref="GeneID:8203806"
     mRNA            complement(<226065..>227000)
                     /locus_tag="ZYRO0D02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496512.1"
                     /db_xref="GeneID:8203806"
     CDS             complement(226065..227000)
                     /locus_tag="ZYRO0D02882g"
                     /note="similar to uniprot|P40493 Saccharomyces cerevisiae
                     YIL096C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496557.1"
                     /db_xref="GeneID:8203806"
                     /db_xref="InterPro:IPR019446"
                     /db_xref="UniProtKB/TrEMBL:C5DV05"
                     /translation="MAKKSKGKGLRTPLQKHQNAAKLRNMEKQKDKKTQKNQAVKRNQ
                     ESQKNHSTPFIPFGPNETLLLVGEGDFSFARSIIEQNYIMPENLVVTSYDDSMEDLNA
                     KYPHSFDENYKYLASEGVRMFFGVDGTDLIKSFKLSKKTTWTKILGGSWNGKYLDNVM
                     FNFPHTGKGVKDQERNVRDHQNLVLGFFKSCKELFQAINSKWLKSRLQYGDTESLQLS
                     EEGWGKIILTLFAGEPYDSWRIKVLAKENQFQLQRSNRFQWEIFPGYHHKRTNSEQDT
                     TKPAEERESRIYVFEKQGIVKKPSKRSRDSDDDDD"
     gene            complement(<227284..>227790)
                     /locus_tag="ZYRO0D02904g"
                     /db_xref="GeneID:8203807"
     mRNA            complement(<227284..>227790)
                     /locus_tag="ZYRO0D02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496513.1"
                     /db_xref="GeneID:8203807"
     CDS             complement(227284..227790)
                     /locus_tag="ZYRO0D02904g"
                     /note="similar to uniprot|P53961 Saccharomyces cerevisiae
                     YNL038W GPI15 Protein involved in the synthesis of
                     N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI) the
                     first intermediate in the synthesis of
                     glycosylphosphatidylinositol (GPI) anchors homologous to
                     the human PIG-H protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496558.1"
                     /db_xref="GeneID:8203807"
                     /db_xref="GOA:C5DV06"
                     /db_xref="InterPro:IPR019328"
                     /db_xref="UniProtKB/TrEMBL:C5DV06"
                     /translation="MKSQVSVIKDQRYSLSIEKDDRETFVKFTVIPSSYALKSVVNFL
                     LLIVLNSIAMKTCHDKLELPFYKAVMLRLAIFVVTSMFLRKPTIESMTVIRNYGVEVT
                     KENGLVVCPNSWIQPWIQRSDFLARDLIVDVIINEGFVKNQQVIFYLAILVREAKRLT
                     LLFSVCAL"
     gene            complement(<227979..>229688)
                     /locus_tag="ZYRO0D02926g"
                     /db_xref="GeneID:8203808"
     mRNA            complement(<227979..>229688)
                     /locus_tag="ZYRO0D02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496514.1"
                     /db_xref="GeneID:8203808"
     CDS             complement(227979..229688)
                     /locus_tag="ZYRO0D02926g"
                     /note="weakly similar to uniprot|P46678 Saccharomyces
                     cerevisiae YNL039W BDP1 Essential subunit of RNA
                     polymerase III transcription factor (TFIIIB) which is
                     involved in transcription of genes encoding tRNAs 5S rRNA
                     U6 snRNA and other small RNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496559.1"
                     /db_xref="GeneID:8203808"
                     /db_xref="GOA:C5DV07"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017174"
                     /db_xref="UniProtKB/TrEMBL:C5DV07"
                     /translation="MSSVVNKSGTRFAPKLKPRSVPAVANKAKPAPPIPNPPKPTNSD
                     DTAVADENDEDDDGDEDESGEDDEFDESRENSPDKGALPDNESTQVSTSSASKSSAPL
                     QTSTQLSIPSSASQRRRSSRLDSLSNASNGRPLFKPNFEDSSDEGRLSTISKNAPKKV
                     RATTIPEKDAALQALKRRRMSVRSVATKKPGSAKRIGIVSKIDTPDSDVHTATAISDP
                     GQKKESSVELFQRTDSLYEKYTIRSLKEIPKDIQDTDSERYMIDEQEFTMAELCKPKL
                     PIGTPSENFERAKLAGMIKFEKRKSRRELRKRAREEFKSLKSLNREVEEKELEDRKEA
                     REKLLHTEVPEFSQSQSALQLKMGQDGKMILDEDSTVVDRHRNATFENRQKERVDENP
                     FENLYNSSTYGRNVYTDPWTTEELIKLYKSLSMWGTDFNLIAQLFPYRTRKQIKAKFI
                     NEERKHPVIVELALRSRLPADFDQYCLDTKKEIGTVVEFNEKLEQIKIRHEEEMKEIE
                     AAKANAKEEDSKNVKTVGVVGKKSSGGFRTEELKAYRKTEVVLGTIDDVRRKKEEEVA
                     EEA"
     gene            <230654..>231133
                     /locus_tag="ZYRO0D02948g"
                     /db_xref="GeneID:8203809"
     mRNA            <230654..>231133
                     /locus_tag="ZYRO0D02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496515.1"
                     /db_xref="GeneID:8203809"
     CDS             230654..231133
                     /locus_tag="ZYRO0D02948g"
                     /note="highly similar to uniprot|P39515 Saccharomyces
                     cerevisiae YJL143W TIM17 Mitochondrial inner membrane
                     protein involved in protein import 16.5 kDa inner membrane
                     protein required for import of mitochondrial precursor
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496560.1"
                     /db_xref="GeneID:8203809"
                     /db_xref="GOA:C5DV08"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005678"
                     /db_xref="UniProtKB/TrEMBL:C5DV08"
                     /translation="MSADHSRDPCPIVILNDFGGAFAMGAIGGCVWHGIKGFRNSPMG
                     ERRIGAMSALKARAPVVGGNFGVWGGLFSTFDCAVKAVRKREDPWNAIIGGFFTGGAL
                     AIRGGWKHTRNSAITCACLLGVIEGVGLMFQRYAAWQAKPMAPPLPEASPQPQPLQA"
     gene            complement(<231363..>233669)
                     /locus_tag="ZYRO0D02970g"
                     /db_xref="GeneID:8203810"
     mRNA            complement(<231363..>233669)
                     /locus_tag="ZYRO0D02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496516.1"
                     /db_xref="GeneID:8203810"
     CDS             complement(231363..233669)
                     /locus_tag="ZYRO0D02970g"
                     /note="similar to uniprot|P14680 Saccharomyces cerevisiae
                     YJL141C YAK1 Serine-threonine protein kinase that is part
                     of a glucose-sensing system involved in growth control in
                     response to glucose availability translocates from the
                     cytoplasm to the nucleus and phosphorylates Pop2p in
                     response to a glucose signal"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496561.1"
                     /db_xref="GeneID:8203810"
                     /db_xref="GOA:C5DV09"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DV09"
                     /translation="MWNPLYLSSEDQEQLKKQQQQQGLQQRLHQMERRQSQSQRAQHQ
                     QHSQQHQQPQQQVQFTFTNPWGNNEDLDPYYSSSAGASSTGLDTSETNPLLAAEYGGD
                     GFDTYRRKSSLVIPPARAPNPNPFEYDDRNAYAGVYDPQRQNQIRNMLLAQQQQQLAG
                     ARFVPSSFYGAGGDLHRRQSVAAVHYPPSGPTNLASLGAPTNFTPAAGAATNMTPYRR
                     LSCYPPSTSPTASLQPPYKQLRRDAGAQGAMVGAPSPQQVKIPQMQKCNSKSELKPTL
                     NATPKYRRASLNSKTISPVIALTKGLITTYSLCSPDFSYQTSKNPKRVLTKPNEGKYN
                     GGYDNINSDYILYVNDVLGTEQNRKYLVLDILGQGTFGQVVKCQNILTKKIVAVKVVK
                     SREEHLTQSITEARILDLLNTKVDPMNKHHILQMYDTFVHKNHLCLVFELLSNNLYEL
                     LKQNQFHGLSMRLIRTFTAQLLDALCVLKDSKLVHCDLKPENVLLCSPDRPDLKVIDF
                     GSSCEERRTIYTYIQSRFYRAPEVLFGIPYSTSIDMWSLGCIVAELFLGIPILPGVSE
                     FNQVSRIVECLGYPPVWMMDMGKNTSRFMKKDDTLEEGLSFADGDDGRLGSPTMKYRL
                     KTVDEYNQEYSSNEQPSKQYFKWTKMPDIIKNYRYSKKIKGNPELIEQEQRDRDCLIH
                     FLRGVLNINPLERWTPQLASMHPFVTQQPFTGEWYPPGTLQSTATSNSTNDSTIPPGM
                     NKNIGNIKHPSLQEGTAKEFDRLRIGED"
     gene            <234330..>234953
                     /locus_tag="ZYRO0D02992g"
                     /db_xref="GeneID:8203811"
     mRNA            <234330..>234953
                     /locus_tag="ZYRO0D02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496517.1"
                     /db_xref="GeneID:8203811"
     CDS             234330..234953
                     /locus_tag="ZYRO0D02992g"
                     /note="similar to uniprot|P20433 Saccharomyces cerevisiae
                     YJL140W RPB4 RNA polymerase II subunit B32 forms two
                     subunit dissociable complex with Rpb7p dispensable under
                     some environmental conditions involved in export of mRNA
                     to cytoplasm under stress conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496562.1"
                     /db_xref="GeneID:8203811"
                     /db_xref="GOA:C5DV10"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR006590"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:C5DV10"
                     /translation="MNTSTSTFQTRRKRLKKVEEEENAATLQLGREFQLIQINHDGGE
                     EELLALNLSEARLIIKEALFERRRSFRRAQRQHRGGPKSENEDGKSSEDENDEEIAHT
                     ETREKELESLDNLLEQTTGSNNKDLKNTMEYLTNFSRFRDQETVSAVIQLLKSTGLHP
                     FEVAQLGSLACDTADEAKTLIPSLNNKISDDDLERILKELSNLETVY"
     gene            complement(<235000..>236274)
                     /locus_tag="ZYRO0D03014g"
                     /db_xref="GeneID:8203812"
     mRNA            complement(<235000..>236274)
                     /locus_tag="ZYRO0D03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496518.1"
                     /db_xref="GeneID:8203812"
     CDS             complement(235000..236274)
                     /locus_tag="ZYRO0D03014g"
                     /note="similar to uniprot|P33550 Saccharomyces cerevisiae
                     YKR061W KTR2 Mannosyltransferase involved in N-linked
                     protein glycosylation member of the KRE2/MNT1
                     mannosyltransferase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496563.1"
                     /db_xref="GeneID:8203812"
                     /db_xref="GOA:C5DV11"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DV11"
                     /translation="MLRNQTRRPFVVIIFLLALFGLYLTYILSLVLLNCLEGSRIEKD
                     LFERSREVAEKYQSHRGRHFKKPLKLSSNSYDDEMNGFTFHKVPQRENATLLMLVRNW
                     ELNGALKSMRSLEDRFNRDYHYDWTFLNDEPFDDAFIEATTAMASGKTQYALVPPEHW
                     NRPNWIDEEEFERRLQLMEEKGVLYGGTRSYRNMCRFNSGYFFRQKVLEPYDYYFRVE
                     PDVEYYCDFPYDPFKVMRRNNKKYGFVIAIYEYEDTIPTLWDAVEEFIEDNKEIVDME
                     NNSYDFITDSEVVGTFTPIVDSNSDYNLCHFWSNFEIGDLNFFRSERYKKYFEYLDSK
                     GGFYYERWGDAPVHSIGVSLLLNRDEIIHFDELAYYHNPYYTCPASHNMRIQQRCQCN
                     PHEDGHVDIDPNSCLMRWWKNGAGKTFLKDDQ"
     gene            complement(<236594..>237355)
                     /locus_tag="ZYRO0D03036g"
                     /db_xref="GeneID:8203813"
     mRNA            complement(<236594..>237355)
                     /locus_tag="ZYRO0D03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496519.1"
                     /db_xref="GeneID:8203813"
     CDS             complement(236594..237355)
                     /locus_tag="ZYRO0D03036g"
                     /note="similar to uniprot|P36144 Saccharomyces cerevisiae
                     YKR060W UTP30 Possible U3 snoRNP protein involved in
                     maturation of pre-18S rRNA based on computational analysis
                     of large-scale protein-protein interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496564.1"
                     /db_xref="GeneID:8203813"
                     /db_xref="GOA:C5DV12"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:C5DV12"
                     /translation="MVKIDEELSNRALSSLLKHCSTDESLRNDKDVQVIINASKKIGI
                     KNDHTPRIIPLRESKLHRPKDLRILLITKDPSTTYRESLAKDETTTDLFKEILSIKNL
                     KRRFRGVKSIQLYKEFDLIVADFRVHHLLPDVLGSKFYHGTKKLPYVIRMTRPYDKSK
                     TSQDCDSAFVRAQLRSICKNTSYVPNSDNCLGVRIGRVGKHSTQEMVENIKDVVNFLT
                     DKSKRPQGGVIRDGISSMFVKTTNSPSLPIYGEQK"
     gene            complement(<237526..>238713)
                     /locus_tag="ZYRO0D03058g"
                     /db_xref="GeneID:8203814"
     mRNA            complement(<237526..>238713)
                     /locus_tag="ZYRO0D03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496520.1"
                     /db_xref="GeneID:8203814"
     CDS             complement(237526..238713)
                     /locus_tag="ZYRO0D03058g"
                     /note="highly similar to uniprot|P10081 Saccharomyces
                     cerevisiae YKR059W TIF1 translation initiation factor
                     eIF4A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496565.1"
                     /db_xref="GeneID:8203814"
                     /db_xref="GOA:C5DV13"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DV13"
                     /translation="MSEGITELEESQIQTNYDKVVYKFDDMNLKPELLRGVFGYGFEE
                     PSAIQQRAILPIIEAHDVLAQAQSGTGKTGTFSIAALQRIDVNVKAPQALMLAPTREL
                     ALQIQKVVIALAFHMDIKVHACIGGTSFQEDAEGLRDAQIVVGTPGRVFDNIQRRKFK
                     TDHIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVLLSATMPNDVLEVTTKFMRN
                     PVRILVKKDELTLEGIQQFYINVEEELYKYDCLTDLYDSISVTQAVIFCNTRRKVEEL
                     TQKLRADSFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQVSLVIN
                     YDLPTNKENYIHRIGRGGRFGRKGVAINFVTNEDVGAMRDLEKFYSTQIEELPANIAE
                     LFN"
     gene            complement(<239039..>240295)
                     /locus_tag="ZYRO0D03080g"
                     /db_xref="GeneID:8203815"
     mRNA            complement(<239039..>240295)
                     /locus_tag="ZYRO0D03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496521.1"
                     /db_xref="GeneID:8203815"
     CDS             complement(239039..240295)
                     /locus_tag="ZYRO0D03080g"
                     /note="weakly similar to uniprot|P47011 Saccharomyces
                     cerevisiae YJL137C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496566.1"
                     /db_xref="GeneID:8203815"
                     /db_xref="GOA:C5DV14"
                     /db_xref="InterPro:IPR002495"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DV14"
                     /translation="MSGQQLAIATLLYSAAYLPGVFTLGYQLKKLRGGKDVALLLLVS
                     RDLYRDVLTELSLDILRKLFTDIIIVDPIQGTAGNNENLKLLNRPELHFTLVKARLWE
                     LNYDRVLYLDGDTLPLSTDVFNLFENYPINQNQIAGAPDVGWPDMFNSGVLLLAPDKE
                     LAQSLQKFISDTVSMDGADQGVLNQFFNAHCSRGIENIEQRWIRLPFVYNVTMPNYGY
                     QSSPATKFFKKQIKLVHFIGENKPWKGWCGDEDSYSSQWNKVFLEFQSEYDLARYMKG
                     LKLETSSSAWLESMTQSQQEPERVFPDQRTQQPVHITPIAPITSFTPTAPSAPTASTT
                     SFTPTSPTISTTPTAPTTFTSPSTTLKKDRSIGIMSPEEPKPTPVSVERVFPEDSLEP
                     EERAFPYDLRDWRSRFFSTKNEKNNH"
     gene            complement(<240599..>240972)
                     /locus_tag="ZYRO0D03102g"
                     /db_xref="GeneID:8203816"
     mRNA            complement(join(<240599..240838,240949..>240972))
                     /locus_tag="ZYRO0D03102g"
                     /product="40S ribosomal protein S21"
                     /transcript_id="XM_002496522.1"
                     /db_xref="GeneID:8203816"
     CDS             complement(join(240599..240838,240949..240972))
                     /locus_tag="ZYRO0D03102g"
                     /note="highly similar to uniprot|P05760 Saccharomyces
                     cerevisiae YJL136C"
                     /codon_start=1
                     /product="40S ribosomal protein S21"
                     /protein_id="XP_002496567.1"
                     /db_xref="GeneID:8203816"
                     /db_xref="GOA:C5DV15"
                     /db_xref="InterPro:IPR001931"
                     /db_xref="InterPro:IPR018279"
                     /db_xref="UniProtKB/TrEMBL:C5DV15"
                     /translation="MENDKGQLVELYVPRKCSATNRIIKAKDHGSVQINIAKVDEEGR
                     AIPGEYITYALCGYVRARGEGDDSLNRLAQNDGLLKNVWSYSR"
     gene            complement(<241437..>243212)
                     /locus_tag="ZYRO0D03124g"
                     /db_xref="GeneID:8203817"
     mRNA            complement(<241437..>243212)
                     /locus_tag="ZYRO0D03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496523.1"
                     /db_xref="GeneID:8203817"
     CDS             complement(241437..243212)
                     /locus_tag="ZYRO0D03124g"
                     /note="similar to uniprot|P33753 Saccharomyces cerevisiae
                     YKR056W TRM2 tRNA methyltransferase 5-methylates the
                     uridine residue at position 54 of tRNAs and may also have
                     a role in tRNA stabilization or maturation previously
                     thought to be an endo-exonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496568.1"
                     /db_xref="GeneID:8203817"
                     /db_xref="GOA:C5DV16"
                     /db_xref="InterPro:IPR001566"
                     /db_xref="InterPro:IPR002792"
                     /db_xref="InterPro:IPR010280"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR025795"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DV16"
                     /translation="MIAWKSVIRPIKTVLRSRINSIGCYSILKSNMTTVADSTAEINN
                     NKRQLGNSAPNRKPKKPKLRRYKAKKADPTGPLGVLEFEIDELLQEHGLKREEVKNDV
                     SAILNDVPRLSGPMTRAYHRVVNNIKVLRNASNGEGMALIENPVETGKKQIALIPFGL
                     VGDVVNINVYKTHPYHVETDLLDVVEKSPMRKDELITCKYFGKCSGCQFQFLTYERQL
                     ELKRNTIVNAYRYFAPRLVVEKLVQEVGETIGSPLKLGYRTKLTPHFDMPRRKQLEDR
                     PPLGFGQKGKQKWRKDNLEIGGTGSILDIEECPIGTPAVNMGMSNERQKFDTDYQNYR
                     KGATILLRENTTILNGSEETREQLMDNGSKNEQGEISFVETEDKEKDIKLAKTCVTNT
                     RQVVREYVDGYTFKFSAGEFFQNNNSILPLVTKYVRENLQIPNSEPNAPNYLVDAYCG
                     SGLFSICSSKGVAKVTGVEISADSVSFAETNAKNNGVENCKFIVGKAEKLFESIDTPN
                     DRTSVILDPPRKGCDELFMRQLSEYYPARIVYISCNVHSQARDVEFFLKDTERGKDYK
                     IESLRGFDFFPQTHHVESVCVMSRV"
     gene            complement(<244206..>245039)
                     /locus_tag="ZYRO0D03146g"
                     /db_xref="GeneID:8203818"
     mRNA            complement(<244206..>245039)
                     /locus_tag="ZYRO0D03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496524.1"
                     /db_xref="GeneID:8203818"
     CDS             complement(244206..245039)
                     /locus_tag="ZYRO0D03146g"
                     /note="similar to uniprot|Q00246 Saccharomyces cerevisiae
                     YKR055W RHO4 Non-essential small GTPase of the Rho/Rac
                     subfamily of Ras-like proteins likely to be involved in
                     the establishment of cell polarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496569.1"
                     /db_xref="GeneID:8203818"
                     /db_xref="GOA:C5DV17"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DV17"
                     /translation="MSFDMANNDLFKPPLPQHGADCYSAISQDSIPVGGSSTALEGNA
                     TPAPFSRTLSSITSYEQVKRTNKMPDCHLKIVVVGDGAVGKTCLLISYVQRRFPTDYV
                     PTVFENYVTRIQGPQNKIIELALWDTAGQEEYSRLRPLSYSEVDILLVCYAANNPTSL
                     QNVDDLWFPEVTHFCPDVPIMLVGLKSDLYANDDTSNLVDPREAESLALKLGAFSHIQ
                     CSAKTRNNVELVFTTAMDTALHDTLYEPKDNSSGTKNPFKRKSTAGGKKAIRKHKCII
                     L"
     gene            <245353..>257490
                     /locus_tag="ZYRO0D03168g"
                     /db_xref="GeneID:8203819"
     mRNA            <245353..>257490
                     /locus_tag="ZYRO0D03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496525.1"
                     /db_xref="GeneID:8203819"
     CDS             245353..257490
                     /locus_tag="ZYRO0D03168g"
                     /note="similar to uniprot|P36022 Saccharomyces cerevisiae
                     YKR054C DYN1 Cytoplasmic heavy chain dynein microtubule
                     motor protein required for anaphase spindle elongation
                     involved in spindle assembly chromosome movement and
                     spindle orientation during cell division targeted to
                     microtubule tips by Pac1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496570.1"
                     /db_xref="GeneID:8203819"
                     /db_xref="GOA:C5DV18"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004273"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR013594"
                     /db_xref="InterPro:IPR013602"
                     /db_xref="InterPro:IPR024317"
                     /db_xref="InterPro:IPR024743"
                     /db_xref="InterPro:IPR026983"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DV18"
                     /translation="MAIDYLNVVNELVLYTSGVLQSIFGFSEARCGEIKVHLLDKFSN
                     ELELFLVGGEMKSYNTLFVTVLENQDVTLQVDIANLNQECAKFVILKNKEVIDYGNKP
                     LQDQLSVLTLPSHIDTDSLVSIMNNGVYPTFSALIDSNALACTAESVRITRAKFKDLT
                     TSFTTLKNSIPIPELIIHPEIKQIVENDTDIDSLLLEDLNFLNVLQSMANQWHRITRN
                     LVSLQRNPDEGAAIDEIKFWSNFESCLSGTLAQLLDKPVQKSLEVLAITKRSRGSSAF
                     IADTGIEEKLREVKGNNQYVSSIPLPELHSTTKLFELQESIKKIALSFKKFRSSDYPI
                     DRFIIFLQKVSKDVGNKILELIPNVFEIPYEKFQQLTNEINDVIDTWDHVLSDNNMQI
                     REVIRRKKIENVSFMSLDSSMNQLRDILSKIICFRLQHNKFKNTLENIGYEESAYDEE
                     FVYEPLKVFQINSEFHDEWRKVKSAYNQRLSSLENRLIEICEEKLNHSQNLKEKLTVF
                     LNFKPLMEYYPKLRSMMVNHQQILINLINEEVALIDEKLNWRANFEQVLQLRDLPPVA
                     SVATLSRITENHLQALSQQIEILIGPSWKDTPEGDSFLNKFDTILSKFNADNVSSEYL
                     NNILRNKTAALDVPILKVLYNGEKYELFVNFDFSLGTIFKEIRNLIYMGYDIPNDISK
                     IARKYRAFYPSAVLLLEQIQTFMSVMRELPKRPHTGIILKSQIDSIWTLLLEAMNTSW
                     ISMPKDITEGLKNDTFSSIIEKRLAKVLEDFAKLQRIEERLVYLFERLKKSQFEASTI
                     NGLITDFQVLINEMPLLGFDQDYVFTTSLNRSLKLMLLEKMKSFFRNLIFKNRTVLVR
                     FEENSVIFTPDSEELKFLWLKEIDELVISFIDLPQLTTSNAPRRNGILKKALRKQFAA
                     AYQQINHLHQQFLNYTTSWKESQRLWKLEESAVERFVGSDLNQCLQSLADLLHQRPSL
                     STFRPQNCFNGLLDFKYDEAFSKVLTKYNFWVSYLCNQLLSLYLKESTKFAEELRSQR
                     EHLEQNALDVSSLRNMSQLVREIDAVKERLRDREELLNSLKKSHNLFYVLHAELPPEF
                     LFIEQLEADLRALCECSTKKEAILSKNRDIIVRKLEFEAQRVENLQAAVLNSWSKEKP
                     VAVEWTPIDALSSIMVFEDSYNALKSDVQLISDSAKIMLVPIIIKDRLETFYEELVAL
                     KKVWMDLEVFWNDTHKLLRMPWEEIEVHTHIENFKLIQSSMKNVPFKTKQYTVFDNLL
                     STIDEVLGTEEILRILKDPSLKIRHWMYLFKKAGRGNLENSSTFSFESVLSIGLKSHE
                     TLIKELFQRAQKEYVLEKSLARMRSFWTSAQYRTFNHSSGLKLVGEWNSLIQACTEDL
                     EELQSMKNSIHYKYFETECLDLEEKLTVLSNLLTEWMEVQFFWIDLFGVIGKNKEMQN
                     LLSLESSKFQGLTADFKSLLTRIFSLNNAIDAVHVPEAMIILKRILESLKMIKSSLND
                     FLEQQRKLFPKFYFLGNDDLLKFIGAGEDLGKLVGFMPKMYGTIAGFDFKGTIIEGIY
                     SSEGEHVQLIRKINVSSIRCDEWLSKLDNEMKLTIAESVSTCLSSLKNGVQFSELLDS
                     YIFQTLLLSWQIFWTGAINESFNKANFPQVITSIERETAELIAELERRSKPIEKKKLR
                     SLLIECLHFMDVTHRLNKTSLQKARLIWFNTQKFFYDHNRDPLERISISLADRVDLYG
                     FAYIGIPERLVYTPTLQKGYIALSEALHQKYGGCFFGPAGTGKTETVKSLGQNLGRIV
                     VVFNCDDSYDFQSMARLMMGISQVGAWGCFDEFNRLDENIMSAVSSQVEVVQNALATG
                     KKEIDLMGTSATLNHTTALFITLNPDYAGRSRLPENLKKKFREFSIKKSDNDVIAGVI
                     LEILGFQKSKELSKKVVKLFNTLTERCSIQKHYDFGLRTLKKTLKNCFDLFNSSAENN
                     EELILVRSLCQVILPTLVKSDEEKFLNCIQEVFSCGRVTERNENFIEIFSHTCKEQNI
                     STTEEFIKKCLQIYNLQKNQQALIIAGEAGFGKTTTLKTVLKIVKVLENLENIVHTID
                     TKTLSKEEIYGSINRATLEWQDGIFTSIIRQVLNQNSQVENKIKFWVIFDSDMDPEYA
                     ETLNSALDDNKLITLPTGERLEIPTNLRIVFETHNLEQATPATITRCALVLFTERVCS
                     SFGNLKCLLESSFDNLEAQSKVNPSLLNRYRTLLREIFSEKNVNHLISQAGKIEHILG
                     YDHSRIFTTISKLISHDLQKYRSGLLNASDLAFEKFFYARIHQIIKVSFIGDTNLKDH
                     SNFIDSIRDLSKCINNLNMDSESTEFVPETLEPIDLLSSVPQLSLDAKDVMKPNVIIP
                     TIDTIKQELCVFELLNARRSVILCGPPGSGKTMILNNALQRSLNFQVVGLNFSKDTDI
                     SHILKTLNRHTYYTSGSRGLVLLPKNPTKDIVLFCDEINLPKLDAYGSQSTILFLREL
                     IEKNGFWKTNENKWVTMERIHVVGACNPSTDPGRIFMTQRFTRHVTVLQISYPSIPSL
                     KHIYRVFYDGILQLTPPFKRYSEGFAEGSIRLYEKCKYNFSGNSQTHYLISPRELTRW
                     MRGFYISVANSFKPTLESLLLMWAYEAWRIFADKLIYQSEKDVFEKILHDTIHEFFPG
                     KVSVDLNTSSLLFSYWLSLDYREVTKKELQDFVEQRFQTFCEEEVDTSFIIYDDMLAH
                     LLRIDRVLRQVQGHAMLIGPCRTGKTTMTRFVAWLNGVEIVQPNIHRGFNIFDFDEFL
                     RGVLLRCSIDDKRLCLLIDETDILEPSFLERMNTLLANSDVPDLFQNEDYETLMTSLK
                     NRIFSLGLLMDTEQEMYQWFIQQISKNLHVIFIMRDPYNGNVPSMATSPALFNRCAIN
                     WMGDWSNDIMYQIADVIIRPLPLDTISRNKASSNNEMQLLLSGKSSHDVLIDLFLDFH
                     GKCFQNKPNSSRSPGPFLDALKSFECSFERQYQELDDKQRFVRIGLDKLDESVLKVKD
                     MNKLLLEKQEELKDKEGEARKTLDKMLYEQNEAERKQEAVVEIKKILATRQEESNIRR
                     KRVMAELEAFAPIMNEAQRGVKNIKKQQLTEIRSMINPPSAVKITMEAVCAILGHRKS
                     SWREIQNFIRKDEFIFDIVHFDTETMFPPEIKSFVEAEYFSNPNFTYEVVNRASKACG
                     PLYQWVFAQLKYGEILSKAEPLKKEAQSVENEALKSKAKLLAAQDMINELQESIETSK
                     ENYSIIIRDIEMIKAKMRDVQNKLERSKTLISNLTSEKERWTRSTNSFKKASQELTGN
                     CLISALYSNYCGGLVEKQRKQLFEDMKSTLFEHAIDFDPNYQFVTHNVEIERRFEWTA
                     LGLPNEEFFLENFSMVITSTNVPYILDPSSQMIPILSRFYTKRFTLTSFLETGFVKKL
                     ENAIRFGGVILIQDAEYFDPIISKLIAREYRASGGRQTVQVGEHEIDIASEFRLLLYS
                     SDADAVIPNFVESRVRLINFSMNKGSVDMKAIRVALSKEVPEIDRERNELMKLNGEYK
                     IMLKSLESKLLEELNDSQGNILENDELIHTLEKLKQESFEIEKKLEETEDFMKKANEY
                     SHMYAPLGYHASTLYSILEYVSQLHWFYDISMWQFMECYESIFTTAKSNDGNRISSLV
                     WNLYQEVYSTFSQYLMKKHRAAFAVVMYLTYCFAHNDRKFQEKSLSILKCIAISQQLQ
                     DVDVIKDDCPESLFEIVQMMQNKSTKTVLQEFQKHFQEQFSLDKFLSHKSGRFVLMAS
                     EMDVDASFKVSQLADVQRENLSVIALGSSESSNYAEQEITRCNHEGGWILLQNLQMSL
                     TWTKSVLTKKLEQTTENVKVFMTCNLLGQDLPSPLLQQSYRSVHDGSPGILGTVRDLY
                     FDNAVSDCQWKLPLCWFHSILLNRSLLAPIGFTKRYDFNDRDFACALQFLADLPVDHD
                     ARSKICSVLGSIVYGGKVDQDDDQLIVQSICNQIFQDSPITENRNQTLSSKIINGILP
                     DSHDNDILSTFLMELQEPVDSYSVWLGLPNHAIREYESLQAQEVASQALSILVNHHH"
     gene            <257726..>258934
                     /locus_tag="ZYRO0D03190g"
                     /db_xref="GeneID:8203820"
     mRNA            <257726..>258934
                     /locus_tag="ZYRO0D03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496526.1"
                     /db_xref="GeneID:8203820"
     CDS             257726..258934
                     /locus_tag="ZYRO0D03190g"
                     /note="similar to uniprot|P47013 Saccharomyces cerevisiae
                     YJL134W LCB3 Long-chain base-1-phosphate phosphatase
                     regulates ceramide and long-chain base phosphates levels
                     involved in incorporation of exogenous long chain bases in
                     sphingolipids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496571.1"
                     /db_xref="GeneID:8203820"
                     /db_xref="GOA:C5DV19"
                     /db_xref="InterPro:IPR000326"
                     /db_xref="UniProtKB/TrEMBL:C5DV19"
                     /translation="MTAGKKSVLGLEPNDTLKRHPLKDPGNHGPEHFRGKMSHFRFAT
                     RQYLTRYTNSQSEYLAKWQSRYKTKWNSVYFATTALFAAHTFYIICLPTPAWAGAIDG
                     ISDMVYILAYSIYLSGFLKDFWCLPRPKSPPLHRITLSEYTTREYGAPSSHCANATAA
                     SLYLMWNVAGSNTSITNKAILFILIIAYYLTLAVGRIYCGMHGLLDVGSGILCGLICT
                     LGRAGANRLLSNFQCGDYWWFPILSITWGLTILLKHVRPIDECPCFSDSVAFVGVVSG
                     LEVTRWTWQRLGIDVTYGMSVEGAPGLFAGRLIVGGLIVVIWKYVLSKPLVYSFLIYV
                     LGMEDDRPIKEEERAKYADSIECPPFIGEAKIDIVGRYVIYGGIPPVVLFACPAAFKL
                     LKLLNVAESS"
     gene            <259753..>260658
                     /locus_tag="ZYRO0D03212g"
                     /db_xref="GeneID:8203821"
     mRNA            <259753..>260658
                     /locus_tag="ZYRO0D03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496527.1"
                     /db_xref="GeneID:8203821"
     CDS             259753..260658
                     /locus_tag="ZYRO0D03212g"
                     /note="similar to uniprot|P23500 Saccharomyces cerevisiae
                     YKR052C MRS4 Mitochondrial iron transporter of the
                     mitochondrial carrier family (MCF), very similar to and
                     functionally redundant with Mrs3p; functions under
                     low-iron conditions; may transport other cations in
                     addition to iron"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496572.1"
                     /db_xref="GeneID:8203821"
                     /db_xref="GOA:C5DV20"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DV20"
                     /translation="MNSPESIAAEEIDYESLPPDAPLYSQLMAGAFAGIMEHSVMFPI
                     DALKTRIQSATGSSSIGMLAQISKISTMEGSLALWKGVQSVILGAGPAHAVYFATYEF
                     TKSQLIDRRDYQTHQPLKTALSGTAATVAADFLMNPFDTIKQRMQLNTATPMHKVAKG
                     IYQKEGLAAFYYSYPTTIVMNIPFAAMNFVIYESSTKIFNPSNGYNPLVHCLCGGISG
                     AACAAITTPLDCIKTVLQVRGSESVSHEVLRKADTFTKATKAIYQLRGLKGFLRGLKP
                     RIIANMPATAISWTAYECAKHFLLG"
     gene            complement(<260954..>262231)
                     /locus_tag="ZYRO0D03234g"
                     /db_xref="GeneID:8203822"
     mRNA            complement(<260954..>262231)
                     /locus_tag="ZYRO0D03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496528.1"
                     /db_xref="GeneID:8203822"
     CDS             complement(260954..262231)
                     /locus_tag="ZYRO0D03234g"
                     /note="similar to uniprot|P36142 Saccharomyces cerevisiae
                     YKR051W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496573.1"
                     /db_xref="GeneID:8203822"
                     /db_xref="InterPro:IPR005178"
                     /db_xref="UniProtKB/TrEMBL:C5DV21"
                     /translation="MLEAVQLPWWWQELSEVSTVASLAITVYAITMHLLNYRKPYEQR
                     LVVRIQLIVPVFAFTSLVAIKSPEFCQIYLDPVREVYEAFVIYTFFSLLVLVLGGEHR
                     IITEICLTHRPSTHAIPFLGQYLGKIDLSYPEDFLMVKRGILQYVWFKPFYCIGNLLC
                     LIYDFPNLNFALVITYNISVTWSLYNLAVFWRCLYKDLRPFNPWGKFLCVKVVIFASY
                     WQSMVIMILDSRDILNGGSAGFVYQNGLLCVEMIVFAILHLITFPWNEYSPSMMPECG
                     RMNYIYAIRDCFGGRDLKWDFGQTMRGHSYYNCRNFDPTAESALIAKADADSRLRRIT
                     QGLRFENQGQGRHWIGYGSTDDNSSCSIRSERSERGRSPLREEPWDDSIATHKYLPTD
                     PNYPVSADLSTRHRNSRSMRDLRRDINSRASVI"
     gene            <262441..>264660
                     /locus_tag="ZYRO0D03256g"
                     /db_xref="GeneID:8203823"
     mRNA            <262441..>264660
                     /locus_tag="ZYRO0D03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496529.1"
                     /db_xref="GeneID:8203823"
     CDS             262441..264660
                     /locus_tag="ZYRO0D03256g"
                     /note="similar to uniprot|P47014 Saccharomyces cerevisiae
                     YJL132W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496574.1"
                     /db_xref="GeneID:8203823"
                     /db_xref="InterPro:IPR013519"
                     /db_xref="InterPro:IPR029002"
                     /db_xref="UniProtKB/TrEMBL:C5DV22"
                     /translation="MKFAGRCLTLTSLLVLILQNWQVYGAGVNVHLIYLARVTSELDR
                     KYEPWLKAGAFFPDAFYSCKPSKQWHDFAESTHWPQFLVNAVKLWHGKYNDNPQCEDS
                     MKLRSFLIGIFTHQIVDSSWHSLVNGYRSEGLLEVLAQTEFSGRTQEAHDFLDLMGDF
                     IGLGNIIRDINDNNWQFLTRTKWYLPKEEDMLDLVKCAGAESIEVDYEQLQDCVQRGF
                     VASVGEVLTVIENRDQVLNSAYQMSPRARDMIQEHWLGGEFNLVSLMQNCLPNLYRLM
                     NHIDEENALGELQLCGNLPPAYEIGTTSTTGVITMERRKNLIQITTNHHLSNLGTSLA
                     LGRFKNDHKLYLAMGAPLENGRGSVYLIRWDEVTMNLESDVEMYSNPTTVMIGAKIHL
                     YQLEDIDFLIISEPSSNNIYFYHDDVLVLRVNLPPETRANQLKVTEVYDIDSDGIPDL
                     ILSGWCYGKDQEGCIVIIPGRIIVPNLERGKAANDVSTLTAYPITVLEGGWWSQAYQH
                     FGSAVELSDSKFLYVACQSLGVVLVYSLAELNSRSLPKFILKGNEVKLANKRHLCRLK
                     VVSSQEHGMFGGVIISWTYQGKHFVGISQHTFSTIFIYQEVHGFIRLYLKVKLPVELY
                     SIPYSIGFGTDMKYSMDEEALYISSPGYFEGLGAIWKVPMVQIVKTAEFLGQRFFLVD
                     PRKHLVVSGIDINQKGLGNYGKNILLGPQGKLIIGVPQYNYGVLEGNNQLTGMVLVS"
     gene            complement(<264731..>265798)
                     /locus_tag="ZYRO0D03278g"
                     /db_xref="GeneID:8203824"
     mRNA            complement(<264731..>265798)
                     /locus_tag="ZYRO0D03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496530.1"
                     /db_xref="GeneID:8203824"
     CDS             complement(264731..265798)
                     /locus_tag="ZYRO0D03278g"
                     /note="similar to uniprot|P47015 Saccharomyces cerevisiae
                     YJL131C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496575.1"
                     /db_xref="GeneID:8203824"
                     /db_xref="GOA:C5DV23"
                     /db_xref="InterPro:IPR029427"
                     /translation="MLRLQLGKRIVRNAFSVVVIRGFCSSGPCRKDWMANNDILLNAT
                     AAMKRNKEKVQRGSLDSAHTNGSFRQVNMNQRSNHNKKPLKKPRSIVIKWSTGSDRAK
                     EAANSTVSSIFKMNFEGTVQRINSETNKVEETNIREFVKGINLDEVGLSIVDVSQINE
                     NTSIPLVKLVEARVALKRYSDEMAKQKEKELIEMGVIKKSTKSSEPDKVESTVKRLKI
                     SWEIKPDDLCKQKAHEIVTQLKKGFKVFVYIDSKNSSGSRNWLDCFENSIPQEIKLSK
                     REHEQRSFVVDKISEIVEEYSIQPNLDGTLGDKMIIKLAPKTLTGEKMDKKTLKEHKK
                     KERQEKLQKRIEKKNQRGTGL"
     gene            complement(<266204..>272869)
                     /locus_tag="ZYRO0D03300g"
                     /db_xref="GeneID:8203825"
     mRNA            complement(<266204..>272869)
                     /locus_tag="ZYRO0D03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496531.1"
                     /db_xref="GeneID:8203825"
     CDS             complement(266204..272869)
                     /locus_tag="ZYRO0D03300g"
                     /note="similar to uniprot|P07259 Saccharomyces cerevisiae
                     YJL130C URA2 Multifunctional carbamoylphosphate synthetase
                     (CPSase)-aspartate transcarbamylase (ATCase) that
                     catalyzes the two first reactions of the pyrimidine
                     pathway; carbamoyl-phophate synthetase, aspartate
                     transcarbamylase, and glutamine amidotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496576.1"
                     /db_xref="GeneID:8203825"
                     /db_xref="GOA:C5DV24"
                     /db_xref="InterPro:IPR002082"
                     /db_xref="InterPro:IPR002474"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005480"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005483"
                     /db_xref="InterPro:IPR006130"
                     /db_xref="InterPro:IPR006131"
                     /db_xref="InterPro:IPR006132"
                     /db_xref="InterPro:IPR006274"
                     /db_xref="InterPro:IPR006275"
                     /db_xref="InterPro:IPR011607"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DV24"
                     /translation="MSAIVPTAPITPPMSSTGDRLAVLELKDGNTLVGYSFGGSKPAA
                     GELVFQTGMVGYPESITDPSYEGQILVITYPLVGNYGISDADLKDELLEQLPRYFESN
                     RIHVAGLVIAHYTEEFSHWLAKSSLGDWLKRENVPAVYGVDTRALTKHLRESGSMLGR
                     LGLQIGEKPVDLNQPQWKDSFEVSSWVDPNVKNLVAEVSIKEPQLYVPPADKVDLQKG
                     PDGKVLRILAIDVGMKYNQIRCFIKRGVELKVVPWNYDFTKEQYDGLFVSNGPGDPSV
                     LHEVTSRLHAVLEAKKTPVFGICLGHQLLARANGFSTVKMKFGNRGQNIPCTSTVSGK
                     CYITSQNHGYAVDETSLTNGWKALFTNANDGSNEGIYHTELPYFSVQFHPESTPGPRD
                     TEFLFDTFIQAVKDHKTSGVLHPVKFPGGDIEENRKLHPKVEAKKVLVLGSGGLSIGQ
                     AGEFDYSGSQAIKALREEGIYTILINPNIATIQTSKGLADKVYFLPATAEFVRKVILH
                     ERPDAIYVTFGGQTALSVGIEMKDEFEALGVKVLGTPIDTIITTEDREMFSAAIDEID
                     EKCAKSRAASTLEEALQAGKEIGFPVIVRAAYALGGLGSGFADNEEELTDLCNIAFAS
                     SPQVLVERSMKGWKEIEYEVVRDAFDNCITVCNMENFDPLGIHTGDSIVVAPSQTLTD
                     EDYNMLRTTAVNVIRHLGVVGECNIQYALNPVSKEYCIIEVNARLSRSSALASKATGY
                     PLAYTAAKLGLNIPLNEVTNSVTKSTCACFEPSLDYCVVKMPRWDLKKFTRVSTQLSS
                     SMKSVGEVMSIGRTFEEAIQKAIRSTEYKNLGFNETELDVDVDYELNNPSDLRIFAIA
                     NAFANLGYSVEKVWQMTNIDRWFLNKLYGLFQFSKEIASYGIKENLPPLVLRQAKQLG
                     FDDRQIAKFLNSNEVAIRRLRKELGITPFVKQIDTVAAEFPAYTNYLYMTYNAAAHDV
                     DFNDHGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANKIKSIMVNYNPETVSTDYDEA
                     DRLYFETINLERVLDIYEAETSGGVIVSMGGQTSNNIAMSLHRENVKILGTSPEMIDG
                     AENRYKFSRMLDQIDVDQPAWKELTSMEEAEDFANKVGYPVLVRPSYVLSGAAMNTVY
                     SKADLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVAKDGELIMHVVSEHVENAGV
                     HSGDATLIVPPQDLDPETVNRIVVATAKIGKALKITGPYNIQFIAKNNEIKVIECNVR
                     ASRSFPFISKVVGVNLIEMATKALMGLPVTPYPVEKLPDDYVAIKVPQFSFPRLAGAD
                     PVLGVEMASTGEVACFGHSKYEAYLKSLLSTGFRLPKKNILLSIGSYKEKQELLPCVF
                     KLYNLGYKLFATAGTADFISEHGIPVQYVEVLNQEDEEKAEYSLTQHLANNKIDLYIN
                     LPSANRYRRPASYVSKGYRTRRMAVDYSVPLVTNVKCAKLLIEAIARHLPLDVSDRDA
                     QTSHRTVTLPGLINIATFVPNSSNVVEGPAELKETTRLSLEAGFTYCQIMARAISGPI
                     ISDMVSLKAALSVAQGSAYTDISYTVAGTVNNSENVAQTSNDVSSLFLPFRELTNKVS
                     TVAELLKNWPTGNQIIAEAKTSDLASVMLLTALQNRSIHITGVSNKEDLDLIITVKEK
                     DPRLTCDVNIHALFVSQDDYPEALFLPTKEDQEFFWRNLDAIDAFSIGALPTSLAYVT
                     SNKVDVGLGIKESLPLLLSAVDEGKLTIDDIVQRLHDNPAKIFNIPEQRNAIVEVDLD
                     YSFNHTKRWSPYTKGGLNGGINRVVINNETVVLSGDLVIPEPMGKVVVTNKTITNKTI
                     PSTPSAQNDAQLNVQSTKRRFSFSNERRGSTTSLDDYEEYNQPLEQRLMSSRPPKELT
                     APGAIQTLIRSNNPFKGRHILSVRQFKRSDFHALFAVAQELRAAVEREGVLDLMKSRV
                     LTTVFYEPSTRTSSSFIAAMERLGGRTVHINPGSSSVKKGETLQDTIRTLACYSDAIV
                     IRHADEMSAHTAAKYSPVPILNGGNGSREHPTQAFLDLFTIREELGTVNGITVTFMGD
                     LLYGRPVHSLCRLLQHYQVRINLISPQELRLPAALRKELADSGLLGVESEILTPEIIS
                     KSDALYCTRIQKERFENKEEYERLKDVYIIDNKMLSHAKEHMAVMHPLPRVNEIKEEV
                     DYDHRAAYFRQMRYGLFVRMALLAMVIGVDI"
     gene            complement(<273641..>277555)
                     /locus_tag="ZYRO0D03322g"
                     /db_xref="GeneID:8203826"
     mRNA            complement(<273641..>277555)
                     /locus_tag="ZYRO0D03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496532.1"
                     /db_xref="GeneID:8203826"
     CDS             complement(273641..277555)
                     /locus_tag="ZYRO0D03322g"
                     /note="some similarities with uniprot|P12685 Saccharomyces
                     cerevisiae YJL129C TRK1 Component of the Trk1p-Trk2p
                     potassium transport system 180 kDa high affinity potassium
                     transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496577.1"
                     /db_xref="GeneID:8203826"
                     /db_xref="GOA:C5DV25"
                     /db_xref="InterPro:IPR003445"
                     /db_xref="InterPro:IPR004773"
                     /db_xref="InterPro:IPR015958"
                     /db_xref="UniProtKB/TrEMBL:C5DV25"
                     /translation="MISRTISRNPTLATFSVKYKESFGRKFRDAVAKTGHYVKPLRKY
                     LFRNFLMVHYFYIISMTILASIILYPVRNESYIDILFLATGSTTQGGLNTVNINELEL
                     YQQIIIYIFTFLTTPIIIHSALAFVRLYWFERHFDGIRDSSKRNFKMRRTKTLLEREL
                     TARTMSKGRQRTGTRQFTSPTRRHDDFQEKLFSGKMVNRDEQDSLADLSHGGNGSSDQ
                     SVPNGKSFADPHRLSWSSSNTIEDNAEIHPSGRGLLFREPKPKRHQHYSHGNNNPQQR
                     PLESFARRRRSTDISPEDMYRSISMMKGQRQTNTEDDGPALVIGAPAERSNDKDAAKL
                     DAEKSDLKKKASYDSLRQNKMEKYPIGLPNKSDEEDFENEDEEDDDYNNDQTENSNST
                     SSSTSTTSNSSSVDNQSDNSPPIPSGSSTGSDSMHSDSVTSNAVTTDDRETMNEADSM
                     SSDHSQPEFPQENRNGPSIHFDIAAPPKRKKLRDQPNLTRKSRRSHYSPGVPIPSAKS
                     ISQRLKRRLSLGPMEKPRAKTTRSSGDINTMNNSDDYFSKDGMSDHFPRANTFDQQYD
                     LQDDNFPDVLSKSHSFDLGKTKDWNKLSTSPEFQSMIYEKWKREKRGRKSILRPKIRR
                     PSINSPNISGLRRFYSNPENNDDGNNTTEELPTDSVRHEHSDNDLTDEENDHGNFVNT
                     RDSLDEEEGYFGNDLSFADDPSRHKLTRTLSANYLSWEPTVGRNSIFVNMTKEQKEEL
                     GGVEYRAIKLLCRILVVYYGGFWIMAFIFLVPWIVSRDGYRKIVRNDGVTPVWWGFFT
                     GMSAFADLGLTLTPDSMMSFQTTSYPTIVMMWFIVIGNTGFPVLLRFMIWVMFQLSPD
                     LSLTRESLGFLLDHPRRCFTMLFPSAATWWLVATLVGLNAIDLIIFVILDLGNSVLHN
                     LNRGYRVLVGLFQAISTRTAGFQIVDIGSLHPAVQVSYMLMMYVSVMPLAISIRRTNV
                     YEEQSLGVYGDPDEDASHHGHELDSDDDESLGSSPSPASKKKKKSTTSFIGAHLRRQL
                     SFDLWYIFLGLFIICLAEGGKIQDERRPEFNIFTILFEIVSAYGTVGLSLGYPNSDTS
                     FSGQFGTISKLIIIALLIRGRHRGLPYTLDRAIMLPSDRLDNIDKFQDMLMRHRASRE
                     GSTDAVTSYFRSKLSAIKKEIHKMRTKSAEGEHLLHDFTDLPHHDNGDSRGDNHQERP
                     SEAASDGYNTNYNNNKSADHVLDIHEEPKEVSKSPNDSSLQPQEPISYFPNTTPSPRK
                     ASDELSPSDPLSTIPSQGTPTSRVAPSLESYRMKPLDSARTN"
     gene            complement(<278347..>280326)
                     /locus_tag="ZYRO0D03344g"
                     /db_xref="GeneID:8203827"
     mRNA            complement(<278347..>280326)
                     /locus_tag="ZYRO0D03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496533.1"
                     /db_xref="GeneID:8203827"
     CDS             complement(278347..280326)
                     /locus_tag="ZYRO0D03344g"
                     /note="similar to uniprot|P08018 Saccharomyces cerevisiae
                     YJL128C PBS2 MAP kinase kinase that plays a pivotal role
                     in the osmosensing signal-transduction pathway activated
                     under severe osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496578.1"
                     /db_xref="GeneID:8203827"
                     /db_xref="GOA:C5DV26"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DV26"
                     /translation="MNEQFSKLTINTERNPGDSDVSQGPPSATPVRTPSSQYNKINAD
                     LHARVKAFTEQRALKRSGSIGSNKSDTNGGGEVKNAGAPQNLQQIVNKPLPPLPPSPP
                     AVAMSNVAKDVKPEPIMRSSIVQRRESKMQQQQQEQQLANSSDNGIITNNGVNNMNGL
                     DNRKMMNPTDMTQFNPNRRAPRRPVVPRPTNPLPNAGPKQSLSARRGMKLPMGGMPLK
                     MPGKSSPSSSLSSNQHQEFASTPSNKNHLNVSGNNANINNNLNGRGSAPGSLINGIQS
                     TSTSSSNEEQRDTEGTAPKNSGSNSGSGGGGLFANFSKYVDIKSGSLNFAGKLSLFSE
                     GIDFSNGYSSRISLDELNFQEELGHGNYGHVSKVLHKPTSITMAMKEVRLELDEAKFR
                     QILMELEVLHKCKSPYIVDFYGAFFIEGAVYMCMEYMDGGSLDKVYDFSDEIGGIDEP
                     QLAKITYSVIEGLRELKDSHNIIHRDVKPTNVLCSARHGTVKLCDFGVSGNLVASLAR
                     TNIGCQSYMAPERIRSLNPDRVTYTVQSDVWSLGLSILEMALGRYPYPPETFDNIFSQ
                     LSAIVDGPPPKLPKDKFSAEAQDFVSVCLQKIPERRPTYAALLEHPWLLKYKDVDVGM
                     SSYITDKLNKRKQLLAERGEKELPKYLPALHMGGL"
     gene            complement(<281310..>283058)
                     /locus_tag="ZYRO0D03366g"
                     /db_xref="GeneID:8203828"
     mRNA            complement(<281310..>283058)
                     /locus_tag="ZYRO0D03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496534.1"
                     /db_xref="GeneID:8203828"
     CDS             complement(281310..283058)
                     /locus_tag="ZYRO0D03366g"
                     /note="some similarities with uniprot|P35208 Saccharomyces
                     cerevisiae YJL127C SPT10 Putative histone acetylase
                     required for transcriptional regulation at core promoters
                     functions at or near the TATA box"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496579.1"
                     /db_xref="GeneID:8203828"
                     /db_xref="GOA:C5DV27"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR015416"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DV27"
                     /translation="MTGDLGSLLNSRDSKDSRSINAVVHEERIDEDQILTPLQPHTIL
                     LKDGETIATMYPIPANSKLLPMGLLTFLLDEFNMEIEKGGTFPYYEKLTLQEFKEVWF
                     HPDGHLCVMVLGEVPELDYSRNNEETELRNNYGTDVSTTRNTTQYKRRKQRKNLNLSI
                     QWEQQCLGYFSIQPAYPGRSAHVVTGNFVVNAGIRGKRIGRTLVETFIRWSMKLGFGS
                     CVFPLIYSTNVGIRRILDDLNFKQIGQLPESGILKGFDVPVNSFIYGQQFTHITKHMD
                     VVKVKDTERKDEIAKYERLKHYILTGTYPPSCDRNEKARIRVNAKHHTLINGRLYTKG
                     REVILEPQRQREIALDMHLLDHPGINKLTTQIVEKYHWKGIKSTVCQTIANCPACRFR
                     QPDGVGVVVAPSSPVKQARMLPNMNADDEMNNSNQLSKVAEAVVGSLQKRGTREPEEE
                     EEEEEQEEEDAAISSQAEEEGDEEQDVDVELEDEGDDIDAEEEDEEEDEDSLRVELEN
                     EATPADDQMNTFNKFVEEERARKRRKYTLPLDRERTHNNSNSSTPGTVPVIDSSTILS
                     FGENPLTASQEQDRNL"
     gene            <283279..>284199
                     /locus_tag="ZYRO0D03388g"
                     /db_xref="GeneID:8203829"
     mRNA            <283279..>284199
                     /locus_tag="ZYRO0D03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496535.1"
                     /db_xref="GeneID:8203829"
     CDS             283279..284199
                     /locus_tag="ZYRO0D03388g"
                     /note="similar to uniprot|P47016 Saccharomyces cerevisiae
                     YJL126W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496580.1"
                     /db_xref="GeneID:8203829"
                     /db_xref="GOA:C5DV28"
                     /db_xref="InterPro:IPR001110"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:C5DV28"
                     /translation="MASRIAIGQLCSTANLTKNLGVVTSLISRALDNDVSLIFFPEAT
                     DYLSQNAAHSRKLAQETPQFISSLQLEIRSLVKKSSKKIDVSIGVHLPSTGLELQKGD
                     DRVKNVLLYIDHRGEILHSYQKMHLFDVDVPNGPILKESKSVQPGKTIPDILDTPAGK
                     LGTEICYDVRFPELSLKLREKGAQILCFPSAFTMKTGEAHWELLARARAIDTQCFVVM
                     PAQKGEHDVSDPNWTTGESKKNVQRISWGHSMVVDPWGTVIAHSDPNNKTDEPELIIA
                     DLDYNLLENVRKNMPLWDQRALKLYTSVND"
     gene            complement(<284196..>285299)
                     /locus_tag="ZYRO0D03410g"
                     /db_xref="GeneID:8203830"
     mRNA            complement(<284196..>285299)
                     /locus_tag="ZYRO0D03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496536.1"
                     /db_xref="GeneID:8203830"
     CDS             complement(284196..285299)
                     /locus_tag="ZYRO0D03410g"
                     /note="similar to uniprot|P46959 Saccharomyces cerevisiae
                     YJL125C GCD14 Subunit of tRNA (1-methyladenosine)
                     methyltransferase with Gcd10p required for the
                     modification of the adenine at position 58 in tRNAs
                     especially tRNAi-Met first identified as a negative
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496581.1"
                     /db_xref="GeneID:8203830"
                     /db_xref="GOA:C5DV29"
                     /db_xref="InterPro:IPR014816"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DV29"
                     /translation="MDSSVSPFSYRDIIQEGDLALVWISRDNIKPIIVDANHMFNTRY
                     GSFSHKSMIGKPYGSQIAIRTKGQNRFSFIHVMQPSPELWTLSLPHRTQIVYTPDSSY
                     IMQRLNCNPCSTVIEAGTGSGSFSHAFARTVGHLYSYEFHSVRYEQALKEFKDHGLPN
                     VTLTHRDVCSDGFTIKRNDPTSYLFQDDAAQATINANAVFLDLPAPWDAVPLLDQVIA
                     RDQKVGVCCFSPCIEQVDKTIEALEKCGWTEIQMVEIQGKQWESRRQMVRTLDDALER
                     LRDVRRRKEEGIERRKQMYDAVLKDDEADGEKSERPQPPKTKFNPFGKGTRVREGDVN
                     YQWKQVTKVEPEIKSHTSFLTFAFKIMDKSRIC"
     gene            complement(<285423..>285980)
                     /locus_tag="ZYRO0D03432g"
                     /db_xref="GeneID:8203831"
     mRNA            complement(<285423..>285980)
                     /locus_tag="ZYRO0D03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496537.1"
                     /db_xref="GeneID:8203831"
     CDS             complement(285423..285980)
                     /locus_tag="ZYRO0D03432g"
                     /note="highly similar to uniprot|P47017 Saccharomyces
                     cerevisiae YJL124C LSM1 Component of small nuclear
                     ribonucleoprotein complexes involved in mRNA decapping and
                     decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496582.1"
                     /db_xref="GeneID:8203831"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5DV30"
                     /translation="MVESNIEILQHQQSPFAPNVNVNTNAPVNTTQQHHHKKITEGEA
                     DLYLDQYNFTTTAAIVGSVDRKVFVLLRDGKMLFGVLRTFDQYANLILEHCVERIYFT
                     EKNKYAEEYRGLFMVRGENVVMLGEVDIDKEDQPLETMERIPFRDALKAKQIHDESRF
                     KQETIKGKQLARYGILYDFHKSDMY"
     gene            <286183..>286548
                     /locus_tag="ZYRO0D03454g"
                     /db_xref="GeneID:8203832"
     mRNA            <286183..>286548
                     /locus_tag="ZYRO0D03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496538.1"
                     /db_xref="GeneID:8203832"
     CDS             286183..286548
                     /locus_tag="ZYRO0D03454g"
                     /note="similar to uniprot|P36141 Saccharomyces cerevisiae
                     YKR049C FMP46 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496583.1"
                     /db_xref="GeneID:8203832"
                     /db_xref="GOA:C5DV31"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR012882"
                     /db_xref="UniProtKB/TrEMBL:C5DV31"
                     /translation="MSLFRSLQHQPRVITLFTHSLQQNSSQRILESLRANTSGKFKFE
                     LESKFPTLDQLRYMQSVNPTILSTQVPNVKSVLAKPSHDPLFQSELEKCVKGGQWNPN
                     SSMWVDWEQQRMGNERYEW"
     gene            complement(<286629..>288101)
                     /locus_tag="ZYRO0D03476g"
                     /db_xref="GeneID:8203833"
     mRNA            complement(<286629..>288101)
                     /locus_tag="ZYRO0D03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496539.1"
                     /db_xref="GeneID:8203833"
     CDS             complement(286629..288101)
                     /locus_tag="ZYRO0D03476g"
                     /note="similar to gnl|GLV|CAGL0L05522g Candida glabrata
                     CAGL0L05522g and weakly similar to YJL123C uniprot|P47018
                     Saccharomyces cerevisiae YJL123C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496584.1"
                     /db_xref="GeneID:8203833"
                     /db_xref="InterPro:IPR018814"
                     /db_xref="UniProtKB/TrEMBL:C5DV32"
                     /translation="MADKSKEDDVFEFLESLPEAKGGADSKGDKKEKTEEKKSGGKQG
                     NEDIMDFLDELEKSNLSVPKKEEAQEKKKEEISKMKPSKEEPSKEEPPKEEPPKEEAP
                     KQELPKQEPLKEEAPKQEPPKKEQPKEVPPKESKGFHREGTPVESREDTPLNDPITSF
                     SNWWSSSGSATVSNFWSKTTEQASQIKTRLAQEQLDLTSRLNTNTITDLARNLQKIVV
                     GETEEVLRIHLVHDLVNFSFLQTIVDQKFDEVFSSQVQGGIRVFSDQWGHPHRTEDEM
                     NFHFTSQQPKLNIFTGKITDGEKLAFANLENSIKLFQKAHEEFMRQKEAHSTATNERQ
                     EQEQDGEDADDDEKDDQEDRISDIFISILPIAIPTKQEDENEIVTTDPHQPGNFSFTV
                     VLKDITNDVSTITRSQSFPLKWVSWLEGDSEWKTKGKKEQEGKEQEGKQQQQQQQQQQ
                     EDDEDEDVDPSDWVRDWVEDGLNVAFGVVAQNYVIKRMGF"
     gene            <288824..>289285
                     /locus_tag="ZYRO0D03498g"
                     /db_xref="GeneID:8203834"
     mRNA            <288824..>289285
                     /locus_tag="ZYRO0D03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496540.1"
                     /db_xref="GeneID:8203834"
     CDS             288824..289285
                     /locus_tag="ZYRO0D03498g"
                     /note="similar to uniprot|P47019 Saccharomyces cerevisiae
                     YJL122W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496585.1"
                     /db_xref="GeneID:8203834"
                     /db_xref="GOA:C5DV33"
                     /db_xref="InterPro:IPR015218"
                     /db_xref="InterPro:IPR022784"
                     /db_xref="UniProtKB/TrEMBL:C5DV33"
                     /translation="MPSKNSVNRPKLTENLRHKNHALARKRADRERRGLINPPRSHED
                     SKSGQAKSESVDLYLKGNPQGSVITTKTLSKKRQQKIERNMKYAEKRKLLTDVQAKLE
                     DEMDVEDENEPKEESKRSVKDAFWSALEDTQSSANLCQDGQGTTLGGPLYP"
     gene            complement(<289335..>290051)
                     /locus_tag="ZYRO0D03520g"
                     /db_xref="GeneID:8203835"
     mRNA            complement(<289335..>290051)
                     /locus_tag="ZYRO0D03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496541.1"
                     /db_xref="GeneID:8203835"
     CDS             complement(289335..290051)
                     /locus_tag="ZYRO0D03520g"
                     /note="highly similar to uniprot|P46969 Saccharomyces
                     cerevisiae YJL121C RPE1 D-ribulose-5-Phosphate
                     3-epimerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496586.1"
                     /db_xref="GeneID:8203835"
                     /db_xref="GOA:C5DV34"
                     /db_xref="InterPro:IPR000056"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR026019"
                     /db_xref="UniProtKB/TrEMBL:C5DV34"
                     /translation="MVKPIIAPSILACDFANLGCECHKVINAGADWLHIDVMDGHFVP
                     NITLGQPIVTSLRRSVPRGDDPNNTANKPAAFFDCHMMVENPERWVEDFAKCGADQFT
                     FHYEATKDPVSLVKLIKSHGIRAACAVKPGTPVDVLFELAPHLDMALVMTVEPGFGGQ
                     KFMADMMPKVETLRSKFPHLDIQVDGGLGKATIPQAAEAGANVIVAGTSVFTATDPEE
                     VISFMKGEVSKNLESRKLLT"
     gene            <291057..>292454
                     /locus_tag="ZYRO0D03542g"
                     /db_xref="GeneID:8203836"
     mRNA            <291057..>292454
                     /locus_tag="ZYRO0D03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496542.1"
                     /db_xref="GeneID:8203836"
     CDS             291057..292454
                     /locus_tag="ZYRO0D03542g"
                     /note="similar to uniprot|P25293 Saccharomyces cerevisiae
                     YKR048C NAP1 Protein that interacts with mitotic cyclin
                     Clb2p required for the regulation of microtubule dynamics
                     during mitosis controls bud morphogenesis involved in the
                     transport of H2A and H2B histones to the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496587.1"
                     /db_xref="GeneID:8203836"
                     /db_xref="GOA:C5DV35"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:C5DV35"
                     /translation="MSEPIRAKPKSSMKIDNAPTPHNTPASVMNNSFLKNGNPVQNRK
                     DNSNSESNKGTTAAATPPTNEAPQTIKEEDMQGALTNQPLLLQSIQEKLGSLVGQDSG
                     YVDQLPIQIRNRIYGLKKLQNDLFAIEKDFQVEMFELEQKYLQKYAPLHDRRRRIVAG
                     DDEPSSQEVTKGKEIERLEKADQGEDEDDEDDETNQMTGEDDKTDVKGIPSFWLTALE
                     NLPVVSDTITDRDAEVLDYLQDVQLQYLTEGKPGFKLVFTFDKDVPFFDNTVLTKTYY
                     YQTELGYSGDFIYDHAEGDKINWTDNECNVTITVEKRKQRNKVTKQVRTIEKITPVES
                     FFNFFDPPRAPSSAEKDSEPEQQDPAAETAEEGLEDEEELEELEQRLALDYSIGEQLK
                     DKLIPRAIDWFTGAALEFEFDNEQDDEFEEGDEDEDEDEDEDEDENDDDDDDDEEEED
                     DFAGKKENPPECKQS"
     gene            <292731..>293660
                     /locus_tag="ZYRO0D03564g"
                     /db_xref="GeneID:8203837"
     mRNA            <292731..>293660
                     /locus_tag="ZYRO0D03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496543.1"
                     /db_xref="GeneID:8203837"
     CDS             292731..293660
                     /locus_tag="ZYRO0D03564g"
                     /note="weakly similar to uniprot|P36139 Saccharomyces
                     cerevisiae YKR046C PET10 Protein of unknown function that
                     co-purifies with lipid particles expression pattern
                     suggests a role in respiratory growth computational
                     analysis of large-scale protein-protein interaction data
                     suggests a role in ATP/ADP exchange"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496588.1"
                     /db_xref="GeneID:8203837"
                     /db_xref="UniProtKB/TrEMBL:C5DV36"
                     /translation="MTKPRQRRSSASLKVVVDKDMTDKFARNSPTLSHLYRYPLLANG
                     VDSAVNLPLVNVVLSWVLLLADRSRSLLLDSQKAPRFIKVGYNLVAGTLYKIDELFAL
                     LVLREGLGVLVEQWKIHGNKPGLWFGYFLVDYWANVVNILLTHFVLGPKKLAATPVIL
                     PTTPDDEQHSLPHLEELATTTKGISKDLQEKIPTGYLEKTASYARTKYEKLFKPVAER
                     VQTEYVDPTKAHALDTYKTVSSSYGANLRNSESIPRAIVSTGIDLKNITLENLKTTTA
                     EVVEEESKKLQEEAQTQVPKLDSVPVSNGGNAE"
     gene            <293826..>294857
                     /locus_tag="ZYRO0D03586g"
                     /db_xref="GeneID:8203838"
     mRNA            <293826..>294857
                     /locus_tag="ZYRO0D03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496544.1"
                     /db_xref="GeneID:8203838"
     CDS             293826..294857
                     /locus_tag="ZYRO0D03586g"
                     /note="some similarities with uniprot|P36138 Saccharomyces
                     cerevisiae YKR045C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496589.1"
                     /db_xref="GeneID:8203838"
                     /db_xref="UniProtKB/TrEMBL:C5DV37"
                     /translation="MSYTFCSAALLRFLFFQSYSHYNLFSSLYLLSSSNRFRDGYQLA
                     SIMSNNNAGVNDHTFQGRKKKLSVWVKKIIQPAKESGPAATTVTHANNSTNHGQGSST
                     IKRASPSSISSRPAETIGSPFQYGGAGYCAEGDDEAARVHIQVQDQDQDENQDEDYYD
                     NNGEIESNSQISTRAIRELSPARTDSMKVFWGDDPKRLRSEADSDLMVPSRDDDSDST
                     DNVSIQALFSMGSSSFKSSTFSDVHSLQSTRATVVSGRTTETNSSTVAIPPASILDRT
                     RHGGSAANSTTTTNLGSPTPSLHHHGHHHHHHHHHPPHSRHISRPNSIRQMPLQRERE
                     NNAATATIK"
     gene            <295036..>295959
                     /locus_tag="ZYRO0D03608g"
                     /db_xref="GeneID:8203839"
     mRNA            <295036..>295959
                     /locus_tag="ZYRO0D03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496545.1"
                     /db_xref="GeneID:8203839"
     CDS             295036..295959
                     /locus_tag="ZYRO0D03608g"
                     /note="similar to uniprot|P46956 Saccharomyces cerevisiae
                     YJL117W PHO86 Protein specifically required for packaging
                     of the high-affinity phosphate transporter Pho84p into
                     COPII coated vesicles for transport to the plasma membrane
                     transcription and localization are regulated by phosphate
                     levels"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496590.1"
                     /db_xref="GeneID:8203839"
                     /db_xref="InterPro:IPR024297"
                     /db_xref="UniProtKB/TrEMBL:C5DV38"
                     /translation="MSREVKNRKASKQVDARLSEPLNSETPPTIGSTDLKPEYATAAL
                     NMAADFVKQKQSLANMSILGHPLIVVFVWMVAIYFAAPKVTIPTDNGNGSFINFIWQA
                     FSKNKSVVPTVIFFGCLSTMIVFTLMSRVTETFFNSLSRDIIDTQGENVFGVDLKKLA
                     ERKCTSQELEQAKNTYIVVYRDTPVALVSLVENKILTTKDNLVMSVSTMGCRKVYEKS
                     GIIEDLIDWCTIRTKQKYVQGDYTGKMKLLIDVYSFDVDTKAILKRKGFTLLKNAKVH
                     ESFILGKLFGMKKELWGLQFHFEKPKISEIK"
     gene            complement(<295998..>297332)
                     /locus_tag="ZYRO0D03630g"
                     /db_xref="GeneID:8203840"
     mRNA            complement(<295998..>297332)
                     /locus_tag="ZYRO0D03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496546.1"
                     /db_xref="GeneID:8203840"
     CDS             complement(295998..297332)
                     /locus_tag="ZYRO0D03630g"
                     /note="similar to uniprot|P36137 Saccharomyces cerevisiae
                     YKR044W UIP5 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496591.1"
                     /db_xref="GeneID:8203840"
                     /db_xref="GOA:C5DV39"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DV39"
                     /translation="MKRDAAIQLVIITGILLLFAVGQTCWKNTHSSLEQQENVLHLRP
                     SQVKRIENKDASLQVPFLDKISKHWYVGGSPEIRNSEYVRLTNIGSPGSHGSVVSNGL
                     GDNTINDFEIVVKFRIMSKDQHRKTPSGNSPSMGDGMAIVISSEKDFVSPESYASGYA
                     RKQFDLNSGGVLLGNTEMMGFPKNLPGLSLVIDTFQNSDRSRTKIPFLDIHVNTSPRD
                     QKYDFPSDGADTTALKLLKDPIRLTQRCVKGDLTQFRIIYMESINTLKIDAKYAHEGD
                     YWIELFHSQLDIKLPKNSRNGQRYVGVGALTGQLTETVDVFSIETNEFHSENHDESAE
                     TSFDYAKEVQMFLAQEFDRKVSLEEDEFQKWKIARAQPNLAIQEVQRESSSPLSPPRR
                     SKSIFGWFGKSVAFSILTVAFYLTSVYIRVSIKHINNTHRRKRAQSIGLLPI"
     gene            <297716..>298510
                     /locus_tag="ZYRO0D03652g"
                     /db_xref="GeneID:8203841"
     mRNA            <297716..>298510
                     /locus_tag="ZYRO0D03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496547.1"
                     /db_xref="GeneID:8203841"
     CDS             297716..298510
                     /locus_tag="ZYRO0D03652g"
                     /note="similar to uniprot|P36136 Saccharomyces cerevisiae
                     YKR043C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496592.1"
                     /db_xref="GeneID:8203841"
                     /db_xref="InterPro:IPR013078"
                     /db_xref="InterPro:IPR029033"
                     /db_xref="UniProtKB/TrEMBL:C5DV40"
                     /translation="MTTSSPKPTPTPRCVIIRHGQTEWSVSGQYTGKTDLPLTEKGEK
                     LVCDSAEALFRNNLLNPDHITYVFTSPRQRSIKTMELMLSSLTEEQKSKIKVVVDDDL
                     QEWDYGDYEGKLTSEIRELRKSRGLDKERPWVIWRDGCEGGESSDQVAMRVSRAIARI
                     QSLHDQHLKQGITSDILVFAHGHLLRYFAAIWTGLGEEAEMSPKDAAVRACQDPDVPH
                     ITLEKYHYMHRNPKLMLDAGGVGVLSYEHNNCAEPAMVIAGPFTVN"
     gene            complement(<298892..>300070)
                     /locus_tag="ZYRO0D03674g"
                     /db_xref="GeneID:8203842"
     mRNA            complement(<298892..>300070)
                     /locus_tag="ZYRO0D03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496548.1"
                     /db_xref="GeneID:8203842"
     CDS             complement(298892..300070)
                     /locus_tag="ZYRO0D03674g"
                     /note="similar to gnl|GLV|CAGL0L03289g Candida glabrata
                     CAGL0L03289g and some similarites with YKR042W
                     uniprot|P36135 Saccharomyces cerevisiae YKR042W UTH1 Youth
                     involved in determining yeast longevity involved in cell
                     growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496593.1"
                     /db_xref="GeneID:8203842"
                     /db_xref="InterPro:IPR005556"
                     /db_xref="UniProtKB/TrEMBL:C5DV41"
                     /translation="MKFSQVLIASATAATALAVPAGHGHEDRHRRDSIAYVTKFVDQN
                     GNSVTKGSGPSVVTVQASATGLQANNKNPQTTLAPSGSSAASSSSASASGSSSASSSA
                     SSSASGASSGSQAPSSTSSSSSPSGSGSSSGGGDFQDGTISCSNFGISDIDGVVSLDW
                     VNKGGWASVMDLNGNTADSCQEGYYCSYACKPGMSKTQWPSNQPGDGKSVGGLLCKGG
                     KLYKTNTDASGLCESDQGGSSAVNQKDQSIAMCRTDYPGSENMVVPTVIEAGSSQPLS
                     VVKEDSYYQWMGKKTSAQYYVNNAGVSQEDGCVWSNEGSGKGNWAPLVVGSGYTDGVS
                     YLSIIPNPNNKETPNFNVKIVGDNVDGECKYENGQFSGSGSDGCTAAVRSGSAQLVFY
                     "
     gene            <302198..>302992
                     /locus_tag="ZYRO0D03696g"
                     /db_xref="GeneID:8203843"
     mRNA            <302198..>302992
                     /locus_tag="ZYRO0D03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496549.1"
                     /db_xref="GeneID:8203843"
     CDS             302198..302992
                     /locus_tag="ZYRO0D03696g"
                     /note="some similarities with uniprot|P32447 Saccharomyces
                     cerevisiae YJL115W ASF1 Nucleosome assembly factor
                     involved in chromatin assembly after DNA replication anti-
                     silencing protein that causes derepression of silent loci
                     when overexpressed"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496594.1"
                     /db_xref="GeneID:8203843"
                     /db_xref="GOA:C5DV42"
                     /db_xref="InterPro:IPR006818"
                     /db_xref="InterPro:IPR017282"
                     /db_xref="UniProtKB/TrEMBL:C5DV42"
                     /translation="MSVVSLLGIKVLNNPAKFTEPYQFEITFECQEQLKNDLEWKLTY
                     VGTSRSLEHDQELDSILVGPVPVGVNKFVFTADPPSPELIPASELVSVTVILLSCSYD
                     GREFVRVGYYVNNEYDNEELRENPPAKVQVDHVVRNILAEKPRVTRFNIVWDNENEGD
                     IYPPEQPGIDEEEEEEEEEDEEEEEEEEDDDDDDEEEDEDDDENEEEAAQEVDEEEAE
                     EDNANEEQQEEERPSKKPKVEKSASHSTEDQQDGGVDAAPTPQDTQ"
     gene            complement(<303081..>303698)
                     /locus_tag="ZYRO0D03718g"
                     /db_xref="GeneID:8203844"
     mRNA            complement(<303081..>303698)
                     /locus_tag="ZYRO0D03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496550.1"
                     /db_xref="GeneID:8203844"
     CDS             complement(303081..303698)
                     /locus_tag="ZYRO0D03718g"
                     /note="weakly similar to uniprot|P36134 Saccharomyces
                     cerevisiae YKR041W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496595.1"
                     /db_xref="GeneID:8203844"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5DV43"
                     /translation="MSQSQDYESSSEDESTANGLPRPFYLRPYTRHHRVKKPDVAKQS
                     TKHPPVTKCSKPSKPLIYERVTNKQGRTRRKSFPRSNSDPTQERLFEYGEPINGYKFL
                     TTPDNIPLLQPRQSVSSPAQEPSYLLKYWNSVDLKLLPVDPGNQINKNNVYSFYQKSC
                     DLLKQDMRKIIKRERIRWHPDRMHLPEATQIFQIINDLWESLQEV"
     gene            complement(303813..303885)
                     /locus_tag="ZYRO0D03740r"
                     /db_xref="GeneID:8203845"
     tRNA            complement(303813..303885)
                     /locus_tag="ZYRO0D03740r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.19"
                     /db_xref="GeneID:8203845"
     gene            complement(<304207..>306009)
                     /locus_tag="ZYRO0D03762g"
                     /db_xref="GeneID:8203846"
     mRNA            complement(<304207..>306009)
                     /locus_tag="ZYRO0D03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496551.1"
                     /db_xref="GeneID:8203846"
     CDS             complement(304207..306009)
                     /locus_tag="ZYRO0D03762g"
                     /note="similar to uniprot|P19145 Saccharomyces cerevisiae
                     YKR039W GAP1 General amino acid permease localization to
                     the plasma membrane is regulated by nitrogen source"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496596.1"
                     /db_xref="GeneID:8203846"
                     /db_xref="GOA:C5DV44"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DV44"
                     /translation="MSDKEYTTKDVEAGNVQVKETLPDVETGASYEHYDNYIDEEEQG
                     PPDSRWKKIKDSFKRAEVPELDPNLTEAEKIAIATARSPLQHQLKNRHLQMISIGGAI
                     GTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAELAIAFPVAGGFTTYATRF
                     IDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRDGFVALFWVVIVIINM
                     FGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGARYWYHPGAFAGDTS
                     GRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVFWRITMFYVLCLL
                     LIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNVVILIAVLSVGNSAV
                     YACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDKEGEVFDWL
                     MALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLFLCIIML
                     AAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKAEDMDIDTG
                     RRELDLDLLRQQVEEERAALAAKPMWYRIYKFFC"
     gene            <307515..>308675
                     /locus_tag="ZYRO0D03784g"
                     /db_xref="GeneID:8203847"
     mRNA            <307515..>308675
                     /locus_tag="ZYRO0D03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496552.1"
                     /db_xref="GeneID:8203847"
     CDS             307515..308675
                     /locus_tag="ZYRO0D03784g"
                     /note="highly similar to uniprot|P36132 Saccharomyces
                     cerevisiae YKR038C KAE1 Putative glycoprotease that
                     interacts with Bud32p which is a member of the novel
                     protein kinase piD261 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496597.1"
                     /db_xref="GeneID:8203847"
                     /db_xref="GOA:C5DV45"
                     /db_xref="InterPro:IPR000905"
                     /db_xref="InterPro:IPR017860"
                     /db_xref="InterPro:IPR017861"
                     /db_xref="UniProtKB/TrEMBL:C5DV45"
                     /translation="MVNLNTVLPRNGRNYYLALGLEGSANKLGVGIVKHPVLPEHEDG
                     DLSFKCESEIMANIRDTYVTPPGEGFLPRDTARHHRNWCVRLIKRALQEAGVKDPSRD
                     LDVICFTRGPGMGAPLHSVAIAARTISLLWGIPLVGVNHCVGHIEMGREITGAANPVV
                     LYVSGGNTQVIAYSEKRYRIFGETLDIAIGNCLDRFARTLRIPNSPSPGYNIEQLAKK
                     CSDKERLVELPYTVKGMDLSMSGILAYIETLAKDLFRGNKKNKILFDPKTGEQKVTVD
                     DLCFALQENMFAMLVEITERAMAHVNSNQVLVVGGVGCNERLQEMMGQMCGDRALGQV
                     HATDERFCIDNGVMIAQAGLLEYRMGQATTDLNETVVTQKFRTDEVYVGWRE"
     gene            <308840..>309703
                     /locus_tag="ZYRO0D03806g"
                     /db_xref="GeneID:8203848"
     mRNA            <308840..>309703
                     /locus_tag="ZYRO0D03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496553.1"
                     /db_xref="GeneID:8203848"
     CDS             308840..309703
                     /locus_tag="ZYRO0D03806g"
                     /note="similar to uniprot|P36131 Saccharomyces cerevisiae
                     YKR037C SPC34 Component of Dam1p complex important for
                     spindle and kinetochore integrity localized to nuclear
                     side of spindle pole body and along mitotic spindle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496598.1"
                     /db_xref="GeneID:8203848"
                     /db_xref="GOA:C5DV46"
                     /db_xref="InterPro:IPR013966"
                     /db_xref="UniProtKB/TrEMBL:C5DV46"
                     /translation="MSETLDVCLEEITKSIDSINTLYFKPPGIFHNAVVHDGRGQSYS
                     SIITKLIRDCNPREELSLFSVDPKRKIPRRKDGKEGVLDYLAERDINLKRNRRIGLPE
                     EKPVIHVPKEFYLKQHNQVLAAKRQKTGALFFDLDTNSVAAAGSDPGIFELLDAKLDD
                     PQITKLLYALRNGSVTFEGTPEGTQRSTMFVEDFSADLLLKVLEEVSNQWPLSEYKET
                     YLKYLTNYQDLETEIQLIKKELKLQEDQLQAQLQFQPSSSHVVGKLIEKEQSEVELLE
                     QEIARMEQELE"
     gene            <310049..>312229
                     /locus_tag="ZYRO0D03828g"
                     /db_xref="GeneID:8203849"
     mRNA            <310049..>312229
                     /locus_tag="ZYRO0D03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496554.1"
                     /db_xref="GeneID:8203849"
     CDS             310049..312229
                     /locus_tag="ZYRO0D03828g"
                     /note="similar to uniprot|P47025 Saccharomyces cerevisiae
                     YJL112W MDV1 WD repeat protein that regulates steps in the
                     Dnm1p-dependent process of mitochondrial fission"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496599.1"
                     /db_xref="GeneID:8203849"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DV47"
                     /translation="MSNHDDHFSHLGSALSTTAAAIFGAQNLEDTILSYSSPYKRVLH
                     KAMTNLGSEGAVVNFRGRKDRGTGSFQSLSSNNGKEFFQNKFADSKTSFKVLSYLSDD
                     QLRDIPSEFDGTNLSLSKKLLTQNGEPNSKSNKKKGQKTEPTLFQGFEASLPVINETL
                     HSENKLLKNDEDSKTIDQHPHRHHHGGKPEMDQNEFNDQFTLPQGVEPERITNSYSLS
                     FLKSVSSGVIDNLDLLEIQKKVAASEIRELDYKLERLKFMRELAFKRIAKIEQNELFL
                     ENNLNVARDRISFLQEYGLQKEEDDIDEERKENEDEDIIDNPQHSLDEDGNRPQDIAE
                     SPLNVHKSNENHGLETEANANSPMLSKSVYQKLKVKDEKPSKKLHEFYNDKHKKHRKT
                     YPTLQQYYTRGSQISSFPKSHDESIICLDFDVPFGTLATAGHLDHSIKLWNLSKKNQV
                     GQMTGHHASINCMQLDNQYNMLISGGRDAVLKLWDLSLAYQLYQEDTEFASNSEEACV
                     YTFDSHLDEITALSFDSGHLVSGSQDRTLRQWDLSTGKCVQTIDISFASRGQSTSSLA
                     SSSLLSPVVEAPVVGALQCFDAALATGTKDGIVRLWDMRSGKTIRSLEGHTDAITTLK
                     FDSRNLVTGSLDRSIRIWDLRTGTLADAFAYESPVLELDFDLQDIVAAVGENGVKVFD
                     RENDKHWVCAQSEEEDASISQFVKYKNGYLIEGRSNGDVNAWAI"
     gene            <312565..>314208
                     /locus_tag="ZYRO0D03850g"
                     /db_xref="GeneID:8203850"
     mRNA            <312565..>314208
                     /locus_tag="ZYRO0D03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496555.1"
                     /db_xref="GeneID:8203850"
     CDS             312565..314208
                     /locus_tag="ZYRO0D03850g"
                     /note="highly similar to uniprot|P42943 Saccharomyces
                     cerevisiae YJL111W CCT7 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496600.1"
                     /db_xref="GeneID:8203850"
                     /db_xref="GOA:C5DV48"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012720"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DV48"
                     /translation="MNFGNQTPTIVVLKEGTDTSQGRGQIISNINACVAVQEALKPTL
                     GPLGSDILIVSGSGKTTISNDGATILKLLDVVHPAAKTLVDISRAQDAEVGDGTTSVT
                     ILAGELMKEAKPFLEEGISSHIIMKGYRKAVSLATAKIQELAVDISHKGGENRELLER
                     CAKTAMTSKLIYKNADFFVKMCVDAVLSLDRNDLDDKLIGIKKIPGGAMEESMFINGV
                     AFKKTFSYAGFEQQPKRFKNPKILSLNLELELKAEKDNAEVRVEHVDDYQAIVDAEWQ
                     LILNKLKQIEDTGANIVLSKLPIGDLATQYFADRNIFCAGRVNGDDLNRVILAVGGSI
                     QSTTTDIRPEYLGTCEKFEEIQIGSERYNLFEGCTKAKTCTLLLRGGAEQVIAEVERS
                     LHDAIMIVKRAIQNKLIVAGGGATEMEISRHLREYSKTIAGKQQLIINAFAKALEVIP
                     RQLCENAGFDAIEILNRLRMAHSKGEKWYGVDFEIENIGDNFAKFVWEPALVKINELN
                     SAAEATNLILSVDETITNKESSANGGAPPQGRGRGMPMQ"
     gene            complement(<314306..>314911)
                     /locus_tag="ZYRO0D03872g"
                     /db_xref="GeneID:8203851"
     mRNA            complement(<314306..>314911)
                     /locus_tag="ZYRO0D03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496556.1"
                     /db_xref="GeneID:8203851"
     CDS             complement(314306..314911)
                     /locus_tag="ZYRO0D03872g"
                     /note="highly similar to uniprot|P69771 Saccharomyces
                     cerevisiae YKR035W-A DID2 Class E protein of the vacuolar
                     protein-sorting (Vps) pathway associates reversibly with
                     the late endosome has human ortholog that may be altered
                     in breast tumors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496601.1"
                     /db_xref="GeneID:8203851"
                     /db_xref="GOA:C5DV49"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DV49"
                     /translation="MSRNQAGLENTLFQLKFTSKQLQKQAQRAVKEEKQETAKLKKSL
                     GESEEIAKIYASNAIRKKNERLQLLKLASRVDSVASRVQTAVTMRQVSSSMGSVCRGM
                     DKALQSMNLQQITMVMDKFEQQFEDLDASVNVYEDMGSNSDAVIVDGDKVDELLNKVA
                     DENGLELKQQAKLDDLPEIEQPQANEEKEDKLAQRLRALRG"
     gene            complement(<315134..>316468)
                     /locus_tag="ZYRO0D03894g"
                     /db_xref="GeneID:8203852"
     mRNA            complement(<315134..>316468)
                     /locus_tag="ZYRO0D03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496557.1"
                     /db_xref="GeneID:8203852"
     CDS             complement(315134..316468)
                     /locus_tag="ZYRO0D03894g"
                     /note="some similarities with uniprot|P42944 Saccharomyces
                     cerevisiae YJL110C GZF3 GATA zinc finger protein and
                     Dal80p homolog that negatively regulates nitrogen
                     catabolic gene expression by competing with Gat1p for GATA
                     site binding function requires a repressive carbon source
                     dimerizes with Dal80p and binds to Tor1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496602.1"
                     /db_xref="GeneID:8203852"
                     /db_xref="GOA:C5DV50"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C5DV50"
                     /translation="MTGSTAAASFVSEPRVDEKPSGNNDNNSDASFVNASANANSNVS
                     CSTTDASPASSSDAPSRSPSPSSGSVHSKSKVVDAHTNGNTTNIGSNPNVNSHNTVCK
                     NCFTVTTPLWRRDENGAVLCNACGLFLKLHGRPRPISLKTDVIKSRNRKGNHSHSHNH
                     SNTPPSPKGTPNGDERKRKYDDPNKPKPKKVKSEVKEPQFEGTEITKAANTLGNINRS
                     CNGVNSPTLSASNAPRQLPHLSTLLGEVSPQPQPQSVHPSQPLQRGASPLPPPVTMLE
                     SARSTVSSPSMLPQNPKVYQMSSINDVLSPSHAVQQQQPSSTPAEVRGHLSPPPPPPP
                     HHQYHQPQPAFLPIALPRVNSPQPNQQQQQQQQQSQPVLETQLRNEEEIIRLRARINE
                     LELVTDLYKRHIFELDEKYKSLQDGVDQIKQQQQQQQQQQQQQQQQQQQQSQ"
     gene            <317703..>320099
                     /locus_tag="ZYRO0D03916g"
                     /db_xref="GeneID:8203853"
     mRNA            <317703..>320099
                     /locus_tag="ZYRO0D03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496558.1"
                     /db_xref="GeneID:8203853"
     CDS             317703..320099
                     /locus_tag="ZYRO0D03916g"
                     /note="similar to uniprot|P07261 Saccharomyces cerevisiae
                     YPL075W GCR1 Transcriptional activator of genes involved
                     in glycolysis functions and interacts with Gcr2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496603.1"
                     /db_xref="GeneID:8203853"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5DV51"
                     /translation="MNLDPFDRNRISSSNRNASSPSSSSSQAIPLFPLNNISNANDDL
                     YHVLNSQDQQARISSTNISSNFYLITQYILQAYFKVSFTELRSLKLVDLIVDQTYAES
                     LTLRKLNEGASVRSYEYFNTVPRQEDITRCPIFALATYFVIRWSHPNPPISVENFDRI
                     PLLDPTTITWNKGFQELNHTKEGYKVSRSVSFEPANELADIIFPWLPSLRQDMEIMDR
                     SNYKLHSFLELFEFMARTIVQDLKYLQLNSGLLPNIVTFVAKFIPDLFQHPKFQKAKP
                     VFNERGGDDEDSHFLQLSKRLTTENVRLAQQITQLKTDLSNVQYMCDQILKLQQQQLV
                     NNDRNYRQNNNNNNNGVIVIDKNSVNSSIWNNLAQNTAAVSASGGNNSTSNNEEPQES
                     SNLAPMLASFPLVNPEVNRKRKLPPPQPGLSPFLPSPGPVLPTVAESPYTKRLRIDDK
                     RTPSQSALDLLLSKTASSPRFPSLPNNHVAKMPSRYSSPTAFAMTGSPSAVLPPNPVS
                     LAPRTTQPEAHSQPRNISGPIVQNSPTITAATAARAAPATVSAIDNASSKNPNTNSLP
                     NTPIVNNGADEPNEEAEEDASEEDGRDDENDDSKALSPKSSEARPRPVSSQQVPSSNP
                     DNTSSGPNNKQNRPMEKLGPNRHIKYKLSRDNKTIWDLYTEWYIGLNGQSSIKSLIET
                     YGLRRWKVSDDSHFFPTRRIIMDYIEMECDRGIKLGRFTNPDQPREDIRKIIVGDLEK
                     FRINNGLTLNSLSMYFKNLTRENKEICIFENFKNWSVRAMTEEEKNKYCKRQHTKETL
                     "
     gene            <320521..>322578
                     /locus_tag="ZYRO0D03938g"
                     /db_xref="GeneID:8203854"
     mRNA            <320521..>322578
                     /locus_tag="ZYRO0D03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496559.1"
                     /db_xref="GeneID:8203854"
     CDS             320521..322578
                     /locus_tag="ZYRO0D03938g"
                     /note="similar to uniprot|P40328 Saccharomyces cerevisiae
                     YPL074W YTA6 Putative ATPase of the CDC48/PAS1/SEC18 (AAA)
                     family localized to the cortex of mother cells but not to
                     daughter cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496604.1"
                     /db_xref="GeneID:8203854"
                     /db_xref="GOA:C5DV52"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DV52"
                     /translation="MGNDKFIIPANFTLLQSLQLLYSIVASQCENYEKQAANLELNIN
                     DLVKLYRLFDNLLQYMNDGLSRIEKSYKLQGGLRENTSNDKDLKRKFEDLQLLGQDIR
                     LSRRECNNRIGVLENIRNNQSIFGKFRSRSTKRCKPKFEDEKQENTAIEAAENVRRER
                     RDKELRKLEKEKQRQLELDAQKEKEIELFLKQQLEAEYLEKESKRDAITASKRKSMPE
                     RKAVGSPTLPQQSTFTSRRPDRHSMYVNGGSIQRTTGKSSEESGLRPAASVARSSSTG
                     GGSGAPKKRYEYVKPVIRRQPIRSPRATSRVASPEIVGTDGFKPVVRRERNSNSLRRN
                     GTPQSPPMSSPPLVAAGREKFGTDSSDEDASDDKSDSSIDNYMGSSVNGVDPIACRQI
                     MKEIVIQDEEVRWDDIAGLRNAKNSLKETVVYPFLRPDLFKGLREPIRGMLLFGPPGT
                     GKTMIAKAVATESKSTFFSISASSLLSKYMGESEKLVRALFYMAKKMAPSIIFIDEID
                     SLLTARSDNENESSRRVKTELLIQWSSLSSSTGNDVNADTRVLVLAATNLPWAIDEAA
                     RRRFSRRLYIPLPEFETRLHHLKKLMSKQNNHLSEIDFEVIAEMTEGFSGSDITALAK
                     EAAMEPIRDLGDRLVDAEFSKIRPVTVKDFEKAMLTVKMSVSPASLQQYQDWAAGFGS
                     TGA"
     gene            <323001..>324383
                     /locus_tag="ZYRO0D03960g"
                     /db_xref="GeneID:8203855"
     mRNA            <323001..>324383
                     /locus_tag="ZYRO0D03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496560.1"
                     /db_xref="GeneID:8203855"
     CDS             323001..324383
                     /locus_tag="ZYRO0D03960g"
                     /note="similar to uniprot|P38131 Saccharomyces cerevisiae
                     YBR199W KTR4 Putative mannosyltransferase involved in
                     protein glycosylation member of the KRE2/MNT1
                     mannosyltransferase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496605.1"
                     /db_xref="GeneID:8203855"
                     /db_xref="GOA:C5DV53"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DV53"
                     /translation="MVGWPSRRIIGRVVALGVILALLVSGYQLASGYGYTDGLGEMAS
                     KPYKWYTTGLSAPLLSDVANGTQPHTYKELLNKLQSPLVDKESLDRKVVDDLLKERKQ
                     IYWNTLHTPIKEPKVDGLVRPGDKLAGSSKACFLCLVRNEDLDGIIGSIQELEEQFNE
                     DFNYPYVFLNDGKFTKDFKDAIRKALPRGRKIEFGSIEPSLWDMPSNIDENEFKEHME
                     KLSGIQHADQLSYHNMCRFYSKSFYHHPLLKKYKYAWRVEPGVHFYCKVEYDVFQFMQ
                     MNDKIYGYVLNLYDSPESIETLWTKTFDFLQENPHYLNENCAHEWVRDNVQKPDNYDV
                     TQGYSTCHFWTNFEITDMDWLRGPIYEAYMEFLDSQKGFYYERWGDAPVRSLALALFA
                     DKGRIHWFRDIAYSHFPYTNCPSCPEGSERCNGDCRPGFFVPWENLEIENCQATWIKY
                     SMDQKDLDMY"
     gene            <324687..>327152
                     /locus_tag="ZYRO0D03982g"
                     /db_xref="GeneID:8203856"
     mRNA            <324687..>327152
                     /locus_tag="ZYRO0D03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496561.1"
                     /db_xref="GeneID:8203856"
     CDS             324687..327152
                     /locus_tag="ZYRO0D03982g"
                     /note="weakly similar to uniprot|Q02863 Saccharomyces
                     cerevisiae YPL072W UBP16 Putative ubiquitin-specific
                     protease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496606.1"
                     /db_xref="GeneID:8203856"
                     /db_xref="GOA:C5DV54"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DV54"
                     /translation="MAGVVYLIAQGRGQNVNGQWLHSFIQSNGRGIKYIGYGVLAAVS
                     IYILIPSVSSLITGKDMFHSKRSDRTTTGLINNRNDCFANSSVQALSALPRLTRYLND
                     ILSQASQMVYDLEKDHDAPKEFHKAPEPSPAPSAPPAINKSPEELEQQHQEHSHHSNH
                     LTVPHDQLGAATPKIELDQNPLDMHVNSMVDVSADRPGLPALKSTTTINTITTLKDEE
                     DGGDETPEMSVNQEADGGEDSGDTPVDGSNLPKLPLHRSLASMLEQLQRTVTSPRHLS
                     IWPLLHSLEVIFNARISSGQNDAHELTQVILETLQKENNKIREFAKNQKLPVDIPEIP
                     FRGKVADHLVCTACRNSSKVRVTQFNMLPLAVPQAITAKLAEMVSDNQVESIEGYSCL
                     TCKVGKILENEKGRDTSSYETTEQNTLASLARAFPNLTINDDVSEELMNYINGYNRDG
                     LVTSQLKSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQ
                     NDRCVGINSVNYELKAIVKHAGSHSQGHYQCYRHKPDFVKDIDTHAVINRTPVIDANL
                     INIHDPQDSKEVAATEMMEPPPTKQTGDSPSNLSSSSLGGSTDLPNSNDPNDSDDYVL
                     DNDDSSKMSRKPSTFRKITNFLSRRSSVSNSSLDTPDAPESDNVGRGRRSTTSRNTDD
                     HSRPTSTVRSSTGNRESSVASRQGGTQPIRSRSRANSTSSQQSSRSRADSISSDRSLS
                     DLSAVTSSESNNYGTTTSASDTDSTSGADPMTRKRHLKKIKSVLKYPYWSISDTVVHE
                     AKPEEVLNETKYVYMLFYERVNA"
     gene            <327544..>329327
                     /locus_tag="ZYRO0D04004g"
                     /db_xref="GeneID:8203857"
     mRNA            join(<327544..327552,327618..>329327)
                     /locus_tag="ZYRO0D04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496562.1"
                     /db_xref="GeneID:8203857"
     CDS             join(327544..327552,327618..329327)
                     /locus_tag="ZYRO0D04004g"
                     /note="similar to uniprot|P29366 Saccharomyces cerevisiae
                     YBR200W BEM1 Protein containing SH3-domains involved in
                     establishing cell polarity and morphogenesis functions as
                     a scaffold protein for complexes that include Cdc24p Ste5p
                     Ste20p and Rsr1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496607.1"
                     /db_xref="GeneID:8203857"
                     /db_xref="GOA:C5DV55"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DV55"
                     /translation="MLKSLKFTKRDSSGSKGRISSSDISSPTPAGNSIGGIGGGGKFG
                     KIGISRNASGASSQSMSSVRKNSRSVPSPEKWIRAIGSYRSQTPQEVSFTEGEVFFVL
                     EEEKEWYQALNPSTKKQGLVPRGYFELADRNKSISRHASVLSQQSDISKMGTLYAIVL
                     YDFQAEKGDELTSYAGENLFICAHHNFEWFIAKPIGRLGGPGLVPVGFVSIIDITTGY
                     ATGNDVKEDINYVNLPTVQEWKSNIARYKASNISLGSVEHAQPSSVPAVQQPVGQQQQ
                     QQQQQQQQQQQQKYKSFGMDLDVVTKAAVESFGMEDEKYWFEVTCDLSSGKGRRLKRC
                     YQDFYDLQVRLLDSFPAESGKLRDPSGQWTRRIMPYIPGPVPYVTDTITKKRKEDLNI
                     YVGDLIMLPDYISRSEMVLLLFQIRDNGYDREFPLGMGETFANGSNVNRGEDTVLTNA
                     TNTLGIPREDNTLTGEDLQLYEKLSELSLTNSKAQSRPPSQLPPPIKPIKIKFYYKDD
                     IFALMLNTNITYAELCSKISPRVDTENFKLFVKLTGDDDTEEIKSDEQIAQVIQAKLK
                     ISVYDA"
     gene            complement(<329413..>329925)
                     /locus_tag="ZYRO0D04026g"
                     /db_xref="GeneID:8203858"
     mRNA            complement(<329413..>329925)
                     /locus_tag="ZYRO0D04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496563.1"
                     /db_xref="GeneID:8203858"
     CDS             complement(329413..329925)
                     /locus_tag="ZYRO0D04026g"
                     /note="weakly similar to uniprot|Q02864 Saccharomyces
                     cerevisiae YPL071C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496608.1"
                     /db_xref="GeneID:8203858"
                     /db_xref="UniProtKB/TrEMBL:C5DV56"
                     /translation="MSWSNSISSASSSSTFKLKRPHSPDSVGVNNYKKQRLIQDFEKL
                     SLKDSSHGAQSQVVTANNNLLDEIGIGIISIPKDVKKRVRRLRNSSGTYNDEKLIYEK
                     LREAIRNEHLQIIRWQDPLHVVYQQWLRWIRTRWIVWPAQPYPEDNDNDDYDYNNFYG
                     GYDSDVDMDA"
     gene            <330261..>332090
                     /locus_tag="ZYRO0D04048g"
                     /db_xref="GeneID:8203859"
     mRNA            <330261..>332090
                     /locus_tag="ZYRO0D04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496564.1"
                     /db_xref="GeneID:8203859"
     CDS             330261..332090
                     /locus_tag="ZYRO0D04048g"
                     /note="similar to uniprot|Q02866 Saccharomyces cerevisiae
                     YPL070W MUK1 Protein of unknown function localized to the
                     cytoplasm computational analysis of large-scale
                     protein-protein interaction data suggests a possible role
                     in transcriptional regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496609.1"
                     /db_xref="GeneID:8203859"
                     /db_xref="InterPro:IPR003123"
                     /db_xref="InterPro:IPR013995"
                     /db_xref="UniProtKB/TrEMBL:C5DV57"
                     /translation="MTTKEETRALHTPPMSNTKFDTTQSIKESYRPQSGVTQEDSNEG
                     QGNGNSGSQSHCHNHVELSKEDIDREVNSIEQLPVELSKLIDLFINDLKQPKYVKPLT
                     IIQLSSLFQNFYIKFDKASFQYLSTSHSNSNGTSNGNGGNNNNGNTDTNNSNNVNGNN
                     NNLNGNGNGNGNSNDSQPAFLVARETLSSGLSGIFARSRSGSGSSLRRGRRSSSLFSV
                     DSNNVQPLLSPEEIQKQLRTNELNNYKIDKFMSLCEREVFRRILEVGTSVASPSKEEL
                     VTRSNHQKKTFNVSSLFRNSPEFIEFDKVLYEKLHALSTMATQNKIDLVEFLRLPIGK
                     NPDLESQEGFDGAKELLTNLVSHTIAPCEKIAVILKIHESMMFSQEMCNDDFLSMLVY
                     YIIKVCPKNIFLNAQFIKLFRNKKKLVQQEMYALTNFEAALVFVEGLTFTDFIPSSQE
                     KLTNSEKDILQTPVSNKISLPSPLKNSGAVNVDVTLHETHPEAMRSNSYDGFKYAFDT
                     SLKNIFGKIRSYTPPVQPINLPRSSSTLSLEADKKISTSPTRAAVGSQPVTATPSSST
                     TTTATATATQLPEVWKKYKDRKFEDLKVSDMKEIFEIYQKLMG"
     gene            complement(<332174..>333142)
                     /locus_tag="ZYRO0D04070g"
                     /db_xref="GeneID:8203860"
     mRNA            complement(<332174..>333142)
                     /locus_tag="ZYRO0D04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496565.1"
                     /db_xref="GeneID:8203860"
     CDS             complement(332174..333142)
                     /locus_tag="ZYRO0D04070g"
                     /note="similar to uniprot|Q12051 Saccharomyces cerevisiae
                     YPL069C BTS1 Geranylgeranyl diphosphate synthase increases
                     the intracellular pool of geranylgeranyl diphosphate
                     suppressor of bet2 mutation that causes defective
                     geranylgeranylation of small GTP-binding proteins that
                     mediate vesicular traffic"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496610.1"
                     /db_xref="GeneID:8203860"
                     /db_xref="GOA:C5DV58"
                     /db_xref="InterPro:IPR000092"
                     /db_xref="InterPro:IPR008949"
                     /db_xref="InterPro:IPR017446"
                     /db_xref="UniProtKB/TrEMBL:C5DV58"
                     /translation="MMDVEKLVKQSPIWDDRDETAIVEPYDYIVSKPGKSFRSKLINV
                     FNEIYQIPIEKTNQISTLVAILHNASLLIDDIEDSSATRRGIPTSHTLFGVPLTINAA
                     NYMYFKAMEILQTISGDDKILLHDLMVIFNQEMINLHRGQGLDIYWRDNLLQFIPDEA
                     TYYNMVMNKTGGLFRLTVRIMELLTDVELPHSLVPLSNLLGIIYQIRDDYQNLSNEQM
                     IANKGLAEDISEGKLSFPIIHGLKYGQSQNETILQDVLRLRTDDVELKKRALDYLNNE
                     SHSLEYTWEKLEELSKLAKSENYIPRKNFPDASNKLMSVVDYLSTR"
     gene            <333298..>333930
                     /locus_tag="ZYRO0D04092g"
                     /db_xref="GeneID:8203861"
     mRNA            <333298..>333930
                     /locus_tag="ZYRO0D04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496566.1"
                     /db_xref="GeneID:8203861"
     CDS             333298..333930
                     /locus_tag="ZYRO0D04092g"
                     /note="similar to uniprot|P38307 Saccharomyces cerevisiae
                     YBR201W DER1 Endoplasmic reticulum membrane protein
                     required for the protein degradation process associated
                     with the ER involved in the retrograde transport of
                     misfolded or unassembled proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496611.1"
                     /db_xref="GeneID:8203861"
                     /db_xref="InterPro:IPR007599"
                     /db_xref="UniProtKB/TrEMBL:C5DV59"
                     /translation="MDAVLLNLVGDVPIVTKVWAIGCVGLSLLASTHTIDATKMIYDF
                     DLVFKKGQYERIIYSLFYYGPLKWTSVLDIFLTVSRLTELENSFPNKRRYCWMISMLL
                     MVVIAMSSVAQPITSLGAILLDNLIYYQMRKNERMMNERFVGGLNISPLIVPLYTNAE
                     LLFVYKLSWLQVAMNIIPAHLIYYCDDVVHKLYEIDLCQTPYDYIVNRYF"
     gene            complement(<334238..>334801)
                     /locus_tag="ZYRO0D04114g"
                     /db_xref="GeneID:8203862"
     mRNA            complement(<334238..>334801)
                     /locus_tag="ZYRO0D04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496567.1"
                     /db_xref="GeneID:8203862"
     CDS             complement(334238..334801)
                     /locus_tag="ZYRO0D04114g"
                     /note="similar to gnl|GLV|CAGL0H05225g Candida glabrata
                     CAGL0H05225g and weakly similar to YPL067C uniprot|Q6Q586
                     Saccharomyces cerevisiae YPL067C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496612.1"
                     /db_xref="GeneID:8203862"
                     /db_xref="InterPro:IPR022036"
                     /db_xref="UniProtKB/TrEMBL:C5DV60"
                     /translation="MTILWQEARSYVGSGRLELLKRSPEGTEKYRKHKQTLTGDISID
                     VCGKLGWDPQEIIELNTVKFPNPAQKVDAVFSSSKWFKTTVNDFPYDFESGVHHLLIW
                     SKVSLPLYGENSETIQNEVYNKISNFLKYNLEIHYRLDPQDYLFFINYSNLQSVKAIS
                     HIHLLLHSDESIANKILSDQLKPYIEY"
     gene            336286..336357
                     /locus_tag="ZYRO0D04136r"
                     /db_xref="GeneID:8203863"
     tRNA            336286..336357
                     /locus_tag="ZYRO0D04136r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=60.23"
                     /db_xref="GeneID:8203863"
     gene            <336740..>341503
                     /locus_tag="ZYRO0D04158g"
                     /db_xref="GeneID:8203864"
     mRNA            <336740..>341503
                     /locus_tag="ZYRO0D04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496568.1"
                     /db_xref="GeneID:8203864"
     CDS             336740..341503
                     /locus_tag="ZYRO0D04158g"
                     /note="similar to uniprot|P19524 Saccharomyces cerevisiae
                     YOR326W MYO2 One of two type V myosins involved in
                     polarized distribution of mitochondria required for
                     mitochondrion and vacuole inheritance and nuclear spindle
                     orientation moves multiple cargo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496613.1"
                     /db_xref="GeneID:8203864"
                     /db_xref="GOA:C5DV61"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR001609"
                     /db_xref="InterPro:IPR002710"
                     /db_xref="InterPro:IPR008989"
                     /db_xref="InterPro:IPR018444"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DV61"
                     /translation="MSFEVGTRCWYPHDKEGWMGGEVTKHEFNDGKHHLELTLEDGSV
                     IPIVTKSLVKEGSISNEDSSQKLPQLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYS
                     QLNIYTYSGIVLIATNPFDRVDQLYSQDMIQAYAGKRRGELEPHLFAIAEDAYRMMKN
                     DKKNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSNAMDNVQHQVEMSETEQRILAT
                     NPIMEAFGNAKTTRNDNSSRFGKYLEILFDKNTSIIGARIRTYLLERSRLVYQPKVER
                     NYHIFYQLLSGLPQEVKKELHLTSAEDYTYMNQGGETEIPGVDDAQEYKTTVDALTLV
                     GVDQEVQSQVFKILAALLHIGNIEIKKTRNDASLPSDEPNLQIACDLLGIDSFEFAKW
                     ITKKQINTRSEKIVSNLNYAQAVVARDSVAKFIYSALFDWLVENINTVLCNPEVSDQV
                     ESFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFI
                     EFNDNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQTLDKPPTNKVFSKPRF
                     GQTKFVVSHYAHDVAYDVEGFIEKNRDTVSDGHLEVLKSTKSGTLQSILKNLEEAAAR
                     LEEAKKAQQEQAQKRPGPARTVQRKPTLGSMFKQSLIELMDTINSTNVHYIRCIKPNS
                     EKEPWKFDNLMVLSQLRACGVLETIRISCAGFPSRWTFSEFVLRYYLLIPSNEWSKIL
                     GSEGPTEGSVVQICKMILDATVTDSDKYQIGNTKIFFKAGMLAYFEKLRSDKIRTSSV
                     LIQKNIRAKYQRKQYLATQRSLRMLGAHAYGLIVRHRVQDKFMTKAAVMVQTLHRAKV
                     VRERISSILDSVVRIQFLVKRQLSARERKATYESNAALAIQSRIRSFQPRKKYNNNKR
                     DVVKVQALVRRRSAMAKLQTLKSEAKSVNHLQEVSYQLENKVIELTQNLASKVKANKE
                     MTARIAELQAALAASATLQSQIEEQKREHSKALENQAMAHDHVYKDLEDQKKEAELQM
                     QQVGQEVRSITEKYNKIKEDSKSALEELENTKIQLRDSKTQNSDLHDQVKSLKEEISR
                     LQNNMASGAGFVQTPRNSMRYSMNGSDILSPGQKNLISMNGPSTTVPFTGLGIEGTNG
                     MSDNKSTMSTLSQINDELYRLLEDTKVLNEEVTEGLIKAFKVPDSGVAIQLSEREVLY
                     PARILIIILSDMWRLGLTKQSEGFLAEVLTTIQKVVQGLKGADVIPGGAFWLTNVREL
                     YSFVIFAQESILNDESYNKGLTEDEYKEYVVLVTELREDFESLSYNIYNIWLKKLQKD
                     LQKKAVPAVILSESLPGFKNEPNRFLSNLFGSGPEYTMDDILTFFNSIYWCMKSFHVE
                     NDVFRNTVLILLNYVDAICFNDLIMRRNFLSWKRGLQLNYNVTRLEEWCKTHYIPEGA
                     ECLQHLVQTSKLLQLRKQDLDDIKLLCEICTALKPAQMQKLMTQYAVADYEAPISVEI
                     LNYVAEKVKKGASLSSDGKSKVHSDDIFLQTETGPFEDPYVGMETRQFRKIEAYIPAW
                     LNLPTTRRVVELVTRQVSVQESSPLYDGSGKEEEN"
     gene            complement(<341949..>342342)
                     /locus_tag="ZYRO0D04180g"
                     /db_xref="GeneID:8203865"
     mRNA            complement(join(<341949..342197,342262..>342342))
                     /locus_tag="ZYRO0D04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496569.1"
                     /db_xref="GeneID:8203865"
     CDS             complement(join(341949..342197,342262..342342))
                     /locus_tag="ZYRO0D04180g"
                     /note="similar to uniprot|P33328 Saccharomyces cerevisiae
                     YOR327C SNC2 mediate the targeting and transport of
                     secretory proteins vesicle-associated membrane protein
                     (synaptobrevin) homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496614.1"
                     /db_xref="GeneID:8203865"
                     /db_xref="GOA:C5DV62"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR016444"
                     /db_xref="UniProtKB/TrEMBL:C5DV62"
                     /translation="MSSSVPYDPYIPPEETGGPNKAAALKAEIDDTVGIMRDNINKVA
                     ERGERLTTIEDKADNLAVSAQGFKRGANRVRKQMWWKDLKMRLCLFFVCIILIVVIVV
                     PIVVHFS"
     gene            complement(<343217..>345658)
                     /locus_tag="ZYRO0D04202g"
                     /db_xref="GeneID:8203866"
     mRNA            complement(<343217..>345658)
                     /locus_tag="ZYRO0D04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496570.1"
                     /db_xref="GeneID:8203866"
     CDS             complement(343217..345658)
                     /locus_tag="ZYRO0D04202g"
                     /note="some similarities with uniprot|P34758 Saccharomyces
                     cerevisiae YOR329C SCD5 Multicopy suppressor of clathrin
                     deficiency and of ts ipl1 mutants"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496615.1"
                     /db_xref="GeneID:8203866"
                     /db_xref="UniProtKB/TrEMBL:C5DV63"
                     /translation="MSFEWLNIPGLSTADDSGSTGSSVSQPPPSVSFNFGGPNVDHLQ
                     QPNPTLHSQSQGSIGGQGHNTDGSNGWGGNHHPSMGNGVQYQNGQYSQQFPQHYPQQH
                     PQQHPQQHPQQYSQHYAQQQYPQQYSHYPSQQNQGGSHGQAGQVIQDDYRESPEDLRV
                     PLSLSHSQLTKEEIQTYLRWYTYITARTHVKLVRLGDVFRFLCNFRLSERLKARVTSI
                     FRTCKNALNIGQFFAVLRLISKSLLEDILPERKMVLDKVPVPKPRPILCTDSKGETYE
                     EVEEENGEGGDKVDFDSFASMLLTGNKPGKKRLRRKVVSSTHRDKRVRFSENVTFQDP
                     PSESADDSNGAAPVDDEDDVVDFSLPMDQLLKRMAKKKERNSALVSQLPNEQHETEEE
                     KEVLEDMKDSLSHFKQIQTPDMPGVSEQMASGIIPSTTSINTPNGGNDGQQPQQIPLQ
                     PLKPTSTGSANYLFKSAFQPKITGGDSSGNGSQQDQTELQPLKPTATGSANYLVRSQF
                     DAQIQPQHSQPQQHQPQPQQQQPQPHQQQPQPQQQPQSQQQPTTGGLPLLKPTATGSA
                     NYLMKSQFDQQPIGGSEPRLSPNTIASPAISPDKVSSPQNTNQYMNLNQPPKNQQPLQ
                     YQQPVLQQQTSPPPSQYQQPILQPQSSPQPPNPNLLAAPNPAQNYFQSLLSPSPSPSQ
                     PNLNVPGGPSNLNVPNVTPSPSPYISSPNLSSQQGSTQRQQPIMYNNGYQYPSPIHPQ
                     QSSQQQPQYYGTPQQQMQYSQQMYPNNISPMRGQNNYPMSTPSQNYGNRGNILGDLHS
                     LQQQVDALQNVYGRR"
     gene            <345859..>346599
                     /locus_tag="ZYRO0D04224g"
                     /db_xref="GeneID:8203867"
     mRNA            <345859..>346599
                     /locus_tag="ZYRO0D04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496571.1"
                     /db_xref="GeneID:8203867"
     CDS             345859..346599
                     /locus_tag="ZYRO0D04224g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496616.1"
                     /db_xref="GeneID:8203867"
                     /db_xref="InterPro:IPR018612"
                     /db_xref="UniProtKB/TrEMBL:C5DV64"
                     /translation="MAKRKKPSVFNDDNGAGDDEDGFMNYVREKADQSRKRAKDSSGD
                     VKIAEQEILNQELSHDAVSGELESSGSKYMDQLLESRKRRELDRLHAQSIKMRLERKL
                     EGAEDSEEIITDGYRQKKEKYERADELAQDEQNREVIDSNNSILGADGVALKMIATKK
                     PQENYQPPLELIENPSKPAETHYSNDVYVNESIKSSSTWEKQDDLNPVKKLECVKKFL
                     RSEKNKQDIDILVKQYSERHNSIKKFDN"
     gene            complement(<346620..>350339)
                     /locus_tag="ZYRO0D04246g"
                     /db_xref="GeneID:8203868"
     mRNA            complement(<346620..>350339)
                     /locus_tag="ZYRO0D04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496572.1"
                     /db_xref="GeneID:8203868"
     CDS             complement(346620..350339)
                     /locus_tag="ZYRO0D04246g"
                     /note="similar to uniprot|P15801 Saccharomyces cerevisiae
                     YOR330C MIP1 Catalytic subunit of the mitochondrial DNA
                     polymerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496617.1"
                     /db_xref="GeneID:8203868"
                     /db_xref="GOA:C5DV65"
                     /db_xref="InterPro:IPR001098"
                     /db_xref="InterPro:IPR002297"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR016265"
                     /db_xref="InterPro:IPR019760"
                     /db_xref="UniProtKB/TrEMBL:C5DV65"
                     /translation="MSSRVRISYLYHTSASSMSLRCCRLYRHRSYSTTTKPAAVPEEP
                     TINPVGIQYLSRNLHKQLFTGKVLSHNEDPITPEERVGLIDLSRRFLKTYHLLGKKTS
                     ISEPLSMELPKLQGDSLDEHFQRLGHFASEPYKSMCQAKFTKIVGRPKKWIRKQGWMR
                     YEPGKEPEPVPWPLEDTLVFDVETLYKISQYPTLAVALSDKAWYLWCSPFICGSDSFE
                     HLIPLNTQERTGLVIGHNVGYDRARVLEEYNLKPSKTFFLDTQSLHVASSGLCSRQRP
                     KFLKTHNVKRRSAAEDEDEIEADQLSSALANTDGMDPELEEDPWLRVSAMNSLKDVAL
                     LHCGIRIDKDPRDRFATTDKNEVIQDFQNLVEYCATDVDTTSQVFDKVWPLFLQKCPH
                     PVSFGALRSLSSCILPTQYNEWTDYLNRSERIYLKSKQSIEDKITEIVEDTVKLRDEM
                     SAEEIHKDPWLRQLDWTTKPLKLTKKGVPVKNQKLPGYPEWYRSLFPNKTETRPQVTI
                     KSRNIPIFFKLSWEGYPTIWTSCGWCFATPADLMDKFKAKNYRVADEDIIETYRSETN
                     GMCPGAADNQVLFRIPHPNGPQSACTTLLSKPYIHYFEKGILTSGSDFAREALHMNSS
                     GSYWMAARERIMNQFNVPSSRFPNQFNRLDGSPQTSNRDDLGIILPGIVPMGTVTRRA
                     VENTWLTASNAKENRIGSELKTQVKAPKGYSFVGADVDSEELWIASLVSDSVFNIHGG
                     TAIGWMCLEGTKNEGTDLHTKTAQILGCNRNEAKIFNYGRIYGAGVKFATQLLKKFNP
                     SLPDEEAQGIANQLYENTKGKIQRSKIFKKFWFGGSESILFNKLESIAEQDEPRTPVL
                     GCGITFSLMKRNLRTNTFLPSRINWTIQSSGVDYLHLLCCSMNYLIATYHIKARLCIS
                     IHDEIRFLVADEDKYRASMALQVSNIWTRAIFCEQLGINDLPQNCAFFSAVDIDKLLR
                     KEVDMDCITPSNPNPIPHGESIDMKTLLEKPGAMLTNPDPAVNVSHFPASYREPVFSK
                     YNKAHNKQYRKYLLKMQLQNAKWKVDDLEKAYLQETQEFVLKRKTDTTYSLLDYLKDI
                     RQDKNKKKSIMDTTMFGTEDEMFTLEQQVAAAFEESQAVRGRQQKNSKTSNKRKALYR
                     GNKAFEAFYSSVDKPPEQVHSLSQSLEVPVDDVVQDLISNTSRTPKRARKSVKRTTST
                     KRTSPNKEKKTNGEHEKTSININDRSERFTQHKLH"
     gene            <351145..>351837
                     /locus_tag="ZYRO0D04268g"
                     /db_xref="GeneID:8203869"
     mRNA            <351145..>351837
                     /locus_tag="ZYRO0D04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496573.1"
                     /db_xref="GeneID:8203869"
     CDS             351145..351837
                     /locus_tag="ZYRO0D04268g"
                     /note="similar to uniprot|P22203 Saccharomyces cerevisiae
                     YOR332W VMA4 vacuolar ATPase V1 domain subunit E (27 kDa)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496618.1"
                     /db_xref="GeneID:8203869"
                     /db_xref="GOA:C5DV66"
                     /db_xref="InterPro:IPR002842"
                     /db_xref="UniProtKB/TrEMBL:C5DV66"
                     /translation="MSSVITALTPNQVNDELNKMQAFIRKEAEEKAREIQLKADQEYE
                     IEKTSIVRNEISNIDANFEDKMKKASLKQQITKSTVSNKMRLKVLSAREECLDAVFDK
                     ALEDLKKLVRKEKDYKPILKSLILEATLRLLESKIIVKVTAKDKKLVESLAGSISEDY
                     KEKTGNHLEISISEEGLDKNTAGGAVVTNSDGKIVVDNTLECRLSMLSETALPAIRLE
                     LFGRSKSRRFLD"
     gene            <352089..>353417
                     /locus_tag="ZYRO0D04290g"
                     /db_xref="GeneID:8203870"
     mRNA            <352089..>353417
                     /locus_tag="ZYRO0D04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496574.1"
                     /db_xref="GeneID:8203870"
     CDS             352089..353417
                     /locus_tag="ZYRO0D04290g"
                     /note="similar to uniprot|Q01926 Saccharomyces cerevisiae
                     YOR334W MRS2 Mitochondrial inner membrane Mg(2) channel
                     required for maintenance of intramitochondrial Mg(2)
                     concentrations at the correct level to support splicing of
                     group II introns"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496619.1"
                     /db_xref="GeneID:8203870"
                     /db_xref="GOA:C5DV67"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:C5DV67"
                     /translation="MQQFFRNIPRFRFLGRLNPTRFVSTTDTSSRRLPLTTKNKQLLS
                     LKPITPSDSYVSCTIFNDRGDVTAVSQKFPKWTFLRDHSLYPRDLRKIDTTTVDIIPS
                     ILVKPHCIVVNMLHIKALIERDKVYVFDTSNPSAAAKLGVLMYDLESKLSSRRGPTVN
                     GTTPQAYEHSALESMLINVMSDLETEYKIHHALCGHILSELENEVDRDKLRDLLIKSK
                     NLSLFYQKSLLIREMLDELLENDEDLAGMYLEVKKTEEDDFADLEMLLETYYTQCDEY
                     VQQAESLIQDIKSTEEIVNIILDANRNALMLLELKVTIYTLGFTVATLVPAFYGMNLK
                     NFIEENNWGFLSVVIFSVTSALVVTAANFRALRSITRLTMLNNHSGARSPRHKQMATQ
                     YAEEHIPLLWQRCKRWTNDIWHGKARSNRFKQGQEDREIIWRWLLDDERK"
     gene            <353905..>356664
                     /locus_tag="ZYRO0D04312g"
                     /db_xref="GeneID:8203871"
     mRNA            <353905..>356664
                     /locus_tag="ZYRO0D04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496575.1"
                     /db_xref="GeneID:8203871"
     CDS             353905..356664
                     /locus_tag="ZYRO0D04312g"
                     /note="weakly similar to uniprot|P39732 Saccharomyces
                     cerevisiae YAL031C FUN21 Cytoplasmic protein of unknown
                     function potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496620.1"
                     /db_xref="GeneID:8203871"
                     /db_xref="GOA:C5DV68"
                     /db_xref="InterPro:IPR026241"
                     /db_xref="UniProtKB/TrEMBL:C5DV68"
                     /translation="MFAVAAAHATRLAKVKGAQHLDIYDVRIIQYRSAILRLSEAIRL
                     LEVLEKNLEKRQDAGKTIIPLINYVLSLCEGPVFNIHPVLRKRFTLLSEFKLTKLNEV
                     NPPLSPFGVEYDVDFAPFVVDLSQLRENVYNSNLQWKLMGCLQAISQNALDIYEKKLK
                     HVSMERASKRPADFPGKVLPLNYGAIDDILRPFEMELCLDWAVLINDREQDTSFKSLR
                     KLQSQVLTKFLSNINEKVFPVIRTYFNQLQKAYNNRSPAVANLKELPHWEFSVHRLYS
                     YIYRIICVLDVMVNLTRQLWLPNRDYFYSLRSQLSSENVYAYNEILDKIDSICNEPKR
                     HVTGTILAILDSCSNPNLNISVTANTVPEIFANSICKVTPILRNTLQSITSWLEVWKF
                     VDNNHDSHEKLASLNEEQLSNMLQERLAVDKLNQAEMQQRTNRLSPDVTPSAAGGLSR
                     TGSTIRRSHSKRLSTPTSPSTSSNISSPGKVSPLKMSPANSVDKPSARGPNISSPQLS
                     RRSSIVDIRISSPTSHSGSPQISGKNSLADSRVAGSVPMKNAGDQKCTPRSPLANRTA
                     NGRPRSSSLQSGHDEDTNTNRKVALPSRSTSLQAHATVNQKRIQDSFAQLTRSRSING
                     SSNISGSPNGRKMQQTTRKTRTPTLTGNPPTSSRQGFKSTSETSPLPEMEELSIGSGG
                     GHERKRQHEEQNGEESSPNGLSSPQKRTQQQQEQETPSGDKQQEKEQPQGQQEEKHGQ
                     QLPYEHHKYFDHKVADEQNGLPLIKKPEESGQEPLEKEESEEREQSAEPQQARSEQSS
                     YHGAESMSAQEADDAHSVQKKVRFAGVGPMTEDELTRPTRRGWYRKPAVLHYPPPPPQ
                     YLSQKFRLRQEGMAFRTSLREENGKEPTNKRNSMVTTFDELAPPPQKESVSHRFASIL
                     REKLK"
     gene            <356897..>358240
                     /locus_tag="ZYRO0D04334g"
                     /db_xref="GeneID:8203872"
     mRNA            <356897..>358240
                     /locus_tag="ZYRO0D04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496576.1"
                     /db_xref="GeneID:8203872"
     CDS             356897..358240
                     /locus_tag="ZYRO0D04334g"
                     /note="similar to uniprot|P28004 Saccharomyces cerevisiae
                     YAL032C PRP45 Ortholog of human transcriptional
                     coactivator SKIP can activate transcription of a reporter
                     gene interacts with splicing factors Prp22p and Prp46p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496621.1"
                     /db_xref="GeneID:8203872"
                     /db_xref="GOA:C5DV69"
                     /db_xref="InterPro:IPR004015"
                     /db_xref="InterPro:IPR017862"
                     /db_xref="UniProtKB/TrEMBL:C5DV69"
                     /translation="MSFTSLLPAPKHSQSVPEDNFNAEQKNKELAVRALTHQKDEQDI
                     ERSVFDSAITNNLKFQDFVPIRQKDFGLQIPLPSQNEIDETYRRTKGIFEQILLKNTQ
                     PEAATIRNNQRALENTQEILVHSTGGKSNRKLKVIEHAKDPLQPNAHRAKKVVAPPVD
                     EPMTPIFHKTDSVETAKKVSKEEKDMWKIPPAISSWKNPNGYTIGIDKRLAMDGRYNK
                     DKMQAHEINDGFSQLSAALEMADRKARQELKLKAEAKKQIAEDENREKGEKLRILAQK
                     AREERSRQRNKRSHRAIDDGYNNEATHREAIRKSRREELERDIRKSKMSTADRLRELA
                     YSQGREVSEKVVLGAAKSTNSSGAHYDSRLFTKGANTQAKRGEGQVYDNPLFSQLGSS
                     YRANLNKLDKDVEDEASMSAGQTKPIEFTAATDNNDADKEKEEHKEYGLSKKDDL"
     gene            complement(<358284..>358790)
                     /locus_tag="ZYRO0D04356g"
                     /db_xref="GeneID:8203873"
     mRNA            complement(<358284..>358790)
                     /locus_tag="ZYRO0D04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496577.1"
                     /db_xref="GeneID:8203873"
     CDS             complement(358284..358790)
                     /locus_tag="ZYRO0D04356g"
                     /note="similar to uniprot|P28005 Saccharomyces cerevisiae
                     YAL033W POP5 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496622.1"
                     /db_xref="GeneID:8203873"
                     /db_xref="GOA:C5DV70"
                     /db_xref="InterPro:IPR002759"
                     /db_xref="UniProtKB/TrEMBL:C5DV70"
                     /translation="MVRLKTRYILFEVLYPCDTPQAKQSSESRAINTGILLRHHRVSP
                     SQISAKTIAQEVRRSLQTNFGDYGLGKAGSLLQVKYFSNRTSTGIIRCHREDTDLVLM
                     ALCLTNRIGEVDSLILNAVKVSGTIKKVEQYAIRRSQRFLAAVQRNDKDILDDFTNVT
                     ANEEDQDD"
     gene            complement(<358976..>361846)
                     /locus_tag="ZYRO0D04378g"
                     /db_xref="GeneID:8203874"
     mRNA            complement(<358976..>361846)
                     /locus_tag="ZYRO0D04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496578.1"
                     /db_xref="GeneID:8203874"
     CDS             complement(358976..361846)
                     /locus_tag="ZYRO0D04378g"
                     /note="highly similar to uniprot|P40825 Saccharomyces
                     cerevisiae YOR335C ALA1 Cytoplasmic alanyl-tRNA synthetase
                     required for protein synthesis point mutation (cdc64-1
                     allele) causes cell cycle arrest at G1 lethality of null
                     mutation is functionally complemented by human homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496623.1"
                     /db_xref="GeneID:8203874"
                     /db_xref="GOA:C5DV71"
                     /db_xref="InterPro:IPR002318"
                     /db_xref="InterPro:IPR003156"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018162"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="InterPro:IPR018164"
                     /db_xref="InterPro:IPR018165"
                     /db_xref="InterPro:IPR023033"
                     /db_xref="UniProtKB/TrEMBL:C5DV71"
                     /translation="MTIGDREKWTATNVRKAFLDFFKSKDHKFVASSPVVPYDDPTLL
                     FANAGMNQYKPIFLGTVDPSSDFYHLKRAYNSQKCIRAGGKHNDLEDVGKDSYHHTFF
                     EMLGNWSFGDYFKQGAISYAWELLTKVYGLPADRLYVTYFEGDPKNGLEADMEAFELW
                     KSVGVDESHILPGNAEDNFWEMGDQGPCGPCSEIHFDRIGGRNAASLVNMDDPDVLEV
                     WNLVFMQFNREQDGSLKPLPAKHIDTGMGFERVVSILQDYRSNYDTDVFTPLFARIHE
                     VTGVRPYAGKFGAEDTDGIDTAYRVLADHVRTLVFAIADGGVPNNEGRGYVLRRILRR
                     GARFARKYMNYPIGDFFSRLVPTLISQVQDIFPEVAKDPSYLFEILNEEEVSFAKTLD
                     RGERLFEKYADAATSSGKKTLDGLQVWRLYDTYGFPVDLTELMAEEKGLTIDGPGFEK
                     AKQESYEASKRGGKKDGAEVLKLNVHEISELNGENVPKTKDEYKYGMENVDSTILKLH
                     DGTKFVNEISEPGKKYGVILDKTCFYAEQGGQEYDTGKLVIDDVAEFNVENVQLYNGF
                     VFHTGSLLEGKLSVGNKIIASYDELRRFPIKNNHTGTHILNFALREVLGNDIEQKGSL
                     VAPEKLRFDFSHKKGMAADEILKVEDICNKQIKENMSVYYKDVPLTDAKSIYGVRAVF
                     GETYPDPVRVVSVGKSVDDLLANPSNEEWSKYSVEFCGGTHVVKTGDIKVFVILEESG
                     IAKGIRRIVAVTGSEAYEAQRIANEFDKELNAVDRLPFSPLKEKKLKELSVKLGQLSI
                     SVVSKQELKTKFAKIEKVVKDEIKTRAKQESKKTLDEVKEYFAKNENSQFLAKFVDIP
                     TNAKAITEAVNYVKSSAKDKSIYLFTGNDPEGKIAHGCYISDAALSKGIDGSTVAKQV
                     SGIIGGKAGGRGNVFQGMGDKPTAAGDAVAEVEKLFKEKLQL"
     gene            <362190..>366239
                     /locus_tag="ZYRO0D04400g"
                     /db_xref="GeneID:8203875"
     mRNA            <362190..>366239
                     /locus_tag="ZYRO0D04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496579.1"
                     /db_xref="GeneID:8203875"
     CDS             362190..366239
                     /locus_tag="ZYRO0D04400g"
                     /note="similar to uniprot|P22023 Saccharomyces cerevisiae
                     YOR336W KRE5 Protein required for beta-1 6 glucan
                     biosynthesis mutations result in aberrant morphology and
                     severe growth defects"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496624.1"
                     /db_xref="GeneID:8203875"
                     /db_xref="GOA:C5DV72"
                     /db_xref="InterPro:IPR009448"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DV72"
                     /translation="MKLITAGIVFLTVLKTVVCLSVSLQSASVSERFKIWTIAQHLFR
                     GDKKGILATVYPLVMQLDEDLEDTPVANLCEVVSARLSELGELDLASLMPLYCQWYPM
                     GLPFPSSYDHLKSETYFVLNNKRYDHSDDVFYLKSGELKKQAQMPDEAVVAVNDVIIG
                     NNPEAPIVYFYGCPDDDEATFEEFNRNLYSEATETGKLRFIWRSTCHVRNDTEIGPFP
                     VELSIRDGKSNIDVLPIDHLGVPHQFDKSKYGLINPTTNQLSDLDLKVAHLIAQKYNS
                     SKDFNSTLDYARGIINNFPLLVPELITMKNNTEAIMDSNTNLTESGVDHKLLGLFING
                     ENWRFSSLDQYTLLNALESEYRRLKQLLSGLVKMYSKSTLVTAKDLITKFSQISIPNL
                     QQSQPIKVDLHRISGFSESVIYFNDIEIDDQYRELTTDINKFFEKSKFGEIPEYRHNW
                     NELIFVIDFNNLEDPDTKLALDGLKRAIGVITQGYPQRIGLLPLNTGASDDIIRKIYE
                     LKDRDLLELEDFLGNELIRGRTISSDYTNTPGVAKLLRNLQINETSIIINGEIYPFRK
                     NTWHYLIAKTIKKDVGYLKRELRKYIRHDGEKAQPIIDVRGVLHMKSSETRHMKYTPD
                     YFADSTYTTLDNSALQVWDERILEYVKGKEYNLLHTITLVDDFNTLQALKRLHNLIGI
                     KFVGVKFRIIHSGALESNWKILKKISSKPSFLKELKSLIKKSARVISTNELNRNVLQS
                     WLVDLKPEFLSAKSFMLINGRFIHFEENEIPQIKLFETTIKREAQRTIDALEALETIL
                     PGVTSNKIDPEFMENISATLTKMFYQGTELYGNGPVFTTESTLSRFDMSEILQVNNFT
                     IFESSNDGDKPIDVVLVIDPLEERSQRLLSLITDIQQLPFLNVKIVIYPTADLKFMPI
                     DRIYVPNFPDELGGKLTDIESKFDVAVEVPRNFVLNDNKNVGGYLVEVHAFDERQPVS
                     EGIIDGLGNVCLELVDSTGKSVDKTVTMMTFGYGQFIVPKLGSNFTIKSCDPRYKVVS
                     FSSDARADYMPMESVNVTSLNPVVTYVKLQKVDEVAKITVEESVINIFTIPKNEHSFE
                     QEYQKMVLHILHSPQHGYMGVKFWLLDQPFISQSLRKFIDVINLDPKLDGNIELVKYE
                     WPPWLRPQRFLERRMDAYKILFLDLLFPQSVSRIIYMDPSISQLPDPFKLNEKVKTKL
                     PFAMYKMVGHGYWETHYWAQRLGDRNLKFHSVHPAFVVNLQQLREYNGGNKLRIHYQR
                     LSADVLSLAKIDQDLINDAQEEVPIRTLSSSTIVFLNTKNQNSVNAWLTNFQKLAAKE
                     ETAGFATDENPGIKQEGTRETIDLMHDEL"
     gene            <366583..>368877
                     /locus_tag="ZYRO0D04422g"
                     /db_xref="GeneID:8203876"
     mRNA            <366583..>368877
                     /locus_tag="ZYRO0D04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496580.1"
                     /db_xref="GeneID:8203876"
     CDS             366583..368877
                     /locus_tag="ZYRO0D04422g"
                     /note="similar to uniprot|P47988 Saccharomyces cerevisiae
                     YOR337W TEA1 Mutants are defective in Ty1
                     Enhancer-mediated Activation Ty1 enhancer activator and to
                     YLR098C uniprot|P43634 Saccharomyces cerevisiae YLR098C
                     CHA4 Zinc-finger protein with Zn[2]-Cys[6] fungal-type
                     binuclear cluster domain DNA-binding transcriptional
                     activator or CHA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496625.1"
                     /db_xref="GeneID:8203876"
                     /db_xref="GOA:C5DV73"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DV73"
                     /translation="MCSIDFDLNNVVKQETIENNAGTHQGLNLFSQHQPSPIQVPQQQ
                     QQQQPQFQAQSQQQQQQVQLPPGTKRLACSNCRRRRKKCDLNFPCGNCIKLKLTCNIN
                     GEDLRKKRYSASYVKSLESHIAYLENSFKDLVERACPEDSDLRKNLMLDDIVSGFMSA
                     PSNSDNSNFNNRPAASMETDPIVDEETDSMRALLEFAGTKRNTVTPELPTEPPEKKKK
                     KTFHKGSLYPDDTKSQSFTNLAAAPAMMALGSSTSSSSSQNEMSITAALDKTISDERI
                     SDLKKTVIVRPSGDGLNQNSLNNDPKILKSLSNFYRWLYPGHFIFLHRESFLYGFFNH
                     AKNNYRGSPYCSVELIYAMCAVGSRLSSDLQPMSEEYYERSKTALLKLVFDDHSVARI
                     TTVQALFCLAFYELGKGDTQLAWYFSGLAIRVGYDMGFQLDPEVWITADDDIVTGRTK
                     LTKSELRIRSRIYWGCFVADHLISLLLGRTTSLSVSNSTIPESDELPEIEGVEDFRFA
                     SQHVLQVSLPLKNMIILSRIVQIFTTQIFIETLETKHKVAHLIRFNLKVFNWRQLLPD
                     FLKWSKEKLRDHDISTDPTISYFWYLYYIVLLTFNKPFIEDCEESKTVVGELVDDVKM
                     LFDGFRIKFGGFQKASLCQLYTCLLAINSLIKLTCYAEVGSVGAGTKFSARPPHTPQC
                     DHSPQCTKRLEQLGFFSNVFHYHMSPQFGLPKRLQEDAKYNSEQEKQTVNQVCNSSYI
                     HDFTLSNEIDDMIKELFGLGDVLL"
     gene            <369376..>370431
                     /locus_tag="ZYRO0D04444g"
                     /db_xref="GeneID:8203877"
     mRNA            <369376..>370431
                     /locus_tag="ZYRO0D04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496581.1"
                     /db_xref="GeneID:8203877"
     CDS             369376..370431
                     /locus_tag="ZYRO0D04444g"
                     /note="similar to uniprot|Q06855 Saccharomyces cerevisiae
                     YOR338W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496626.1"
                     /db_xref="GeneID:8203877"
                     /db_xref="GOA:C5DV74"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5DV74"
                     /translation="MEFYSPQPEHAQLGSMLGKANERLLSQLHQQVLAATNGNRNNNI
                     GGVNPSTSIDSVLSSGNGSNGEHPIPSPPLSPKFDSHHYKISALPDDLREEEDEDEDD
                     SDSIKVQLSWVPGLSPKRYRYAHSNFLGEYRIFSPHATQPRTRRYNTKKSLDHQERSA
                     QNFNRTRRFMRRHEMLLSDTQDDDDDYSDELQVPKRPSTPQRRRRTAQPLGSPLASAT
                     AVSGIPQYVPNMSWEKLPDYSPDPYKTLPENNSKSLKVEWKGSPMDLSHDPLRHQLHP
                     AELVLSQILRLPCDLYLDSKRRLFLEKVHRLKQGLPFRRTDAQKACRIDVNKASRLYA
                     AFEKVGWLNDSDFRKFL"
     gene            complement(<370627..>371106)
                     /locus_tag="ZYRO0D04466g"
                     /db_xref="GeneID:8203878"
     mRNA            complement(<370627..>371106)
                     /locus_tag="ZYRO0D04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496582.1"
                     /db_xref="GeneID:8203878"
     CDS             complement(370627..371106)
                     /locus_tag="ZYRO0D04466g"
                     /note="highly similar to uniprot|P52492 Saccharomyces
                     cerevisiae YOR339C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496627.1"
                     /db_xref="GeneID:8203878"
                     /db_xref="GOA:C5DV75"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5DV75"
                     /translation="MAKQVHIPEGHSVVKRLQSELVQLMMSPTPGLSAFPNNEDDLRD
                     WSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFISPMWHPNVDMSGNICLDILK
                     DQWSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAELWDKDMVEYKKRLLSRYEEPEE"
     gene            complement(<371247..>372065)
                     /locus_tag="ZYRO0D04488g"
                     /db_xref="GeneID:8203879"
     mRNA            complement(<371247..>372065)
                     /locus_tag="ZYRO0D04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496583.1"
                     /db_xref="GeneID:8203879"
     CDS             complement(371247..372065)
                     /locus_tag="ZYRO0D04488g"
                     /note="similar to uniprot|P39731 Saccharomyces cerevisiae
                     YAL034W-A MTW1 Essential component of the MIND kinetochore
                     complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
                     kinetochore subunits contacting DNA to those contacting
                     microtubules critical to kinetochore assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496628.1"
                     /db_xref="GeneID:8203879"
                     /db_xref="GOA:C5DV76"
                     /db_xref="InterPro:IPR008685"
                     /db_xref="UniProtKB/TrEMBL:C5DV76"
                     /translation="MAAPTMKSTSILTEHLQYPAISLVDDIINAVNEVMYKCTAAMEK
                     YLMEKSIVGGRDHSEEIKIGIAKLESILEQSVDKNFDKLELYVLRNVLRIPQELLDAN
                     VFRLAYQRNLIIPSQSESELSRLQLEEKAKQVENALRINQELKTRITKAKTIKQRIGK
                     FKELVLAAFKTHNDDSPEFQQIVESLTPLDDSLKLLTLQLKQLYLDSEEKVSMDLVQT
                     THQTLEDSGHLRAHYIDRETNRILGPVGENTESPTPEEPIVSSPDLESLKRLTT"
     gene            complement(<372200..>373081)
                     /locus_tag="ZYRO0D04510g"
                     /db_xref="GeneID:8203880"
     mRNA            complement(<372200..>373081)
                     /locus_tag="ZYRO0D04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496584.1"
                     /db_xref="GeneID:8203880"
     CDS             complement(372200..373081)
                     /locus_tag="ZYRO0D04510g"
                     /note="similar to uniprot|P46669 Saccharomyces cerevisiae
                     YOR340C RPA43 RNA polymerase I subunit A43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496629.1"
                     /db_xref="GeneID:8203880"
                     /db_xref="GOA:C5DV77"
                     /db_xref="InterPro:IPR005576"
                     /db_xref="UniProtKB/TrEMBL:C5DV77"
                     /translation="MSSKRSYESVQAARFVREHKKQVKNPINEEDGISNCIIRVAQSL
                     YVSLAPRYQQHPEQGIMKQHLNPMVMKYNSQVNGMVLGYDNLRILDADPLNDENAPNK
                     MVKLTADTPFGFTWCDVNLYVWQPQVGDIIEGWIFIQSASHIGLLIHDAFNASIKKNN
                     IPMDWTFVDEEDNNSREQSQEDTQKFRSLGHWVDQDGGRIDGKLKFKVKSVYTSGRVV
                     SVEGTLLEQPDQGDGSQAQNLPVVSNKKVTFDDEVSTGNRESHKDLELPKMKEDNGEE
                     IVYERDSDSDSSSSDSD"
     gene            <374177..>379180
                     /locus_tag="ZYRO0D04532g"
                     /db_xref="GeneID:8203881"
     mRNA            <374177..>379180
                     /locus_tag="ZYRO0D04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496585.1"
                     /db_xref="GeneID:8203881"
     CDS             374177..379180
                     /locus_tag="ZYRO0D04532g"
                     /note="highly similar to uniprot|P10964 Saccharomyces
                     cerevisiae YOR341W RPA190 RNA polymerase I subunit largest
                     subunit of RNA polymerase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496630.1"
                     /db_xref="GeneID:8203881"
                     /db_xref="GOA:C5DV78"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015699"
                     /db_xref="UniProtKB/TrEMBL:C5DV78"
                     /translation="MDISKPVGSEISSVDFNVFSAEEIRNLSAKQITNPTVLDNLGHP
                     ISGGLYDLALGAFLRNLCATCGLDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSC
                     LYCHRFRLRSIEVNRFACKLRLLQYGLVEESYQLDQLRVGDLQGGSDDEDDNDEAVED
                     NNTSETPAKKSLKDASSAMLKELLQKRKEFVDVAIAKAISEGKASHKGVFTIITNEER
                     KKVIHDFHRRLLSRAKCDNCGMFSPKFRKDGFTKIFETALTDKQLTNNRVKGVIRQDM
                     IKKQQQSAKLDGEEKANDVDEVFSLGKNPSARPKTGSTYILSTEVRNIMRVLFKKEQE
                     ILQYVFHSRPNLLRKSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQLLSKVLT
                     TSLLIRDLNDEMSNLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQGSTGG
                     KVPIPGVKQALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTY
                     PEPVTSYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLVGMTLEQRNALANQLLTPS
                     SNPATHTLNKKVFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGA
                     YNADFDGDEMNMHFPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLT
                     NKDSFFTRDQYQQYIYGCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNV
                     TPADMPGINLLSKNKIKNEYWGQGSTENEVIFKDGALLCGILDKSQYGASKYGIVHSL
                     HEVYGPETAAKVLSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGR
                     QAAAEVTNLPTDTPSNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIP
                     KGTMKKFPQNSMQAMALSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKP
                     FETDSMAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEG
                     IHVSYDNTVRDGDGTLVQFLYGGDAVDTTKESHMTQFDFCLENYDALLRKYNPSALVE
                     HLDVESALKYSKKALKSRKKIDKEPHYKNSDKYDPVLSKYNPAKYLGSVSEKFQDKLE
                     GFLDSHSKQLKLHSGINEKKFRALMQLKYMRSLVNPGEAVGIIAAQSVGEPSTQMTLN
                     TFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWNHVSDDQASIFCKSITKV
                     VLSEVVDKVTVTETTGVSEHGSPARSYAVHMKFYGKDAYGEEYDVSKEELQNVVATKF
                     LYYLEMAIVKELKKQKKTSMPDIGVAVPKSQTALGSGEGPTSGSNEDNDEEEARQKTK
                     QAVSYEEPDEDEIETMRQAEKSSDEEGLDSDMDSGESDNESEKDEKDEEEDSIESAMT
                     EANKNMSKSQRDRQHAVISEHKFITKYNFDDEDGQWCNFKLELSGDTEKLLMVNIVED
                     ICRKSVIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAV
                     LRTYGVEAARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETST
                     SSFMKMSYETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVLTKIPNSV"
     gene            complement(<379454..>382483)
                     /locus_tag="ZYRO0D04554g"
                     /db_xref="GeneID:8203882"
     mRNA            complement(<379454..>382483)
                     /locus_tag="ZYRO0D04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496586.1"
                     /db_xref="GeneID:8203882"
     CDS             complement(379454..382483)
                     /locus_tag="ZYRO0D04554g"
                     /note="similar to uniprot|P39730 Saccharomyces cerevisiae
                     YAL035W FUN12 GTPase required for general translation
                     initiation by promoting Met-tRNAiMet binding to ribosomes
                     and ribosomal subunit joining homolog of bacterial IF2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496631.1"
                     /db_xref="GeneID:8203882"
                     /db_xref="GOA:C5DV79"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DV79"
                     /translation="MGKNNKNQQNYWEEDFTEDMPASEEFGVDPNAKEETPAAEGTPA
                     EQAGAEAIEADFMSTLAKSKKKQDKKTTDEKAENNNNAKPVLKSKKEKEKEKKEKEKQ
                     KKKEENNKKKAQQQAQKEKNKELNKQNVEKVQAEKEAKDKSKSGSPAPEATQTPKAAP
                     KKGGKKAPAGLAALKRQLELKKQAEEEEQRLREEEERLEKEELEREAEADKEREAAKE
                     AKKEKDKAKKEKLKAEGKLLTKKQKEEKKLQEKRRAALLAAGNIKVPALEKKEAEAPK
                     AKKVVYSKKKKTNAPEKAESKDTNGKEKGTDGADEKKGDEEVLIDDWERLALEDDEGE
                     AASATTTVEETTKMEVKESTPEVSSSEVSSKEVIEEVNTPAAASKPTPVSKAVEESKG
                     GTPARASASPAPTPKKDLRSPICCILGHVDTGKTKLLDKIRQSNVQGGEAGGITQQIG
                     ATYFPISAVKDKTKTMSKYEKQTFDVPGLLVIDTPGHESFTNLRSRGSSLCNIAILVI
                     DIMHGLEQQTLESLRLLRDRKSPFVVALNKIDRLYDWKTIPGNSFRDSFEQQSRAVKD
                     EFETRLSAIKLALAEQGLNSELYFQNKNMSKYVSIVPTSAVTGEGVPDLLWLLLELTQ
                     KRMSKQLMYLSHIEATILEVKVVEGFGTTIDVVLSNGILREGDRIVLCGMNGPIVTNI
                     RALLTPQPLRELRLKSEYVHNKEVKAALGVKIAANDLEKAVSGSRLLVVGPDDDEEEM
                     MDEVMDDLTGLLDSVDTSGRGVTVQASTLGSLEALLDFLKDMKIPVMSIGLGPVYKRD
                     VMKAGAMLEKAPEYAVMMCFDVKIDKEAEQYAEQEGIKVFNADVIYHLFDAFTKYQED
                     LLEQRRKDFLDFAIFPCVLQTLQIINKRAPMIIGVDVVEGVLRVGTPICTVKLNPTTN
                     EKQVLLLGKVVSLEINHHPVNEVKRGQTAAGVAMRLEDPSGQQPIWGRHVGESDPLYA
                     AISRRSIDTLKDKAFRDQVSKSDWILLKKLKPVFGID"
     gene            <382884..>383993
                     /locus_tag="ZYRO0D04576g"
                     /db_xref="GeneID:8203883"
     mRNA            <382884..>383993
                     /locus_tag="ZYRO0D04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496587.1"
                     /db_xref="GeneID:8203883"
     CDS             382884..383993
                     /locus_tag="ZYRO0D04576g"
                     /note="highly similar to uniprot|P39729 Saccharomyces
                     cerevisiae YAL036C RBG1 GTPase that interacts with
                     ribosomes member of the DRG family of GTP-binding
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496632.1"
                     /db_xref="GeneID:8203883"
                     /db_xref="GOA:C5DV80"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DV80"
                     /translation="MSTTVEKIKSIEDEMARTQKNKATSFHLGQLKAKLAKLRREILT
                     ASQSSGGGGGGVGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESESAEYEFTTLVT
                     VPGIIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTSNMLFIVLDVNKPLAHKQ
                     IIEKELEGVGIRVNKSPPDIIVKKKERGGISITNTVPLTHLDNDEIRAVMSEYRINSA
                     ELAFRCDATIEDLIDVLEGPTRRYMPAIYVLNKIDSLSLEELEVLYRIPNAVPISSGK
                     DWNLDELLQTMWDRLNLVRVYTKPKGTMPDFSDPVVLRSDRCTVRDFCNQIHKSLVDE
                     FRNAAVYGTSVKHQPQYVGLNHVLQDEDVVTILKK"
     gene            complement(<384047..>384787)
                     /locus_tag="ZYRO0D04598g"
                     /db_xref="GeneID:8203884"
     mRNA            complement(<384047..>384787)
                     /locus_tag="ZYRO0D04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496588.1"
                     /db_xref="GeneID:8203884"
     CDS             complement(384047..384787)
                     /locus_tag="ZYRO0D04598g"
                     /note="weakly similar to uniprot|Q12182 Saccharomyces
                     cerevisiae YOR342C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496633.1"
                     /db_xref="GeneID:8203884"
                     /db_xref="UniProtKB/TrEMBL:C5DV81"
                     /translation="MDRCHYDQLVEQIRSQRLDNNVFFGPINSLIQKDFLQLENIRFF
                     ITLGLDTCQLSQLWDNGSLRNDDSVVINFDPKFNPSEIDTTSRFFYENVENLRKIIAN
                     VANDCNNTNQQEMKKLVKNDIESLGTLYSGNWGVQMRYLLDIAIIFKIASQYGKILIV
                     SKNGNDNVLVSFLIAIQMIQNPQLSALEAFKFIKVQRPSVHELTPEFVSLCNSLSGNS
                     LSGPIPDKQSRKLEQMDYLSSKRSRISD"
     gene            385436..385508
                     /locus_tag="ZYRO0D04620r"
                     /db_xref="GeneID:8203885"
     tRNA            385436..385508
                     /locus_tag="ZYRO0D04620r"
                     /product="tRNA-Met"
                     /note="tRNA-Met (CAT) cove score=71.12"
                     /db_xref="GeneID:8203885"
     gene            complement(<385898..>386554)
                     /locus_tag="ZYRO0D04642g"
                     /db_xref="GeneID:8203886"
     mRNA            complement(<385898..>386554)
                     /locus_tag="ZYRO0D04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496589.1"
                     /db_xref="GeneID:8203886"
     CDS             complement(385898..386554)
                     /locus_tag="ZYRO0D04642g"
                     /note="some similarities with uniprot|P33122 Saccharomyces
                     cerevisiae YOR344C TYE7 may be involved in glycolytic gene
                     expression TYE7 a 33 kDa serine-rich protein is a
                     potential member of the basic region/helix-loop-
                     helix/leucine-zipper protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496634.1"
                     /db_xref="GeneID:8203886"
                     /db_xref="GOA:C5DV82"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DV82"
                     /translation="MDDFEDWMLKDTQAAGSLSDESVNSFSWFEPLEQIISSGSSSSG
                     DSPVDVPSAEQPVKQEELATLDLGSMDAAAGAAVPAPTPAEAATVEATPTATTSSSSS
                     VADATVAPAKRRRAPRKRLTSHQKQAHNKIEKRYRININTKIAKLQQIIPWVASEQTA
                     FEVGENIKKGEDGFPTSTKLNKSMILEKAVDYILYLQNSERLYEMEVRRLRAELAGQN
                     "
     gene            <387336..>389789
                     /locus_tag="ZYRO0D04664g"
                     /db_xref="GeneID:8203887"
     mRNA            <387336..>389789
                     /locus_tag="ZYRO0D04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496590.1"
                     /db_xref="GeneID:8203887"
     CDS             387336..389789
                     /locus_tag="ZYRO0D04664g"
                     /note="similar to uniprot|P12689 Saccharomyces cerevisiae
                     YOR346W REV1 Deoxycytidyl transferase forms a complex with
                     the subunits of DNA polymerase zeta Rev3p and Rev7p
                     involved in repair of abasic sites in damaged DNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496635.1"
                     /db_xref="GeneID:8203887"
                     /db_xref="GOA:C5DV83"
                     /db_xref="InterPro:IPR001126"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR012112"
                     /db_xref="InterPro:IPR017961"
                     /db_xref="InterPro:IPR017963"
                     /db_xref="UniProtKB/TrEMBL:C5DV83"
                     /translation="MSGYNQEDSPLGNRGNVPEKSFLESLSDDGLLDYITGLSQERSE
                     QYSREDYFHDKQRRQDRQDQEFRERYGDGCDIFSGVSIYVNGFTKPGRMQLHEMVIAN
                     GGKFAHFLSSKGQVSHIIASNLPLKKRVELANYKICRPEWIVDSLQRGKLLPWQDYAL
                     LSDQDEIQPKLQPTTIVSCKHPEFLKQFFSKSRLHHLSNWKSDLRAEFCEKFLEKPLH
                     IPSKNDDITVFHIDFDCFFASVSAMANGFDIHADPIVVCHGTKNSDIASCNYEARRYG
                     IRNGMWVGTAERMMPGGKRLVRLGYDFDQFELMSKRFYQILHDSQFQLVLPISIDEAV
                     CIAGNLSHMECDSICQRIREHVSSVTNGCTVSIGCANSLVLARLALKWSKPNGYRIVN
                     CDELDATFWSNLKIDDLPGVGRSLAYKISEYSNPPIGNLCELRQMTLDSLQRCVGEKM
                     GNKIYLAVRGKDDEESGKIIYDPKQFFQRKSLSIDINWGIRFDTIYEIDQFIDRCTQY
                     LIDKLKELNKKTSQLTLKIMKRSKDESIEPPKYLGMGKCDPFARSTRLGVPTDEFGII
                     TTEIKSTFRSLCCPPKELRGIAIQFNKLENSVSNQSKLPFVDAKIYQNLPNDVKGEID
                     QELNRRKIKVKATAAKRINSYQEQFIQELPTQIRNEVENEIIITNKAKRTKFDEIKEQ
                     IAKRQNEKMNAKAHFLGETTVLLPIKFQNQTNFKRIIQLILNWVDGTIRSRGPHEKDL
                     KLFEKYLQRLSDANRLPLVLRICKLISTKLELRSELFSHCNGFQEWERVLLQIILPKL
                     NKNKHTFQTVRKLDIDFDT"
     gene            complement(<389907..>391610)
                     /locus_tag="ZYRO0D04686g"
                     /db_xref="GeneID:8203888"
     mRNA            complement(<389907..>391610)
                     /locus_tag="ZYRO0D04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496591.1"
                     /db_xref="GeneID:8203888"
     CDS             complement(389907..391610)
                     /locus_tag="ZYRO0D04686g"
                     /note="highly similar to uniprot|P00549 Saccharomyces
                     cerevisiae YAL038W CDC19 Pyruvate kinase functions as a
                     homotetramer in glycolysis to convert phosphoenolpyruvate
                     to pyruvate the input for aerobic (TCA cycle) or anaerobic
                     (glucose fermentation) respiration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496636.1"
                     /db_xref="GeneID:8203888"
                     /db_xref="GOA:C5DV84"
                     /db_xref="InterPro:IPR001697"
                     /db_xref="InterPro:IPR011037"
                     /db_xref="InterPro:IPR015793"
                     /db_xref="InterPro:IPR015794"
                     /db_xref="InterPro:IPR015795"
                     /db_xref="InterPro:IPR015806"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018209"
                     /db_xref="UniProtKB/TrEMBL:C5DV84"
                     /translation="MVYGIYKGGLKLIKKQITVLQRVPRSFQLKSSSFNKFRSNKNSI
                     YFLPRKRIITTTSSPTTNSKMATASRLTWLSQLNPNPGEHVRRTGIIGTIGPKTNNAE
                     TIAGLRKAGLNIVRMNFSHGSYEYHKSVIDNARKSEEIYPGRPLAIALDTKGPEIRTG
                     TTKNDVDYPIPANHEMTFTTDDQYKLVSDDNLMYLDYKNITKVISKGKLIYVDDGVLS
                     FEVLEVVDDKTLKVKSQNAGKICSHKGVNLPGTDVDLPALSEKDQNDLRFGVDNGVHM
                     VFASFIRTANDVKTIRNVLGEKGKDIKIVVKIENQQGVNNFDEILEATDAVMVARGDL
                     GIEIPAPEVLAVQKKLIAKSNLAGKPVVCATQMLESMTYNPRPTRAEVSDVGNAILDG
                     ADCVMLSGETAKGNYPFNAVTTMADTARIAEQAIAYQSNYDDLRDSTPKPTSTTETIA
                     AASVAAAFEQNAKAIIVLSTSGNTPRLVSKYRPNCPIIMVTRCPRAARFTHLSRGVFP
                     FVYEKAVEKDWTLDTEARLNFGVAEAKKFGFLKEGDTIVTIQGLKPGVGHSNTLRVSI
                     V"
     gene            <392243..>395332
                     /locus_tag="ZYRO0D04708g"
                     /db_xref="GeneID:8203889"
     mRNA            <392243..>395332
                     /locus_tag="ZYRO0D04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496592.1"
                     /db_xref="GeneID:8203889"
     CDS             392243..395332
                     /locus_tag="ZYRO0D04708g"
                     /note="similar to uniprot|P40987 Saccharomyces cerevisiae
                     YOR349W CIN1 Tubulin folding factor D involved in
                     beta-tubulin (Tub2p) folding isolated as mutant with
                     increased chromosome loss and sensitivity to benomyl"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496637.1"
                     /db_xref="GeneID:8203889"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DV85"
                     /translation="MSWEPIETSLDTIESGLSNLNEDSLPSVLRALDRFQQDPLVLIH
                     RGVLTRYVSLICDNFFELSSHTKLLRCKVFYTISKVVSWKRSVRYLPIDVYILKKLVP
                     LLENQREDNWYIQFFILCWIYVLCLSPFQLEIDEKLYHLVSHCKAPSTVPLVVNIRSQ
                     LLSKNKALFHKYRDELDLSTFNAILKLVIHQEDSVVDMQTLNRFTEHCLHGPVDIVKL
                     KMLPKLFLRYALEMDANRTQDIITWVVSQFGHDFTDTRFAIAHCYAKIVKIVVGELEE
                     EEMFGLLVENCLNPTAKMLRFEPWDVLDQNRLHTYLLVIAELSTTIVEHAPEDAVSRI
                     CQDIIPYASRFQQLRANTIKGSQIRDASNFICWSLARAKNGKDHVGKEDLNNVFLNVL
                     MCSLFDRELLIRKSANAALQEILGRYVTFAGILDNKTILQIIELPINNLPKHITSNTL
                     KLYEMLSHNDERFSTFMIHWLFDSCIMANHDLSMVQWTTWTLCQWAKDLPNGLRDTGI
                     LGRIENLKVSTPLEASRLLYLLVQMKSRGLSLAATRMHALSKLVLDSTVDRRFRRNDY
                     ELFQFLAIFEYAALMLQDDGCGFALDVEFIDLVFRMLRGFEPSIRFHQDMVRLLRVVL
                     PIVSTASAKFVSTEAETRFWDHFEHLIRSNNSCCCYSFSTIESHRFVKTFRNNLPLMD
                     CQGKSQTLDSFQTVHSLRNAVQVDKHILVLVTKLLDDYTITEQGDVGRLVRTSAAQLV
                     SKNQDLFEEEQLRSQVISSLIRLSGEPNEEIRSIAINVLQKTAGLCVEDKIDLLRLME
                     FQSSQFNDYLKEFWKGFLMSAGAIHSTEIQIRTAIDAFLHYYNLLPNDSERLAVCNDL
                     VRIIPSANLITESKSQQTLDPETRIVNQDILKITVSYINFWHRVLESGLRIDPNFNFQ
                     GFYAKLYNLHLLNGASLLRSTIVGFFAQLVVSLVHSRDLSDRKLINSIIERLLTIMKR
                     EASRRRKATQTSLEQDCLKALATIFLELKSFTKLDDLVKCSNSKEGLLESSISMFTM"
     gene            complement(<395322..>397223)
                     /locus_tag="ZYRO0D04730g"
                     /db_xref="GeneID:8203890"
     mRNA            complement(<395322..>397223)
                     /locus_tag="ZYRO0D04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496593.1"
                     /db_xref="GeneID:8203890"
     CDS             complement(395322..397223)
                     /locus_tag="ZYRO0D04730g"
                     /note="weakly similar to uniprot|P24720 Saccharomyces
                     cerevisiae YOR350C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496638.1"
                     /db_xref="GeneID:8203890"
                     /db_xref="InterPro:IPR025694"
                     /db_xref="UniProtKB/TrEMBL:C5DV86"
                     /translation="MRPFPVNVVVKRGFSMDVGKIARDILIADRSTSERNNPRLNHLH
                     RNNARDSITDKWLKKALTRKQHAYMQNEVTIYSPVVLKTLQKLRSTDNTSAYFTLLNK
                     IRVSDITWISQNGSHIRNREEVPIEFYHEVSNMIYRMSLNCSDFKDFRALANFSITLM
                     SGYNQLIRSSSNSQISHETKFYKNCLLVVIKSESIAALLDAFKEMPPRQNGLKPLAEL
                     VFYHQTGQFIKLLEFLEEFILTSLAEKSITGQQIKAFSTPLLNILQSCLLNGEEQICC
                     TFLKKLKRKWNFKMDEHSYVVLKELCERMGMDQVLLTLAGNKQDLRTKIARKNMSWSE
                     YINFLHQSQIDLFEEELPFDYSQSILSSVGPTIQDWKAFIDSNPLPEGANDSLRTFYF
                     NSILVDLATRKNIGFMLSMLEFLVYKREFCQYLIYSHKLIGSTKSSGFHALVKSISNS
                     NSSKITAYTLHDFLQKHYPDIGFQFNDNDYYHLMKACAYKADRHTIYYFLYHYLKNQG
                     HTLYTGAESVDWRLPHRISLLLNQINNPKLNKRINEIEKNAKDLFTERRLNGSQVKDD
                     DIRRLFGENYSPRITTKTLLSMDAVGDQLEDLIRNQSVYSLSIDLEYSERLSNCLSYT
                     ITHSSPVTS"
     gene            complement(<397364..>398907)
                     /locus_tag="ZYRO0D04752g"
                     /db_xref="GeneID:8203891"
     mRNA            complement(join(<397364..398215,398290..>398907))
                     /locus_tag="ZYRO0D04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496594.1"
                     /db_xref="GeneID:8203891"
     CDS             complement(join(397364..398215,398290..398907))
                     /locus_tag="ZYRO0D04752g"
                     /note="highly similar to uniprot|P24719 Saccharomyces
                     cerevisiae YOR351C MEK1 Meiosis-specific serine/threonine
                     protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496639.1"
                     /db_xref="GeneID:8203891"
                     /db_xref="GOA:C5DV87"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5DV87"
                     /translation="MPGTALGYLETIDVVDLDSNGDSGVGGYSKLLAIRKHSILKLGR
                     NGKECDLVVEDPAISSIHCIFWAVLFDEESTPMCYIKDCSLNGTYLNGLMLKKNTTYL
                     LQDGDIVELCRGGGKFKFINESQRINNKLLQQLGFEDKVEQWRVTPKVIGNGTFGHVL
                     IAYKDSRDENTNNRDKWSPENYAVKIIKLKPNKLDKEAKILLKLNHPNIIKVHHTYCD
                     LRDNLYIFQDLIPGGDLFSYLAKSDCLTSVSETESLIIVYQILNALKYLHDRGIVHRD
                     LKLDNILLCSPEPCTRIVLADFGIAKDLSTAKTRMHTVVGTPEYCAPEVGFRASRKAY
                     QSFSRAATLEQKGYDSKCDLWSLGVITHIMLTGISPFYGDGTERSIIQNAKVGKLNFN
                     AKQWDVVADTAKDFVRKLLEVDVNKRLDSNRSLKHPWISKHHEQLKKIYSKKILNGVE
                     PEESEPNELEKKSEWKRKLPKCIMLDQTIPNKKRQRTNI"
     gene            <399626..>400522
                     /locus_tag="ZYRO0D04774g"
                     /db_xref="GeneID:8203892"
     mRNA            <399626..>400522
                     /locus_tag="ZYRO0D04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496595.1"
                     /db_xref="GeneID:8203892"
     CDS             399626..400522
                     /locus_tag="ZYRO0D04774g"
                     /note="similar to uniprot|Q08816 Saccharomyces cerevisiae
                     YOR352W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496640.1"
                     /db_xref="GeneID:8203892"
                     /db_xref="UniProtKB/TrEMBL:C5DV88"
                     /translation="MSEPETPLHAPPNEQLDLSNIKELDENDMTDLDLVSEIENPESR
                     NSNSKPESKREFTEDEDMYDDVDDFKPRINIGSPFNSSTDMGQLGSSQNSGRPRGRLS
                     LSQQSKFIAYLDEQLMNIQRKFVQSRGLNAENGYSGLAPLLQDLKSVIDFIWYSIDGT
                     TPNTEKLLTQDVSEISVDQFESSKSTYFGQTAYLMRVADDIMDYTEKFDLDQLDFHEK
                     GSVVTKLFKLLFILDHIFARLLDGTIPGRTKMNLTDAVRMRAIAERTRTRLPRYLGQK
                     QVHGYHYEVSKIYEESLERCSG"
     gene            complement(<400656..>403256)
                     /locus_tag="ZYRO0D04796g"
                     /db_xref="GeneID:8203893"
     mRNA            complement(<400656..>403256)
                     /locus_tag="ZYRO0D04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496596.1"
                     /db_xref="GeneID:8203893"
     CDS             complement(400656..403256)
                     /locus_tag="ZYRO0D04796g"
                     /note="some similarites with uniprot|Q08817 Saccharomyces
                     cerevisiae YOR353C SOG2 Protein required for cell
                     viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496641.1"
                     /db_xref="GeneID:8203893"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR019487"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:C5DV89"
                     /translation="MSLANSGMDTASKAGMVLGATPVGTPNGTGRSVIKEKVPLTLRD
                     HITRELLQQQQYEGSTIRLIGMGISGVPEADVKLLESVERLSMRKNWISHLPANFCSL
                     KSLRYLDLDSNVLREIPPVLMQCPTLEILDLSNNKIESLPQDVTTLWSENLKVLSLKN
                     NNVGSIWDMSSLAKLENLSVLEIEGNPLPKEELDLVKSYTPLASGIAKEEYWAIALRR
                     YLQSQTPPTVLGSGHHADPKISRAAKRMGFVSTSTSSDPSISISPSPVSQFYPSDGEF
                     SAISHNDTSTASNNELYNHSKFNDYFKRLSILPEESHQNTSHHSSSVSSGNEQHKLPH
                     EELVIACRKLLFSFTECQQNIRKIASFCKEKSVAVSVVSLLYSVRSHIDNLVEVLEQA
                     ELKENCHDKALIKLCITIVSIFKQIISQLRKHFKAFFEADDLCFIRMFYMTLLCSYNE
                     IYNAWCFIDAEDAKFAKKRSVGRSLSSSVAHPISGANGTGSNNMFLPRTRSNTLQSKV
                     APLSFNSGANNNTDPMHASNSITSPVSDAVTSPYPLNLQPSSRQLTPPPAISSNNNSH
                     TNNTNNSTPPVSQISHVSTDSRHQDHSPRQYIPHSPKPKPTESSNESESESPSASVSS
                     ATKNVDQQLYQTLRVVIKMVNVVYDQLTSIISNTARASSSGQQELTGHLLAKIRDLTD
                     TCCQAMDLSKVLGERLNLLTSETVACEKFLTHGEKLKTWENINAFLKSIISILANTKV
                     LMEGMPALNEIRPNLASLAKVTKDVTVVLDLSSYKGVSTLASQTQPQHQHQHQHQHQH
                     QHQHQQQHQQQHQHQHSYHQHPLPHQHGYHQQYTHQYPQQYSHDEHMHIPMMTPQATP
                     VHGKNPFEDV"
     gene            <403528..>404358
                     /locus_tag="ZYRO0D04818g"
                     /db_xref="GeneID:8203894"
     mRNA            <403528..>404358
                     /locus_tag="ZYRO0D04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496597.1"
                     /db_xref="GeneID:8203894"
     CDS             403528..404358
                     /locus_tag="ZYRO0D04818g"
                     /note="similar to uniprot|P06182 Saccharomyces cerevisiae
                     YAL039C CYC3 Cytochrome c heme lyase (holocytochrome c
                     synthase) attaches heme to apo-Cyc1p in the mitochondrial
                     intermembrane space human ortholog may have a role in
                     microphthalmia with linear skin defects (MLS)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496642.1"
                     /db_xref="GeneID:8203894"
                     /db_xref="GOA:C5DV90"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:C5DV90"
                     /translation="MGWFWADPVVDHGSKVPSASQASSSSACPVMHNASSVKPETSAC
                     PVMQDSSASSGSDGLNPLNNMPVFLSANKQQGQKLDLPTERTTSSIPKGDNTHENWEY
                     PSPQQMYNAMLRKGKIDPNTGEEIPEDAVESMVQVHNFLNEGCWQEVLEWERPHTQQT
                     QVEPKLLKFTGKPGQLTPRARYYGILSKLFPNHFEGDPPFDRHDWLVLRADPMSADPE
                     NPGYRKIRYVIDFYGGADDEDGMPTFHLDVRPALDNVTNARDRFRHYYQELKEKYNKD
                     "
     gene            complement(<404451..>406439)
                     /locus_tag="ZYRO0D04840g"
                     /db_xref="GeneID:8203895"
     mRNA            complement(<404451..>406439)
                     /locus_tag="ZYRO0D04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496598.1"
                     /db_xref="GeneID:8203895"
     CDS             complement(404451..406439)
                     /locus_tag="ZYRO0D04840g"
                     /note="weakly similar to uniprot|Q08818 Saccharomyces
                     cerevisiae YOR354C MSC6 Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to
                     mitochondria msc6 mutants are defective in directing
                     meiotic recombination events to homologous chromatids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496643.1"
                     /db_xref="GeneID:8203895"
                     /db_xref="UniProtKB/TrEMBL:C5DV91"
                     /translation="MFKGLLARREISVVQRRFQSYVHPVSKLGLQLQSQLSEQKQEDA
                     DKNTSTIYRSFKESLESLNETNSSSLHRSFGLNAPLTQLLKRSSTENGSYVEPFQILN
                     TMCQFELARSHHFEIVLTHLIGKNLFQDAIALWVKYLECIAENPFTISQSSANRNENW
                     QSHESNLALATLAYTLLSGNVPDLQVLKSILQLDSSKHQTVPFGKAQKLAKTIIKDPA
                     QSKIAQDSLSLLFRQHVASDKASFLSQLDGILQLRHLKDFYSAYHSSKSTSDDPEILC
                     KFMDKFIELNKPLEAITIYNQHKSLDSSALQNELLIAVAALQSNNRQLKLDRILAIWN
                     SMIKANANADSYAALIRALGVSGHVNQLQSIYEKEIPKEFKDQPVVLEPYLTSLVHHG
                     KISHAELSSKLPPQIKSVSLVNAVLLQMVRDDVPQEEWEKFYQLQFVGGNAPHRPTTL
                     SLAIRMWANWKSGPQDKKDFQFLKSISISSRDFIKTNSIIEHFIEIVPNVYPIRALFE
                     QIKLPLDSRKYALFLQSEFLKKNGDYQWAEDIFKEYLTNCKDQLNKLDRFVIEPMING
                     FDELAILQQDSSFLLKVSVYQSLADKLNVRLSNQCLAKTLHAAAMLSRVKSGKFSQNE
                     QEFLNDFLQKLSISNDFKASPKDLDSLRQSNVSIPSNL"
     gene            <407609..>409201
                     /locus_tag="ZYRO0D04862g"
                     /db_xref="GeneID:8203896"
     mRNA            <407609..>409201
                     /locus_tag="ZYRO0D04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496599.1"
                     /db_xref="GeneID:8203896"
     CDS             407609..409201
                     /locus_tag="ZYRO0D04862g"
                     /note="weakly similar to uniprot|P13365 Saccharomyces
                     cerevisiae YAL040C CLN3 role in cell cycle START involved
                     in G(sub)1 size control G(sub)1 cyclin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496644.1"
                     /db_xref="GeneID:8203896"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:C5DV92"
                     /translation="MIRHDSKRSLGTSMAGLPDLAHLSRVRKLRSSAKALDPNLTQKE
                     SIVHQRAISEYGDELWLQLQDQLQGSLVNSNNCSCENFSSQPQINCRMRNLIYDFIMC
                     CHTRLNLCTSTLFLSFSILDRYTSRFIVRSGNYQLLALTALWISSKYWDSKNRVATLP
                     VLLSLCCEQYTAQQFKNTEIQLLKYLNWSLCDIVTCDSLIDLQLFLKGAPKGIDLNEI
                     KLGTIMLCELSRFDLELSLDSQLDKIVLAAITLIKLAIKFVKDGQYDNYKAVLSQNPK
                     CSEICEKLLNLVIKRDNLPSSFRFKYLRSDSKSNKSLRIIESLTGYHMQWQLEQFLTT
                     ANFTNNFGEHSCYELSLSSSSNEFNDNKHNLASSPASCDSASLTSMSNSITSAASPFA
                     SPSMGTELSTINTTHTTPESVPTPSFMEARHNPYHQHYHHYTKPLLTLQPSLQHSHSQ
                     LPPLTPTTPSILQSKLKLSALRRTRSGQNHGHSRNPSFNTRPIMSTNASAIQSDYLRT
                     HRKRASSDMEIDFFQDHLTSKR"
     gene            <409775..>411319
                     /locus_tag="ZYRO0D04884g"
                     /db_xref="GeneID:8203897"
     mRNA            <409775..>411319
                     /locus_tag="ZYRO0D04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496600.1"
                     /db_xref="GeneID:8203897"
     CDS             409775..411319
                     /locus_tag="ZYRO0D04884g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496645.1"
                     /db_xref="GeneID:8203897"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="UniProtKB/TrEMBL:C5DV93"
                     /translation="MKRSNQQEQDQDFRNVKVRADLDSKLYKNYSGYKPLEQETAVVD
                     TINLPRTDKEIQNFFNQYVTARKPCKILGVSPQNFPRDELKPDKVVNYLPSDEILTVE
                     TKKDGGFGSGAKRVKMTFGQFMSKLNQEGEHSLYLTTQYYEDDPNAVDSQTETDEEEK
                     DQILSDGEDSVTFQDMHDDFDQLEGAQEEEDVEDYEEYEMRLRELYQPPMTNLVKTLP
                     ETPEFLKYLIPQQINIWIGAASTIYNDDSDNSWLSKFNPNEEKLGLGRNVPGGGSSSG
                     LHHDHADNLYIPVSGRKRFTLFAPSDAAKMYTVGNIREIYASGVIDYVPDSKAPTWRQ
                     LRDDGAILAHVYNYLLENPDDHKLNDQEIAEFRKFIESDEMQAEKEPPSGLDPPSFSE
                     IPPSVVHTDKIKNKKIRDQILKISSEKWPLFQSANRLTVELEPGEMLYLPTGWFHEVT
                     SFGDSSKSNDVHVAVNYWFVPPTGHQIDAVYDHKDGYWPKDYELTKKALDWARTEDDD
                     DDDEEE"
     gene            <412145..>413425
                     /locus_tag="ZYRO0D04906g"
                     /db_xref="GeneID:8203898"
     mRNA            <412145..>413425
                     /locus_tag="ZYRO0D04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496601.1"
                     /db_xref="GeneID:8203898"
     CDS             412145..413425
                     /locus_tag="ZYRO0D04906g"
                     /note="similar to uniprot|P41913 Saccharomyces cerevisiae
                     YOR355W GDS1 Protein of unknown function required for
                     growth on glycerol as a carbon source"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496646.1"
                     /db_xref="GeneID:8203898"
                     /db_xref="UniProtKB/TrEMBL:C5DV94"
                     /translation="MALTNPRPLPMHALESEILHNNASPVFQASSLVFSPKPDGLSHS
                     EPMGVIPGTPNSDDNSSNDGGTMRSGTPKKESSPLELSKVIPVTGERPMPKDRASPLD
                     DDVLYAVFVILWEKDSTLQGMTVKQLSDHLLEKHPDMNNLSTKLSNLISAKLNAYVKK
                     LEKGEKTLVYALSREWSNSSPRRMVYVYRGILSPDYKKHAQAAAPVNVKRPDSTKNED
                     IESSKFETSLENGSENLDSSITVNNNNNNKRMHSSNAFTLNSEFNVPYLTSPVSVVLT
                     PNATGIEKKETLTVPNDSQKRSHDEEDDIDEEQMVKRPNIGPQMIPHNSGRENNTYVT
                     AAAAAPRISKLFTKNGFKTTTSNATGIMTAIHKVIYTQNPIESRRFSKVKNNQDNLLP
                     ATWLKTVRDGFLTNDIESPESISFEDLEGILNQA"
     gene            <413779..>415722
                     /locus_tag="ZYRO0D04928g"
                     /db_xref="GeneID:8203899"
     mRNA            <413779..>415722
                     /locus_tag="ZYRO0D04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496602.1"
                     /db_xref="GeneID:8203899"
     CDS             413779..415722
                     /locus_tag="ZYRO0D04928g"
                     /note="similar to uniprot|Q08822 Saccharomyces cerevisiae
                     YOR356W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496647.1"
                     /db_xref="GeneID:8203899"
                     /db_xref="GOA:C5DV95"
                     /db_xref="InterPro:IPR007859"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="UniProtKB/TrEMBL:C5DV95"
                     /translation="MLRFARGSLRQTVKTGANVLCKRRTAGLTPRLMNQRYSMMLLTN
                     RGFHHSCQLCKSVELPFQDLSPEEQAVLTEERAVDKVDVCIVGGGPSGLATAIKLKQL
                     DTDERLRVVVLEKSGDIGSHIVSGVIMDPRALRELFPESEYYDANGQGIPLPPDLVTK
                     VVSEDLKYFMGNLSFPVPAPPQMQNKNKNYVGSLSQVAAYLAERAEELGVEIYPGIAV
                     SDVIYSEDGQSVVGVATKDMGISKSGKPKESFEKGMEFHARQTVFAEGCHGSLSKQVI
                     KKFDLRKGRQNQSYGLGIKEVWEVKPENFKKGFISHTMGYPLSNDVYGGGFQYHFGDN
                     LVTVGLVVGLDYKNPYISPYQEFQKLKQHPYYKNVLLGGRCISYAARALNEGGLQAVP
                     KLHFPGGVLVGASAGFMNVPKIKGTHTAMKSGMLAAEKMYEAISPLPSLEELEEAENE
                     QLLEKPIDLESYENAFKNSWIYEELYSVRNIRPSFNTSLGGYGGMMYSGLDSFILKGR
                     TPWTFGFHESDASVTESADKHKPIQYPKPDGEVTFDILTSVSRTGTYHDEDEKCHLRV
                     PDQDLQKHAEAAYPKYKGIENRFCPAGVYEYVEDENSPLGVKFQINSQNCIHCKTCDI
                     KVPTQDINWVVPEGGDGPKYSLT"
     gene            complement(<416099..>418429)
                     /locus_tag="ZYRO0D04950g"
                     /db_xref="GeneID:8203900"
     mRNA            complement(<416099..>418429)
                     /locus_tag="ZYRO0D04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496603.1"
                     /db_xref="GeneID:8203900"
     CDS             complement(416099..418429)
                     /locus_tag="ZYRO0D04950g"
                     /note="similar to gnl|GLV|KLLA0C12969g Kluyveromyces
                     lactis KLLA0C12969g and some similarites with YAL041W
                     uniprot|P11433 Saccharomyces cerevisiae YAL041W CDC24
                     Guanine nucleotide exchange factor (GEF or GDP-release
                     factor) for Cdc42p required for polarity establishment and
                     maintenance and mutants have morphological defects in bud
                     formation and shmooing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496648.1"
                     /db_xref="GeneID:8203900"
                     /db_xref="GOA:C5DV96"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR000270"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR010481"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DV96"
                     /translation="MVTQAHMSSTSLPLQRTRSPSIQNVMNTAVTEQDSLYYVCANMR
                     RRLEQLPQMQPYLNLAYASSEVLSERQALLLSQKRQQQKAIGHQSIGSTFSGRDSHSI
                     AQRASSISNSSFKEEMSLDGITYAGGQSNNNHNINNINNTNMEDTLITFSMGILPISM
                     DCDPVTQISQLFQQGSPLCIIFNAVKPQFKLPVVSSDDLKICKKSIYDFILGCKQHFA
                     FTDEELFTISDVFSNSTSHLLKVLDVVDTLLNSAPEIFPSFQSVQEGLKRELHYLSQQ
                     RNTTEHYKVIKEFVTTERKYVHDLEILDLYRQQLLNSNLITSEELYMLFPNLSDAIDF
                     QRRFLVALEINSLVDSPKQRIGALFLHSKYFFKLYEPWSIGQNAAIDFLSQHLEKMPK
                     TDLIIRNKLELQSFLYKPVQRLCRYPLLLKELLQACQDIASSKELELALEISKGIARS
                     INENQRRTENHEVVKKLYSRVLNWKGYRIAKFGELLYFDKVFISTSNSSEPEREFEVY
                     LFEKIIILFSEVVPKKSTSLSLKKKQTNSGSSLTLNLTGSLNGSNSGSNAGGPEPKLD
                     LRGRIMIANLTQITPQSAHSLAITWESIKEQGNFILKFKNEETRENWSSCLQTLVRNI
                     RSESFRTSNSGEVSNFSSPAHYRTTHNSMTSLASSHHKHVSEVLPKHHPTSYENEYRA
                     ISENYKNSIPKTSLLVRISYKSDFYTILVDLSSSIEDVMGIIRRKLSHSGVVSKVKYQ
                     DEDGDYVMLESEEDWTVAKDMLRESEERILNVWAYT"
     gene            complement(<418757..>419971)
                     /locus_tag="ZYRO0D04972g"
                     /db_xref="GeneID:8203901"
     mRNA            complement(<418757..>419971)
                     /locus_tag="ZYRO0D04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496604.1"
                     /db_xref="GeneID:8203901"
     CDS             complement(418757..419971)
                     /locus_tag="ZYRO0D04972g"
                     /note="similar to uniprot|P39727 Saccharomyces cerevisiae
                     YAL042W ERV46 Protein localized to COPII-coated vesicles
                     forms a complex with Erv41p involved in the membrane
                     fusion stage of transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496649.1"
                     /db_xref="GeneID:8203901"
                     /db_xref="InterPro:IPR012936"
                     /db_xref="UniProtKB/TrEMBL:C5DV97"
                     /translation="MFKRSTLRTFDAFSKTEEDVRIRTRTGGIIALLCCLVTIFLLIS
                     EWLNFNQVVNRPELVVDKDRQLKLELEADITFPSMPCDMLSLDIMDSAGEIQLDLLES
                     GFTKTRLDQNGQSLGSSSLKVSDESYDPKDENYCGACYGAKDQSRNNEVPKEERVCCQ
                     TCNDVRRAYLEANWAFFDGKNIEQCEREGYVDRVNEQLNEGCRVQGSALLNRIQGTLH
                     FAPGVAFQNPKGHFHDLSLYEKTHNLNFNHIINHLSFGKPVTSNARGRGASVATAPLD
                     GRQAFPDRDTHMHQFSYFTKIVPTRYEYMDKMVVETAQFSATLHDRPLHGGADQDHPT
                     TLHTKGGFPGLFVYFEMSPLKVINREQHAQTWSGFILNCITSIGGVLAVGTVLDKITY
                     KAQKSIWGKKSV"
     gene            complement(<420503..>421096)
                     /locus_tag="ZYRO0D04994g"
                     /db_xref="GeneID:8203902"
     mRNA            complement(<420503..>421096)
                     /locus_tag="ZYRO0D04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496605.1"
                     /db_xref="GeneID:8203902"
     CDS             complement(420503..421096)
                     /locus_tag="ZYRO0D04994g"
                     /note="similar to uniprot|Q08826 Saccharomyces cerevisiae
                     YOR357C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496650.1"
                     /db_xref="GeneID:8203902"
                     /db_xref="GOA:C5DV98"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5DV98"
                     /translation="MYRFKNSWTPERATQPHTYKQTKNNKIEKKGGEFVMREFKSFSS
                     TEQTSLPQPHRGPSSSEIYAEPENFLEAEVVNPKTHTPHGSDTRGMFTDYEIICRTNL
                     PSFGRRFSRVRRRYSDFEFFRKCLTKELAMCGGHPRVVVPHLPGKILLGNRFNDEVIE
                     ERRQGLCKWLQTVAGHPLLQSGSKVLVRFVEDEKFVG"
     gene            <421127..>421654
                     /locus_tag="ZYRO0D05016g"
                     /db_xref="GeneID:8203903"
     mRNA            <421127..>421654
                     /locus_tag="ZYRO0D05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496606.1"
                     /db_xref="GeneID:8203903"
     CDS             421127..421654
                     /locus_tag="ZYRO0D05016g"
                     /note="highly similar to uniprot|Q758Y6 Ashbya gossypii
                     ADR391W ADR391Wp and similar to YOR358W uniprot|Q02516
                     Saccharomyces cerevisiae YOR358W HAP5 Subunit of the
                     heme-activated glucose-repressed Hap2/3/4/5 CCAAT-binding
                     complex a transcriptional activator and global regulator
                     of respiratory gene expression required for assembly and
                     DNA binding activity of the complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496651.1"
                     /db_xref="GeneID:8203903"
                     /db_xref="GOA:C5DV99"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="InterPro:IPR027170"
                     /db_xref="UniProtKB/TrEMBL:C5DV99"
                     /translation="MIRIMAEQELEFMENHEDVREDNDEGNTNAGGTTTGRVPEQEDE
                     EEFDVFRNVGQGLVGHYKEIMIQYWQELINEIESTNEPGSQHTDDFKSHSLPLARIKK
                     VMKTDEDVRMISAEAPILFAKACEIFITELTMRAWCVSEENKRRTLQKADIAEALQKS
                     DMFDFLIDIVPRHLQ"
     gene            <422014..>424338
                     /locus_tag="ZYRO0D05038g"
                     /db_xref="GeneID:8203904"
     mRNA            <422014..>424338
                     /locus_tag="ZYRO0D05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496607.1"
                     /db_xref="GeneID:8203904"
     CDS             422014..424338
                     /locus_tag="ZYRO0D05038g"
                     /note="similar to uniprot|Q01329 Saccharomyces cerevisiae
                     YAL043C PTA1 Subunit of holo-CPF a multiprotein complex
                     and functional homolog of mammalian CPSF required for the
                     cleavage and polyadenylation of mRNA and snoRNA 3' ends
                     involved in pre-tRNA processing binds to the
                     phosphorylated CTD of RNAPII"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496652.1"
                     /db_xref="GeneID:8203904"
                     /db_xref="InterPro:IPR021850"
                     /db_xref="UniProtKB/TrEMBL:C5DVA0"
                     /translation="MAFPEVEQLQQARRLAMENNPNELLPKVLETSGSLYLSQGTSYA
                     LKLELSRFFSQLLLQILSDCDFPTSEKPFVAQQQLRCLWSIIRSIRDGTAYKYSVLSL
                     SAAYPLLFDLVAKTSNKETWELMQQMKSFIVQRWNTPFPETPIANENDMFADDAKSMG
                     VRLATAKFIAEIVIVHTSRSSSSPNDVISISSVPEGHPVISNKQQIESEAKKFLDVLL
                     NYLVEEPIMVAPLFSGILNCLAFVMRHRPQATMRILGALLNFNVDAKFQQEGTSILNY
                     RLSKRFVERSYKNFVQFGLKSQLIKNHGSMAPLHARLSKISKTLHVIGEETRSKGVLN
                     FDESQFDNKMTPKDKQKYTSLRKRQQRQLQSQPQPPTQQQLPQQIQPQRGSASNSPAP
                     NSTPQLVQEALQQQPEQVPNDIQLLSHLQKYTMSKNTPNFFNGSPIAIDNSYCAIYSL
                     MNSNNSGQDVSKLSQEVMVKLCSEAFYNTDTTKLISGLSIVASRYTDLINKSTQSRTG
                     VEQSSDASGSRKRKSEQDSPPSKRLKNEEPHDQDDEDREDAIPLELTQSASLTEDEKM
                     RHVQGIVQRIVAIKDSDENPGVAGMLGHDTDPLMKIKLLQWNQNSWLHLLTRLATRGL
                     THNPAMCDLIREWLQEQFLQDISNRIGMVLEWLSEEWYAETLVGATSYETYNKWSLSV
                     LNSLVPFLENQHRRLFIRLMSELPRITQAHIDTVRPICLDPARASLGFQTLKFLVMFR
                     PPVKPKVHSLLLQLKSEDPTTSQNVDSIISKFYT"
     gene            <424712..>426406
                     /locus_tag="ZYRO0D05060g"
                     /db_xref="GeneID:8203905"
     mRNA            <424712..>426406
                     /locus_tag="ZYRO0D05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496608.1"
                     /db_xref="GeneID:8203905"
     CDS             424712..426406
                     /locus_tag="ZYRO0D05060g"
                     /note="some similarities with uniprot|Q08831 Saccharomyces
                     cerevisiae YOR359W VTS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496653.1"
                     /db_xref="GeneID:8203905"
                     /db_xref="InterPro:IPR001660"
                     /db_xref="InterPro:IPR011510"
                     /db_xref="InterPro:IPR013761"
                     /db_xref="UniProtKB/TrEMBL:C5DVA1"
                     /translation="MNHAYDEFGQGSQSPYTVGRGAHPGAVLLSPQSSAMNLSNSIAS
                     PMVLSPKMGAQSHSMFFNDVVDVQPLPQPAIPSQSSSTTPAAPATASAVAAAPKQGTQ
                     APQNSHATHNSAAGSAVLSPMVQSPNCNPSNLGSASMFLDSFTRPSSTSMLGANSKPK
                     QQTQQNQHPQSSQQLPPSQTATTAGAASQHLPQSQQPPQQHQQSTVPPPPQLPNNPVV
                     NFTQDINQLCSWLSMLSSAQQNTVMDNLLFTLHEDVLQYTKLKLNSLVKSGFISPQVP
                     AIASPVPNRDPYPLINLDSVFTNDEVDNDPNDNSILFQHWSPQPTSVTQPIFDYIKDV
                     HQRPKSADPHVARATGHAPSNNKPKRNLGVGNNNNNNNNNNNINNNSHANVHSYGHSS
                     SNHHFTSKARAAAASGGDIDSSGSAESLSRPASRGNVQNGSVAINAAHNNNTSIGNNT
                     SNTHSGTNNNNNSTSNSATPTGTTTATNGSSMNPKTLTDPRLLTNIPVWLKSLRLHKY
                     SDSLRSKRWDELIYLDDETLEKMGISALGARRKLLKAFAVVKEYKEQGLIDQSAYV"
     gene            complement(<426912..>428465)
                     /locus_tag="ZYRO0D05082g"
                     /db_xref="GeneID:8203906"
     mRNA            complement(<426912..>428465)
                     /locus_tag="ZYRO0D05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496609.1"
                     /db_xref="GeneID:8203906"
     CDS             complement(426912..428465)
                     /locus_tag="ZYRO0D05082g"
                     /note="similar to uniprot|P06776 Saccharomyces cerevisiae
                     YOR360C PDE2 High-affinity cyclic AMP phosphodiesterase
                     component of the cAMP-dependent protein kinase signaling
                     system protects the cell from extracellular cAMP contains
                     readthrough motif surrounding termination codon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496654.1"
                     /db_xref="GeneID:8203906"
                     /db_xref="GOA:C5DVA2"
                     /db_xref="InterPro:IPR002073"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR023088"
                     /db_xref="InterPro:IPR023174"
                     /db_xref="UniProtKB/TrEMBL:C5DVA2"
                     /translation="MSSLFLVGGVAQGPLQDAIDTRFPSLFDRVVVLDDINQLLLYLY
                     RERVGAKYIASASDSNTIKPWSFETGIALIVHRPDGTYKDLNPILQRFFPCLNAIALT
                     ESQLRDDDSTLSILSRLQQLALICRDRIARMSHWMYDDGPFSGLYLMIRHLRCVQQFN
                     QQVNVIPRAIRSIDFASLLGVTPEMESRLWDSLDTWSFQPHSLQTKELVYCGFLLLRQ
                     CARDAKSTVQENKLLLLIFTLESSYHQVNRFHNFRHAVDVMQAAWQLAKRLLTDPLQV
                     LLVTLAALGHDVGHPGANNQLLCKYNSPVALHYKQRSVLENLHTDIFTSLLSEHWPQL
                     IGKTSQGRQHMELISEAIMATDMAFHGNYVRQLQESNQAARDPRSLLSLILKAADISN
                     VTRPLTISAQWAALITLEFDDCALLDRYQAKGGKHNSSTSGSRRNSYAEGRNSPELEH
                     GIDYSDDFYTASPEQLTENFPAIPAGQIFFIDTFAEQFFAEFCKTFPQVGFLVENVKS
                     NREFWVSRS"
     gene            <430819..>432279
                     /locus_tag="ZYRO0D05104g"
                     /db_xref="GeneID:8203907"
     mRNA            <430819..>432279
                     /locus_tag="ZYRO0D05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496610.1"
                     /db_xref="GeneID:8203907"
     CDS             430819..432279
                     /locus_tag="ZYRO0D05104g"
                     /note="weakly similar to uniprot|P39734 Saccharomyces
                     cerevisiae YAL028W FRT2 Tail-anchored endoplasmic
                     reticulum membrane protein interacts with homolog Frt1p
                     but is not a substrate of calcineurin (unlike Frt1p)
                     promotes growth in conditions of high Na alkaline pH or
                     cell wall stress potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496655.1"
                     /db_xref="GeneID:8203907"
                     /db_xref="GOA:C5DVA3"
                     /db_xref="InterPro:IPR025752"
                     /db_xref="UniProtKB/TrEMBL:C5DVA3"
                     /translation="MWKMNSSIERKDHSTQNANSIINERKASTPSTSTTKGSMNVQNK
                     PGFQKRMSLPTISVNDKPIRNRQSSLPGYNPSTTIDKHLHGHMSQDLSSAATGMFSEC
                     MFQPPPKAKDELPPSPSSIHTKPDWIDLEYSKRNPPAQSPSCKIKRHQNQNTPNSGWH
                     NTNPSHYHGKRHPARSYSSTFAPDRKRLVNQFLKSVEPVPSNDSTSTKEQTPSTLTPS
                     TGIDPESIYLGQKSSLHALLYFDLEQLQRSMAKPPQVSVTGPPGSSSTSSVSSSSVLP
                     EENSSSSSSLFGVSDESYMPPEFDIDTATYDLNSGICQNYNELDYCRKHVATQLHNFE
                     NVIKQSFKEIIIKDEFEFQKSLKTFDSLVGDLRKLKEQVLQMYESIKNKSLVSLRREF
                     DENEQGTFISRTNAAVEANVRQLRSLENRIEISKRKLVRQKDTLKKMESLLSLKDDML
                     ASQRNTKLAYQYRYMVFDLGVFTVLICIFALGKLLL"
     gene            <432392..>433231
                     /locus_tag="ZYRO0D05126g"
                     /db_xref="GeneID:8203908"
     mRNA            join(<432392..432402,432472..>433231)
                     /locus_tag="ZYRO0D05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496611.1"
                     /db_xref="GeneID:8203908"
     CDS             join(432392..432402,432472..433231)
                     /locus_tag="ZYRO0D05126g"
                     /note="similar to uniprot|P39735 Saccharomyces cerevisiae
                     YAL027W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496656.1"
                     /db_xref="GeneID:8203908"
                     /db_xref="InterPro:IPR021624"
                     /db_xref="UniProtKB/TrEMBL:C5DVA4"
                     /translation="MAPSVALVKVASNTVLPIRIFINRKQLLQNNSKDTVFHAPLLSN
                     NSIVCIKSPSTRIYLSNHDMQNLTNDIETEILLIVHELTSPELMQDVLRKIKIGQSMD
                     WQKDVMPRIFPSETEPLVVSHIQSITRIAKFKYKLHFKHNWELNIFIDNIRALTHIRA
                     YLMFKNDLSIIPPVVGLHSKSKLLLHEQMETEKPPQVLQEDDEPSIPNYDEAAEIQEE
                     QKPELKFKYSPVVSLGECINVHVLQRPQRNKRTQPTSS"
     gene            <433455..>434825
                     /locus_tag="ZYRO0D05148g"
                     /db_xref="GeneID:8203909"
     mRNA            <433455..>434825
                     /locus_tag="ZYRO0D05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496612.1"
                     /db_xref="GeneID:8203909"
     CDS             433455..434825
                     /locus_tag="ZYRO0D05148g"
                     /note="highly similar to uniprot|P54885 Saccharomyces
                     cerevisiae YOR323C PRO2 Gamma-glutamyl phosphate reductase
                     catalyzes the second step in proline biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496657.1"
                     /db_xref="GeneID:8203909"
                     /db_xref="GOA:C5DVA5"
                     /db_xref="InterPro:IPR000965"
                     /db_xref="InterPro:IPR012134"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR020593"
                     /db_xref="UniProtKB/TrEMBL:C5DVA5"
                     /translation="MSTSEKIAKDARRAGNILKTISNENRSKVLYKIHDELKAHANAI
                     QEANKLDLQTARETGLADSLVKRLDLFKGDKFDTMLQGIKDVAELPDPVGKVNFAREI
                     DEHLTLYQVTAPVGVLLVIFESRPEVIANITALAIKSGNAGILKGGKESINTFREMAR
                     IIDGTIAQNESQTGVPVGSVQLIETREDVSDLLSQDEYIDLVVPRGSNALVKNIKSST
                     KIPVLGHADGICSVYLDEDADLEKAKRIVLDAKTNYPAGCNAMETLLINPKLNNWCEV
                     LESLARKGGVTLHATTDVKQAYLKSLEKSGHLDEELESKLVDVDESKDFDGEFLSLDC
                     AVAFVSSTQEAIQHINLHSSKHTDCIVTENTPNAELFLKGVDSAGVYWNASTRFADGF
                     RYGFGTEVGISTSKIHARGPVGLDGLVSYQYQLRGNGQVASDYQGAGGSRAFVHKDLD
                     VSHVSL"
     gene            complement(<434923..>438945)
                     /locus_tag="ZYRO0D05170g"
                     /db_xref="GeneID:8203910"
     mRNA            complement(<434923..>438945)
                     /locus_tag="ZYRO0D05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496613.1"
                     /db_xref="GeneID:8203910"
     CDS             complement(434923..438945)
                     /locus_tag="ZYRO0D05170g"
                     /note="highly similar to uniprot|P39524 Saccharomyces
                     cerevisiae YAL026C DRS2 Integral membrane Ca(2)-ATPase
                     potential aminophospholipid translocase required to form a
                     specific class of secretory vesicles that accumulate upon
                     actin cytoskeleton disruption mutation affects maturation
                     of the 18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496658.1"
                     /db_xref="GeneID:8203910"
                     /db_xref="GOA:C5DVA6"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DVA6"
                     /translation="MSAPLPRNEGEEDVLFDVDFLSDPPTAGQQRQPQQGQETPGFLI
                     HDDSNRYNANYLFPQETIDLDRDENIENDITGNPFMDDTAATWNDDRFAESRHGSRLG
                     GGRNTRSGGNAFTNFFANMRDRFGMNKKRYQSFEMTDFNNVDNHGTYEKSRNMFDIKI
                     LFNHYILRKPINSANENGPRLIHINDGIANDGLGYGDNHISTTKYNAATFLPKFLFQE
                     FSKYANLFFLFTSVVQQVPNVSPTNRYTTVGTLLVVLVVSAIKECVEDIKRVHSDNEL
                     NNANTEVFSELDGGLIQKRWIDIRVGDIVKVKSEEPIPADMIILSSSEPEGLCYIETA
                     NLDGETNLKIKQSRPETSKYIDVRTLGSIQGHIKSEQPNSSLYTYEGTLILNDQEIPL
                     TPDQMILRGATLRNTAWMFGIVVFSGHETKLMRNATATPIKRTAVERIINLQITVLFG
                     VLVVLSLISAIGNVIMSTAGSKHLQYLYLKGTNKVGLFFRDLLTFWILFSNLVPISLF
                     VTVEVIKYYQAFMISSDLDLYDEETDTPTVVRTSSLVEELGQIEYVFSDKTGTLTRNV
                     MEFKSCSIAGRCYIETIPEDKNATFEDGVEVGYRKFEDLQERLNDSTNDEAPLIENFL
                     TLLATCHTVIPEIQTDGSIKYQAASPDEGALVQGGAFLGYKFIIRKPSSVVVFIEETE
                     EERTFELLKICEFNSSRKRMSAIFRTPDGSIKLYCKGADTVIMDRLASENNPYVDSTV
                     RHLEEYASEGFRTLCVAMKDIGEAEYAEWCKIYESAATSLDNRQQKLDDAAELIEKDL
                     LLLGATAIEDKLQDGVPETIHTLQEAGLKIWVLTGDRQETAINIGMSCRLLSEDMNLL
                     VINEDTKEKTSDNMIEKLDAINEHKISPQEMDTLALVIDGKSLGFALEPDLEDYLLTL
                     GKMCKAVICCRVSPLQKALVVKMVKRKSSSLLLAIGDGANDVSMIQAAHVGVGISGKE
                     GLQASRSADFAIGQFKYLKKLLLVHGAWSYQRISMSILYSFYKNIALYMTQFWYGFSN
                     AFSGQSIMESWTLTFYNVFFTVLPPFVIGVFDQFVSSRLLERYPQLYKLGQKGQFFSV
                     TIFWGWIMNGFYHSGVIYVGSILFYRCGAVLNKHGEVADHWTWGVAVFTTSLAIVLGK
                     AALVTNQWTKFTFVAIPGSFILWIVYFPIYAAIFPHANVSREYYGVVSHTYSSATFWL
                     MLIVLTVFALMRDFVWKYYRRMYAPEAYHVVQEMQKFNISDYRPHAQQFQSAIRKVRQ
                     VQRMKKQRGFAFSQSEEGGQERIIRMYDTTQKRGIHGELHDASADPFSDDHYVNVPSN
                     PFSDENHEPTLVNGEDSLEL"
     gene            complement(<439364..>440266)
                     /locus_tag="ZYRO0D05192g"
                     /db_xref="GeneID:8203911"
     mRNA            complement(<439364..>440266)
                     /locus_tag="ZYRO0D05192g"
                     /product="66S preribosome component MAK16"
                     /transcript_id="XM_002496614.1"
                     /db_xref="GeneID:8203911"
     CDS             complement(439364..440266)
                     /locus_tag="ZYRO0D05192g"
                     /note="some similarities with uniprot|P10962 Saccharomyces
                     cerevisiae YAL025C MAK16 Essential nuclear protein
                     required for normal concentration of free 60S ribosomal
                     subunits required for maintenance of M1 satellite double-
                     stranded RNA of the L-A virus"
                     /codon_start=1
                     /product="66S preribosome component MAK16"
                     /protein_id="XP_002496659.1"
                     /db_xref="GeneID:8203911"
                     /db_xref="InterPro:IPR006958"
                     /db_xref="InterPro:IPR029004"
                     /db_xref="UniProtKB/TrEMBL:C5DVA7"
                     /translation="MSDDIIWQLINNQFCSYKIRTDKNQNFCRNEYNVTGLCNRRSCP
                     LANSKYATVKNVNGRLYLYMKTAERAHTPAKLWERIKLSKNYSKAIEQIDEHLIYWNK
                     FLIYKCKQRLTRLIQVAVTERRMALREEERHYVGVAPKVKRREENRERKALAAAKIEK
                     TIEKELLDRLKSGAYGDKPLNVDEKIWKKVMGHMEDENEAISDQEMEDEEEESDEGEV
                     EYVEDDGDEDLVEMEDLEKWLQGSGDEQDEDESSSSSDESSDEDDERATKKQKKAPLR
                     RRPKVEIEYEQEQEQNPARQEVSL"
     gene            complement(<440628..>445208)
                     /locus_tag="ZYRO0D05214g"
                     /db_xref="GeneID:8203912"
     mRNA            complement(<440628..>445208)
                     /locus_tag="ZYRO0D05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496615.1"
                     /db_xref="GeneID:8203912"
     CDS             complement(440628..445208)
                     /locus_tag="ZYRO0D05214g"
                     /note="similar to uniprot|P07866 Saccharomyces cerevisiae
                     YAL024C LTE1 Putative GDP/GTP exchange factor required for
                     mitotic exit at low temperatures acts as a guanine
                     nucleotide exchange factor (GEF) for Tem1p which is a key
                     regulator of mitotic exit physically associates with
                     Ras2p-GTP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496660.1"
                     /db_xref="GeneID:8203912"
                     /db_xref="GOA:C5DVA8"
                     /db_xref="InterPro:IPR000651"
                     /db_xref="InterPro:IPR001895"
                     /db_xref="InterPro:IPR023578"
                     /db_xref="UniProtKB/TrEMBL:C5DVA8"
                     /translation="MDVFSRPDYYPTPSSNVVRYREPDGFKGKRSVLNTDLVALIVDL
                     SSPIDAVDYTVISDFFLVYRNFMSPLQLQELLVLRFHWCIDEIMADRAKKTRRKKIGE
                     IALVRTFVLLRHWILNYFVQDFLVDVNLRLQFIKFLNLYLQDLPKIVRCTMLNLKKSW
                     IHCTKKVWTNLDLNEPKSIGEDELWVFYEIKDFTELDELRKRDSQLSSYAIQGSSSPN
                     FRNQSVLSLYKSSDVFQLPAPSPVDKKKRENRTASMILFPQDNSNVKNVDPRTPATAG
                     TQELSPSNRSASKSQKKKINRLSRLTKVSTVMKDVEYPSTPGIDKVIPPTPAKKVELI
                     LQLPEDNKNGPPMKNPNSHNHSKGDVRRSVSWSKVTGMNRTSNIVKNRTSRSASIGKA
                     STNFRSSMLHHGAMGLLSKWRKNHAYYKHNDMDGASLSSFSKDDTLRDGNGKKEMDNF
                     VKYVISISSLEDRNFAPREMENLVSTKFDLLSARTIEEVEFLVTLENNLIKELNDTVV
                     ETTDIPSAVRRNGQDDQTKITDIMQFSAMDNLNLYQTVNSIANSVFSLSRSLTQRKQQ
                     QQHQHQQSQNQNLIGSPSFAALERRKVQSAIPFMNSASQSRFSISSQTLDRDGTPRLD
                     DTGPQRLVFHGSGVLDSSSKKGFGTLSRSDSASTFLTPTKLRNSQSPRRNSPSKGQLP
                     NLQEQHEISQDSNHDDGASTSSFVSYDSDLSSTFNNNLYATRRKSKKMSLIYPDEARS
                     LKRKDAHSNLHEFTFEDENKLEREETQSLTSFVTTNTTNDQRIIDIDDDDNDNDSDSD
                     SSISDVQGFSTYDNKEDKYGNEARNELKDIRKDRNEDENGQGNELEHTVGQENKDERD
                     SETKNEIINKNQPTISVRRASGRVSLGQRRTRIASNPRESMWSASQRVGQDPDYITKD
                     KELREKEMELFELEQYVSNRVSTATSVDTSMLFSSANCSPRRSRMLGPDHIRLSATPS
                     IKSISSDHPDFGADTFETYDESIHRQATSESVANNRNPAPNNKLQPQESTDSSFNYST
                     TGSQNGIGLSTGGMGSKYLFAPENEGTDYASPDKNVEALKNRFFEEDDDGSHDNDSKL
                     DRDSPSKERGDQDNVDHGIEENDNSMDRLLGTLDDTQKNIPKISSPESRRTLDWNNIS
                     QDSEVDDPVNVALMKLEGTYKRGENDVKQNSEDKGPSRQSSSASILAREVSMLGIADV
                     NGGPPDPGDKRKSLLIETRRRTIMNIPYTPKEEKIQVDKQENIALQAKDLLNQYEMKD
                     PNLTVNNCEQHIPFILMYDSLSIAQQMTLIERELLSEVDWKDLLDVNLKYRGPTVTSW
                     LQLLVQNESLSGIDLAIARFNLTVDWIISEIILTSDIRLKRNTIQRFIHVADHCRSFQ
                     NYNTLMEIVLALNSTTVQKCIEAWRLIEPGDLITWGELKKMPSLDKNYSYIRKLLNNI
                     DPIKGCAPFIVVYLSDLTLNNEKRTWIEEKQVVNYNKFETNVQIVKNFIQRVQWSKFY
                     NFPVDHELLSKCVYLTALSHDEITQIINKLNK"
     gene            <446310..>448592
                     /locus_tag="ZYRO0D05236g"
                     /db_xref="GeneID:8203913"
     mRNA            <446310..>448592
                     /locus_tag="ZYRO0D05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496616.1"
                     /db_xref="GeneID:8203913"
     CDS             446310..448592
                     /locus_tag="ZYRO0D05236g"
                     /note="similar to uniprot|Q12502 Saccharomyces cerevisiae
                     YOR322C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496661.1"
                     /db_xref="GeneID:8203913"
                     /db_xref="InterPro:IPR024391"
                     /db_xref="UniProtKB/TrEMBL:C5DVA9"
                     /translation="MNMGLSKLVHKYKYPNQKHPNSADTFRSAYRSPEEHPIEICIDI
                     ESPPCVLYGTATESSGSLLSGLVSLRVKNPYDSVQMGSSVTPVTSRENKRKSTVGVNL
                     SNAFSNLAVSNSQPATLSPAPSSNLQIMAGYTKVTVTSVMLTLVQKVHFHKPFMADLH
                     SIQTCMNCQSKTTDIRSWDIQKNAKDLPVGNYSFPFSCLISGSFPAKSALGSNSETQI
                     KYELCAVVTYKDPRRGASPHQKDQLLQLVMPVPVTRSLPRGPDKNSLRVFPPTELTAT
                     AVLPNVVYPKSTFPLEMKIEGISIGDRRWRMRKLTWRIDEITRIRNHACDIHKHELRK
                     LEKSVKEKEDHKSKKPNNGLKRYGDQVPQVRVSVSTPDNTPLPPVPEIPEAQGQNRDN
                     NTPGDQDRDADDESQAGFIHPDDDALRQEITLHQQRLREQQLQQELQSDSNLFTEEVR
                     TVTRGDMKSGWKTDFDNKGQIELITEIDCMPLNSGVTNPITSVSTTKPQAEYIKQEAN
                     VACDIQDPALGIYVSHILAVEVVVAEEALQYTNGQPVKKSGGPRNSSDQRLAELSPML
                     AARSSNRQPAMNSEELGPSPSTNSSQSSGQGKNNSEGFVPRVISVPTGAARVLRMQFR
                     IHLTERSGLGISWDEEVPPIYQDVKMLSPPSYASSVSNTSVPRSLSPLAKDEAAGGPE
                     NDIVPLMPSLLPTPPMAHHHDSSNSLRGLTTVQSPQLDSVVSIQGNVPFQNNALTPHA
                     TRDIRIRSITELMDSDRITQ"
     gene            complement(<448819..>451071)
                     /locus_tag="ZYRO0D05258g"
                     /db_xref="GeneID:8203914"
     mRNA            complement(<448819..>451071)
                     /locus_tag="ZYRO0D05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496617.1"
                     /db_xref="GeneID:8203914"
     CDS             complement(448819..451071)
                     /locus_tag="ZYRO0D05258g"
                     /note="highly similar to uniprot|P31382 Saccharomyces
                     cerevisiae YAL023C PMT2 Transfers mannosyl residues from
                     dolichyl phosphate-D-mannose to seryl and threonyl
                     residues in proteins acts in complex with Pmt1p dolichyl
                     phosphate-D-mannose:protein O-D-mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496662.1"
                     /db_xref="GeneID:8203914"
                     /db_xref="GOA:C5DVB0"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5DVB0"
                     /translation="MPSTTGFEGRIKGDNAELKNRKEVSSDEEEVLDEKEDYSKEKST
                     EQDPLVKIEAWIMPLVFTALAFFIRMYKIGANNRVIWDEAHFGKFGSYYLRHEFYHDV
                     HPPLGKMLVGLSGYLAGYNGSYDFTSGEFYPEWVDFIKMRIFNAAFSALCVPLAYFTA
                     KSIGFSLPTVWLFTCLVLFENSFTTLGKFILLDSMLLFFTVASFYCFVTYHSYRNQPF
                     SRKWWKWISLTGITLGCTISVKMVGLFIITVVGIYTVGELWTFLADKKMSWRTYFFHW
                     FARIVCLILIPSAVFMLCFKVHFDLLSHSGTGDANMPSLFQANLQGSGVGEGPRDVAL
                     GSSRVAIKNQALGGSLLHSHIQAFPEGSNQQQVTCYGFKDANNLWQFDRPRGLPGYNE
                     NETDIEFITQDTEYRLVHISTGRNLHTHPIPAPISRQAWEVSGYGNAEIGDVKDNWVI
                     EVMDQRGPEDTSKIHPLTTSFRIKNAVLNCYLAQTGQHLPEWGFRQSEVACVKDPFRR
                     DKRTWWNVETHENELLPPRPEGFKFPKTNFFKDFIHLNLAMMATNNALIPENDKLDYL
                     TSAAWQWPSLNIGLRLCGWSDDNIRYFLLGTPISTWASTAAVGIFAVLFVLLVLRWQR
                     QYNDLNKPGDFNLFLIGGVFPMLAWGTHFVPFLIMSRVTYAHHYLPALYFALIVLSYI
                     FDAGLKSWSVTKTNQVLRLAIYALFGISVIACFFYYGPISFGMEGAISDFQYLDWLPR
                     WYISDKHKMP"
     gene            complement(<451492..>452772)
                     /locus_tag="ZYRO0D05280g"
                     /db_xref="GeneID:8203915"
     mRNA            complement(<451492..>452772)
                     /locus_tag="ZYRO0D05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496618.1"
                     /db_xref="GeneID:8203915"
     CDS             complement(451492..452772)
                     /locus_tag="ZYRO0D05280g"
                     /note="similar to uniprot|P31381 Saccharomyces cerevisiae
                     YAL022C FUN26 Nucleoside transporter with broad nucleoside
                     selectivity localized to intracellular membranes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496663.1"
                     /db_xref="GeneID:8203915"
                     /db_xref="GOA:C5DVB1"
                     /db_xref="InterPro:IPR002259"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DVB1"
                     /translation="MRSEEYTDSPRDEQDSSYTESTERHSFITMIKDAKYLTFLFIGI
                     GLLWPWNCILGASQYFKHDVFLDNTLWSKIFASSMMTVSTVSSTLFNIWLAKRQHSYS
                     ERVVRGLIWEIIVFIILGILTLLKSWFSLPFIFISIMVLVAISSVATAMTQNGIMAVA
                     NVHGPVFSQAVMVGQAVAGVLPSVVLFIISFSSDPSRQSTGGILFYFLTTAAVSIVSI
                     ILYRVNQIGAKLVNVSPGSSPSSQVPFSVHYDKLKHLVLSIFTTFVVTLIFPVFASTI
                     LVKGLPLANSQFVPFIFTIWNLGDLYGRIIADWPQFRSPKFTPFKVFVYSLLRMLFVP
                     LFFLFSRVNSSEHTSSPMVKDLLYTLLQFLFGLTNGHVISISFMKVPEALTTDEEKEA
                     AGGFTNIFVSAGLTLGSVLSYGCVFIIESYSKVH"
     gene            complement(<453024..>455597)
                     /locus_tag="ZYRO0D05302g"
                     /db_xref="GeneID:8203916"
     mRNA            complement(<453024..>455597)
                     /locus_tag="ZYRO0D05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496619.1"
                     /db_xref="GeneID:8203916"
     CDS             complement(453024..455597)
                     /locus_tag="ZYRO0D05302g"
                     /note="similar to uniprot|P31384 Saccharomyces cerevisiae
                     YAL021C CCR4 Component of the CCR4-NOT transcriptional
                     complex which is involved in regulation of gene expression
                     component of the major cytoplasmic deadenylase which is
                     involved in mRNA poly(A) tail shortening"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496664.1"
                     /db_xref="GeneID:8203916"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="UniProtKB/TrEMBL:C5DVB2"
                     /translation="MNNPSLLGYPALGPQQQASMMSNVRTGTPTAIHQQLHGSAPPNA
                     AGATGMPPPGLINQNVNLNSNDHTHLVTQLAQAQAQAQAQAQVQAQAQAQGNNLNVAN
                     NAAAVAAAAAAANGGGMGMNGMAPPNATAAASLGVMSNPVNVNAKNPLYHPHLEDHSL
                     SNNPIWKLQLQLAAVSMQSTGQPNVYARQNAMKKYLSNQQQQAQILEQQRQSGIGGPL
                     PSLQQQPTMGHTPLAAHAQVAALQQQNPQMAEASMSLVDRTKQLLVEMATEIGKDNGT
                     ANTASSVATSTSATVATNGTLSTPTTPKTELHTLRDQLTGTPALLLQHKKLSQFNIDE
                     DDEVENNLITLKAEKPDDQLWHAIDFSNLQISNLSPNLFKYSFLSRLYLNGNNLTSIP
                     GEIRELKNLRVLDLSHNKLTSLPGELGSCYQLKYLYFFDNMVTTLPWEFGNLFNLQFL
                     GCEGNPLDRHLLKILTEKSVTGLVFYLRDNRPEVPLIKDREFIEINTDGEVSEVYDSL
                     SNATDNLNKEVAKRSFTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSY
                     MTDIVCLQEVEAKTYEEHWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKE
                     SEFKLQFKDEVDFSSTWMKHKKFQRTEDYLNRAMNKDNVVIYIKLNHLKSGESVWIAT
                     THLHWDPQFNDVKTFQVGILMDHLEELIKEHGSPSSRQDPKKSPVIICGDFNSQKDSA
                     VYELLSTGHVQSHKDIDGRDFGYMSQKNFAHNLSLKSGYGYIGELPLTNFTPSFTSTI
                     DYIWFSTQALRIRGLLGEIDDDYISKFIGFPNDKFPSDHIPILARFEFTKGGAGGSRK
                     I"
     gene            complement(<456793..>457437)
                     /locus_tag="ZYRO0D05324g"
                     /db_xref="GeneID:8203917"
     mRNA            complement(<456793..>457437)
                     /locus_tag="ZYRO0D05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496620.1"
                     /db_xref="GeneID:8203917"
     CDS             complement(456793..457437)
                     /locus_tag="ZYRO0D05324g"
                     /note="similar to uniprot|P31386 Saccharomyces cerevisiae
                     YAL020C ATS1 Protein with a potential role in regulatory
                     interactions between microtubules and the cell cycle as
                     suggested by genetic and physical interactions with Nap1p
                     and genetic interactions with TUB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496665.1"
                     /db_xref="GeneID:8203917"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:C5DVB3"
                     /translation="MEVEKGSKLFSSFQNCVVVEPCGKGSRVLGWGSNTKCQIKEPKC
                     RIVDRPYVIYANEEVLIDYVAMGKDFMLIIDIHGYIVHAIGSLPREFRLQEWQGKSVQ
                     VSCMWSSLHIHYNRSIHSYGNGNHGQLYAVPYPLEIDSFTTGSEHGILIHNKNQVFCW
                     GWGEHGNCGRTNGQGSINDYSNVVSPLNKVFNVNSNATLRIYGGYASTWIICEC"
     gene            <458096..>461377
                     /locus_tag="ZYRO0D05346g"
                     /db_xref="GeneID:8203918"
     mRNA            <458096..>461377
                     /locus_tag="ZYRO0D05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496621.1"
                     /db_xref="GeneID:8203918"
     CDS             458096..461377
                     /locus_tag="ZYRO0D05346g"
                     /note="similar to uniprot|P31380 Saccharomyces cerevisiae
                     YAL019W FUN30 Protein whose overexpression affects
                     chromosome stability potential Cdc28p substrate homolog of
                     Snf2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496666.1"
                     /db_xref="GeneID:8203918"
                     /db_xref="GOA:C5DVB4"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVB4"
                     /translation="MSEQDDEVQVPESSSPNTTRMLSSSPLKQEQESQDAAGMRNNHT
                     DTTSLLRDRFSFTPGNNQGKDDKQRPNGELPANVTANPETQLAILSGEFPDFSPTLVQ
                     AVFKSNLFNAKLARERLNRIRSQRQNWSVSSNKRKTGSGQFSQQLQLQHNSPMATSRL
                     SSIKKNDSSKITVERQKTSIFDRYSNVMNQKVRPTMTDSLVIDEESLAKLGIKSQPPT
                     TKRRKLVRADDFHDKKKPTQLDKARENHMKMKKRGGSDGEATAEEEMSGDEEGSADEY
                     EERTPEVNIDEQILHFLNTADASDVADLGETSMEKANIIISKRPYNSLYTFSQLELLT
                     VSEQEKKAQEAQKKKGRRVQQKKEGERVLEKINQSIKGYNAIDSLIKKCSTYGKLIGS
                     HMRRWGIDLEHSDKNGELDFMSVDSEDGAVVEEFDDKAVSSSSTPAPSMPNSGEGTEK
                     TNIQTGKTAKSDPEFAEIGEDEEEEEADEDADGDVEFQESEDEDEDYGHRGRRRNNDV
                     TNHKNKPTAQQRGLVKFFKGKPLLLSEDLELKDYQQTGINWLNLLYHNNMSCILADDM
                     GLGKTLQVIAFLAYLKQINEPGPHLVVVPSSTLENWLREFQKFCPVLKIEPYYGSQQE
                     RADLREILEKNVGQYDVVVTTYNLAAGNKYDISFLRNCYFNAVVYDEGHMLKNSLSER
                     FSKLMRIQGNFRLLLTGTPLQNNLKELMSLLEFIMPSLFESKKEHLASIFKQRARTTD
                     NNKDFNPLLAQEAINRAKTMMKPFILRRRKDQVLKHLPGKHRKVEMCEMNKQQRTIYN
                     EEIRLVMEHRQMVKDGVFPKDSKEKAKVQSSSSKNLIMALRKAALHPLLFRHLYTDEV
                     ISKMSDAILDEPDYAENGNRQYIMEDMSYMTDFELHKLSRNFPDTLSKFKLQNNEWMQ
                     SGKIDKLCEILHHIIVEKKEKVLIFSLFTQMLDILELVLSTLNYKFLRLDGSTQVNDR
                     QSLIDKFYEDEKIPIFILSTKAGGFGINLVCANNVIIFDQSFNPHDDRQAADRSHRVG
                     QTKEVTITTLVTKDSIEEKIFQLAKNKLDLDFHVSEDDKKAQDAIENKVSDILEDIIY
                     DEAKK"
     gene            <462538..>466008
                     /locus_tag="ZYRO0D05368g"
                     /db_xref="GeneID:8203919"
     mRNA            <462538..>466008
                     /locus_tag="ZYRO0D05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496622.1"
                     /db_xref="GeneID:8203919"
     CDS             462538..466008
                     /locus_tag="ZYRO0D05368g"
                     /note="weakly similar to uniprot|P19659 Saccharomyces
                     cerevisiae YOL051W GAL11 Component of the Mediator complex
                     interacts with RNA polymerase II and the general
                     transcription factors to form the RNA polymerase II
                     holoenzyme affects transcription by acting as target of
                     activators and repressors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496667.1"
                     /db_xref="GeneID:8203919"
                     /db_xref="GOA:C5DVB5"
                     /db_xref="InterPro:IPR003101"
                     /db_xref="InterPro:IPR008626"
                     /db_xref="UniProtKB/TrEMBL:C5DVB5"
                     /translation="MSSGGKDTLSLEERSRNVQDLLQVLMDINDINGGNSDIAEKMKV
                     HAKNFEAALYAKSSSKKEYMDSMREKVNAMRNTRDTRKKAAASAVSMGAVNRAMLTQQ
                     QQQQQQRLQQAGMAANGGFVPNTLNMNSHMFLNQQAQVRQQAQQQLRNQQQQQQQAQQ
                     QQQQLHGQPQTPQLSAQHQQLINQMKVAIIPRELLQRIPNIPPGVNTWQQITELAQQK
                     RLTAQDMQIAKEIYRLHQQLLYKSRLQQASVNNRMNLQQQEQLHQQRMAGVNGLQSQQ
                     SQGPTPQQLAQQHQGGLQQQQQQQQQQQQQQQQQQPTTLQQQQQQQQHAQQQRLQQQQ
                     QQQQAQQQQGRSVKSEGEFPNMLSQINQIFTPEEQRALLHEAMEACKNFQKTQFGNNM
                     TDSNRQNFIRKYINHKAIKKIQNVRLAQMAASGATPQQHAAPNNQRHSVSLQSQPSAG
                     VGTAGPAGGAPTGGRPSSSTIAGAPAGGSGGGGPPNNGTPNVHNSMPSQGALNAQYNQ
                     ANLRNNAAAAAAQGGAPIQQPNRMAQPQARPSVLQAFAPTPQDVEVVKRISADAARTP
                     LRLSDLTNTLSPQERDEIKRMLQINQQLFAQVSNYAPQVYVFTKSENFLKEVLQLRIF
                     VKEILEKCAKEIYVVKLDTVEKLVIKYKKYWESMKIQLLRRQQLIQQQQQLQQQKQKL
                     AVQQQAAGNTQAGLNISQQQQRVQGSLQQIQQQMQQKQRQQQQMQQQQQVQQQPVPKV
                     PPTNSNIALAAQNAVTNMSNPSANGTPGVNAAGATNYQPPLSDASMGMSAGSAVGVEA
                     PRTGLGLDFMGSPNLAKGSPPTGATTGMSPKRELAKAAATGNFTKARSNSLKPSPNAS
                     QSNMNTPVVVPPPTGSGSATPGVLNVGDGISPLNGKPLAVANHKTPSPLTVPSISQVQ
                     ATASNTDNHPFEEEEDALRKMNIRKAEIISRFKHRQEVFGKSPLDMFLSTLADCIGVK
                     DANVEAVMTIPPAVVDQVNGTGKKKLSKMAQKARDQDVVLVSIKDNNKLVMESKTNPK
                     SQSYQVPSDALGSVFKDVYGTSDIMTMNFNDPFGISRSVSDGAVVGSSQINARKRKLE
                     ELEISPANSANSPSSSLMSDSKKVKIDSPEDMFVTRYGGDSDTKQLMNTGVPSTNVWD
                     WNYWAKLEQP"
     gene            <466520..>467971
                     /locus_tag="ZYRO0D05390g"
                     /db_xref="GeneID:8203920"
     mRNA            <466520..>467971
                     /locus_tag="ZYRO0D05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496623.1"
                     /db_xref="GeneID:8203920"
     CDS             466520..467971
                     /locus_tag="ZYRO0D05390g"
                     /note="similar to uniprot|Q08220 Saccharomyces cerevisiae
                     YOL049W GSH2 Glutathione synthetase catalyzes the
                     ATP-dependent synthesis of glutathione (GSH) from
                     gamma-glutamylcysteine and glycine induced by oxidative
                     stress and heat shock"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496668.1"
                     /db_xref="GeneID:8203920"
                     /db_xref="GOA:C5DVB6"
                     /db_xref="InterPro:IPR004887"
                     /db_xref="InterPro:IPR005615"
                     /db_xref="InterPro:IPR014042"
                     /db_xref="InterPro:IPR014049"
                     /db_xref="InterPro:IPR014709"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="UniProtKB/TrEMBL:C5DVB6"
                     /translation="MASTETPNLSDDVIKRDLLPEIYQWSLSNGLIMYPPNFKLESVS
                     VAPTTLYPTPVPRRSFQDAIAVQKAYNELYCNVSRDGNENWLTNESSKLAEFDSEFTG
                     RLWGLYQKASKQGYSQKLRLGVFRSDYLIDKRHDEIKQVEFNTISVSFGGLSSKVGQL
                     HNFLNDSGKYSPDRGSEFYSNEIPVSESAIKLADALATAVEHYEPRQPNPVVAFVVQD
                     GERNVFDQRIVEYNLLQSHGIQTVRFTLEQVKTHTFLEPDSRRLYWKKSGQEIAVIWF
                     RSAYSPADFKTEESWENRLILETSYAIKAPDLLIQLSGTKKIQQLLTNPDILAQFVPD
                     ESSRSQLLSTFVNIYPLDDSSLGREGKRLAFEQPFNYVLKPQREGGGNNIYKNDIPDA
                     LRKMDEKDWAAYILMELIQPEPNKKNVVLRGSEYYKEPILSELGIFGCVLFDESEIHY
                     NQYSGWLLRSKFNSSNEGGVAAGFGCVDSLVLY"
     gene            complement(<468021..>468596)
                     /locus_tag="ZYRO0D05412g"
                     /db_xref="GeneID:8203921"
     mRNA            complement(<468021..>468596)
                     /locus_tag="ZYRO0D05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496624.1"
                     /db_xref="GeneID:8203921"
     CDS             complement(468021..468596)
                     /locus_tag="ZYRO0D05412g"
                     /note="weakly similar to uniprot|P31379 Saccharomyces
                     cerevisiae YAL018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496669.1"
                     /db_xref="GeneID:8203921"
                     /db_xref="UniProtKB/TrEMBL:C5DVB7"
                     /translation="MTLGPLGFILVHIQWLLQTNALTALVCRKIILTYISNQIFDTTL
                     YLHGQSEFLARAKFITVSADSDNRIHWSMAEFWSFVVPLWILNIMRKILVAVILAGIS
                     LIPLIGPPIVNQLISSRRASSYMGRYFVLSGTDPMAAKNYEYEHLGLFYSFGMAAGIL
                     EFLPLFSIITMTSNTVGAARWSIDIIKKKRS"
     gene            complement(<469258..>470544)
                     /locus_tag="ZYRO0D05434g"
                     /db_xref="GeneID:8203922"
     mRNA            complement(<469258..>470544)
                     /locus_tag="ZYRO0D05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496625.1"
                     /db_xref="GeneID:8203922"
     CDS             complement(469258..470544)
                     /locus_tag="ZYRO0D05434g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496670.1"
                     /db_xref="GeneID:8203922"
                     /db_xref="GOA:C5DVB8"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR027450"
                     /db_xref="UniProtKB/TrEMBL:C5DVB8"
                     /translation="MSTDGLTEKKLEQLSKLYRDIVPASPETESFYLEILVSCEGNLE
                     AAVELINDSLGVQRTSETDILCAKGKHEDEAVSPAPKVQKSLNSFIKDPNNKIKSVSE
                     GSLGKISNRAIELFTKEDIETNIKYVSVHKNVLPELLANSLLKKLSQDNDSFTPNQFY
                     LFGKKCTSNHLTKMFSSSEEISAGNIRIYYNSYSLSRIAQYDDDLKMAQLLIEDLVND
                     CIAQRDLLPYQIRSPNWKGDVVLVNRYYKESNLDWHSDKMTSIGPQPIIASLSLGCSR
                     EFRVRKNYPSNSQIYIIRPPHNTLVIMHAGFQEEYRHCVHGHSKNSPLKPHPISGHVR
                     INLTYRCYLRKFLDRCPKCKKCGSPMDLRRAFKDPKTRGQYIWQCSKSYTGQECGGVI
                     RAKFDNDSLTVQNFDEEGSRWLAPDDQEAHSAQDLN"
     gene            complement(<470696..>471610)
                     /locus_tag="ZYRO0D05456g"
                     /db_xref="GeneID:8203923"
     mRNA            complement(<470696..>471610)
                     /locus_tag="ZYRO0D05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496626.1"
                     /db_xref="GeneID:8203923"
     CDS             complement(470696..471610)
                     /locus_tag="ZYRO0D05456g"
                     /note="weakly similar to uniprot|P31379 Saccharomyces
                     cerevisiae YAL018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496671.1"
                     /db_xref="GeneID:8203923"
                     /db_xref="UniProtKB/TrEMBL:C5DVB9"
                     /translation="MADTTTVIQPAGQPKNNAFKRIIDFYTLEAHYTKDCIILVLSNF
                     TSDLFTNIGIVIYPFLGVLELVRHGDYYYFLMSFLVTYLVELVCVAFLYFVFLFPFTV
                     AAYGILGPMGFPLAIIHGIQFSNLVACHEVRRDKVRGGLNLLRLIFTRHKMSSVLLTP
                     DTIHPRPEDHAIPWIHYVTTIEFWGGALPSMTVQYLIALGIFMVWYMVSLIPIVGVLL
                     LKFHTSPHRGFDYVLPFYKDVRQYDKRALTRIYYGGYARWLLLGASTGILESIPILAG
                     VAVCTNLIGCTLWEISMVRDHQAKKKPI"
     gene            complement(<471717..>472616)
                     /locus_tag="ZYRO0D05478g"
                     /db_xref="GeneID:8203924"
     mRNA            complement(<471717..>472616)
                     /locus_tag="ZYRO0D05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496627.1"
                     /db_xref="GeneID:8203924"
     CDS             complement(471717..472616)
                     /locus_tag="ZYRO0D05478g"
                     /note="similar to uniprot|P31379 Saccharomyces cerevisiae
                     YAL018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496672.1"
                     /db_xref="GeneID:8203924"
                     /db_xref="UniProtKB/TrEMBL:C5DVC0"
                     /translation="MSFGGSLILTGIGAFIYKYDHDQQFEKHPDSQLAFRDYGHNVFR
                     KEGESLTKRVSKASGNFVDEFFDGSAFLYPHKGVQMFLTHKTEYSLSILGILAIYLLM
                     FTLVSMFYWGTITPMYTTFFAVFGPPGMILTWVHSFLHTNMLTMMFMRLCHFNNHMVS
                     TTLKLKGLETVYNKDPIKYYVPISTLYFWVFYVPLKIIKYFLGFIGLLILLLISSFPL
                     LGPPVFHLLISPFISKVYFTKIMRLQGVDSIKRYNRIFDQFGQYAAFGLAAGLLENIP
                     FLAGFALCTNTIGGALWGIDQKL"
     gene            <473262..>477050
                     /locus_tag="ZYRO0D05500g"
                     /db_xref="GeneID:8203925"
     mRNA            <473262..>477050
                     /locus_tag="ZYRO0D05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496628.1"
                     /db_xref="GeneID:8203925"
     CDS             473262..477050
                     /locus_tag="ZYRO0D05500g"
                     /note="weakly similar to uniprot|P31374 Saccharomyces
                     cerevisiae YAL017W PSK1 One of two (see also PSK2) PAS
                     domain containing S/T protein kinases coordinately
                     regulates protein synthesis and carbohydrate metabolism
                     and storage in response to a unknown metabolite that
                     reflects nutritional status"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496673.1"
                     /db_xref="GeneID:8203925"
                     /db_xref="GOA:C5DVC1"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DVC1"
                     /translation="MPYTGTHNESGAPCHSSLKERQSSYNGSPNFVSPISSHDSLDTY
                     NNTFSSTVDTTSDSRSAKYMPYRERVGNGSNGSNDSLLENEGSNKLSKELQNQGPPRP
                     NLLGSPGKSQSVNSLVSNATTDVYMDELYELPNKSTHVYSYNPLSPNSLAVRLSILKR
                     SLEIMIKNPHILEAPPIRPELGRNHSDAVVQQSETSDSSKTVQQKGTASAAALKAFVN
                     NTSNSSANASANHTAPNTANPENPSFLPPSAVRRNLQRASSMVFPLEYLKKSDPMCRE
                     REDLEDLLVLLNKALEDNEYENATDLHLLSLLNINKLMLGKEGQEEDMRTLQLKKALL
                     DSLAEPFFEHYHEKSSDSEGDSDNDSDGDDEDEEFLELHAGSQSPLNVGIPGHEYGRV
                     LHTFTSGKNVAPQAIFTCSQQHPWAFKAANDLACLTFGVSNNALKALTLLDLIHTDSR
                     NFVLNKIMSTEGQELVFSGEVVAIAQPGNGTGGPNLIWASFWAKRKNGMLVCVFQKVP
                     CDYVDVLLDVEDYSIKSVSGGGELFWGQGGGDSVKSSTSEDALSKKDDSGNEKEPHLN
                     KKKTVKFVHEHRDIKEISASLAQLIDDVLQSRLMAEDDDLLPMPIRVANHVNDTRYFT
                     LNNLSNNIPGAVSLTILNDELKLKIHSLPYEAGLFVIDSHSLNLISSNKSIFKNMFGR
                     HFADMAGKPITNIIPSFANMIQFIRASRPSLNITSRKNRGLVLSEHFFRKIQAEMNGD
                     PGNFYTSVGIGALHRDGFEIKVDLQLRVMSSRVILLWITHSRDVVVKDYTSTPSQLRI
                     LKENELAYVSSTPSSRSSSKRSSSKISLTALKEMASHSTSANGDYDKQESTDSPNDND
                     NDKNEKDKDKDEKLDNDDKEGTATAKDNDDVERKPGIEDDEKSTTTIEKSSHPVDVEN
                     DGSVDIGNSELQRKLELTKIYSRDKSRFVNDGNFKLDQDLIRSITSMPTEEVKSDNIS
                     TRSDSAEPIFLHAPVDDIGAQKHTKKYSDFVVLQKMGEGAYGKVNLCLHKKKRYIVVI
                     KLIIKERILVDTWVRDRKLGTIPSEIQIMAALNKHPDGNILTLIDFFEDDDYYYIETP
                     VHGETGCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHSQGIVHRDIKDENVVVDS
                     KGFVKLIDFGSAAYVKSGPFDVFVGTIDYAAPEVLSGEPFDGKPQDIWAIGVLLYTIV
                     FKENPFYNIDEILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEVYNNEWSQI
                     "
     gene            <477488..>478600
                     /locus_tag="ZYRO0D05522g"
                     /db_xref="GeneID:8203926"
     mRNA            <477488..>478600
                     /locus_tag="ZYRO0D05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496629.1"
                     /db_xref="GeneID:8203926"
     CDS             477488..478600
                     /locus_tag="ZYRO0D05522g"
                     /note="some similarities with uniprot|Q08215 Saccharomyces
                     cerevisiae YOL044W PEX15 Phosphorylated tail-anchored type
                     II integral peroxisomal membrane protein required for
                     peroxisome biogenesis cells lacking Pex15p mislocalize
                     peroxisomal matrix proteins to cytosol overexpression
                     results in impaired peroxisome assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496674.1"
                     /db_xref="GeneID:8203926"
                     /db_xref="UniProtKB/TrEMBL:C5DVC2"
                     /translation="MATANGMNGISHPPVATTLDELLKDDKFGFEESPVSNRNYNEGQ
                     LYQLCLASFIRGDSKDCLEKMYEFGFLESQILAENDQVYALFQGACDAIKNFNSLGTN
                     LQKVIRATFTGDTNHLENHIAGKPRSFEIAILNRYYRCCAKVLQMDSAVNGPQISYLE
                     TKVRNDIDKHSSVPLFQDPESIVELEQLAETYIFHILVGLMHKQVSSYLYKRLCESAS
                     GLSDNLNNIIGNGKTVEQRILERLESKERKSKKSRSITSSSRPHRDTTTTEKKLPSPE
                     SPKQVQQFQEHDQQQGQGQGQEQQLQAAPKWLHICYRYINRFKFSRQTLVIALLLLLL
                     SARKIRGISRIPNYIAQTTRAAAPHLRNLLRLLSSI"
     gene            <479074..>480909
                     /locus_tag="ZYRO0D05544g"
                     /db_xref="GeneID:8203927"
     mRNA            <479074..>480909
                     /locus_tag="ZYRO0D05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496630.1"
                     /db_xref="GeneID:8203927"
     CDS             479074..480909
                     /locus_tag="ZYRO0D05544g"
                     /note="highly similar to uniprot|P31383 Saccharomyces
                     cerevisiae YAL016W TPD3 protein phosphatase 2A regulatory
                     subunit A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496675.1"
                     /db_xref="GeneID:8203927"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="UniProtKB/TrEMBL:C5DVC3"
                     /translation="MATETADDNSLYPLALLMDELKHDDIANRVEAMKKLDTISVALG
                     PVRTREELIPFLVEVAQDDEDEVFAVLSEELGKFVPYVGGPEYATILLPPLNILASTE
                     ETLVREKAVDSLNQIAEQLSQEQLFHDFIPLIQHLADADWFSSKVSACGLFKAVIVRV
                     KDDSLRKELLSLYLQLIQDDTPMVRRTAAKNLPLLIDLLTQNLDLSTNEDWDYISSMF
                     QKIINDNQDSVKFLTVNTLISILQFFNAKKDYSHTQDLLESSKKLIGDEAWRVRYMAA
                     DRFDDLASQFEGHDVYIGELVQPFLTLCEDNESDVRKAIAKQLPGFASLVKDPSVVSN
                     KILPAAQSLSMDESEIVRASLAVTVTNLVSLMTKEEAIDHLLPILLNMLKDEFPEVRL
                     NIIANLKVVNDVIGVDLLSESLLPAITELAKDVNWRVRMAIIEYVPILAQQLGVQFFD
                     QQLSDLCLSWLWDTVYSIREAAVNNLKKLTEIFGSDWCREEIISKLLKFDSQLLENFV
                     YRFTLLAALTTLVSVVDKKVIAEDILPFVSRLADDSVPNIRFNTAKSYAKIVERLSQD
                     SNYSGLIKHTILPSLEKLRQDEDFDVKYFANQSLEKCNITLWMRN"
     gene            complement(<481061..>482143)
                     /locus_tag="ZYRO0D05566g"
                     /db_xref="GeneID:8203928"
     mRNA            complement(<481061..>482143)
                     /locus_tag="ZYRO0D05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496631.1"
                     /db_xref="GeneID:8203928"
     CDS             complement(481061..482143)
                     /locus_tag="ZYRO0D05566g"
                     /note="similar to uniprot|Q08214 Saccharomyces cerevisiae
                     YOL043C NTG2 DNA N-glycosylase and apurinic/apyrimidinic
                     (AP) lyase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496676.1"
                     /db_xref="GeneID:8203928"
                     /db_xref="GOA:C5DVC4"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR003651"
                     /db_xref="InterPro:IPR004036"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:C5DVC4"
                     /translation="MGRVKREREHVEVSIEGAEVKSKYFEKKPKLMHQQVNPDVDYIK
                     NLDSKAYFQYIKELTDDSPERWSRPLDSSIFVSRPGCEPLPSNFKTIYCKIRLMRSKL
                     MTPVDTVGCASLPITVSGHCGIEQVDIEPKNYRLQLLTALMLSSQTKDEVTAQAMENI
                     MQYSMEEFKITQGITLETLLRIDEKKLDELIKSVGFHTRKAKYVKQMAQILVNTFDSD
                     IPTDLPGILSLPGVGPKMGILALQKAWGKMDGIGVDLHVDRLCKMWGWVDAKKCKTPE
                     HTRKQLESWLPRELWYEINPLLVGFGQVICMSRGKRCDLCLANDVCNAVDPKIMNKKA
                     KTEGRATRGDFSQWLEYWDLNKKDVE"
     gene            <482402..>483472
                     /locus_tag="ZYRO0D05588g"
                     /db_xref="GeneID:8203929"
     mRNA            <482402..>483472
                     /locus_tag="ZYRO0D05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496632.1"
                     /db_xref="GeneID:8203929"
     CDS             482402..483472
                     /locus_tag="ZYRO0D05588g"
                     /note="similar to uniprot|Q08213 Saccharomyces cerevisiae
                     YOL042W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496677.1"
                     /db_xref="GeneID:8203929"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DVC5"
                     /translation="MTLGRLLIPVRSSIPGSNPAKLSVLTYNMLSPYYMWPQVYTYVP
                     DEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDYQQYWNKVLMEKYNYGSKYIAKP
                     PPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLFGTFDLKEQNYLEHKMLQLTD
                     GQGNPMEKMTLSDVLKGRNQVCMFVSLRHKATNTFLIVINTHLYWKYDEVKLAQCMII
                     MRRLSKIIKDLLIGVQDTTYNKVKIIFAGDMNSSRDSLVVKFLKGDPVSHENLKLINP
                     MRPYLNRVLYDNIPEDLFVHTCFSGKLKGIFDYICYHSDDLAPRKVLGVSDDLKIDPE
                     MGLPNASHPSDHIPIMMEFQLL"
     gene            <483639..>484103
                     /locus_tag="ZYRO0D05610g"
                     /db_xref="GeneID:8203930"
     mRNA            <483639..>484103
                     /locus_tag="ZYRO0D05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496633.1"
                     /db_xref="GeneID:8203930"
     CDS             483639..484103
                     /locus_tag="ZYRO0D05610g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496678.1"
                     /db_xref="GeneID:8203930"
                     /db_xref="UniProtKB/TrEMBL:C5DVC6"
                     /translation="MTVMTPTQSYAEMSGIPNYMISDGNQAQLQQVHHDDPISRNARI
                     RLDYKKSFQDDLIFFPEPKNENLSMIDTNFVFQRPQHKDQHNSQKDNLVLLMALKRQQ
                     QQQQQFYQNQLAMRKGANDTFYHQPLQHEQHYGENYMSPQNVYNYMNLRARG"
     gene            complement(<484227..>485078)
                     /locus_tag="ZYRO0D05632g"
                     /db_xref="GeneID:8203931"
     mRNA            complement(<484227..>485078)
                     /locus_tag="ZYRO0D05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496634.1"
                     /db_xref="GeneID:8203931"
     CDS             complement(484227..485078)
                     /locus_tag="ZYRO0D05632g"
                     /note="similar to uniprot|P31377 Saccharomyces cerevisiae
                     YAL014C SYN8 Endosomal SNARE related to mammalian syntaxin
                     8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496679.1"
                     /db_xref="GeneID:8203931"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C5DVC7"
                     /translation="MESLQLSYELDRLVDIVEERKRLVTVLKIEPSNNDNVNLKKQLN
                     KVLDSLNEANENSFEELEEYAKNYNDILTDIPDEAVDIKLYQFQIPQRKAAPITITDG
                     SSITSANSTFRDTTKKVRFRDDNLVSYEEDPNQNFVPYKDEPDQPSGNENANIDDIEQ
                     ERQKLFDSSNALEQTTSVISPQVSNQDLFIQQQQQLLEQDSQLERLSGSIRTTHGISL
                     SINDEVNEQNDQVLHDLESLLDNGGRNLDRAKRRLKSFERSARENGPCFTIVVLILIL
                     ILLLAVL"
     gene            complement(<485258..>486583)
                     /locus_tag="ZYRO0D05654g"
                     /db_xref="GeneID:8203932"
     mRNA            complement(<485258..>486583)
                     /locus_tag="ZYRO0D05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496635.1"
                     /db_xref="GeneID:8203932"
     CDS             complement(485258..486583)
                     /locus_tag="ZYRO0D05654g"
                     /note="similar to uniprot|Q08208 Saccharomyces cerevisiae
                     YOL041C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496680.1"
                     /db_xref="GeneID:8203932"
                     /db_xref="GOA:C5DVC8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DVC8"
                     /translation="MSSSVENLFGSVNDAKIESSVGKLFSTSSGPIDKNVVNARKRTV
                     LPDLPAKKDESESEKEPEQQSEQESKEESEEESEEEQAPEPLPEPLPESKPKSQSKKR
                     HSDEDEGLEERYFAKLMDQEPAEDAGDADKQAEKPQQDERPQEGAKKIDLKEDELEKA
                     ERTVFVGNVPADVIPNKSLHRQFKKLFQDEKGLESIRFRSISFEVPLPRKVAFVQQKL
                     HKSRGSVNAYVVYKNKNSVSSVCSRLNGQVFVDRHLRVDSVTHPAKHDNKRSVFVGNL
                     DFEEDEESLWRHFGSCGEIEYVRIIRDPKTNMGKGFAYVQFKDFPNVSKALLLNDKPL
                     ESNGKSRKLRVTRCRNLKKSSNKNGAQSLKQNGIMNKLSDSHKTKLGRAKKVLNKADS
                     AQLGKEITVEGIRASKADSKPSAILKKRKKRSQSGRVTKRSQAHKKNNK"
     gene            <487057..>488304
                     /locus_tag="ZYRO0D05676g"
                     /db_xref="GeneID:8203933"
     mRNA            <487057..>488304
                     /locus_tag="ZYRO0D05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496636.1"
                     /db_xref="GeneID:8203933"
     CDS             487057..488304
                     /locus_tag="ZYRO0D05676g"
                     /note="some similarities with uniprot|P31385 Saccharomyces
                     cerevisiae YAL013W DEP1 Transcriptional modulator involved
                     in the regulation of structural genes involved in
                     phospholipid biosynthesis also participates in regulation
                     of metabolically unrelated genes as well as maintenance of
                     mating efficiency and sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496681.1"
                     /db_xref="GeneID:8203933"
                     /db_xref="InterPro:IPR013907"
                     /db_xref="UniProtKB/TrEMBL:C5DVC9"
                     /translation="MDSHRDNINTDQEEQKNVSSRVASNNNNNNYNENLLDYYIPSDA
                     DTEKMSEEADNGNQHPKLEELVENKRTNIDMDDKEEPESKRPKTDSQVPQESQASETT
                     AIPDDEGDVEEDVEEEAEEESSEHKTANVKGTGASVSVDADADVDVEEEEEIEEMGEE
                     EEEEDSKEREISKRFSSMLSPIEMEEQRQTALQEITDIEYKFAELRQRLFENKILRLK
                     TELQMCVEGSHPRLQTYYQKIASIRDHKLKRAYQRQKYNMQCIDTETRATRTHIHQDF
                     LRKASDLRSKLLTDTTQTWYDINKERREMDIVVPEVNYHVPVKLAGKTLSCITGYAGP
                     AQQRYPGEPLPEDLECENITFKYRSNAVDKLEVIVDRMRLNNELSDLEGLKRYFHGFP
                     GAPNLSGLRDSEIYDDLLRLQNR"
     gene            complement(<488402..>488827)
                     /locus_tag="ZYRO0D05698g"
                     /db_xref="GeneID:8203934"
     mRNA            complement(<488402..>488827)
                     /locus_tag="ZYRO0D05698g"
                     /product="40S ribosomal protein S15"
                     /transcript_id="XM_002496637.1"
                     /db_xref="GeneID:8203934"
     CDS             complement(488402..488827)
                     /locus_tag="ZYRO0D05698g"
                     /note="similar to uniprot|Q01855 Saccharomyces cerevisiae
                     YOL040C"
                     /codon_start=1
                     /product="40S ribosomal protein S15"
                     /protein_id="XP_002496682.1"
                     /db_xref="GeneID:8203934"
                     /db_xref="GOA:C5DVD0"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR005713"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:C5DVD0"
                     /translation="MSTTAPKKRTFRTYSYRGVDLEQLLTMSNEEFIKLAPARIRRRF
                     ARGLGHKPARFMKKLRAAKLAAPENEKPDVVKTHMRNMIVFPEMIGSVVGVYNGKVFN
                     QVEIRPEMVGHYLAEFSISYTPVRHGRAGATTSRFMPLK"
     gene            <489426..>489740
                     /locus_tag="ZYRO0D05720g"
                     /db_xref="GeneID:8203935"
     mRNA            <489426..>489740
                     /locus_tag="ZYRO0D05720g"
                     /product="60S acidic ribosomal protein P2"
                     /transcript_id="XM_002496638.1"
                     /db_xref="GeneID:8203935"
     CDS             489426..489740
                     /locus_tag="ZYRO0D05720g"
                     /note="highly similar to uniprot|P05319 Saccharomyces
                     cerevisiae YOL039W RPP2A Ribosomal protein P2 alpha a
                     component of the ribosomal stalk which is involved in the
                     interaction between translational elongation factors and
                     the ribosome regulates the accumulation of P1 (Rpp1Ap and
                     Rpp1Bp) in the cytoplasm"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P2"
                     /protein_id="XP_002496683.1"
                     /db_xref="GeneID:8203935"
                     /db_xref="GOA:C5DVD1"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:C5DVD1"
                     /translation="MKYLAAYLLLNAAGAEPSAEKVKAVLSSVGIEPEEEKVGALLTS
                     LEGKNVDELIAEGNEKLSSIPSAGPAPAAGAAGGDEAPKEEAKEEAAEESDDEMGFGL
                     FD"
     gene            <489953..>491128
                     /locus_tag="ZYRO0D05742g"
                     /db_xref="GeneID:8203936"
     mRNA            <489953..>491128
                     /locus_tag="ZYRO0D05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496639.1"
                     /db_xref="GeneID:8203936"
     CDS             489953..491128
                     /locus_tag="ZYRO0D05742g"
                     /note="highly similar to uniprot|P31373 Saccharomyces
                     cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
                     catalyzes one of the two reactions involved in the
                     transsulfuration pathway that yields cysteine from
                     homocysteine with the intermediary formation of
                     cystathionine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496684.1"
                     /db_xref="GeneID:8203936"
                     /db_xref="GOA:C5DVD2"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DVD2"
                     /translation="MVLKATDKFATKAIHAGAHVDVHGSVIEPISLSTTFKQSAPAQP
                     LGEYEYSRSQNPNRKNLEDAIASLENGKHGLAFSSGSATTAVILQSLPQGSHAISIGD
                     VYGGTHRYFTKVANAHGVDVSFTNELVKDLPSLVKPNTKLLWIESPTNPTLQVTDIAL
                     VNKTVKELNKDILVVVDNTFLSPYLSNPLDFGVDVVVHSATKYINGHSDVVLGVLATN
                     STELYERLQFLQNAIGAIPSPFDAWLAHRGLKTLHLRVRQAATTATKIAEFLQSNDRV
                     IAVNYPGLASHPSHDVVQRQHRDGLGGGMISFRIKGGAEGAAKFSSNTRLFTLAESLG
                     GIESLLEVPAVMTHGGIPEDQREASGVYDDLIRLSVGIEDTEDLLEDIKQALKSASA"
     gene            <491291..>492517
                     /locus_tag="ZYRO0D05764g"
                     /db_xref="GeneID:8203937"
     mRNA            <491291..>492517
                     /locus_tag="ZYRO0D05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496640.1"
                     /db_xref="GeneID:8203937"
     CDS             491291..492517
                     /locus_tag="ZYRO0D05764g"
                     /note="similar to uniprot|Q6B1H9 Saccharomyces cerevisiae
                     YOL031C SIL1 ER-localized protein required for protein
                     translocation into the ER interacts with the ATPase domain
                     of the Kar2p chaperone suggesting some role in modulating
                     its activity homolog of Yarrowia lipolytica SLS1 GrpE-like
                     protein in the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496685.1"
                     /db_xref="GeneID:8203937"
                     /db_xref="UniProtKB/TrEMBL:C5DVD3"
                     /translation="MKLLPVAIVGLTNILPILANPIKATLSPESNTVETSSLYVGDSL
                     VCNQEGCYPKLFEADNDWKTVKEGQVLPGGLDIRMNLETGLKEAKLSDNTAHTDTPND
                     ANAVVPVSAPSEDTEYYEFTNDFETVDKLLQNLHSSEEVVKLENKLDDLIVFAHDYKH
                     GSKIITHEFELLRNIALQQQLPTSIRELGVRMIVSCLRNNPKSIEYVQDTHPEFVHQV
                     FQELENGVEVSNPAPSTIALAKRYLSVLDELLSSTYHFTKDQMLTLKKIYEIQDKQIR
                     IKVLELISKYFGPTQQPHLNKRDIVDTAPNVSEWAQELQKWIQDDGIDEIHTRKFFNS
                     LYNIKTQLGSDIKVDSSFINWLSHETEKRKQNVENQNQNRDLEQDSFDKRLIESRHLV
                     FGNPMAHRVKHFNDEL"
     gene            complement(<492555..>493292)
                     /locus_tag="ZYRO0D05786g"
                     /db_xref="GeneID:8203938"
     mRNA            complement(<492555..>493292)
                     /locus_tag="ZYRO0D05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496641.1"
                     /db_xref="GeneID:8203938"
     CDS             complement(492555..493292)
                     /locus_tag="ZYRO0D05786g"
                     /note="similar to uniprot|Q08202 Saccharomyces cerevisiae
                     YOL032W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496686.1"
                     /db_xref="GeneID:8203938"
                     /db_xref="InterPro:IPR008493"
                     /db_xref="UniProtKB/TrEMBL:C5DVD4"
                     /translation="MFAAIASGNPLQLSTEVPNSNGLQHTIVLSSTKPKSYSHITLFI
                     LPNVTFPENFVSTVYFKLGPTEDFQLFGYLGAEKPSAIFKVRLPNGDVSRGTTGNGVD
                     GLGEIDMEDEDVAAAGAAADRQFNGLHNISELIIGISIEPRDQGMATIEQWKQQQQLQ
                     KNDTSSLVLSRDSNRGINTVGKLANVYPILTQELAGKIVQHAYNYLSGFLDSAGNVSI
                     KRFDTWWEKFKSRLANDGNFLDEVTSS"
     gene            complement(<493474..>495075)
                     /locus_tag="ZYRO0D05808g"
                     /db_xref="GeneID:8203939"
     mRNA            complement(<493474..>495075)
                     /locus_tag="ZYRO0D05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496642.1"
                     /db_xref="GeneID:8203939"
     CDS             complement(493474..495075)
                     /locus_tag="ZYRO0D05808g"
                     /note="similar to uniprot|P48525 Saccharomyces cerevisiae
                     YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
                     encoded by a nuclear gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496687.1"
                     /db_xref="GeneID:8203939"
                     /db_xref="GOA:C5DVD5"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR004527"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="UniProtKB/TrEMBL:C5DVD5"
                     /translation="MSVKTFYRRFHGTLNLSSILPKKSLVSKKPSKDIHPKHPVRTRF
                     APSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLRWCK
                     LHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARKL
                     QPPTTASYDRHCAHMSPHEIKQNLDNDVAYTIRLRAPEKYPIIQDLLHGTLDIQPQVN
                     ANDVRYDDPILVKSDNLPTYHFANVIDDHLMEITHVIRGEEWLPSTQKHLAIYNAFGW
                     SPPQFIHIPLLTTTEDKKLSKRKGDSSVINLKRKGILPEALVNFSVLFGWSPPRDLAA
                     ASHECLSLEQFEQVFNLNYLTKGNAKVDEKKLWFFNKHYLQLQLESQLPQVAEQVIPL
                     VQSKYGSNLATDDKVTTILQKCGKALTTIYEFNDTFSYFFERPNYDQIDSVQEYLAAH
                     DLQQAWYILQGFQDSLDATNAEKLIKQTAEKMSISKRPIFECLRFALAGSKPGAKIPV
                     LVDVLGLEETHRRLDEACKYLENRL"
     gene            <495428..>497770
                     /locus_tag="ZYRO0D05830g"
                     /db_xref="GeneID:8203940"
     mRNA            <495428..>497770
                     /locus_tag="ZYRO0D05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496643.1"
                     /db_xref="GeneID:8203940"
     CDS             495428..497770
                     /locus_tag="ZYRO0D05830g"
                     /note="some similarities with uniprot|P22470 Saccharomyces
                     cerevisiae YDR143C SAN1 Ubiquitin-protein ligase controls
                     turnover of a specific class of unstable nuclear proteins
                     including Sir4p but not Sir2p or Sir3p san1 mutations
                     suppress sir4 spt16 and cdc68 mutations suggesting a role
                     in chromatin silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496688.1"
                     /db_xref="GeneID:8203940"
                     /db_xref="GOA:C5DVD6"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DVD6"
                     /translation="MNGAGDSRNLEPQDSSGGPPGQPAEDSNSDGNQRATRNITVSIQ
                     YSYFTPHRFANLNNNNDNNNNNDQEVPANDPGITIPGLGFPVVGNEGNGGGVAPEGGN
                     NPDPAAAAATNAVNAAANNAARPDGALVLSFRDVPVSTPQERLESIISIAAELAMRRF
                     SDIMSIPKGITREQFEQLPVVQVSSLPEKQDTICSICYENYEDEPSTPLKRARDGEDM
                     EDEEDLDSVKKRRSESPGSSETMETAPSHPLEHSDNQEEGNGSHVHEEQRSETAQQQP
                     EAPQQDSSQQGEESQKKYLHSPVQLPCAHIFGRECLDKWSQIENSCPLCRRKIVEVQP
                     EQRPEPGNPAGTTNMEAFERIRQLLYNSPAEQQQQQQQQQQQQQQQQQQEQQGQQQQA
                     GEGFTATGELDPQSFTVSRSGIVFLRPGLQQGGENANQPPPPNVSQTPLDGTGNQATN
                     EAPAARDDGATPNENNDNTGPLGGDLNSRRIHWMPLPLTSIRMDNGLEDREGQGQHDR
                     LVSILDHIFNAARNDSNNNNNNNNNDDAGNNDNQENNNENDNINNNDDNRREIPPAPG
                     FVTLPVIRPPVATIPGPASFARAATPARDQSAAAADASASLAPGTTGSPAASAPSPTP
                     ASAPSPASAPAPASAPAPTPVSAANANPPPTPSRRRSFLDNILRITNLNRTFGRSRNN
                     NSSNDNSNNTTSSTDNNDNQSHRNNNMFNSGVASYRNQGGRVSTFHIHNGPLPFLLRR
                     RQGANRDDSSNDANGTSNDNDNSNIGSSPSHSRGNQEASQ"
     gene            <498219..>499334
                     /locus_tag="ZYRO0D05852g"
                     /db_xref="GeneID:8203941"
     mRNA            <498219..>499334
                     /locus_tag="ZYRO0D05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496644.1"
                     /db_xref="GeneID:8203941"
     CDS             498219..499334
                     /locus_tag="ZYRO0D05852g"
                     /note="similar to uniprot|P39108 Saccharomyces cerevisiae
                     YDR142C PEX7 May serve as intraperoxisomal receptor for
                     type 2 peroxisomal proteins (such as thiolase) Member of
                     beta-transducin-related (WD-40) protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496689.1"
                     /db_xref="GeneID:8203941"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DVD7"
                     /translation="MLGYHMQGYSGYGVQYSPYFDNRLAVASGSNFGLVGNGKLFILD
                     IDPQGRILEFNSFLTQDCLFDVAWNEAHENQVLVAQGDGTLRLFDTKLKQYPIAIFNE
                     HQKEVFSCNWNLVGKQNFVSSSWDGAVKIWSPQRKESLLTVVPRPMDVSTMACAGPQV
                     PMSNQKGHADIAKNKNCIYQALFSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFL
                     AHSGLEALTCDFNKYRPHSLVTGGVDNCIRIWDLRMVGPSAASRANASPAVCTNEIVG
                     GHELAVRKVSWSPHHSNILLSTSYDMTCCIWQDLGFDGRRSTGRTNSVDPRRGCRSRF
                     AQHTEFVYSADWCLWGQPGHIASTAWDGNVFIWNAFR"
     gene            complement(<499357..>499866)
                     /locus_tag="ZYRO0D05874g"
                     /db_xref="GeneID:8203942"
     mRNA            complement(<499357..>499866)
                     /locus_tag="ZYRO0D05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496645.1"
                     /db_xref="GeneID:8203942"
     CDS             complement(499357..499866)
                     /locus_tag="ZYRO0D05874g"
                     /note="weakly similar to uniprot|Q99176 Saccharomyces
                     cerevisiae YLR119W SRN2 Component of the ESCRT-I complex
                     which is involved in ubiquitin-dependent sorting of
                     proteins into the endosome suppressor of rna1-1 mutation
                     may be involved in RNA export from nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496690.1"
                     /db_xref="GeneID:8203942"
                     /db_xref="InterPro:IPR009851"
                     /db_xref="UniProtKB/TrEMBL:C5DVD8"
                     /translation="MDSKQNVNIPLPENVELLSSGEILGLLKEHRNQLQSYVTKFHPQ
                     DELKQEVNELRSQLQSLESKFQGLEDERSNTQRQLEECRIMEAQYVKLWQDLRQRIME
                     KYHDDALKKQLEVQIQHLDDASGKLEMDMGKYEGLDEFLNDYIGTRTQYHLKREKLTT
                     WIQQGELKM"
     gene            <499987..>500682
                     /locus_tag="ZYRO0D05896g"
                     /db_xref="GeneID:8203943"
     mRNA            <499987..>500682
                     /locus_tag="ZYRO0D05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496646.1"
                     /db_xref="GeneID:8203943"
     CDS             499987..500682
                     /locus_tag="ZYRO0D05896g"
                     /note="similar to uniprot|Q12354 Saccharomyces cerevisiae
                     YLR118C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496691.1"
                     /db_xref="GeneID:8203943"
                     /db_xref="GOA:C5DVD9"
                     /db_xref="InterPro:IPR003140"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DVD9"
                     /translation="MASLSAVRVAARSQPAEKALIVFHGLGDSGHGWSFLADYLQRDP
                     SFRSTRFIFPNAPTIPISCYSNMQATGWFDIPDMGFSQEMKADVEGTLRSVGTVQAFV
                     QEQIDKGIRPENIMVGGFSQGAALALAASALLPFKIGGFFCLSGFCQIQSRLMQLKNN
                     NNLETPMFHGHGDEDPIVWFSRGQEAYEFFTREVGLRNYEFHVYKGMEHSSSPKELQE
                     LVQFIKNCLHLNN"
     gene            <500845..>505863
                     /locus_tag="ZYRO0D05918g"
                     /db_xref="GeneID:8203944"
     mRNA            <500845..>505863
                     /locus_tag="ZYRO0D05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496647.1"
                     /db_xref="GeneID:8203944"
     CDS             500845..505863
                     /locus_tag="ZYRO0D05918g"
                     /note="similar to uniprot|Q03921 Saccharomyces cerevisiae
                     YDR141C DOP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496692.1"
                     /db_xref="GeneID:8203944"
                     /db_xref="InterPro:IPR007249"
                     /db_xref="UniProtKB/TrEMBL:C5DVE0"
                     /translation="MSLPLKPLTIDSNSKQLDSKEKKFKNHVTRALENFDSVTEWADY
                     IASLGRLLKALQSWTPQFQNVKYYVPSPYQVSRRLASSLSPDLPAGVHQKTLDVYTFI
                     FEKIGQDNLAAECNIWIPGILPLMTYASMSVKSHLVEVYDNYLVQLPSSTLKLLAKPL
                     LASLLPGIDDESSEFQPVTMNLIDTLRENMDNDSLFWQSCFLVMITSKERRLGGLVWL
                     IKKFPSLNSVPHLVIERNKRIETTGGIDKMNPKELREDAFSTLQPAAKSLLSPEPGLL
                     IRCLVSSLRGDNDLLIKRGIWDLLLQRLHLESPVLNQLISVGDKKLLVMACCKTILDK
                     DMSLNRRIWNWLLGPAAASSMNNAGALTDQVVEDSNEYFLKYGFDSLIDGLKDMIGTQ
                     ESVTTAINICISLMDRWQIGSLVVPEMFIPLLLATKRFAQNPQVMKISSIFFDTVETN
                     IIWGKIFQYIMDSKDLEFLKFVLHSYNVANEEEIVVRHLPLILLTILSSNDFQKEDSS
                     NGRYSICHQLLEILPERAFLPLNFTQMSFDSEIDTKDVLKKISDYYHGVSDPVSLQTV
                     EDSVDVLPPFNTEDLTFLIVHCAHDTLLENLKSGENIAEATRIFVGVCERVPESNAEK
                     DGPSNDLSDDSLVEAIFMCLNNPEKKTGSVYGIVDLYTNYLASRIGFIQSVKLLKLII
                     SSLWNYLVEPRRQLMAVKGLKLLQKCRYADYVEGALSSAFIEEKDISRCLVVLELLWN
                     QLEPNSAVLRRPVELMADELFDEQNPHYLSVSKWILSVVNSGSSNRLFYLLTDDLLKF
                     DFLKRDYLQDLDDLDMFTYRLQCLTSILKSNNNVVLESFTTELTTIGSLADWENEDVS
                     TYKNLVIVIIMRFLHLKNNNNATSIRSALLLLEYLLNGSEQNFKWIVMFLLQMSSEYI
                     SKEGLESDLIAVSLLNIVSKVLRLSHENGIKLDVFDDNTTHLKYVDYLITSVASMESP
                     LIVTSYVKLLRESLAYFESSIFRMILPLTASIVQCVHKLLDKEKKDGGYYQSIALLLA
                     GLEELLEVSHKFLLADENEGYFSAAGSRGDFLQSMVSNVFSSDVSANDVKVQGERDVI
                     LQSFKEVVTCTFHIWSWAHEVSANATRTPESEQTNHNSYKFKFTAKKLLEKLFLLEPL
                     EVMEDLVIAPTDNDKLTLIHVLDGNRPALTIPYFFIGIVYRQNKNGSVKFSVNSGNTK
                     TSGNHLDSSLMHKLDSKALMHFLLNYASSLENAAIEDFYGDFAAFLKEVSANYNLYGT
                     VSTSVLKFVGIIAEKLNKSRFGEQKRIRRELAETFTKYLPNALSDSPLDYENPYQSFE
                     NLECVVKSLQYILNDSVGGEKYNSSLHTIVNQCITPYFKSKTETVVPEYVLKLSLEIA
                     KVGEKVKNWRLLVNDFFMDEKKFILVENPIWKEIMYHWSHYPENKSKVINDLITAVDT
                     KVAGMISFNSWSDSENDAKAQNILRLSFLLLISPVDSYLLQFQSLISLACEYLVSKNV
                     KLKSKCWILLRALFLRFSDSHFNEHWSMLTYSLQTNLQEFFESLHIREEMDVGLLLQT
                     CKTLDLLLALNFEGFSGTNEWLFVIDTINCIYKEYPFVALVDEIYEFKEFERRTVEDV
                     EPLDKIQSQVPLLAGVSSIKSYTQLKNFFQNLSYVHYEYIYSLKGVDMVECENDLFTD
                     IFFT"
     gene            complement(<505874..>506542)
                     /locus_tag="ZYRO0D05940g"
                     /db_xref="GeneID:8203945"
     mRNA            complement(<505874..>506542)
                     /locus_tag="ZYRO0D05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496648.1"
                     /db_xref="GeneID:8203945"
     CDS             complement(505874..506542)
                     /locus_tag="ZYRO0D05940g"
                     /note="similar to uniprot|Q03920 Saccharomyces cerevisiae
                     YDR140W MTQ2 Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family
                     methylates release factor eRF1 (Sup45p) in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496693.1"
                     /db_xref="GeneID:8203945"
                     /db_xref="GOA:C5DVE1"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR004557"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DVE1"
                     /translation="MLPTPYIKCDYETVYEPCEDSFLLLDGLEQEQSFLQTRFRNQLA
                     IVCELGPGSGIVTTFLMQNDIPHGNGSIYLALDISPWALEATQDAQRRNDCQNRYLSV
                     IQSDLTKCLRQNSTDLLVFNPPYVPAEQVPDRPSSNENDKSQWLDLALLGGEDGMVIT
                     RQVLDQLDTILSQQGVAYILFCARNKPEQVAESMRQQGWKVDLIINRKAGWEVLSIYR
                     FIRQ"
     gene            <506710..>507020
                     /locus_tag="ZYRO0D05962g"
                     /db_xref="GeneID:8203946"
     mRNA            join(<506710..506858,506936..>507020)
                     /locus_tag="ZYRO0D05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496649.1"
                     /db_xref="GeneID:8203946"
     CDS             join(506710..506858,506936..507020)
                     /locus_tag="ZYRO0D05962g"
                     /note="similar to uniprot|Q03919 Saccharomyces cerevisiae
                     YDR139C RUB1 Ubiquitin-like protein with similarity to
                     mammalian NEDD8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496694.1"
                     /db_xref="GeneID:8203946"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DVE2"
                     /translation="MIIKVKTLTGKEIAVELNGEDPIYRIKELLEEKEGIPPSQQRLI
                     FQGKQIDDQQTVSSAKLVDGMQLHLVLTLRGGK"
     gene            <507309..>509342
                     /locus_tag="ZYRO0D05984g"
                     /db_xref="GeneID:8203947"
     mRNA            <507309..>509342
                     /locus_tag="ZYRO0D05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496650.1"
                     /db_xref="GeneID:8203947"
     CDS             507309..509342
                     /locus_tag="ZYRO0D05984g"
                     /note="similar to uniprot|Q12309 Saccharomyces cerevisiae
                     YLR117C CLF1 SYnthetic lethal with cdcForty Crooked neck
                     Like Factor an ortholog of the Drosophila crooked neck
                     gene crn pre-mRNA splicing factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496695.1"
                     /db_xref="GeneID:8203947"
                     /db_xref="GOA:C5DVE3"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="UniProtKB/TrEMBL:C5DVE3"
                     /translation="MDAEVKHISAENILQEVYKRRKVVKPSAKVDILDLEELRELQRR
                     KRTEYETYLKRNRLDIGQWIRYAKFEVEQRDIRRARSVFERALLVDSSHVPLWIRYID
                     TEIKLKNINHARNLMNRAVSILPRVDKFWYKYLVIEESLGNVEIVRSLFTRWTSLEPG
                     TNAWDSFVDFELRQENWDNVRKVFAMYVLVHPQTDTWLRWVQFETVHGDTDTVRKVYS
                     LALDTVVSMSEKLTIQDEDLAGLIISFANWEATQQEHERCRELYRISIDKWPQNQFLK
                     EGLVEFEKRFGSSQSIENTVIHKRRRRYELTLQENPHDYDTWWLYLDLIQDNFKADLL
                     KCLDKSVTGTQPKENTKTLAWKSYIFLWIRYLAYVELECANLDICRQLYQRLIELIPH
                     KNFTFAKIWYMYSQFELRNGDLTSARKILGRSLGLCPKPRIFKLYIDMEIKLREFDRV
                     RKLYEKFIEYDGSNVETWMAYADLEANLGDRDRATGIYEISLDPDVTCLTQDAKLQLI
                     QKYIDYMTSEEEFDKARDLYERYLRLTAFSSTIWKMYALYASENPTGDQVQELRESAS
                     ASGNEDEEIEFCVQDVNRQMSRGIFERSLNHFKRLGDKESRIAILEEFKNYENTFGDE
                     ESQEKIQKRQPKLVGPPGQEEYVFPDDEVRNEVPNVSKLQALAKKWEQNRQSE"
     gene            complement(<509420..>510961)
                     /locus_tag="ZYRO0D06006g"
                     /db_xref="GeneID:8203948"
     mRNA            complement(<509420..>510961)
                     /locus_tag="ZYRO0D06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496651.1"
                     /db_xref="GeneID:8203948"
     CDS             complement(509420..510961)
                     /locus_tag="ZYRO0D06006g"
                     /note="similar to uniprot|Q12186 Saccharomyces cerevisiae
                     YLR116W MSL5 Component of the commitment complex which
                     defines the first step in the splicing pathway essential
                     protein that interacts with Mud2p and Prp40p forming a
                     bridge between the intron ends also involved in nuclear
                     retention of pre-mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496696.1"
                     /db_xref="GeneID:8203948"
                     /db_xref="GOA:C5DVE4"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C5DVE4"
                     /translation="MSNSLSEANDGLWEYSQQKNGQEFYNPLATKITGPLTQEQLAAY
                     QIMFRIQEITSLLRSNNLKPPERRNRSPSPPPAYDARGKRINTREQRYAKKLEEERHR
                     LVEVALRLIPHFVAPEDYKRPTKFQDKYYIPVNDYPSINFVGLLLGPRGNTLRKLQEN
                     SGCKIAIRGRGSVKEGKNAYDLPKGAMNFSDPLHCLVIADSEDKIQQGIKLCEGVVIK
                     AVTSPEGQNDLKRGQLRELAELNGILREDNRPCPICGLQGHKRYECPNMETFAQKVIC
                     RRCGQPGHVTIDCTAQLPPHGDSRQSRYDSFRDSSRQAPRFNTTYDSPTTSYRSRYSR
                     RGQEPSQPAPDYGTPLNVPPGLEPNSSVLAVPGMLSTPEDSLTPAPVESASGSSEQSK
                     LIDNGTNKAPGLSAVPGMDAPLAGLSGPPGLPVSDKPPGLDIQGPPGVDFQAPGTGDL
                     QGPPGAEYQPPGGGGLQGPPGSELQPPGDLEGPPGLESQISPSSYGFNEAQPEEGGLS
                     GPPGM"
     gene            complement(<511205..>513712)
                     /locus_tag="ZYRO0D06028g"
                     /db_xref="GeneID:8203949"
     mRNA            complement(<511205..>513712)
                     /locus_tag="ZYRO0D06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496652.1"
                     /db_xref="GeneID:8203949"
     CDS             complement(511205..513712)
                     /locus_tag="ZYRO0D06028g"
                     /note="similar to uniprot|Q12102 Saccharomyces cerevisiae
                     YLR115W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496697.1"
                     /db_xref="GeneID:8203949"
                     /db_xref="GOA:C5DVE5"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="InterPro:IPR022712"
                     /db_xref="InterPro:IPR025069"
                     /db_xref="InterPro:IPR027075"
                     /db_xref="UniProtKB/TrEMBL:C5DVE5"
                     /translation="MTYTFTCCDDGSGNTIGTIVRFDNVTILIDPGWFSSKVSYEDSV
                     KYWSNLIPEVNIILLSQSSVDCLGAYTMLYHNFLPHFISRIQVYATLPVTNLGRVSTF
                     DLYASRGLVGPYDTNQIDVDDVERAFEHIESLKYSQLVDLRSKFDGLTLVAYNSGVSP
                     GGSIWCISTYLEKLIYARRWNHTRDTILNGASLLDGSGKPISTLLRPSAIITTFEKFG
                     SPKPHARRMRCFKDSMKQALTSNGSILIPVEMGGNFLDILVSVHDFLYENSKNKLYSQ
                     VPVILVSYSRGRALTYAKSMLEWLSSSAIKTWESRDNRTPFDLGRRFHVATPEELTNY
                     SGSKICFVSQVDSLVDEVIKHLCQLERATILLPGFTQGYPSALATMYKKWEQASKQQN
                     LEEGKPVSYSGHITLKNIKLDPLVNKELEHYLEQVTERRDSRQELTATLIREAKKTNS
                     IETFAGGAANGQPGALGLGGIGEGDFDDEEEEDNLIGMLRDGTTAPTGKQAVEIPTDI
                     YIQEGTPAKHRMFPFQPPRIKRDDYGSIIDFSMLIPSDDDSSKTKRPSSEEIEEEKDP
                     YDLMDPRRVSVKRSRKDDTKNNPSKNDENWDSIEYLDAVKNPVKRTESSSKVNVKCMV
                     TFINLDSLVDQRSATVIWPALKPKKILLLGPAEAQIESAMLTLRKRDIELTAMPLNKD
                     IQFDTTIKSLDISVDPELDQLLKWQSISDGYTVAHVIGKLVKEKPQAGKSQQQAQEQK
                     QQLHRTRLVLEPLKTTSRHHHKSGSLSIGDVRLAELKRVLTAQRHRAEFKGEGTLVVD
                     GQVAVRKINDGETVVDGAPSELFYLVRKSITDMLAKI"
     gene            <514038..>516167
                     /locus_tag="ZYRO0D06050g"
                     /db_xref="GeneID:8203950"
     mRNA            <514038..>516167
                     /locus_tag="ZYRO0D06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496653.1"
                     /db_xref="GeneID:8203950"
     CDS             514038..516167
                     /locus_tag="ZYRO0D06050g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496698.1"
                     /db_xref="GeneID:8203950"
                     /db_xref="UniProtKB/TrEMBL:C5DVE6"
                     /translation="MELPSEILELVVSQGLDSCQTSISWMQISPVFQKVVTDLLGVVV
                     LQDGVRDLQDMDVPFDYKRLMSKFNTLYVSTDYPNAEQLLEFIKKYMHLLIVIQSDRN
                     YSDVLASLLVSIAQDCTKGTTICVIYCSFQNYLSKLYFRGLSLCEKRVVFSELHLVGK
                     APWNRSELFDVKTLFERTYLYHLKNIYSLDIQNKNHRIISRDLNVINQLNFGNFDEEW
                     HNYFIECPNLKKIENTKYPIRTSDEPFKLPKCESISLTHYVNGIHYQPIDGFKVSGEL
                     KLVPTLRSADPEFYNLHFANLKKLKLVLGDSESHSIRFHNCQFDSLESLDCASCLIPW
                     TNFTDSGVRLKHIRLSLTTDEQAKWLCECPYQLERISVASYGVWSPASPNISHLPLEV
                     MKCQAVDLEIQSIWHCYLCHVLVVPTVGITTDLTITIKEASLLQSILDNHLPMDKWGI
                     NLENDCIILRVPSVKRFTISVTDRSNFGMGNSGPSMPFSSAVGGSSQADYSNIFFDTN
                     ASIQNYAVSPSAFRRKSSGADSATARRQSAIASLTSYPTHPGSVKNRRSSSASSSISG
                     TSLLKTCKFVPFGNCPETITVSLAALDASVISWEEVKTNRIMLLQVLVQEPDSELYCL
                     DDSIHPLSEQITQVLKYPYHISLQGMIVERFQVVVNLEALGLDIQRCQRNQFAADLQQ
                     YLAFKGHDLKVFTESEKNCRVSVLLKF"
     gene            complement(<516283..>518754)
                     /locus_tag="ZYRO0D06072g"
                     /db_xref="GeneID:8203951"
     mRNA            complement(<516283..>518754)
                     /locus_tag="ZYRO0D06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496654.1"
                     /db_xref="GeneID:8203951"
     CDS             complement(516283..518754)
                     /locus_tag="ZYRO0D06072g"
                     /note="similar to uniprot|P17629 Saccharomyces cerevisiae
                     YDR138W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496699.1"
                     /db_xref="GeneID:8203951"
                     /db_xref="InterPro:IPR021861"
                     /db_xref="UniProtKB/TrEMBL:C5DVE7"
                     /translation="MALLDNCIQQCVDFLSPIFKLIAENATDVIDSALNADSFESELL
                     EFNWEPLLKSKIENSDFLIDLVLKRLVTDLLSNEDVHDDFLLHIKRCAVVLDFCFHSK
                     QYREKPTSWIVVYFELFSTVFDMLNWPNATLKFWPYVESRMDWFKMGSSLEPLPFGST
                     NMISYKQPLYDKLRHWNDLLKMVQNNSSLNTPLDNIMSYKLTKFLSELLPLHEESNFN
                     RSALISTRQGSGNPWNKTISSATKRDNSSENVFATDYNYVFDNLLTCPLEFAFRPTEH
                     KMDLDKVLSNLLDSIFETEEDFYRRIKNSHKKLVDINEKLNYQYPCEYEHMPGDQPSY
                     LKNSSRLIGEREAFWHKFCSLKASSVDMVQPTLLDVSTANPDTLYLQMMETDNDFYRK
                     QFLLQLYFTVNMVRQIVTLPEVEKFYKLCYQKEKPSRSINFDNLDEPNRRKTSALCNH
                     ILDNRISKFYRHRDPPLASLIQRLATKDKIFLEAKADGFKVFQNFQVFEHSLEPLTFN
                     YSFKKFGFVEMGNKLVNNVWKINTGLENIKRPQESVKELYDSLHEKFNSGEPVTPTAE
                     YDDKVIKEWQYLRSLRSQYLFEFNKVDENVGINGLFNPSLMESQRDKKRELFQSILQE
                     TKQPHISKLEEARNYIAEKQRRKRAHEEELEENSRKKAKVNIENVEKPVTNSEQVDES
                     IESKSIDTETKTAPVETSEEKSTESVAASGNADKTKEPEGEHKDQEQGQAQTQDQDQE
                     EFRRPEPLKDNSERNAEEPSGQEPDAPVQIQPTTAETDKQEGEDTKGGSQNETQAAPV
                     DGSDPATQMPDSRPSAPSQPENENA"
     gene            <519768..>521735
                     /locus_tag="ZYRO0D06094g"
                     /db_xref="GeneID:8203952"
     mRNA            <519768..>521735
                     /locus_tag="ZYRO0D06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496655.1"
                     /db_xref="GeneID:8203952"
     CDS             519768..521735
                     /locus_tag="ZYRO0D06094g"
                     /note="similar to uniprot|Q12500 Saccharomyces cerevisiae
                     YLR114C AVL9 PHO85 Requiring"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496700.1"
                     /db_xref="GeneID:8203952"
                     /db_xref="InterPro:IPR018307"
                     /db_xref="UniProtKB/TrEMBL:C5DVE8"
                     /translation="MQDELPIIMGLCLVDFHHKRGPEVEYSCGIPKDTEGNIVFPNLP
                     FQALPDGSHSFKETFTYFTLLYNEKKKCSPPNGATEIAEDELGDYTTLFAISCSRQIR
                     SDDLTYKEEDITRSTVQKAIVVISRKPIFGQIKDKVSLVTNAFFLQRDFSDKTIITSL
                     YENLMALFKTWNLQDGHFYLGLSLRRIIYDFKKDILVLLKALLLERQLIFYGTNVEAL
                     CNLQFGLISLIPNLLSHLENSGSPLLYENLENLKVADSFRSSDRKSVLKFLGFPLLIF
                     EKGGLFSPYTPLQQIQDINSEATKFFVIGSSNSLLTERKNELCDIFVNVDDSSVEIIN
                     KSLNAALTLSNHDKKWIDSITNAVVSTWNENDLETPKNSQFEGSEDFIRWQFEDYLTG
                     LLSSIKLSDYMASPKVNDTSLQSIPEEMQNAHPIQLFNNNWVQRWRETQNFEIFNNFT
                     DDRIFDLFTPKHAYNAIDPFTAFQQKLATTFQNLKKNNGSTDGNKPKENISISSKQQR
                     DSTLTKATSSPSSTASSATEINNNNSKEPNMWNSWREYFKDRKKNKKKNNADSTVKST
                     QHLELSRSTNDAIDSALIGLGLHNGIEEPENVNDNDQEKEEEGEEEGEEEGEEEGKQE
                     GKEEGKEENEEEEAESYKSIRRSFTFEETTN"
     gene            complement(<521903..>523867)
                     /locus_tag="ZYRO0D06116g"
                     /db_xref="GeneID:8203953"
     mRNA            complement(<521903..>523867)
                     /locus_tag="ZYRO0D06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496656.1"
                     /db_xref="GeneID:8203953"
     CDS             complement(521903..523867)
                     /locus_tag="ZYRO0D06116g"
                     /note="similar to uniprot|P16664 Saccharomyces cerevisiae
                     YDR137W RGP1 Subunit of a Golgi membrane exchange factor
                     (Ric1p-Rgp1p) that catalyzes nucleotide exchange on Ypt6p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496701.1"
                     /db_xref="GeneID:8203953"
                     /db_xref="InterPro:IPR014848"
                     /db_xref="UniProtKB/TrEMBL:C5DVE9"
                     /translation="MRTHRVDSYLLTENIRLEIVHESNPYFAGENISLVIRIKHLGSY
                     QELVSLKDSLKELHEEIEAQGAYVESQDNDNTNVQEDGRQPWSMKSLLNAMKGMSEED
                     VKPNNAHIDLERQKRQREQLVKQIKYHKPVELMSGYVQIFGMFQFDPEVINETKLDKT
                     SVKVVGLDTPLSHVTKKMSGTAVEENDSNQPNSLAKYFHSKRSAQFLGSSNVNEDELK
                     GDHNAVFTLAAHDESVEYRQFPILLIPQTLLFSELNLEPGETKVFRFKSSKLSRMIPP
                     SYYVSPNISINYSLEVGMGRLYHGDIEQDTIKVPINIAPFVSRSGAQYSPVLNEKVTI
                     MEPGLVKEVKQRQPSGGRVVSSTVHQHARRPSAFSLMNSDRNQDVEKLIHNFAKLVES
                     NQDEFGDLEELVDSQMAIQFPEESSDESPTLMNSDEKREDENGYVTKRMSTVSSNVSD
                     LARLTANRPARKLGFNEEKGLIPQLDNLQNIYQINWNGQSITRIVCSKRFYTITDDID
                     LVLELDHNSPPTHKVSAVTVTLESCELINPEYVTDLENLKKPQVNRIYDAHAICFDDC
                     DRIPLKLIMPKTPMYQLASQFKTDVFQLRWMLGIKFVLVPRTANISLEQFYEDKKGVL
                     YHAKEILEGEEFSCHIPLAILPSASKYGGW"
     gene            complement(524134..524206)
                     /locus_tag="ZYRO0D06138r"
                     /db_xref="GeneID:8203954"
     tRNA            complement(524134..524206)
                     /locus_tag="ZYRO0D06138r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (ACG) cove score=73.20"
                     /db_xref="GeneID:8203954"
     gene            <524435..>529012
                     /locus_tag="ZYRO0D06160g"
                     /db_xref="GeneID:8203955"
     mRNA            <524435..>529012
                     /locus_tag="ZYRO0D06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496657.1"
                     /db_xref="GeneID:8203955"
     CDS             524435..529012
                     /locus_tag="ZYRO0D06160g"
                     /note="highly similar to uniprot|P39109 Saccharomyces
                     cerevisiae YDR135C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496702.1"
                     /db_xref="GeneID:8203955"
                     /db_xref="GOA:C5DVF0"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVF0"
                     /translation="MEALKCKSWVCRFCKSKEGFGPISYYGDFTQCFLDGILLNATGL
                     FMLIFGTRELIKLCRKESPGVKYRKDWVIVSRIFLVLLQIGFVSLACLKLPENKDKDL
                     TVTSQYVITLLSLFEVTILHWIEYNRSRVSNAIVLFYWLIGTIFNSTKTLNFLIRHFY
                     EGKWPMGHSVFILTLFQSINSFFILLLEAIPKKKLMPYQQVQQHLSRRKPNPYDSANI
                     FSKISFSWMTELMRTGYEKFLDERDLYKLPEKFGSGDLANRFDRHWQHQVRRNPHPSF
                     TWALLSTFGPQMLVAGLFKIMFDTLAFVQPQLLRILIKFVTDYSEEHKHKLYEVLGKV
                     HIDKHKVPNVPLVRGFMISLGMFAVSFTQTSILHQYFLHSINTGMNLKSALTSVIYKK
                     SLVLSSEAADMSSTGDIVNLMSVDVQRLQDLAQWCHLIWSGPFQIILCLTSLYKLLGK
                     SMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNKDQRTRLINEILNNMKSLKLYAWEK
                     PYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFFVSCSTFAVFVYTEDRPLTTD
                     LVFPALTLFGLLSFPLAVVPLVLNSYIEASVSIGRLYSFLTNEELQRDSVQRLPRVKN
                     IGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKSALIQSLLG
                     DLFRVKGFATVHGNIAYVSQVAWIMNGTVKDNILFGHKYDPEFYEKTIKACALTIDLA
                     ILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIFLLDDPLAAVDEHVSTHLIDH
                     VLGPNGLLKTKTKILATNKISALSIADSVTLLENGEIIQQGTFCEITKAADSPLSKLI
                     KEYGKKKHKSEVASCGSSPSSSEENERENSVPVKDELEELQKLGNLQLNEDTSQSLRR
                     ASDATLRSIDFDDEEAVNKEHREVGKVKWGIYWEYVRSCGIRNVLIFMSFAILSMFLS
                     VMGSVWLKHWSEVNTKYGANPHAGGYLAVYLAFGIFSALSTLIQTVVLWVYCTIHGSK
                     YLHAGMANSVFRAPMRFFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIKVSFT
                     IIVICFTTWQFTLFVIPLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGL
                     STIRGYNQQRRFIHINQSRMDNNMSAYYPSVNANRWLAYRLEFIGTIIIFGASSLSIL
                     RLKSGSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIPSEAPY
                     LIEDRRPSPNWPTDGAIQFQHYSTRYRPGLDLILKDINLDIKPKEKIGIVGRTGAGKS
                     SLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENIDPTE
                     QYSDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTK
                     ILVLDEATAAVDVETDKVLQETIRTAFADRTILTIAHRLNTIMDSDRILVLDAGRVAE
                     FDTPENLLKNPGTMFYGLCQDAGFVPRPSNA"
     gene            complement(<529121..>530416)
                     /locus_tag="ZYRO0D06182g"
                     /db_xref="GeneID:8203956"
     mRNA            complement(<529121..>530416)
                     /locus_tag="ZYRO0D06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496658.1"
                     /db_xref="GeneID:8203956"
     CDS             complement(529121..530416)
                     /locus_tag="ZYRO0D06182g"
                     /note="uniprot|O93982 Zygosaccharomyces rouxii HOG1
                     Mitogen- activated protein kinase HOG1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496703.1"
                     /db_xref="GeneID:8203956"
                     /db_xref="GOA:O93982"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR003527"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008352"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /translation="MATHEEFIRTQVFGTVFEITNRYTDLNPVGMGAFGLVCSATDTL
                     AGQPVAIKKIMKPFSTAVLAKRTYRELKLLKHLRHENLICLQDIFLSPLEDIYFVTEL
                     QGTDLHRLLQTRPLEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKI
                     CDFGLARIQDPQMTGYVSTRYYRAPEIMLTWQKYDVEVDIWSAGCIFSEMIEGKPLFP
                     GKDHVHQFSIITDLLGSPPRDVINTICSENTLKFVTSLPHRDPVPFQERFKTVEPDAV
                     DLLERMLVFDPKKRITAADALVHPYLAPYHDPTDEPTAEAQFDWDFNDADLPVDTWRV
                     MMYSEILDFHKIGGGDGQIDTNAAFDDQVAAATAAAAHAAAMAQHHHQTQQQSSGKHT
                     NPTTSSSAATHNSNGPHSNHDAIANYGNQAVHYANEFQQ"
     gene            <531615..>532301
                     /locus_tag="ZYRO0D06204g"
                     /db_xref="GeneID:8203957"
     mRNA            <531615..>532301
                     /locus_tag="ZYRO0D06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496659.1"
                     /db_xref="GeneID:8203957"
     CDS             531615..532301
                     /locus_tag="ZYRO0D06204g"
                     /note="some similarities with uniprot|Q12127 Saccharomyces
                     cerevisiae YLR110C CCW12 Cell wall protein mutants are
                     defective in mating and agglutination expression is
                     downregulated by alpha-factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496704.1"
                     /db_xref="GeneID:8203957"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:C5DVF2"
                     /translation="MQFSKIATVAAAAAVASANNVTTETVKHQSTTLVTITSCENHVC
                     SESVSQAQVSTATVTENDVVSEITTWCPLSTAPVTSTANATSEAPSAPVTAAPVTSVA
                     ASNGTAPAPVTSTKPGVSYTTVESVVGTETITYTVPCSETEASATSAPATSAPASSAP
                     VSSEASKSAAPASPSPKGSAAPASSASSSTKSAEASSTKSVPASYTGAADRVLPAAGA
                     LFAGAAALLL"
     gene            complement(532750..532821)
                     /locus_tag="ZYRO0D06226r"
                     /db_xref="GeneID:8203958"
     tRNA            complement(532750..532821)
                     /locus_tag="ZYRO0D06226r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=73.86"
                     /db_xref="GeneID:8203958"
     gene            complement(<533168..>533686)
                     /locus_tag="ZYRO0D06248g"
                     /db_xref="GeneID:8203959"
     mRNA            complement(<533168..>533686)
                     /locus_tag="ZYRO0D06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496660.1"
                     /db_xref="GeneID:8203959"
     CDS             complement(533168..533686)
                     /locus_tag="ZYRO0D06248g"
                     /note="similar to uniprot|P38013 Saccharomyces cerevisiae
                     YLR109W AHP1 Thiol-specific peroxiredoxin reduces
                     hydroperoxides to protect against oxidative damage
                     function in vivo requires covalent conjugation to Urm1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496705.1"
                     /db_xref="GeneID:8203959"
                     /db_xref="GOA:C5DVF3"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="UniProtKB/TrEMBL:C5DVF3"
                     /translation="MSLINQKVPTENFQFQYIPISPSDGDACKLPQAESWSKFLSEHK
                     NVILTGAPAAFSPTCSINHIPEYIKGIKDLQAKGVDQVVVITVDNPFANAAWAKSLGV
                     NDTTHIKFASDAGGHFVKRLGFDLPVGEGVSWSTRWAAVVKDGVITYADKETKPAEEV
                     TVSGLSNIEKHL"
     gene            <534424..>536103
                     /locus_tag="ZYRO0D06270g"
                     /db_xref="GeneID:8203960"
     mRNA            <534424..>536103
                     /locus_tag="ZYRO0D06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496661.1"
                     /db_xref="GeneID:8203960"
     CDS             534424..536103
                     /locus_tag="ZYRO0D06270g"
                     /note="similar to uniprot|Q03900 Saccharomyces cerevisiae
                     YDR132C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496706.1"
                     /db_xref="GeneID:8203960"
                     /db_xref="GOA:C5DVF4"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR003131"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="UniProtKB/TrEMBL:C5DVF4"
                     /translation="MNGLSNITADMRATGTGGGNTSNHANGGARPGIPGALNETISTP
                     TPTSKAASADKADGPMRTLDNVFDPRIPQLLPHENMYKIQIGNKLFKISGASLSSDGP
                     SYFTKCFSESTAETQDQVVFIDRSAEVFQLIYDHLQGYFINIENEVQYTMLYADAMYY
                     NLPRLRTLLKETEYYFTNIGGKSFKVPRSLFRRKGDSPNYFLMTSAALYADVENVFIE
                     KKLLRPPPQAPPYVGRSPEYFNDLMHLLGGSSLELDDCRRESLIKECRYYRFLNLEQR
                     LIKHKIIYNPCAHHEDICIKLSDLNRRGVQLPLEEEKLMCPLNSETPPFEDDRYSSSN
                     SETEQSQTPSSQRLPSHQQQQQQQQSREPPLKRPKTSHTAATSDVKICWNILKYSRPY
                     VDDYPRELSFQIDRPECTLIFDKRFKTIHVCLYNETAHQFEDMFSSELSRMGINLASS
                     KVKTGSNESAPYSKHSVLLALPACVSVCDLSINGVKCPSVRLLLADNQNDQQVPNLNS
                     ASPAPPCPGFKLHLAKSMWKLGVRHGELMMIATKAESFKGVKEFCKLINYL"
     gene            complement(536341..536444)
                     /gene="SNR6"
                     /locus_tag="ZYRO0D06292r"
                     /db_xref="GeneID:8203961"
     ncRNA           complement(536341..536444)
                     /ncRNA_class="snRNA"
                     /gene="SNR6"
                     /locus_tag="ZYRO0D06292r"
                     /product="U6 RNA"
                     /note="SNR6 (U6 RNA)"
                     /transcript_id="XR_002648401.1"
                     /db_xref="GeneID:8203961"
     gene            <536726..>538309
                     /locus_tag="ZYRO0D06314g"
                     /db_xref="GeneID:8204486"
     mRNA            <536726..>538309
                     /locus_tag="ZYRO0D06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496662.1"
                     /db_xref="GeneID:8204486"
     CDS             536726..538309
                     /locus_tag="ZYRO0D06314g"
                     /note="similar to uniprot|Q03899 Saccharomyces cerevisiae
                     YDR131C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496707.1"
                     /db_xref="GeneID:8204486"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C5DVF5"
                     /translation="MLDKVPLELFDRIASLLSQEDRVSLTYVSKKVYQRTLPSLYGSI
                     YLNVKQYFPSDLDRTLGTRDWSVLYFTKSGDNNTVRSIANSKLGSLIRSLRSKPHHLP
                     SLIRRVNCTWHLDKDLLNQLVNTLIEFATNLKIFEDFLDERVATKLSLKGKQMQSMVV
                     TPPSVLPTAPATNDYFARMEVLTTRYNWDNIQHLTLHVNPCTFFPHLEKPLKIKSLTL
                     NLRPDTLGGTFLHQPLYYIFDTGVLETLELLSWYGPDQVEFSLYELWSLEEFYEFHNI
                     REFTLLSLPADRNFLSKCIASFPRLQRLKVDYMLDVPLSALLVDSLSRLPCSQTLQDI
                     DFKFEELDPPLVSIHQDEVSNFNFNVICKCPDCRDTFQRVILGKYFACKDSLIIQDFS
                     DVEARNFTLQLFKLYPILPYTHFVDRNPSIGFYCKSLEAHAEKVNGLLGIEPGHENQV
                     TTLDVLRLYHMHVHSLKKSWDFFLQRFPQLKFVTLNDIPTKVQQVDRQQKCNMPVFYS
                     DGYKSNQVYELVDDESLFD"
     gene            <538491..>539261
                     /locus_tag="ZYRO0D06336g"
                     /db_xref="GeneID:8203962"
     mRNA            <538491..>539261
                     /locus_tag="ZYRO0D06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496663.1"
                     /db_xref="GeneID:8203962"
     CDS             538491..539261
                     /locus_tag="ZYRO0D06336g"
                     /note="weakly similar to uniprot|Q03898 Saccharomyces
                     cerevisiae YDR130C FIN1 Basic protein with putative
                     coiled-coil regions that comprises a filament between
                     spindle pole bodies self-assembles into filaments with a
                     diameter of approximately 10 nm potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496708.1"
                     /db_xref="GeneID:8203962"
                     /db_xref="UniProtKB/TrEMBL:C5DVF6"
                     /translation="MAPKDSNNCLRDVSNTRTSSHSPSTQGNVFKRLGTSPSMRYPNG
                     LSKPPARVSPARKSPVKPLLQLTPKRIQSPECLREYNPKFMHSGGSPSIDDNLTSKVE
                     NRGSTTSILFPTSPTRTIFANERKIGGDGSLGRIRSRFTNGLLSPQKRLAPTPMKNRL
                     EHAMESDNTSDNSNNELQAKNLFEKLKEAEKMEQETNQERSKTQPHKKSVKFELPRKD
                     SKEALKKELQALKELLKEATRRQSELEVRLSKLEEGQD"
     gene            complement(<539347..>540546)
                     /locus_tag="ZYRO0D06358g"
                     /db_xref="GeneID:8203963"
     mRNA            complement(<539347..>540546)
                     /locus_tag="ZYRO0D06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496664.1"
                     /db_xref="GeneID:8203963"
     CDS             complement(539347..540546)
                     /locus_tag="ZYRO0D06358g"
                     /note="similar to uniprot|Q7LI70 Saccharomyces cerevisiae
                     YLR107W REX3 RNA exonuclease required for maturation of
                     the RNA component of RNase MRP functions redundantly with
                     Rnh70p and Rex2p in processing of U5 snRNA and RNase P RNA
                     member of RNase D family of exonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496709.1"
                     /db_xref="GeneID:8203963"
                     /db_xref="GOA:C5DVF7"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:C5DVF7"
                     /translation="MVVRPVDLVNQPAPFQDRYKILQKLLEVLEKVKPNAKGKLNKLA
                     TGLELRVAKSSKSPQSYKFNMSILLRDLNKFHGDLSKIKIGHKPIAHSAPAVENKATR
                     AQAMEKLKSILIDSDTLEKNGYITSIGSAATATATASASGDAQDSQHAICIRCNTKFD
                     KSEVMKKSLCRYHPLKKEYDRESKIHQYPCCGETTDSSSFLRLGCQNRDHHVFREQTY
                     EGMSSISEFKDTRHVEGPENVLALDCEMAYTSLGYEMIRLTIVDFFTSKTLFDEIVRP
                     IGQVIDLNSQFSGVHEIKESESLSYEECMQKVLTESLINKNSILIGHGLENDVNVMRI
                     FHRKIIDTAILYSNGRFKTSLKNLAFENVNRKIQSGEHDSSEDAIATMDVVKSKIGIP
                     IAQKEWD"
     gene            <540803..>555583
                     /locus_tag="ZYRO0D06380g"
                     /db_xref="GeneID:8203964"
     mRNA            <540803..>555583
                     /locus_tag="ZYRO0D06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496665.1"
                     /db_xref="GeneID:8203964"
     CDS             540803..555583
                     /locus_tag="ZYRO0D06380g"
                     /note="similar to uniprot|Q12019 Saccharomyces cerevisiae
                     YLR106C MDN1 Huge dynein-related AAA-type ATPase (midasin)
                     forms extended pre-60S particle with the Rix1 complex
                     (Rix1p-Ipi1p-Ipi3p) may mediate ATP-dependent remodeling
                     of 60S subunits and subsequent export from nucleoplasm to
                     cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496710.1"
                     /db_xref="GeneID:8203964"
                     /db_xref="GOA:C5DVF8"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="InterPro:IPR012099"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVF8"
                     /translation="MGKENMSHNAVLLDLDSAVERFQLFNKTYPAEALDTLFEFDAHV
                     DTDVNLQRLSKLVLSKRFHTGYLFVYKPIFLEIISRWINHHDKLEECVAVLDACSRNI
                     GLFPACKPLVEQFLAQNNEHIITILQNYSTRSEQELRTVLLAYYRLLYHDKEVFGKYV
                     KLDVLYSLVDSKERGTITFLALKVLSIYMDAGERVIDEMIDAHINGESKLYGEYELDS
                     QVDYRFLELNEAKRFANFSRLPEVSECFQRIPGRNYVVLEPEFLSQGVVSICGTLVPF
                     SGSQQPIKESSFVPTEKSIDALRQLANNIRNAEPIMLCGKAGSGKTFLVNQLSKYAGT
                     EESMVKIHLGDQTDAKLLIGTYTSGEKPGTFEWRAGVLTTAVKQGRWVLIEDIDKAPT
                     EVLSVLLTLLEKRELTIPSRGETVKAAHGFHLISTVRIDETQSKRNIDNHSINIIGSR
                     IWKLTHLKELDDKDLHYILCHRYPVLTRLVPKLTHAYKAVKEIYLDQRFTSLNRGAKA
                     RVVSVRDLMKLCERLKVLFENNGITNPDELIESEIFDSIFAEAADCFTGAISEPRALE
                     PLVRTIGESVEISNSRIGLYLSKHVPQFDSYSDHLEIGRAKLPKAVSVLQKKSANATS
                     FATTNHSLRLMEQISVSVQMTEPVLLVGETGTGKTTVVQHLCRLLNKTLTVINVSQQT
                     ETGDLLGGYKPVNSKTIAIPIQEKFESLFAATFSLKKNEQFYKMLHKCFNKNQWKNVV
                     RLWKEAYKMANNILKVQRANDDDNAEKKKKKRKLNEHEQMLLSETWEEFNAAVEKFEF
                     QSSSIESSLVFDFVEGALVKAVRNGEWLLLDEINLASPDTLESISDLLDEGSKRGVLL
                     SDKGDIEPVRAHPNFRIFACMNPATDIGKRDLPPGIRSRFTEIYVHSPDRDITDLLSI
                     IDKYIKNYSTSDEWVGNDVAELYLEAKRLAESNKIVDGSNQKPHFSIRTLTRTLLYVC
                     DIVNIYGLRRSLYDGFCMSFLTLLDGDSEAILEPIIRKYTLGRLKNVKAVISQAPPSP
                     GPDYLQFRHYWIQKGSFEPKEESRYIITPFVEKNMMNLVRATSSKRFPVLIQGPTSAG
                     KTSMIKYLADITGHKFVRINNHEHTDLQEYLGTYVTDDTGKLSFQEGILVEALRKGYW
                     IVLDELNLAPTDILEALNRLLDDNRELLIPETQEVIHPHPDFMLFATQNPPGIYGGRK
                     ILSRAFRNRFLELHFADIPQEELEIILRERCQIAPSYAKRIVEVYRQLSIERSASRLF
                     EQKNSFATLRDLFRWALRDAVGYEQLAANGYMLLAERCRSAPEREVVKRVLEKVMRVK
                     LDMDRYYADSENSLLLSEKSDVVWTGASKRLSFLVETCLKNKEPVLLVGETGCGKTTI
                     CQILASYYRKNLIALNAHQNTETSDILGAQRPVRNRSEIQARLTKLLQSVLDLPEDQL
                     EMLTLEGLIAQYDIMDRTSLDENVKIQIDELRSNLSILFEWCDGPLVHAMKTGDFFLL
                     DEISLADDSVLERLNSVLEPERNLLLAEKGSSDSLVVAVEDFQFLATMNPGGDYGKKE
                     LSPALRNRFTEIWVSSMDSLEDVRMIVSSKLLPDLRDLVDTVVSFSEWYANKFGKGMS
                     GGGIISLRDILAWIEFMNCTYHKVGDKGIILVHGAAMVFVDALGTNNTAYLAESPERL
                     RALKQECIAHLSIFANIDLKPQFNQAIQVQTSEMSLRIGPFEVSRKEHGDMATKFNWN
                     APTTSKNLLRVIRAMQVRKPILLEGSPGVGKTSLVAALSEITGNKLTRINLSEHTDLV
                     DLFGSDVPGEKTGEFVWRDAPFLRAMQKGEWVLLDEMNLASQSVLEGLNACLDHRGQA
                     YIPELDRSFSCHPEFMVFAAQNPQYQGGGRKGLPKSFINRFNVVYNDTLTADDLLLIA
                     NQLYPDVSLEVIKKIIQLMSTLEYEVCKLKKWGSSGSPWEFNLRDTLRWLKMLNQESL
                     VSELDIFDFVDVVVVQRFRSQVDKSKAREVVERIFGAHEKRENFYKLDRDFIQINGEL
                     VKRNPLFSCPTHEKLLSLESNFSFYESALRAIKHSWPLILVGPTNAGKSGIIEFLASV
                     LGAPVSTFSMNSDVDSMDILGGYEQVDLTRKISYIINDLKLVLREILLVNLSLNFGKR
                     EAIVGALELLNFICTNIVSVENFKYFSEKFNGVFSFLYDSPQLQEFSTRIQEMTTIIE
                     QGDQVKFEWFDGMLVEAVEKGNWLVLDNANLCSPSVLDRLNSLLESDGSLIINERSEE
                     NGEPRVITPHQNFRLFLTVNPKFGELSRAMRNRGVELYVEELHSRASYYDCLNLGVET
                     SKEPSQLERGFKAMSLSILDSIVPLKRYLPAQLASAQVFGQLHDVISLSGDQPATEAL
                     LGVVPINRLKQLEQWMGNVIQNRQFSEQRLASEICELLKTFDKEGIVRKVNSIYSSAD
                     ERLLKILDHSPSDLSEQSLFPLLNTYLLPSVLPAQTTNGLSETVYLFSTVKLLHESIN
                     LLERTMEKAIKGKLSSLSYIELSAAVVGGRNVKNPPRIPIYQVLQDLANKVWQIVGQE
                     TLFQRNDIFESLWKLLVLWFGIFETAGRKDEARLRAYKELLEEWQTSAQAEGLITSEF
                     SFLSKFSDGVKLQRGTSIALIWENFKQPYPSSSEGWSLWDALFDISRKFDRVVKSQYV
                     ESYASINGLREIFRMLFEDLIQNDVLEFRNLLLKLESGIEDLENISSKFLNKRINYFE
                     NEFNDLLRLVFNQHNGMVEQLASLSSIPTGKIIRQQQKRHSGPAVFDILWTEVDDKFQ
                     SSISSLITSSLFERIIIKSNNLKHFAGSQVKQTLTDAKLLLSSTVDSSETILQDQLTF
                     FGGLLRDWVVRIIQLHVKEGVVSFDNELLQKQVSKETDEKFYKVFVENLLPALQYATS
                     ASSFSILGRGWILFGVGMMELYAPDRPFDPAIHEYVSYDTSSKHKSFLEKMKESLASV
                     RQVTSGDDLIFAEKVLLEKPDIGELERPRIYRPDFPIDNLFDEWTALLNSSLNHEQVS
                     RLMNTVDDWSNITKGQLELFQQNTSRFLQRLETGYKFYTDLNDIFSSYVLSMKFGFDL
                     MRCDREGKEKNLDLPLLWSVDPLTLVSPTSISETFSKLSSFFKRNNTGSASSEVVLAF
                     LMQLFKFHNKPEAMLSTFNGILQTLYFRWSQRRMKEEQEARERSSLFRFEDNAEDFEE
                     DFRNMFPDYEETVSADNEGTSSSEEELQDAYYSIAKIYISIFQDSKERNLEHMVEMGS
                     KIVEQLARSSLKFKSGTLSENHLTSVVHLLAKNINAFEMPKDNENFNFYKDFSISESQ
                     KAISIVESLWKFVHELLGNWPEHATLRELFRICHEFLSYRSSTPVAKMLQKIEQIYTF
                     VAEWEKYASSRVSMGIHIRKITDLIISWRKMELQTWNGLLKSEEDQINRNIGKWWFYL
                     FEIIIVASISDESANGSQTTLVSHLNIFFSKSSYGEFKTRLDLLRAFAEHTKLLGWGE
                     YSIFHSIQNVLKFYGQFESAVEEHIANSKKSLEKEISEIILLASWKDVNIDALKQSSR
                     RSHNNLYKVVRKYRSVLSEAIQPTVESGISFSIKESLPMITLKGSYATDYDVLSAEKQ
                     VTKIVGWDSRSDIMKNPHNVYSRMKFFITKMENLSFPSLLDFATDISEEAESLQKDTP
                     KVYSKDQKKKLASLKVLKGKLLSDSLKELRRIGLKSSFREDIHKVQSTSTAILSNVVS
                     FTETELEGCDGYFFRIIDLLPKLRAAVSEPSDNIPFASIEKGMAIAENLIFSLITVRQ
                     PIYDLGVIHYKYQGLLEDLKTISFSRGTLNHNSRSMDFEQLKSVGEWFPVLLEYAIVT
                     LSFMKQEKAKKSVVELEQIRVRTEEFYTRLCSVKVLDSMADELLTEFNEFISNAMNSL
                     ERCKDPCSFFVFDVLLSWLSEQAHFPVKDLKSEDGRAEDFDQTFRGIFTSLVLSFQKI
                     MNMELLSVNEDDDKWLSSTAKQLMNVNKVFINSSILQKLEQAIKQIKEMHLAGPTVTL
                     IRAVITFTLPAINSYYDAMSAMLLKSREYYVNTSHGTYILATLLHNLAKNGFCSPEPP
                     SEMHDDKNLHEGTGLGDGEGAQNNSKDVEEDEDLTENAQEANRDEQDKDEDDPNEDKN
                     DAVDMEGDMAGDLEELSDQGSGSDESGDEDENEMDEQVDDVNEDDPNAIDDKMWDEKP
                     ESDSKERNAENNVQGQKDDDDVQAAEGEDSKNENDQQQQGEDENNNEEFDDANKEGSD
                     KEGSDKEGDEKEEDGEDGEDDAAGQDDSVRQEEGEENAIDAPEIETLDLPEDMNLDSG
                     DEKSEDEGEDENMDVSDGEMGDEDEGEEDGKQEENAEAAEPEDEENGEDAENEEDEEG
                     HMDTEEPEDQKLDGEEDGVQSEDEKEGGEAEEDENMSDENDLAETQMGENAEQEKGND
                     EQAEGLDGLDEVPEPEDVDADAAAQQKSGSKGAGSESKDTDEQDNVGNSGNAQNYQEE
                     QQDQENENNEASREDAKEAFKQLGDSMKEYYNRRKEIQEASQQEKEEETTENANQRPD
                     EFEHVDGANTETDTQALGMANQEQILPIDQDKAIDDDEEPHGEDEDIQMLDEEQEADK
                     EYGQPEENEAGEENENARATGASVGEMKEDSERGNLLAEDILKNREEDDLEPLLDEID
                     EEIYQQEELAEPCRDLEESRTLWHKSELSTSELSARLSEQLRLILEPTLATKLQGDYK
                     TGKRLNMKRIIPYIASQFRKDKIWLRRTKPSKRQYQIMIALDDSKSMSESKCVKLAFD
                     SLCLVSKTLTQLESGGLSIVKFGETVKEVHPFGEQFSGEAGAKAFQWFGFQETKTDIR
                     RLVAESIKIFERSSVFASGDQWRLQIVISDGVCEDHETVQRLVRRARENKIMIVFVII
                     DGINSSESIMDMSQVKYVTDQNGNMQLKIDKYLDTFPFEFYVVVHDISELPEMLSVIL
                     RQYFADLASS"
     gene            555923..556013
                     /gene="SNR79"
                     /locus_tag="ZYRO0D06402r"
                     /db_xref="GeneID:8203965"
     ncRNA           555923..556013
                     /ncRNA_class="snoRNA"
                     /gene="SNR79"
                     /locus_tag="ZYRO0D06402r"
                     /product="snR79"
                     /note="=C/D snoRNA monocistronic SNR79"
                     /transcript_id="XR_002648402.1"
                     /db_xref="GeneID:8203965"
     gene            <556125..>557198
                     /locus_tag="ZYRO0D06424g"
                     /db_xref="GeneID:8204488"
     mRNA            <556125..>557198
                     /locus_tag="ZYRO0D06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496666.1"
                     /db_xref="GeneID:8204488"
     CDS             556125..557198
                     /locus_tag="ZYRO0D06424g"
                     /note="similar to uniprot|P16658 Saccharomyces cerevisiae
                     YLR105C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496711.1"
                     /db_xref="GeneID:8204488"
                     /db_xref="GOA:C5DVF9"
                     /db_xref="InterPro:IPR006676"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/TrEMBL:C5DVF9"
                     /translation="MGKRKPSSARYKYPLPIHPIELPPLIPHNPISWVYWTYCYFSSV
                     NGLTNKIHVEFFNDKYVHIVVKDDSQMNYLWENGFFGTGQLSRSEPTWKNRTHNRLAD
                     SDGHGNALEKVTQHRRLLRLEFKKQREKMEQELLELRRKGGTIEQEKELLEQQRKSLR
                     VYKSQQSSAEVLPHEETIRDIDLLLFTDDGKIRQLESLELMPVEAMFLTFALPVLDIT
                     AKDLTRRLVGIPEKYEDIHQFISQYVVYHHYRSHGWCARSGVKFGCDYLLYQRGPPLE
                     HAEFCVRILNSNDIKDYNWYSSLARVVAGANKTYVLCYVESLRSPETILRWWHQGNYK
                     SIFSSYKVGEITYKRWIPGKNRE"
     gene            complement(<557259..>557636)
                     /locus_tag="ZYRO0D06446g"
                     /db_xref="GeneID:8203966"
     mRNA            complement(<557259..>557636)
                     /locus_tag="ZYRO0D06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496667.1"
                     /db_xref="GeneID:8203966"
     CDS             complement(557259..557636)
                     /locus_tag="ZYRO0D06446g"
                     /note="similar to uniprot|Q08045 Saccharomyces cerevisiae
                     YLR104W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496712.1"
                     /db_xref="GeneID:8203966"
                     /translation="MNCACRVIAVCLLLVQVSGFLFNFNQDPPTPPQPYEDKFLNSGC
                     EGYLCPDTLECVSHVKECPCPFPKSQLKCTLPNNQYICISKPATHDEKLNAIYDDPAK
                     GPKAKNKGIRDCGWVLEAYKDQV"
     gene            <558128..>559987
                     /locus_tag="ZYRO0D06468g"
                     /db_xref="GeneID:8203967"
     mRNA            <558128..>559987
                     /locus_tag="ZYRO0D06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496668.1"
                     /db_xref="GeneID:8203967"
     CDS             558128..559987
                     /locus_tag="ZYRO0D06468g"
                     /note="highly similar to uniprot|Q08032 Saccharomyces
                     cerevisiae YLR103C CDC45 DNA replication initiation
                     factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496713.1"
                     /db_xref="GeneID:8203967"
                     /db_xref="GOA:C5DVG1"
                     /db_xref="InterPro:IPR003874"
                     /db_xref="UniProtKB/TrEMBL:C5DVG1"
                     /translation="MYYGIRQIAEPYHRILRSSSSHSSCQLVIFVSCLNIDALCSAKM
                     LTNLFKKQLVQSQLVPVFGYGELKDHYSKLDDNVTSVIFIGCGGGICLDEFLELDAEQ
                     LLMDTDDALKERKFNRHIYVFDSHRPWNLDNIFGSEIVICLDDGTADDSLQRQKEAYF
                     QLIRLDAESEGQEEDEDTQEDETDEDEDEDEDGDGKRSSSEGPSSKKAKKQRKRLIDE
                     YETILEDYYSQGTSVVNSMSLQVYSLITTIGESNLKYLWWTILGTTSLDTAYPQVYNR
                     LYPLLQDEVKRLSPSHQAVKTPDTLSLNIQPDYYLFLLRHSSLYDSFYYSNYVNAKLS
                     LWNENGKKRLHKMFARMGIPLSTAQETWIYMDNSIKRELGIIFDRNLDRYGLQDIVRD
                     GFVRTLGYRGAISASEFVEALTALLEVGNSITRETGDTTEEVSVNSQKRWISNFWLSW
                     DALDDGKVDLLNKGIRHAQTLQKAVFNTGVAILEKRLIKHLRIYRLCVLQEGPDLELY
                     YNPLSLLRLGNWLSECCAESENKQLLPMVLASLNESTDTYLVAGLAARYPRGMDMLQV
                     RKPILNNFSMAFQQIAAQTDARVKIDNFESSIIEIKREDLSPFLEKLTLSGLI"
     gene            <560165..>561019
                     /locus_tag="ZYRO0D06490g"
                     /db_xref="GeneID:8203968"
     mRNA            <560165..>561019
                     /locus_tag="ZYRO0D06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496669.1"
                     /db_xref="GeneID:8203968"
     CDS             560165..561019
                     /locus_tag="ZYRO0D06490g"
                     /note="similar to uniprot|Q12107 Saccharomyces cerevisiae
                     YLR102C APC9 Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496714.1"
                     /db_xref="GeneID:8203968"
                     /db_xref="InterPro:IPR024274"
                     /db_xref="UniProtKB/TrEMBL:C5DVG2"
                     /translation="MSETQKITLSSLTGQTRRLLLLAMSRATKSNASKRDPNLPVESP
                     LFQLPSVAPWRTPKLQKGSNPYSRYNSVTPLRRPSTLLIHHLEQAPVSSGKEELEIDT
                     VLDENELSKEPSLPAEEAEYDYKPFSEKPLLRESKIESYLQAERAAHCLIFHTSGHIP
                     GADDKYRPDAELECGEDEWEGQELNHDEGPLLLSVPGCSKHDLCQLLNKNHMRPRPNV
                     RRIDEILNHEFNALKSFWGDSSLATTLDRNHLHEQYLLLMQEQKEIAQFKSLLHSSRP
                     IKPHVPHN"
     gene            <561299..>563221
                     /locus_tag="ZYRO0D06512g"
                     /db_xref="GeneID:8203969"
     mRNA            <561299..>563221
                     /locus_tag="ZYRO0D06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496670.1"
                     /db_xref="GeneID:8203969"
     CDS             561299..563221
                     /locus_tag="ZYRO0D06512g"
                     /note="highly similar to uniprot|P32599 Saccharomyces
                     cerevisiae YDR129C SAC6 Fimbrin actin-bundling protein
                     cooperates with Scp1p (calponin/transgelin) in the
                     organization and maintenance of the actin cytoskeleton"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496715.1"
                     /db_xref="GeneID:8203969"
                     /db_xref="GOA:C5DVG3"
                     /db_xref="InterPro:IPR001589"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:C5DVG3"
                     /translation="MNIVKLQKKFPTLSQEDLFGVIEKFRNIDIDEKGWVEKQQVLDA
                     VSKSGEASYDEAREALKACSVDASGRVELDDYVELEAKLKDSKAGPPPQTSFATAAPI
                     SQPSAPSQLQHKGTGSHAKIIVGGATAGSQHTINEEERSEFTKHINDNLAGDPQIGHL
                     LPFPTDTFQLFDECRDGLVLSKLINDSVPDTIDTRVLNLPKAGKRLNNFQASENANIV
                     INSAKAIGCVVVNVHSEDLIEGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDD
                     ETLDQFLRLPPEQILLRWFNYHLKHANWHRRVSNFSGDVSDGENYTILLNQLVPDQCS
                     RAPLQTPDLLQRAEQILVNADKLGCRKYLTPNSLVSGNPKLNLAFVAQLFNTHPGLEP
                     IEESEAPEIEEFDAEGEREARVFTLWLNSLDVDPPIVSLFEDLKDGLVLLQAYEKVIP
                     GVVNYSVVNRKPNTGAEMSRFKALENNNYAVELGKFNGFSLVGIEGSDIVDGNKLLTL
                     ALVWQLMRRNITNTIRNLSSSGRDMSDSQILKWAQDQVHKGGKSSKIHSFKDSQLSTA
                     HFLLDVLNGIAPGYVDYSLVAPGTNDDEKYANARLAISIARKLGALIWLVPEDINEVR
                     SRLIITFVASLMSVNK"
     gene            complement(<563454..>564565)
                     /locus_tag="ZYRO0D06534g"
                     /db_xref="GeneID:8203970"
     mRNA            complement(join(<563454..564453,564525..>564565))
                     /locus_tag="ZYRO0D06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496671.1"
                     /db_xref="GeneID:8203970"
     CDS             complement(join(563454..564453,564525..564565))
                     /locus_tag="ZYRO0D06534g"
                     /note="similar to uniprot|Q12452 Saccharomyces cerevisiae
                     YLR100W ERG27 3-keto sterol reductase catalyzes the last
                     of three steps required to remove two C-4 methyl groups
                     from an intermediate in ergosterol biosynthesis mutants
                     are sterol auxotrophs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496716.1"
                     /db_xref="GeneID:8203970"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DVG4"
                     /translation="MVGRKVAVITGTNSNLGLNIAYRLIEQEDPTNRLTIVVTSRTLP
                     RATEAINLIQKFAKKCPRVGIVDYDYLLIDFTDMVSVLGAYYELTKKYKEIHYFFVNA
                     AQGVYGGIDWIGAVKEVCTNLIKSVTYPSYKIQRIGVKSDDDLGLVFQANVFGPYYLI
                     QKILPQLTAGKASVVWISSLMSEPKYFSINDIQLLKSDASYEGSKRLVDLLHMATYKD
                     MKNHGIHQYLVQPGIFISNSFSIYLNIFTYYGMLALFYLARWLGSVWHNVDGYKAANA
                     PVYAATLANPNFEEQYLKYGSASGRDGMEYIQTQEVDPTGASDVQEYLSKLKLEWDEK
                     LKDQITNSRETV"
     gene            complement(<564778..>568221)
                     /locus_tag="ZYRO0D06556g"
                     /db_xref="GeneID:8203971"
     mRNA            complement(<564778..>568221)
                     /locus_tag="ZYRO0D06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496672.1"
                     /db_xref="GeneID:8203971"
     CDS             complement(564778..568221)
                     /locus_tag="ZYRO0D06556g"
                     /note="similar to uniprot|Q03897 Saccharomyces cerevisiae
                     YDR128W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496717.1"
                     /db_xref="GeneID:8203971"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR025651"
                     /db_xref="UniProtKB/TrEMBL:C5DVG5"
                     /translation="MVGYVGGDPYQSPSFGKSLSLRVDGGVNALSINPSGRDVVLASK
                     QGLHIIDLDDPFSPPRWLRHVTPWQVADVQWSPHPAKPYWVVSTSNQKAIIWNLAKPS
                     SNAIEHVLHKHFRAITDINFSPQHPDILATCSIDTYVHAWDLRSPQRPFYTTSGWLSG
                     ASQVKWSFNDQNVLASAHGNDVCIWDLRKGSTPLGKLVGHGSSVNSVDFNRFKRTELM
                     TGSNDGSVKFWDYSKSCNEPIKTIRTDFPIWRGRYLPFGEGCCLMPSVGGFNSVYVAS
                     LAKRDGVEEVNDSKLQPIYAFKGHDDRVTDFVWRSRSSCGSDGCDREFQLVTWSKDCD
                     LRLWPVPETVYEKINFNRHQQLDESIPDYEYTTYNREPEVAKPQLGSHSKRIKENFVS
                     TSGLKSKKDVNHISWLSGVRMNYNSSPESIFKERTLQNLGEEVSSLGHKFPKVVFEKI
                     SVSTGELIITLNGPWSDNNPDEYVFLRIDVKVPPEYPSKGYPPVFSIEDNGNLSSERR
                     EYINKQLKEISDTCTASGLYCLEPCLRLLLGEKVNLEELGQNDEPLLNFEIADQLAME
                     NLSSVPSSEDPTEYLSDSSTSESEEKEDDKVLNMGVDFDGQISRDLAFDSTPVPTECG
                     AIWSPNGTLLCFFASEGKQDKKQQAMLRLASRDTAKHQNGYHRKGSRKNMILTENNAT
                     DSNKNLRPKRYVETIPSAANPLGKSNHVTSEEESNSDEYSDSFEDDWSDILVNDIGVR
                     TKLPALRGRVSKTFESVNSESGKTTESKKMKNVVITKDFSHLIPDRKDLALEFRFTDA
                     PQGELARHNALVAEKYGLEEKSHCWQILSDLLMTNEETDPYNLIWDNHPMGIKWYIKE
                     VLSYFEKRNDVQMLAMLGAVAANTATSVLSTTNAEKLDSNHANKKMESTINFNPNENA
                     NSWRTDMLSHLSSSNGVAPSFFESNRHRPSPDEISIKSEDYFSLKHYNNTAAIAPTVS
                     PPISNTAVSATIAHNQQNASKLPNVTIELIDDDVLTAIRQPVRSLLDPNDAVKLRFYS
                     YQYAKLLYIWGLPMQRAELLKISFESIHKNTSDFDSHTSNDNQDLFGEIRTSWMENKY
                     REPNFHSCNYCGLKVTRNIFLCESCEHVMHASCARDWWAQSEQCASGCGCHCTDLLKM
                     S"
     gene            complement(<568750..>573519)
                     /locus_tag="ZYRO0D06578g"
                     /db_xref="GeneID:8203972"
     mRNA            complement(<568750..>573519)
                     /locus_tag="ZYRO0D06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496673.1"
                     /db_xref="GeneID:8203972"
     CDS             complement(568750..573519)
                     /locus_tag="ZYRO0D06578g"
                     /note="highly similar to uniprot|P08566 Saccharomyces
                     cerevisiae YDR127W ARO1 Pentafunctional arom protein
                     catalyzes steps 2 through 6 in the biosynthesis of
                     chorismate which is a precursor to aromatic amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496718.1"
                     /db_xref="GeneID:8203972"
                     /db_xref="GOA:C5DVG6"
                     /db_xref="InterPro:IPR000623"
                     /db_xref="InterPro:IPR001381"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR006264"
                     /db_xref="InterPro:IPR008289"
                     /db_xref="InterPro:IPR010110"
                     /db_xref="InterPro:IPR013708"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="InterPro:IPR016037"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018508"
                     /db_xref="InterPro:IPR023000"
                     /db_xref="InterPro:IPR023193"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVKFEKVPILGKESIHVGYDIHTDMVQTIINDCRSSTYVVVNDT
                     NLSKVPYCQDFVQELRSSLPEGSRLLQYAVKPGEANKTRSTKADIEDYLLSKGCTRDT
                     VIIAIGGGIIGDMVGFVAATFMRGVRVVQVPTSLLAMVDSSIGGKTAVDTPLGKNFIG
                     AFWQPQFVLVDVKWLETLPRREFINGMAEVIKTACIWNGLEFERLESNAELFLRVVNG
                     SKVIKVNGLSTGEVNDIHYTNIEAMLEHTFKLVLESIKVKAEVVSSDERESSLRNLLN
                     FGHSVGHAYEAILTPQALHGECVSIGMIKEAELSRYLGILSPTQVSRLTKILAAYGLP
                     ISPEEKWFKDLTLQKKTPLDVLLQKMSIDKKNDGSKKKVVILESIGKCYGKSAHYVND
                     EDLKFVLTDETLVYPFSNIPQEQAKTIVPPGSKSISNRALILAALGKGTCKIKNLLHS
                     DDTKHMLTAVQELKGASITWEDNGETVVLEGHGGETLTASADPLYLGNAGTASRFLTT
                     LAALVNSSSKQDYVVLTGNARMQQRPIGPLVDSLRTNGTKIDYLKSEGSLPLKIYTST
                     PFKGGRIELAATVSSQYVSSVLMCAPYAENPVTLALVGGKPISQLYVDMTIKMMEKFG
                     IKVEVSTTEPYTYHIPKGQYTNPPEYIIESDASSATYPLAFAAMTGTTVTVPNIGYES
                     LQGDARFAIEVLRPMGCKVEQTANSTTVTGPPTGSLRPLKHVDMEPMTDAFLTASVVA
                     AVAHDNDTDSANVTTIEGIANQRVKECNRIEAMSTELAKFGVATKELPDGIQIHGINS
                     LDLLQLPSNSTGPIGIESYDDHRVAMSLSLLAGMVNYSKSHPAADIKPVRILERRCTG
                     KTWPGWWDVLHTELGAHLDGAEPLGYLSGKKTKRSVVLIGMRAAGKSTLGRWCSQILG
                     YELCDLDVLFEKQYAKGTVKDFVAEHGWDKFREAEANLFKETVEQYGDGGYVFSAGGG
                     LVENEVSREHLKKYASDGGVVLHLHRDIEETIVFLQSDPTRPAYMEEIRDVWERREKW
                     YNECSNFAFLAPHCSNEKEFQHLRKSFANYITAITGNREVQVPNKRSAFVCLTFGDLT
                     EKASVLPSIVRGCDAVELRVDHLAKYDSQFVSKQLSTLRTATNDLPIVFTLRTKKQGG
                     KFPDEDYTGMARLFDVALKACVEYIDLELTLPIDVQYKVSNTKGYTKIIGSHHDFGAK
                     YPWKDPEWENRYNQALSLDVDVIKFVGTATKFEDNLALERFREEHKSKPLIAINMGEI
                     GKISRVLNPILTPITSEHLPNSSAPGQLTLAQINKIFASMGGITSKKFFVVGNPVSHS
                     RSPVLHNTGYKLNGLPHHFDRFETDSAQVVKETLLDGEPSLGGLAVTIPLKLDIMKYM
                     NQLTDAARVIGAMNTVIPLGNHHFKGDNTDWIGIKHSLTSNGVPEKVSNVAGLVIGAG
                     GTSRAAIYSLHNLGCHRIFVINRTVSKSIELRDSFPQEYNVVAAETTQQIDHLNEHIG
                     IAVSCVPADKDLDTELLAKLERFLHKGKHNSFVPTLLEAAYKPDVTPVMKLAHDKYQW
                     QVVPGRELLVHQGVAQFEIWTGAKAPFQEIFNAVTRD"
     gene            complement(<573724..>574716)
                     /locus_tag="ZYRO0D06600g"
                     /db_xref="GeneID:8203973"
     mRNA            complement(<573724..>574716)
                     /locus_tag="ZYRO0D06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496674.1"
                     /db_xref="GeneID:8203973"
     CDS             complement(573724..574716)
                     /locus_tag="ZYRO0D06600g"
                     /note="similar to uniprot|Q04629 Saccharomyces cerevisiae
                     YDR126W SWF1 Spore Wall Formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496719.1"
                     /db_xref="GeneID:8203973"
                     /db_xref="GOA:C5DVG7"
                     /db_xref="InterPro:IPR001594"
                     /db_xref="UniProtKB/TrEMBL:C5DVG7"
                     /translation="MMLILIAALILQIAVLLISPLFKYQWPFSLYYKYVFLPLFQDND
                     RFRWKFYLVPLFYSSIYLGVVHLAIKNVIPQLSPGLNFFDYWFFIPFFIVLTPATGIL
                     AAIIGPETTKSCKRRNIDKFRYDNLLFYPNINCRTCQLPKPARSKHCNVCNQCVLAVD
                     HHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFIRSMSIVGLKPNIKYPRSILAFNLL
                     TGCFALICIVFTYLQLCMVREGMTTNEKDKWFTIHEYMREKRLVKSSSGKWYYDLTDR
                     LDLPTDQHEFFSTNPYDGRLYRLQSYTLIEDAERINNIYDEGSFMANLRTLCLT"
     gene            <574866..>575483
                     /locus_tag="ZYRO0D06622g"
                     /db_xref="GeneID:8203974"
     mRNA            <574866..>575483
                     /locus_tag="ZYRO0D06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496675.1"
                     /db_xref="GeneID:8203974"
     CDS             574866..575483
                     /locus_tag="ZYRO0D06622g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496720.1"
                     /db_xref="GeneID:8203974"
                     /db_xref="UniProtKB/TrEMBL:C5DVG8"
                     /translation="MIVLYQEVQVRFQKNKGKTLQYITHRDSNRSFWGGLSGVVVMDS
                     TVPVDLTTLQETLEHLHQVINGLAFYLNTVRLKKSEIRQCCESYWYGEQLGVSCDPHR
                     DICRLQEIASMARLVHNMSVPLNSISLIEIQEHIKKLFPSNPVHKLETVSYFSSPSLD
                     EKLLTSVVVDLLISVCRGLTGTDHQTSPHLQKEIVSIINMRFIRP"
     gene            complement(<575600..>575980)
                     /locus_tag="ZYRO0D06644g"
                     /db_xref="GeneID:8203975"
     mRNA            complement(<575600..>575980)
                     /locus_tag="ZYRO0D06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496676.1"
                     /db_xref="GeneID:8203975"
     CDS             complement(575600..575980)
                     /locus_tag="ZYRO0D06644g"
                     /note="some similarities with uniprot|Q3E798 Saccharomyces
                     cerevisiae YLR099W-A Hypothetical ORF identified by
                     homology. See FEBS Letters [2000] 487:31-36."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496721.1"
                     /db_xref="GeneID:8203975"
                     /db_xref="UniProtKB/TrEMBL:C5DVG9"
                     /translation="MSSGDEFGSWESVGQNIPRSLRPELADVLDDMEREAELLDAYDE
                     DEELPLNEGEEEEEEYSDYESDLMDDYYEGQLLDAQKQWEESLDQLNKVLNWILLPLV
                     GKFLGRRVAKTIWKRVMEYCWSGF"
     gene            <576172..>577314
                     /locus_tag="ZYRO0D06666g"
                     /db_xref="GeneID:8203976"
     mRNA            <576172..>577314
                     /locus_tag="ZYRO0D06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496677.1"
                     /db_xref="GeneID:8203976"
     CDS             576172..577314
                     /locus_tag="ZYRO0D06666g"
                     /note="similar to uniprot|Q04623 Saccharomyces cerevisiae
                     YDR125C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496722.1"
                     /db_xref="GeneID:8203976"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DVH0"
                     /translation="MMWWITDWMSRKDPVADLKHFQDKIMNLVKVGGNMENTMVNGQV
                     NQWHFHNSNASEVTTPTLLIHGYAASSMAYYRTFQGLTDKISDLYTIDLPSNGLSKEL
                     PLILDGQTPPPLKVEIHKDGSKFKIIERVDAEHCRSVVKQYEDYYLDSIELWRKHNGI
                     GRFNLVGHSFGGYIAFKYAVKYPKAVEQLGLISPLGVESNIYSVNNDWKLDTVYEMES
                     TDPASRMYGKNWEIPKVLFERQTELLRWMGPIGAKLCWNYITAAYNKLPTMEYKDYVF
                     ELLYGNGGIPKTARKVFGGLFTRSLLARDPIMDSMDKLGARKVLLLYGDSDWMNNYAG
                     YRMVELLNQKRGKGYATYDEVPDARHNLFLDNPDSFNDKLIQFLGE"
     gene            <577455..>579311
                     /locus_tag="ZYRO0D06688g"
                     /db_xref="GeneID:8203977"
     mRNA            join(<577455..577507,577577..>579311)
                     /locus_tag="ZYRO0D06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496678.1"
                     /db_xref="GeneID:8203977"
     CDS             join(577455..577507,577577..579311)
                     /locus_tag="ZYRO0D06688g"
                     /note="similar to uniprot|P43634 Saccharomyces cerevisiae
                     YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
                     fungal-type binuclear cluster domain DNA-binding
                     transcriptional activator or CHA1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496723.1"
                     /db_xref="GeneID:8203977"
                     /db_xref="GOA:C5DVH1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DVH1"
                     /translation="MKRSGSSPDEPSNSRKLACQNCRKRRRKCNSEIPCSNCVKYGIE
                     CVPVDQDLRRTRYTASYVKELEDHVEHLEKTLKKAREVDDKNEKEKILDSVPIVNAVP
                     SPGQDSPDIQLPETSATSVPPVGTNSIYPTNSLSISKKKRTPEQLKILVNMRMLSRSP
                     FILRSLSLFFKWLYPGHFMFIHRETFLSAFFGDESAKSYYCSEELLYAIAALGSKLSS
                     SDGELFGKSEEYYQTAKNKALKLVFQLDGNSFAELTSSNKLAFIQTLLCLAFYDVAAG
                     ENAMAWYLSGLAFRIAHEIGLHLNPNAWNDVYEDELSDLDFEVRSRIYWGCYIADHLI
                     SVLFGRSTTLRLSNSTVPETDELPDIETGIEDYIFDPKATLSLANPLKRLIVLSRITE
                     VFAGKIFIQTQSLSQRCQYLSKFNVEMVHWRQDLPDQLAWSRESLKKLKYFNPTTTYV
                     WFHYYIVLISYNKPFIFDRKPSRQLIEDYIEELHLILEVWKSNFENFEKCSIYMVYSV
                     ILAVQCMKTNSISQQHYKEFTDFLESPSLNYDLAKKFVENELRAECMDPLSSLTYGND
                     LALEYNLDFTLLNEIDTLIGTSGGDSTLG"
     gene            complement(<579323..>580285)
                     /locus_tag="ZYRO0D06710g"
                     /db_xref="GeneID:8203978"
     mRNA            complement(<579323..>580285)
                     /locus_tag="ZYRO0D06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496679.1"
                     /db_xref="GeneID:8203978"
     CDS             complement(579323..580285)
                     /locus_tag="ZYRO0D06710g"
                     /note="weakly similar to uniprot|Q04608 Saccharomyces
                     cerevisiae YDR124W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496724.1"
                     /db_xref="GeneID:8203978"
                     /db_xref="InterPro:IPR021264"
                     /db_xref="UniProtKB/TrEMBL:C5DVH2"
                     /translation="MVYTNKHISMMTTNKFNEIAVFLLKEGYEFSIFVKDKIDSNSNC
                     KFSQAYVTTAVEDILPIGVWDLVDGEKIIKYDSKLCAPQNHYPTIPLPLTNLIVVEKY
                     VHGALKLLRQVPCKAIAKAWIKAIEPRKKTKYPYIKGDIAKPSWWPHDVEHREPDHLQ
                     KADRLKLMCGILIKVLPHIGCLEVVEELLRSTLALSLFKKDPDKDNLISSIFEIPKVL
                     CNPVKMEKPTVEVIDLSYFKKRCKEANSGIVTTNREIHHLHHAHQTAKVTQTPPSTAP
                     RLMDHFENCNLSPPVLIDLLMENDPDLDNYIDVINIVSSPSSKS"
     gene            <580494..>581534
                     /locus_tag="ZYRO0D06732g"
                     /db_xref="GeneID:8203979"
     mRNA            <580494..>581534
                     /locus_tag="ZYRO0D06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496680.1"
                     /db_xref="GeneID:8203979"
     CDS             580494..581534
                     /locus_tag="ZYRO0D06732g"
                     /note="similar to uniprot|Q12347 Saccharomyces cerevisiae
                     YLR097C HRT3 Putative nuclear ubiquitin ligase based on
                     computational analysis of large-scale protein-protein
                     interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496725.1"
                     /db_xref="GeneID:8203979"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="UniProtKB/TrEMBL:C5DVH3"
                     /translation="MVDTGNAEVAISWWEKGVQKEKDGSMNDAIRFYREALKTHEGVE
                     KLYRKKLFEEHELEKKLEQLRLDSIDSRNDTVSPGDQAQADEDEDDSQRDPCWLLDIL
                     PPDVLSRIVHYVVLQSGESWLNLSLTCSTFNRLCFHEMDPYRTFARMIYPKQQYDEMA
                     MDLNGISNIGIWEKEFWGPNYRKMLMERPFVKFGGIYISVVNYLRYGANQDGSRSWMN
                     PIHMITYYRYFRFYPDGGCLRLLTTDEPSMVVPHFSTDTPPRNSEMCRWSLGFDHAFG
                     HLTITRSSSKYTFVEELQIKDQGTRIHQRLKWLSSVIIDKEGEVTECSMKKEKPFFFS
                     RVRSYLPSSTMY"
     gene            <581838..>582773
                     /locus_tag="ZYRO0D06754g"
                     /db_xref="GeneID:8203980"
     mRNA            <581838..>582773
                     /locus_tag="ZYRO0D06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496681.1"
                     /db_xref="GeneID:8203980"
     CDS             581838..582773
                     /locus_tag="ZYRO0D06754g"
                     /note="weakly similar to uniprot|P26798 Saccharomyces
                     cerevisiae YDR123C INO2 Component of the heteromeric
                     Ino2p/Ino4p basic helix-loop-helix transcription activator
                     that binds inositol/choline-responsive elements (ICREs)
                     required for derepression of phospholipid biosynthetic
                     genes in response to inositol depletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496726.1"
                     /db_xref="GeneID:8203980"
                     /db_xref="GOA:C5DVH4"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DVH4"
                     /translation="MESVGGGGGDMFDLFDLDNDNDIDFETAYKMISNFDDVASSGEH
                     DELLPRLGFGDLTDVETQFGLNNNREDQDEQQQHHQQHEQWSLQPHHEQWPLQLHPQP
                     SHAQQLQNYQDFPLKQQRQQQQSDSLERNAETVNGGEFAQHETGTRDDRPQLLSAYES
                     NAIEHFLDSLISHNHAREKEEQESLKRDLPAISTAYRPPTVEIPEITIGDSDIPAEIR
                     NDPSKVKKWKHVEIERIRRNQIKKTFDELIGMTRYPRGSGNNKIVKPKGDKRVPKHTL
                     LSYVVEDIRSIIQANEKLETMLRDITNIKKEDVSI"
     gene            complement(<583027..>586641)
                     /locus_tag="ZYRO0D06776g"
                     /db_xref="GeneID:8203981"
     mRNA            complement(<583027..>586641)
                     /locus_tag="ZYRO0D06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496682.1"
                     /db_xref="GeneID:8203981"
     CDS             complement(583027..586641)
                     /locus_tag="ZYRO0D06776g"
                     /note="similar to uniprot|P13186 Saccharomyces cerevisiae
                     YLR096W KIN2 Serine/threonine protein kinase involved in
                     regulation of exocytosis localizes to the cytoplasmic face
                     of the plasma membrane closely related to Kin1p and to
                     YDR122W uniprot|P13185 Saccharomyces cerevisiae YDR122W
                     KIN1 Serine/threonine protein kinase involved in
                     regulation of exocytosis; localizes to the cytoplasmic
                     face of the plasma membrane; closely related to Kin2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496727.1"
                     /db_xref="GeneID:8203981"
                     /db_xref="GOA:C5DVH5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001772"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR028375"
                     /db_xref="UniProtKB/TrEMBL:C5DVH5"
                     /translation="MPNTMDYHVNSQFKIGGGESGASSSTSTESPAPSSVAPATARMM
                     GKAHQQSQQQQQMQMQLQIQQQQIQQQQQLMQQHQKQQQQQQRQPSPLMPPVEITEAN
                     EEKATTEARQKQQQYADRSSRSQTMDPKQFHRKALGDWDFLETVGAGSMGKVKIAKHH
                     YTNEICAIKIINRATKAFLHKEQQLPPPQNEQEALERQKKLEKEISRDKRTIREASLG
                     QALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASA
                     LQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFDPRTQLHTFCGSLYFAAPEL
                     LKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQHLSIEVI
                     SLLSKMLVVDPRKRASLKQVVEHHWMIRGYDFPAPSYVPNRIPMSPEMLDITVVKEMF
                     RLEFIDDIDETMRFLHAIITEEDYQQLSKQYWNQLSNLNGKSITTSNELNGTKSIEVT
                     EANTSGILPEKSLGTDKIYNPSYTGVAFEDPTRAYHPLLSIYYLVDEMLRRKLAKLQR
                     RQQQREQQQQALMQQKKLEQPADVQSRQTGILSNGNTPQVDKTKSSNEGGSTVPPPLI
                     PPLIVPKSSNNNNNPNNPRQRPLQVLVPPKLAMPEQAHTSPTTRKSSDIHNDADYVLS
                     PVPQSNDYQQRSASPTSLDPQDRPKFGSLFRKLSQRRGGHPQQDQTRDYQQRTPLQMS
                     PDGNKRPPKMHSRAVSEGVSAMRGGPMPNLNEIPISMPARSASQKQNSALPALPVNAE
                     TLVQQQRERQVEHGMGNLRVDDNGAQQPAAQQQEGPQTDKPVIVTDLSQADDNKPLPP
                     LNVTKGRKLHPSARAKSVGHTRRESLKFVRPPVPANAQNVNDTGFLEFNKECKSSEPN
                     GGVDGTSSGRSNVESTGTTPAEKDDEEEFTDEAILEKASKAPPGSMPSIDYPRSLFLK
                     GFFSVQTTSSKPLPIVRYKIISVLKKMHIDFKEVKGGFVCVQTFPQDKSGEIQSELPP
                     THDQQEQHEKEQQFQHAPQQPPQSQHLQLPGAMESTHRRQFSATRNHSVKRQDSARRV
                     QANIPSTPLASSHHERSVSIVTSPTPNNVSGEISSASLESVNQDDILTTSKAQDMNKT
                     ENEQEEITGTKGKPPVKFEIHIVKVRIVGLAGVHFKKVSGNTWLYKELATDILEKLSL
                     "
     gene            <587162..>589366
                     /locus_tag="ZYRO0D06798g"
                     /db_xref="GeneID:8203982"
     mRNA            <587162..>589366
                     /locus_tag="ZYRO0D06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496683.1"
                     /db_xref="GeneID:8203982"
     CDS             587162..589366
                     /locus_tag="ZYRO0D06798g"
                     /note="similar to uniprot|Q12072 Saccharomyces cerevisiae
                     YLR095C IOC2 Member of a complex (Isw1b) with Isw1p and
                     Ioc4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496728.1"
                     /db_xref="GeneID:8203982"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DVH6"
                     /translation="MSMKRGRRAVSASLEPENERPAWQVFCAEDTLVQWHKLKNVESL
                     VLRARERIGEDLFKTWSYHVVISWFYKVCDSFVTANYAGDIETFKPFWKDVKFDEELL
                     LQELSGLAGELTLWESLRWHTLKNVANSKGVSLKDWNELAQHYLKDRGDYKFEKLTLE
                     EQFQEVYAMIRVIERKNLPFRNYLLANLELFESVAYEDDDTGPLYALANVGVLVRKLV
                     KQSPHEIHIPLKLKNCTVRLPHGPNGFELVHLDYSAEINRYLQSVKVDYELVTHNWEQ
                     FAQCVESNQIGEPSPNVDYEDLVNVYVEHQLYSRRLLQQRQKDHDMAELLTRRKRSSR
                     LVAREEEVRRKDLESEWLDRLDSRDQFLRARSRLVNRNVKKIKDWLWSQLWSNFEKDL
                     RITRGDPISKEEGSELTADDLKVLAQGTRYVDWICPVTETAAAVSTTGTDEHPLELPL
                     HCCVTEEDVERGAAQEVDDQRWIFKCVGEPDLDSIWIGSPEEEQEHAALFAEKGGSLV
                     CCESCLRWQHWECQSQRLLLLLASSQGRDSPVTARDFGIVQLGHASVQASRRSSRRAA
                     MSNDQTTTNSADYNVEQHYLRPTDKRKPLGETGVFICAWCCYELEKQLRETFPAELSA
                     LRAKQRKNREERERRRLAAVNAASRTPVNGTFSAAATPAPLPTTESSATPTMFSAFNS
                     SFATNPQQTPNNINSSTTNGAAQLSDSTASATPSGSTTPAIQRPNETGQTFQ"
     gene            <589953..>590912
                     /locus_tag="ZYRO0D06820g"
                     /db_xref="GeneID:8203983"
     mRNA            <589953..>590912
                     /locus_tag="ZYRO0D06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496684.1"
                     /db_xref="GeneID:8203983"
     CDS             589953..590912
                     /locus_tag="ZYRO0D06820g"
                     /note="some similarities with uniprot|Q7LGX3 Saccharomyces
                     cerevisiae YLR094C GIS3 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496729.1"
                     /db_xref="GeneID:8203983"
                     /db_xref="UniProtKB/TrEMBL:C5DVH7"
                     /translation="MLLHSVSCETHASKYSLHRNRGRPSLPRTCSSRNSISSSNRKQS
                     LPNDEVSIPPSMKSVISQVGDATYVQRKKRLLDDPLQSGSNSNNTNVPLGVPKIFHLH
                     DLDMETEFQPDEIELSPPLYERPKNTQSQNNSYIGAREDTCELEYWPDSASTSSNSSV
                     VLPDRRPRQPGLNPHFLKLYAAETTCKIQQTLPCVNIDESLLKQLSYHDLRQINVSTP
                     HASGEAIRLALATRKKLWTEMIKPQRQDLYGESIPQNQRFVLTHSPQQGRQGSLLRID
                     SDVKPWTFHENSTMLRPCGTLKMGRGKPDVQYVVKGWCDSRFS"
     gene            <591212..>591928
                     /locus_tag="ZYRO0D06842g"
                     /db_xref="GeneID:8203984"
     mRNA            <591212..>591928
                     /locus_tag="ZYRO0D06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496685.1"
                     /db_xref="GeneID:8203984"
     CDS             591212..591928
                     /locus_tag="ZYRO0D06842g"
                     /note="similar to uniprot|Q12255 Saccharomyces cerevisiae
                     YLR093C NYV1 v-SNARE component of the vacuolar SNARE
                     complex involved in vesicle fusion inhibits ATP-dependent
                     Ca(2) transport activity of Pmc1p in the vacuolar
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496730.1"
                     /db_xref="GeneID:8203984"
                     /db_xref="GOA:C5DVH8"
                     /db_xref="InterPro:IPR001388"
                     /db_xref="InterPro:IPR019005"
                     /db_xref="UniProtKB/TrEMBL:C5DVH8"
                     /translation="MEMKKFQVSYVELVHQGSCQASCFQQVEETGSTYGSVGASAGSK
                     ELFQRLTHDMVLPKVVPIQGNKVTKLSLHLIDGYECYYTTAPTEDGVGFDVLVSFTRA
                     HVPKILPIRLLSELKDPPLPHTDSQLNQRICNVLDRFHGELLSYRDSGEHGDGTEADL
                     QDIFQVMNDNIDKFLQRQERLSLLVDKTSQLNNNSLTFKRKANRIRQRMWWHRAKGIT
                     LLIFSIILCIGAFIMFLYVR"
     gene            complement(<591975..>592499)
                     /locus_tag="ZYRO0D06864g"
                     /db_xref="GeneID:8203985"
     mRNA            complement(<591975..>592499)
                     /locus_tag="ZYRO0D06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496686.1"
                     /db_xref="GeneID:8203985"
     CDS             complement(591975..592499)
                     /locus_tag="ZYRO0D06864g"
                     /note="some similarities with uniprot|Q04603 Saccharomyces
                     cerevisiae YDR121W DPB4 Shared subunit of DNA polymerase
                     epsilon and of ISW2/yCHRAC chromatin accessibility complex
                     involved in both chromosomal DNA replication and in
                     inheritance of telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496731.1"
                     /db_xref="GeneID:8203985"
                     /db_xref="GOA:C5DVH9"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DVH9"
                     /translation="MPPKGWRKDAQGNYPTTSYIKEQENITIQDLLFLKSVITNLAKD
                     VNHGDKRLMINKDAILALQRSATVFVNHLLMFARENSRSQDRKSCNINDVLDGLDQIG
                     FGGFKTILSTKMVDYQRALELRKINRSRKPVESKVESPQEQHQEEPQEEPQEVQEAQE
                     AQDESNKTRKIDHS"
     gene            <592600..>594222
                     /locus_tag="ZYRO0D06886g"
                     /db_xref="GeneID:8203986"
     mRNA            <592600..>594222
                     /locus_tag="ZYRO0D06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496687.1"
                     /db_xref="GeneID:8203986"
     CDS             592600..594222
                     /locus_tag="ZYRO0D06886g"
                     /note="similar to uniprot|P15565 Saccharomyces cerevisiae
                     YDR120C TRM1 tRNA methyltransferase localizes to both the
                     nucleus and mitochondrion to produce the modified base N2
                     N2-dimethylguanosine in tRNAs in both compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496732.1"
                     /db_xref="GeneID:8203986"
                     /db_xref="GOA:C5DVI0"
                     /db_xref="InterPro:IPR002905"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DVI0"
                     /translation="MSPLKRIRIIKMIQVWQQLKNKIIGSNPNAFNLEDFNVVKEGKA
                     EILFPKKDTVFYNPIQQFNRDLSVCCIKAWDQLYRENKHKKGSKRSSEDEPLEKRRKI
                     NTDNDDRRYMRILEALSATGLRAIRYAHEIPRVKKIVANDLLPEAVESIRRNAEYNHV
                     EELVEPNTDDANVLMYRNKALNQKYHVIDLDPYGTVTPFIDSSLQAIEEDGLMLVTCT
                     DLSVLAGNGYPEKCFALYGGVNMVSHEATHESALRLVLHQLGQSAAKYKKTVEPLLSL
                     SIDFYVRVFVRIRTSPIEVKNLQANTMTVYHCSQCGSFHEQPLGRTSEKVTKKNQPIK
                     KYSVAQGPPVDSKCKFCDGTYHLAGPMYGGPLHNKEFIEKVLQVNANHDDDTYGTRRR
                     IEGMLALAQNEIPNAPFYFSPNHLSSILKLQVPPLKKIVAGLGSLGYECSLTHAQPSS
                     IKTDAPWEAIWYVVAHSDDQLHNKKLKENSIGHRILNNMKSWSKDQDFKTLSYEPNDQ
                     SGKVESLRKLKIVRYQENPTKNWGPKARPTSS"
     gene            complement(<594305..>594538)
                     /locus_tag="ZYRO0D06908g"
                     /db_xref="GeneID:8203987"
     mRNA            complement(<594305..>594538)
                     /locus_tag="ZYRO0D06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496688.1"
                     /db_xref="GeneID:8203987"
     CDS             complement(594305..594538)
                     /locus_tag="ZYRO0D06908g"
                     /note="similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
                     YDR119W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496733.1"
                     /db_xref="GeneID:8203987"
                     /db_xref="UniProtKB/TrEMBL:C5DVI1"
                     /translation="MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAV
                     EWAVSLSLILAWPAAIIKFSEHNRWLKAREEYS"
     gene            <594831..>595646
                     /locus_tag="ZYRO0D06930g"
                     /db_xref="GeneID:8203988"
     mRNA            <594831..>595646
                     /locus_tag="ZYRO0D06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496689.1"
                     /db_xref="GeneID:8203988"
     CDS             594831..595646
                     /locus_tag="ZYRO0D06930g"
                     /note="some similarities with uniprot|P53335 Saccharomyces
                     cerevisiae YGR280C PXR1 Protein with a role in maturation
                     of rRNAs and small nucleolar RNAs required for cell
                     viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496734.1"
                     /db_xref="GeneID:8203988"
                     /db_xref="GOA:C5DVI2"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:C5DVI2"
                     /translation="MGLAATKNKQRFGFDPRNTAWSNDTGRFGHTMLEKYGWKPGTGL
                     GTMPHKSTNTHIRVSIKDDNLGLGAKTHRSKDPNGFDDESAGLDVFQRLLGRLNGKEE
                     TISKELDKQRYDRIINGKWGVHFVKGEVLSSTWDPHTKKLRDYSNKEDEEEDEEESAG
                     ENRKRRASGEDNEVEKHKKHKKHKREKKEHKKHKKEEKEKKRKEKKEKKEKKEKKEKK
                     EKKHKEKSKDKSKGKSPTPELTRLSARSRYIRQKKAATMDPKALNEIFMVTQQ"
     gene            complement(<595856..>597535)
                     /locus_tag="ZYRO0D06952g"
                     /db_xref="GeneID:8203989"
     mRNA            complement(<595856..>597535)
                     /locus_tag="ZYRO0D06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496690.1"
                     /db_xref="GeneID:8203989"
     CDS             complement(595856..597535)
                     /locus_tag="ZYRO0D06952g"
                     /note="similar to uniprot|P22146 Saccharomyces cerevisiae
                     YMR307W GAS1 Beta-1.3-glucanosyltransferase required for
                     cell wall assembly localizes to the cell surface via a
                     glycosylphosphatidylinositol (GPI) anchor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496735.1"
                     /db_xref="GeneID:8203989"
                     /db_xref="GOA:C5DVI3"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DVI3"
                     /translation="MLLKNLSSLTLGALYAASGAFADSSSSSSSLPPIEVAGNKFFYS
                     NNGSQFYIQGIAYQADTVNGSAGDDINDPLADYSTCSRDIPYLKKLNTNVVRVYAVNT
                     TLDHSKCMEALAENDIYVIADLSIPGKSVDRTDPQWNVELYERYTGVVDAFANYTNVL
                     GFFAGNEVTNNASNTDASAFVKAAVRDVKKYISDKDYRKIPVGYSSNDDEDTRVPMAD
                     YFACGDSDVKADFYGINMYEWCGDSNFQTSGYKDRTADFKNLSIPIFFSEYGCNAVKP
                     RKFSEVQTLYGSNMTDVWSGGIVYMYFEEDNGYGLVSVENNNVKTLSDFENLSSQMAK
                     IKPSVAKNSSYTAQSTSLSCPASQKYWKANTKLPPTPSKDLCGCMHDSLSCVVNTDKI
                     DEDKYGDLFGYVCSQVDCDGITADGKNGSYGTYSFCSAEEQLSFVLNLYYQKNGKQSS
                     ACDFKGSASLQKATTQSACSSALKQIGSSGTGSASSSVSVSSSGSGSGSNSKSSSNGD
                     SSSSSSSSKGSSTAGAKEKNLALGSKASLSQVILSFVATLGVVAGAGFAMA"
     gene            complement(<598154..>603664)
                     /locus_tag="ZYRO0D06974g"
                     /db_xref="GeneID:8203990"
     mRNA            complement(<598154..>603664)
                     /locus_tag="ZYRO0D06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496691.1"
                     /db_xref="GeneID:8203990"
     CDS             complement(598154..603664)
                     /locus_tag="ZYRO0D06974g"
                     /note="highly similar to uniprot|Q04952 Saccharomyces
                     cerevisiae YMR306W FKS3 Protein of unknown function has
                     similarity to 1,3-beta-D-glucan synthase catalytic
                     subunits Fks1p and Gsc2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496736.1"
                     /db_xref="GeneID:8203990"
                     /db_xref="GOA:C5DVI4"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:C5DVI4"
                     /translation="MNEYGGNYSPISLTDIDYPAWCQDEEVPVTKTELKSIFDDLTRK
                     FGFQQSSKENMYHHLLAQLDSRASRTTTQNALLSLHVSYIGGEQANFRKWYFAAQLDL
                     DEEIGFQNMKLRGKSQRRNFKSAKKRGTSIKQQMEEWQQREQEFISNHTKMVLTPEQL
                     QDKNSLRTADYKWRLKMKQLTPHQMARQLALYLLCWGESNQVRFTPECLCFIFKCALD
                     YDVSTQNPVTYGSDSKAETETQSKNSNEEVTATGPAANTIAPTAAPEYTFLNEVIDPL
                     YHFLKTQLYRKNSKNKWVRCEKDHKDIIGYDDINQLFWYPEGIERIVLKSGERLVDKP
                     IAERYLYLKDVEWSRVFYKTYREVRNWMHCLTNFNRFWIIHFAPFWFFTTFNSPTLYT
                     KNYVQLLNNPPTLQARLSAVALGGTVSCMIQILATFFEWKFVPREWPGSQHLTKRMLG
                     LLLCFLVNFAPSVYVFGFFELDVHSKSAYIVSVIQLIIAVITTLFFAVRPLGGLFGSY
                     LNRGKGKRRYVSSQTFTASFPKLYGRSKWFSYGLWTFVFLAKFIESYFFLTLSLRDPI
                     RVLSVLNMSRCRGDKLLNRYLCQWQPRVTLGLMILTDLGLFFLDTYLWYIICNCVFSI
                     MLSFSLGTSILSPWKNIYSRLPKRIYSKILATTEMDIKFKPKILISQVWNAIIISMYR
                     EHLLSIEHVQRLLYQQVDSMMMDKRTLKSPTFFVAQDDSTFKTANFFPSNSEAKRRIS
                     FFAQSLSTPITEPVPVECMPTFTVLVPHYSEKILLSLKEIIKEESSKSKITVLEYLKQ
                     LHPLEWDCFVRDTKLLNIEKNAVNKISKELGKKQIKVEDMEEENEIGIGTDSPTAEAA
                     KKDEDEGEDDLVQKKINDLPFYFLGFSSSEFSYTLRTRIWASLRAQTLYRTISGFMNY
                     SKAIKLLYRVENPSMIQLYGDNVDALENALANMANRKFRMLVAMQRYTKFNKDEREAT
                     ELLLKAYPTLCISYLLEEKPSPNSSNGDDSNTDLDEPIFYSCLTNGYADIDKETGFRK
                     PIFKVRLSGNPILGDGKSDNQNHSLIFYRGEYIQVIDANQDNYLEECLKIRSVLSEFE
                     ELDMESTIPYVPGIEYDEEAPPVAILGAREYIFSENIGVLGDIAAGKEQTFGTLFART
                     LAEIGGKLHYGHPDFLNAIFMTTRGGLSKAQKGLHLNEDIYAGMNAICRGGRIKHSDY
                     YQCGKGRDLGFGSILNFTTKIGGGMGEQMLSREYYYLGTQLPIDRFLSFFYAHPGFHL
                     NNMFISLSVQLFFLLLLNLGSLNHETILCHYNKDMPITDLEKPVGCYNIQPALHWVSI
                     FVLSIFIVFFIAFAPLVIQELLENGIWRAISRFLHHLLSLAPLFEVFVCQVYSNSLLS
                     DITFGGAKYVSTGRGFAITRIDFAILYSRFVNIAVYTGVQVFLMLIFSTVSMWQPALL
                     WFWITVISMCFAPFIFNPHQFNFTEFFIDYRNYIHWLSSGNTKYERESWSTFVKTSRS
                     RYTGYKRKTINDISEQDGKDGHKASLDNLFASELFIPFLVLLFDFTAYMFINGQTGVQ
                     EVEPTNSVLRLLLVTFIPILFNMMVLLILFFISLFAAPLTQLCCHNTGTVIASIAHAL
                     SVIVYLVSFEMMWFLEGWNFARTLILLITCINLHVFLFKVFTVFCLTKEFKNNRSNIA
                     WWTGKWYNTGMGWPVVLQPVREYSVKIMESSYFAGDFFLGHFLLYLQTPLLFVPFIEY
                     WHPMLLFWLKPTSIITSKIIYTRKQKRRRNNILRKYFLLYFLILGILLVLLISPFFAH
                     KIIPAPSKFFPSSSPIAGVAQPNSQNNNDTGPNAPGTILTTTPPMPQFRTVP"
     gene            <604737..>605939
                     /locus_tag="ZYRO0D06996g"
                     /db_xref="GeneID:8203991"
     mRNA            <604737..>605939
                     /locus_tag="ZYRO0D06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496692.1"
                     /db_xref="GeneID:8203991"
     CDS             604737..605939
                     /locus_tag="ZYRO0D06996g"
                     /note="some similarities with uniprot|P53334 Saccharomyces
                     cerevisiae YGR279C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496737.1"
                     /db_xref="GeneID:8203991"
                     /db_xref="GOA:C5DVI5"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DVI5"
                     /translation="MRLTNLIATTSMVGAALAAPAAAPGDGHQHHKDRRALVTNTIME
                     KVTVAITGAQGPTTLAAPVSGSSVSPITPSDSYSHQAPLPTSSQSSSGSGSSSASPSS
                     SAAPSSTSGSSSQAPSSASSSSSSASPSSTGGGSGTSGSAGSSGFKGITYTPYNSDGS
                     CKSSSQVKSDLEQLSGYPVLRLYGTDCDQVANVLQAKSDSQKVFAGIYYVDSISDGVQ
                     TIADAVEKYGSWDDIVTVSIGNELVNGGQAVPSQVGQYIDEGKSALKNAGYNGDVVSV
                     DTFIAVINNPDLCKYSDYMAVNAHAFFDKATAAENAGSWLLQQIQRVYEACSGEKKVI
                     IVESGWPSQGQTYGSAVPSKSNQKAAVEDIAKVCGDDTYAFTAFNDMWKADGAYGVEK
                     WFGILSSD"
     gene            complement(<606410..>608095)
                     /locus_tag="ZYRO0D07018g"
                     /db_xref="GeneID:8203992"
     mRNA            complement(<606410..>608095)
                     /locus_tag="ZYRO0D07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496693.1"
                     /db_xref="GeneID:8203992"
     CDS             complement(606410..608095)
                     /locus_tag="ZYRO0D07018g"
                     /note="similar to uniprot|P53333 Saccharomyces cerevisiae
                     YGR278W CWC22 Essential protein component of a complex
                     containing Cef1p has similarity to S. pombe Cwf22p
                     putative spliceosomal component based on computational
                     analysis of large-scale protein-protein interaction data"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496738.1"
                     /db_xref="GeneID:8203992"
                     /db_xref="GOA:C5DVI6"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DVI6"
                     /translation="MDEETSKELQKNNWGTIGSHIDSVIANLDDFNLVNSFKSLLDVN
                     VIRGKRLVVRYILKYQAQNDRPIVYAALSSMLNAELAEFGEILTQEATVRFIDGYREM
                     DNRKAMTMVTFLAECFNYEMIHEIVVLQLLHILLENLDDMSLGIVIQLLRTCGKRLLE
                     VSKTAHNMVFEKLREVLQSGTTSKPISQSLESLFDLRRSNYQEMQGAGLSLPDNLGTN
                     MHTFMIDGEDIRKHSKLLGTFEFDPNFLETERDYEDWKNSILSKFHLDQEEEGQEQRD
                     EPQPLVVKDMTSNEEIEFKKKIYLILKSSLSSDEAAHKIIQKRIPDKQKYRVVDIIIK
                     SNYQEATYSKFYGLLSEKLCASHRSWKPAFEQIFTENYQDCDELEPAQLRTLGKFWGH
                     LLASDYLGFEVFNNVHLNEEETNPPQRILLKFILLELVAELGIDQLQARFQEEYIRPF
                     VQGLFPQQNASNIRYSINYFTAIGLGVLTEQMRALLTIVQSNELATPPVGFNSPQASP
                     DTTAQPSNEPFRRSKISQDRARTRNRSRSRTPPRRARNRSITPPRRRNRSRSP"
     gene            <608261..>609121
                     /locus_tag="ZYRO0D07040g"
                     /db_xref="GeneID:8203993"
     mRNA            <608261..>609121
                     /locus_tag="ZYRO0D07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496694.1"
                     /db_xref="GeneID:8203993"
     CDS             608261..609121
                     /locus_tag="ZYRO0D07040g"
                     /note="similar to uniprot|P53332 Saccharomyces cerevisiae
                     YGR277C Homolog to human PPAT"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496739.1"
                     /db_xref="GeneID:8203993"
                     /db_xref="GOA:C5DVI7"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DVI7"
                     /translation="MKVGVLFHDLGNLDTDSLVNLFAQLLGNLELDAKSQLKIILTDT
                     FRLSYNLDTALGRLYSSSRDYLISKDLYRTSIDVLIEQFSVNDLQLDWLFVPEETYGN
                     RFTHKNLRVFQQPKSSPWHDLLTEGPSDFEKYKVSALGGTFDHIHDGHKILLTMAAFI
                     TSSRLIVGVTDQDLLVNKKYREFLETVDERCDNVKKFLALLKPTLKVEIVLIKDVCGP
                     TGTVPEIEALVVSRETVQGGQFVNKTRIEKGLTELDISVVNVLGGNEEDGWKEKLSST
                     ELRKKDMEQQ"
     gene            complement(<609322..>612903)
                     /locus_tag="ZYRO0D07062g"
                     /db_xref="GeneID:8203994"
     mRNA            complement(<609322..>612903)
                     /locus_tag="ZYRO0D07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496695.1"
                     /db_xref="GeneID:8203994"
     CDS             complement(609322..612903)
                     /locus_tag="ZYRO0D07062g"
                     /note="similar to uniprot|P50101 Saccharomyces cerevisiae
                     YMR304W UBP15 Ubiquitin-specific protease that may play a
                     role in ubiquitin precursor processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496740.1"
                     /db_xref="GeneID:8203994"
                     /db_xref="GOA:C5DVI8"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR024729"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029346"
                     /db_xref="UniProtKB/TrEMBL:C5DVI8"
                     /translation="MNDEITGSVGEAVDLGKTVQNLLPPIGEKIETEPEVEGGFTWHI
                     DDWFKLTEDKYVSPRFKIGEFEWDILLFPQGNHSKSLAIYLEPHAEEKVNEETGETEY
                     VDPDWYCCAQFTIVLSRPGDDNRLHVINSSHHRFNAIDTDWGFASFIDLNQLKYPSKS
                     KVSGLLNQGQLNVTTFVRILKDPTGVLWHNFVNYDSKKMTGYVGFRNQGATCYLNSLL
                     QSYFFTKYFRRLVYQIPTSQENPKDSVVLALQRAFYQLQVSQYPLDTMELTRSFGWDN
                     VEAFTQHDVQELNRILMDRLETRMKGTTVENKLNEIFVGKMKSFIKCINVDYESARTE
                     DFWDIQMNVKNLKGLKDSFENYIEVELMDGENQYAAQDYGLQDAKKGVVFESFPAVLH
                     LQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRWYGLHGVLVHTG
                     DISTGHYYALIKPGLEDQWYRFDDERVWKVSKKQAFDENFGFDRLPDDKIRTMTREQY
                     QEYFIARHTSAYMLVYIQEDKKDEILQPVTSEDVPEHVVTSVDKENRERELKEREIRE
                     AHLYTTVRVNSIGNFIHYQGFETFPNDKSSLFSPELNSENSMPINLKIPSKTYVRDLY
                     KKIKECLNIPLDRDVRYWKMEYRRNGTIRLDEPLSKNISDQTLEKALQDESMRKIPTL
                     NVFVEEPYLDLAFLLKLQKSGLLKIEGGSITDELIQNLRHNIETIAPANEIPKILDDV
                     NHQLLFVKKFDPQAQSLTGVAYCAVSQLDEVSVLSKMIGEFIGTEEQIEFFEELQPGT
                     IEPVSLKDKFYAAELCSGDILSFQVPNAPLPDIFPVYKTLEEFYQYLRHRIKLRFAKS
                     QESTEEYVLSNDSPDNFEFWISAHATYSDVARVVSQFTKVQPEYLKIFAVYANGKFPM
                     KSESFLGDYILKDFNCELTPSFEYEVLSMPLKELEQLKSMKFYWLKDSYIHYQSYEFK
                     VTNNCTVGEFLDKIQAKIGFSDEDKGNILLWTNYNFHFNGVLSANSTLKSIGKSVFLF
                     GRILPEELALVKQLDGMSEGDDDEEEEDISMGDEEDLVMSARNGNPKIEGRLVMVVQY
                     FKDPENRHGISFLFNLIPGETFLKTRARLHDKFGLGQKEFSKIKLRIWYTTPNGHSFR
                     SLQDYTDEELDKLILYNIMSNLDCIYMDHPDRLRTQSSHDRPMFIKN"
     gene            <613206..>615680
                     /locus_tag="ZYRO0D07084g"
                     /db_xref="GeneID:8203995"
     mRNA            <613206..>615680
                     /locus_tag="ZYRO0D07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496696.1"
                     /db_xref="GeneID:8203995"
     CDS             613206..615680
                     /locus_tag="ZYRO0D07084g"
                     /note="similar to uniprot|P32843 Saccharomyces cerevisiae
                     YMR302C PRP12 Integral inner mitochondrial membrane
                     protein with similarity to exonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496741.1"
                     /db_xref="GeneID:8203995"
                     /db_xref="InterPro:IPR018850"
                     /db_xref="UniProtKB/TrEMBL:C5DVI9"
                     /translation="MLRTLGSSRIVGRLCNIGGYGISGPLVSQLPRRAKRFVSSEIQQ
                     KDEQAGDSMTATDTGIIHKTEEETLLYFDNVYPRTTSLWSPAQWYNLLLANQSREAVR
                     DKIMSYASPPSNPINGLELRSSIPVKRDGGVFATFLVPPEYTKAKVNSMIQQNTSKES
                     TIPFLSFFTRAAAFPVKGSPWIEDLRRLPTTTIVVNFQGPALTQEEMYSLFRRYGSII
                     DIFPSKGAGVPAKVKYRSFRGAICAKNCVSGIEIHNTVLHVEYERIVRGHMVNNFFVN
                     HTRIAVPVFIALLSILAVLVFEPIREFFIEQKITHRYSISWDNHWIKQLVNFTSSTMS
                     QFRYYWGTQDNVNNDKHLWEERVEKVNDLKMWLEENNNTFVVIRGPRGSGKHELVMQH
                     TLNERENVLYLDCDKFVKSRTDAKFLRNVASQLGYFPIFPWLNSVTNVIDLMLQGLTG
                     QKSGLSETKEAQFRNMLTTSMMSIRRIALQGYKQAVKQAGDLNLKEEDYLQQHPEEKP
                     VIVLDRFTGKSEMNGFIYKELSDWAAMLVQMNIAHVIFLTETVSPNHLLSESLPSQVF
                     KTLILSDASKENSRNYVLSQLHDHLENPIKEAQTKSGNDLEKAQEQEIQEVHEIDEVL
                     EPLGGRMLDLQAFVRRVKSGEGPREALEKMVEQSSEQITQIFLSDKYDPIKSAQAWEL
                     IELLSKESVVHFENIVFKNLFKAAPETCITELENSGLITVSRNRGVPSEIQPAKPMFR
                     AAFQFLVNDPELSTILRTRYLLKVVGFETNRIKKWEEELRPLGKSGETKMFKDRLNYL
                     SKKIDISNAIINDCEAEIKNLAQKKR"
     gene            <616125..>618254
                     /locus_tag="ZYRO0D07106g"
                     /db_xref="GeneID:8203996"
     mRNA            <616125..>618254
                     /locus_tag="ZYRO0D07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496697.1"
                     /db_xref="GeneID:8203996"
     CDS             616125..618254
                     /locus_tag="ZYRO0D07106g"
                     /note="similar to uniprot|P40416 Saccharomyces cerevisiae
                     YMR301C ATM1 Mitochondrial inner membrane transporter
                     exports mitochondrially synthesized precursors of
                     iron-sulfur (Fe/S) clusters to the cytosol member of the
                     ATP-binding cassette (ABC) transporter family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496742.1"
                     /db_xref="GeneID:8203996"
                     /db_xref="GOA:C5DVJ0"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ0"
                     /translation="MIRGAFIGLPRIGLSLKSPIFRSSPIVIKTAGFKTLPTCAFRKT
                     QWPLAEEKKVSKPIPVDQLKVEPPKPEPPKKSNAPTISELKILRNLTQYIWPKGNTKV
                     KSRVVLALLLLISAKLLNVQVPFFFKQVVDNMNVEWSDPSVALPGAIMLTVVCYGAAR
                     FGAVLFGELRNAVFARVGQNAIRNVSMETFRHLMKLDLGWHLSRQTGGLTRAMDRGTK
                     GISYVLSAMVFHIIPITFEISVVCGILTYQFGASFAGITFTTMLLYSIFTFRTTAWRT
                     KFRREANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSL
                     AFLNSGQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYR
                     ELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYDPRRKILQN
                     ASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAI
                     GVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAPLVYRLPGGLNTIVGERG
                     LMISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVY
                     IAHRLRTIADADKIIVLEEGRPREEGTHHELLQKEDSLYRELWNIQENLDMLEEEMKV
                     EQEVEEEKERQKLLILQRKREERQRST"
     gene            <618590..>620119
                     /locus_tag="ZYRO0D07128g"
                     /db_xref="GeneID:8203997"
     mRNA            <618590..>620119
                     /locus_tag="ZYRO0D07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496698.1"
                     /db_xref="GeneID:8203997"
     CDS             618590..620119
                     /locus_tag="ZYRO0D07128g"
                     /note="highly similar to uniprot|P04046 YMR300C
                     Saccharomyces cerevisiae ADE4 Phosphoribosylpyrophosphate
                     amidotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496743.1"
                     /db_xref="GeneID:8203997"
                     /db_xref="GOA:C5DVJ1"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005854"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ1"
                     /translation="MCGILGIALADESLPVAPELCEGCFYLQHRGQDAAGIATSGPRG
                     RIYQCKGNGMVRDVFTERRIYGLQGSMGITHLRYPTAGSSANSEAQPFYVNSPYGVMM
                     AHNGNLVNTVSLKRYMDEDVHRHINTDSDSELLLNIFAAELEKRNKYRVNNEDVFHAL
                     EGLFRLCRGGYACVGMLAGFALLGFRDPNGIRPLLFGERLNANGQKDYMLASESVVLK
                     AHNFTTYRDLKPGEAVIIPKNCATEKPEFRQVAPMNSYRPDLFEYVYFARPDSVLDGI
                     SVYHTRLQMGTKLAEKIKKQIDTSDIDVVMPVPDTARTCALQLASSLDKPYREGFVKN
                     RYVGRTFIMPNQKERVSSVRRKLNPMTSEFEGKSVLIVDDSIVRGTTSFEIVNMAKES
                     GATKVYFASAAPAIRYNHIYGIDLTDSKNLIAYNRTDDQVAEALGCDKVFYQSLEDLI
                     DCCKTENVQKFEMGVFTGNYVTGVEDGYLQELERVRALNKSKSETKADVDINLYNEGD
                     Y"
     gene            <620358..>621296
                     /locus_tag="ZYRO0D07150g"
                     /db_xref="GeneID:8203998"
     mRNA            <620358..>621296
                     /locus_tag="ZYRO0D07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496699.1"
                     /db_xref="GeneID:8203998"
     CDS             620358..621296
                     /locus_tag="ZYRO0D07150g"
                     /note="weakly similar to uniprot|Q04949 Saccharomyces
                     cerevisiae YMR299C DYN3 Dynein light intermediate chain
                     (LIC) localizes with dynein null mutant is defective in
                     nuclear migration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496744.1"
                     /db_xref="GeneID:8203998"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ2"
                     /translation="MSNSWSELLKENDRNETTWKRTVVICSPTIETLRSFEKTFLPSN
                     CGLSNQSMHSIGFGFDSLRDGIMGNTLVNCELYSVLFPLQETSLECLKSFVDVKSSTI
                     KWWFLLDWSLNDQKFWLAKLIKSLETLKAANVNLTAGSITISCLNTDHIYAKQKNTTT
                     WHSNHVEFLQQSLRSFSFLEKCSLVYSDPNDSTRSGTQLFGQLIADNYREIQADFASA
                     TKILIPYGSDTPGLIKTLDESFEPLQVLEQIFITQRFEEFIPGEKLEGDQEKEEEEED
                     DEDVHYDIDHPYSVDIQQELSNLYEKGKQRFTINTV"
     gene            <621565..>623595
                     /locus_tag="ZYRO0D07172g"
                     /db_xref="GeneID:8203999"
     mRNA            <621565..>623595
                     /locus_tag="ZYRO0D07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496700.1"
                     /db_xref="GeneID:8203999"
     CDS             621565..623595
                     /locus_tag="ZYRO0D07172g"
                     /note="similar to uniprot|P53331 Saccharomyces cerevisiae
                     YGR276C RNH70 3' exoribonuclease required for 5S and
                     tRNA-Arg3 maturation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496745.1"
                     /db_xref="GeneID:8203999"
                     /db_xref="GOA:C5DVJ3"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ3"
                     /translation="MDENYHDVAIDEDASPAKKFGTEKQKTASDTAPNFSDRVARLSI
                     SEDANTSRDIINGLKHSKMTEENRADKRRRRSSAQSLNGPERSATVEGNGGSKQDVSE
                     EKRENNKVIKKAKKEPKKEVKKEVQREAVIDDADMGSQKTSRKKKKKARNAHGIISVE
                     KLGARTSSVSDLREPMISCLYGKTLDASNLKIKNMSSVKKVITVFVPGLQPEDLGLPS
                     GTSFKDAGPFEVKNSKLFTKVPLEQNVEAFPISAPGSKNSLYPAYNHFINRTLSKNER
                     KTRHQELSSQKITINHLLMSLNDLVEHDYPIHPHLLDESARQLNTNAETYVDTQRFDH
                     DGSHIFALDCEMCLSAKGSVLTRVSIVGFDGNVVYDQLVKPDTPITDYLTKYSGITEE
                     KLANVTTTLQDVQRDILNMVSEDDVLIGHSLENDLNALKIRHPKIVDTSVIYDHRAGP
                     PFRPALRHLASTHLNYNIQTGEKIGHNPIEDAKACMDLVKLKIVSGLTFGVSVTTENI
                     FQKLSAAGIKCLKLDDNAFKRRNAEAVNAVSPNYDGQVFESLIDNIDDNQFLVARLKE
                     LAQSRGYAYNVSMRSDKEKGEVPSETQSLDVLSRGLANLYEKSPNGTMIAVFSGNGDT
                     RPYSKIMAELETIDRDQRTKARQERSGELEKAVSRARDGVAVIFFKQETLDE"
     gene            complement(<623621..>624286)
                     /locus_tag="ZYRO0D07194g"
                     /db_xref="GeneID:8204000"
     mRNA            complement(<623621..>624286)
                     /locus_tag="ZYRO0D07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496701.1"
                     /db_xref="GeneID:8204000"
     CDS             complement(623621..624286)
                     /locus_tag="ZYRO0D07194g"
                     /note="weakly similar to uniprot|P53330 Saccharomyces
                     cerevisiae YGR275W RTT102 Regulator of Ty1 Transposition
                     regulator of Ty1 transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496746.1"
                     /db_xref="GeneID:8204000"
                     /db_xref="InterPro:IPR018304"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ4"
                     /translation="MQSLIEKANNGGHLEIVNNRQNWKYDWLNPTHSTPSNAVSSGTD
                     GAPFNDGTSVEKYPFKFKTWIKTDECTWRKILEANDSMDLLDASTYSAQDEVHEIVSN
                     DQQTANRPSNGENLTVDDIRGAVGGVDGIAGFSSSDAQAQPEQHPGQQSEQQPEQQPE
                     QQPEQQPEQQPEQQPEQQPEQQPEQQPEQPPAMIPDQNQNLEQNNNLKDQDQDQDVNM
                     DKD"
     gene            <624565..>627576
                     /locus_tag="ZYRO0D07216g"
                     /db_xref="GeneID:8204001"
     mRNA            <624565..>627576
                     /locus_tag="ZYRO0D07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496702.1"
                     /db_xref="GeneID:8204001"
     CDS             624565..627576
                     /locus_tag="ZYRO0D07216g"
                     /note="similar to uniprot|P46677 YGR274C Saccharomyces
                     cerevisiae TAF1 TFIID subunit (145 kDa) involved in RNA
                     polymerase II transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496747.1"
                     /db_xref="GeneID:8204001"
                     /db_xref="GOA:C5DVJ5"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR022591"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ5"
                     /translation="MEKGKKQRGADLSNEDDAFGAIFGGDFGSLEIGSYIGQAEEGPT
                     QHSANAVDFEDEDELADEELPDEESVGGAGFRDSDLLSDGHIMGVTLGHQQMDPHSVS
                     MRKKGMMPQDVSVDDFDGGNNALFMGMENMERNASYGGYVPEELQPPPEEVMRLENER
                     RIKEERLLLRSYFPEFKKGKILKWNRLLHRRAGKYPWQRDFIKRYLKPLIPLNLKLHV
                     QQDQRRLFNTTENVWQASSLGAPTQRNKKHGIVVVAVDEIDPEDVKKNSKDQNEQEIP
                     EDLIVATDNWDQERIIGEKSFTDETPSSHIGNPLQEDFKDWNWDENDLVEANLDSAQN
                     AELDMNDERLLLVRETAGRRDRQNKSIPLAYNEKGLLQKFNISNDDDYRILRRNHQTR
                     IRATISNLNIEHSQPAIRLQSPYYKVTLPKDTLRHLHRPCFGTQIRPGTNIVFSKLKT
                     RKKKRDKGKEVKESFSSTQDLTVGDTAPVFLMEYSEEAPIALSKFGMANKLINYYRKM
                     NEHDTSRPKLPVGETHVLGVQDKSPFWNFGFVEPGHIVPTLYNNMIRAPVFKHDVSGT
                     DFLLVRSSGNGTSNRFYLRTINHLFAVGQTFPCEEIPGPNSRRVTSMRTTRLRMVVYR
                     ILNRTPSRAISIEPIARHFPDQDYGQNRQKIKEFMKYQREGSDKGLWKLKDGEPLLDN
                     ESAKKLILPEQVSEVESMNQGLQFQDDTESYNFDEKLAKLEENLLPWNATKNFVNATQ
                     MRAMIQIHGAGDPTGCGEGFSFLKTSMKGGFVKSGMDNGKPQAPGGHSYNVAQQQKAY
                     DEEISKTWYTHTKSLNVTNPFEEMDNPDEINQTNRHVRTRRDDRKVLRIIRKKRDENG
                     IIQRQTVTIRDPRVIKGYIRSKERKREANLDVEKLLDENTTMNNAEDIEMQKKLLQNE
                     LASLEKSQQRRAARQVSKTKTQDGKVAKGKNTTRRCATCGQIGHIRTNKSCPMYNGSN
                     GGSQLQASVGQGMGSPSPVGTPTDPPGMPDP"
     gene            complement(<627663..>628088)
                     /locus_tag="ZYRO0D07238g"
                     /db_xref="GeneID:8204002"
     mRNA            complement(<627663..>628088)
                     /locus_tag="ZYRO0D07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496703.1"
                     /db_xref="GeneID:8204002"
     CDS             complement(627663..628088)
                     /locus_tag="ZYRO0D07238g"
                     /note="similar to uniprot|Q03579 Saccharomyces cerevisiae
                     YMR298W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496748.1"
                     /db_xref="GeneID:8204002"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ6"
                     /translation="MRGQEPKILNLFKTLFIALAIMAAVEWFKYGTMINYEWFHCSPE
                     QESIGGPDSSVLKLWARGGPSCDKRGEYKTILKRISRDFEPNDEHLSFCIIENEKLPH
                     VHYPVHEDKGEPGYSAYVGYNRDSELVQKMCGEHTIYNF"
     gene            complement(<628382..>629995)
                     /locus_tag="ZYRO0D07260g"
                     /db_xref="GeneID:8204003"
     mRNA            complement(<628382..>629995)
                     /locus_tag="ZYRO0D07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496704.1"
                     /db_xref="GeneID:8204003"
     CDS             complement(628382..629995)
                     /locus_tag="ZYRO0D07260g"
                     /note="highly similar to uniprot|P00729 Saccharomyces
                     cerevisiae YMR297W PRC1 Vacuolar carboxypeptidase Y
                     (proteinase C) involved in protein degradation in the
                     vacuole and required for full protein degradation during
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496749.1"
                     /db_xref="GeneID:8204003"
                     /db_xref="GOA:C5DVJ7"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR008442"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ7"
                     /translation="MKSAVVPLIYGLGVAAGVVNGFSFQQPFAFEENASPSLLDRAIE
                     ALGFDHSHVKESLSSELKKVWDEIPLRFPSQVSNLEFVSKPRPGSLQPKTDWDFTVRS
                     EDVQDYQLRVNKIADPKLLGIDPDVKQYSGYLDVEEEDKHFFFYAFESRNDPKKDPVV
                     LWLNGGPGCSSMTGLFFELGPSSIDSDLKPVYNPYSWNSNATVIFLDQPVNVGYSYSS
                     KGVFNTVAAGKDVYSFLQLFFKQFPEYNAGQTFHIAGESYAGHYIPDFASEILSHPKE
                     DGRIFNLDSVLIGNGLTDPLNQYPYYKPMACGDGGEPAILGPEECQAMDDSLGRCLGL
                     IESCYDTESVWTCVPAAIYCNNAELGPFQQTGKNVYDVRKECKGNLCYEDMEYSEEYL
                     NLDYVKKALGAEVENYESCNFDINRNFLFAGDWMKPFVKGVTNILNQGLPVLIYAGDK
                     DFICNWLGNQAWTNVLPWKESEGFSKAPVRPWKASLTGEKAGELKSYAQLSYLRIFDG
                     GHMVPYDQPENSLSMLNEWIHQDYTLQTD"
     gene            <631043..>632704
                     /locus_tag="ZYRO0D07282g"
                     /db_xref="GeneID:8204004"
     mRNA            <631043..>632704
                     /locus_tag="ZYRO0D07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496705.1"
                     /db_xref="GeneID:8204004"
     CDS             631043..632704
                     /locus_tag="ZYRO0D07282g"
                     /note="similar to uniprot|P25045 YMR296C Saccharomyces
                     cerevisiae LCB1 Component of serine palmitoyltransferase
                     responsible along with Lcb2p for the first committed step
                     in sphingolipid synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496750.1"
                     /db_xref="GeneID:8204004"
                     /db_xref="GOA:C5DVJ8"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ8"
                     /translation="MPHIPEVLPKSIPIPSFIVTTFSYVWFYLYPVLSRIPGGDFLIH
                     YVRKSHQDDPYRTFVEIVLILYGIYYYLSKPQQKKGLQSNKPNLSPQEVDDLIEEWQP
                     EPIVDPTVMDLQRWRLDAIPVIDGTGVNNRINIFQNGKKHENVLNLSSNNFLHLSQTP
                     RVQDVARSVIKNYGVGACGPAGFYGNQDVHYNLEYRLSDFFGTESAVLYGQDFCTSAS
                     VIPAFTKRGDLLVADEKVSLAVQNALQLSRSTVYYYEHNNMESLEAILSELVESEKKE
                     NLPAISRKFIVTEGIFQNTGDIPPLPQLFELKNKYKFRLFVDETLSLGVLGKSGRGLT
                     EYFGLPRKESIDITVGSMAHAFGSSGAFVLGDAVMSHHQRIGSYAYCFSASLPPYTAR
                     SVDEVLRILEEDNSSVTKLQKFSKLLHNEFLTDAKLPKYLEITSSPLSPILHLRLTPE
                     FRYRKFGYSAEDLFCETMHQQKLVATTRYIEPYEQEERFLQKIVDRLLVESGLLITRN
                     IIVVRQESLPFLPSLKICVNSGLQESDIVESCKSIKQVLVETCSE"
     gene            <633465..>634052
                     /locus_tag="ZYRO0D07304g"
                     /db_xref="GeneID:8204005"
     mRNA            <633465..>634052
                     /locus_tag="ZYRO0D07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496706.1"
                     /db_xref="GeneID:8204005"
     CDS             633465..634052
                     /locus_tag="ZYRO0D07304g"
                     /note="similar to uniprot|Q03559 YMR295C Saccharomyces
                     cerevisiae Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496751.1"
                     /db_xref="GeneID:8204005"
                     /db_xref="InterPro:IPR018809"
                     /db_xref="UniProtKB/TrEMBL:C5DVJ9"
                     /translation="MMHFRKKSTASGDSQGSGGNPQHAKLSKEDEEKWKIRTASVSDP
                     ILEAVQEAQPFEQAADAFQDPNRKSYFSGLEGSSELRDIFGQPIGTPDISNPTRARDE
                     RPLDTIRGFEYAVSGDPSWASQLETSQYGFRVRPDFPLMTTNPYSMDNGAGTGSAPVY
                     SEQAVYTAPASSGAGEGTEKKKKKRGLFGRKKKDN"
     gene            <634439..>635047
                     /locus_tag="ZYRO0D07326g"
                     /db_xref="GeneID:8204006"
     mRNA            <634439..>635047
                     /locus_tag="ZYRO0D07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496707.1"
                     /db_xref="GeneID:8204006"
     CDS             634439..635047
                     /locus_tag="ZYRO0D07326g"
                     /note="similar to uniprot|P53328 YGR272C Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496752.1"
                     /db_xref="GeneID:8204006"
                     /db_xref="InterPro:IPR019310"
                     /db_xref="UniProtKB/TrEMBL:C5DVK0"
                     /translation="MAPKSLRSNAEPLATAGTNKIKKRIRDLERLLARKRDTLPDTIL
                     IEKERSLDALRHELNQAHLKQKIRKNATKYHMVRFFERKKALRRYKQALKKNDADEIL
                     QSKIDLCYVVNFPKGEKYVAIFPNNEGDSTKTGQRRESFRAIVAKQLENGTLPVSLED
                     ILQGKRLGNNGTGVAFDEDSEDEKEPLPKAEEEEEEEDEFFE"
     gene            complement(<635079..>640961)
                     /locus_tag="ZYRO0D07348g"
                     /db_xref="GeneID:8204007"
     mRNA            complement(<635079..>640961)
                     /locus_tag="ZYRO0D07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496708.1"
                     /db_xref="GeneID:8204007"
     CDS             complement(635079..640961)
                     /locus_tag="ZYRO0D07348g"
                     /note="highly similar to uniprot|P53327 Saccharomyces
                     cerevisiae YGR271W SLH1 SKI2-like helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496753.1"
                     /db_xref="GeneID:8204007"
                     /db_xref="GOA:C5DVK1"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVK1"
                     /translation="MSATYSIHSAGSYMQAMQSMVNSSLSLAFDRTKSTVPKIDNELK
                     LSKTPNVQAKMDQIRRLANDGNEWDDVFQEFGDISYEKLKNVVESYGKVNSAATFKKL
                     SRLIEDSSSPLPKDILLDSVLDLVYSHEKTQLGKELLDLLGAENVELIDFLLQSRTEI
                     VSQPKEHIIRMTDDAKNLPRFLSQGDIKDQYNQNAFLAKNQKLDPAQKVVKYPHVYRK
                     YEAGGSSMMALSGQKYTLPVGTTRTSYQTYEEIIIPAADPDTNKRSFFIKLLKVKDLD
                     HFCRQVFNYDTLNQVQSLVYPVAYNTNENMLICAPTGAGKTDVALLTILNTVKQFATI
                     DEDGEVNIDYDDFKIVYVAPLKALAAEIVDKFQRKLEVFGIQVRELTGDMQLTKAEVI
                     ETQIIVTTPEKWDVVTRKGNGDDNLVSKVKLLIIDEVHLLHEDRGSVIETLVARTLRQ
                     VESSQSMIRILGLSATLPNFMDVADFLGVNRQVGMFYFDQSFRPKPLEQQLLGCRGKS
                     GSKQCKENIDKVSYDKLLSMVEKGYQVMIFVHSRKETVRSARTFIGMAQENHEIDLFA
                     PDPIMKSRFTKDLGKNRDKDIKEIFQFGFGVHHAGLARTDRNLTEKMFKDGAIKVLCC
                     TATLAWGVNLPADCVIIKGTQVYDSKKGGFTNLGISDVIQIFGRAGRPGFGSAHGTGI
                     LCTSSDSLDEYVSLLTQQHPIESKFGSKLVDNLNAEISLGSVTNVDEAIQWLGYTYMF
                     VRMRKNPFTYGIEWEELASDPQLYDRRRHLIVNAARRLHSLQMIVFDEISMHFISKDL
                     GRISSDFYLLNDSVEIFNQMCNAKATEADVLSMISYSSEFDGVKFREEEATELSRLTD
                     TAVECQVGGSVDTPQGKTNVLLQAFISQTRIMDSALASDSSYVAQNSVRICRALFLIG
                     MNRRWGKFSKVMLDICKSIEKRLWYFDHPLCQFELPENVVRQLRTKNPSMEHLLELDA
                     DELGELVHNKKVGNKVFKLLNRFPKILIDAEIFPITTNVMRIHVELIPDFAWDFQVHG
                     NAEFFWVLVEESDKSEILHFEKFILNKKQLANKHEMDFMIPLSDPLPPQVVVRVVSDT
                     WIGCEYVHTLSFQHLIRPHNETLQTRLQRLRPLPTSALNNPLVESIYPFKYFNPMQTM
                     LFYTLYNTNENVFVGSPTGSGKTVIAELAMWHAFRDFPGKKIVYIAPMKALVRERVDD
                     WRKKITPVTGDRVVELTGDSLPDPRDVRDSTIVITTPEKFDGISRNWQTRRFVQDVSL
                     VIMDEIHLLASDRGPILEMIVSRMNYISEQMHQPVRLLGMSTAVSNAYDMAGWLGVKN
                     NGLYNFPSSVRPVPLKMYIDGFPNNLAFCPLMKTMNKPAFMAIKQHSPNKPALIFVAS
                     RRQTRLTALDLIHLCGLEDNPRRFLNVHDEEELRGYLSQVTDDTLRLSLQFGIGLHHA
                     GLVEKDRSISHQLFQENKIQILIATSTLAWGVNLPAHLVIIKGTQFFDSKIEGYRDMD
                     LTDILQMMGRAGRPAYDTSGTSIVYTRENRKLFYKHFLNVGFPVESSLHKVLDDHLGA
                     EISSGSVSNKQEALDFLNWTFFFRRAHHNPTYYGITEDTTEAGVNEYLSELIDRTLDN
                     LAESQCVEIFGGDIEPTPFLSISSYYYISHKTIRQLLNQIHLNATFKDVLKWLSMAEE
                     FNELPVRGGEMIMNVEMSAQSRYPAEKTFTGDQEMTMLDPHVKAFLLLQAYMSRADLP
                     IADYVQDTVSVLDQSLRILQAYIDVAAELGYYPVVMTIIKVMQCVKQGYWYEDDSVGI
                     LPGCNLKRRTDIEFSEQGFAIEDSDAKPRLTLEDLGKMGHKKLTSVMEKFQVDQEQRR
                     EFLNVCQRLPVLDSINFEDESRDSLIMTAKHFSNKNNKNFEVYCDAFPKMQKELWFVI
                     AYKGQELLMLKRCQPKIQNKETIIVCDLVVPEDLKGQKLNFMIINDALDLSYQCEHQL
                     LS"
     gene            complement(<641122..>642204)
                     /locus_tag="ZYRO0D07370g"
                     /db_xref="GeneID:8204008"
     mRNA            complement(<641122..>642204)
                     /locus_tag="ZYRO0D07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496709.1"
                     /db_xref="GeneID:8204008"
     CDS             complement(641122..642204)
                     /locus_tag="ZYRO0D07370g"
                     /note="similar to uniprot|P36224 Saccharomyces cerevisiae
                     YMR294W JNM1 Component of the yeast dynactin complex
                     consisting of Nip100p Jnm1p and Arp1p required for proper
                     nuclear migration and spindle partitioning during mitotic
                     anaphase B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496754.1"
                     /db_xref="GeneID:8204008"
                     /db_xref="GOA:C5DVK2"
                     /db_xref="InterPro:IPR028133"
                     /db_xref="UniProtKB/TrEMBL:C5DVK2"
                     /translation="MNVIDLSSQQVKDESCEYIDLNQAETEVFESSPLKEVVQNTVDE
                     EQVPDYEPQINSQNIPAIETTRDKLGNLQLEQHVEEYSAVNRRKEIPESMEQRLLRIK
                     DELEEIKALQELGHDSVNSQDLKMLEDLHHQLNSDSQSKMQGLRQRLSKETEADAVVL
                     PHFTMNFEDCKRLLEVDQRMSLLEGKVGSTLDQEDDKSLVTKLEVLFRQIKILKNDSD
                     TLGQFHERLAQINKNYEDSLAGRKARTDAKLYDAICGGMTMQETKVEELYKYHGLLES
                     YGPIFPQLLNRIKQLSGMSDKILESYEIAHSLNSSVMDLQSQANKWENILNSVEQKLD
                     QQEIDLNKNASYVNKRIAALENKPKS"
     gene            <642360..>643769
                     /locus_tag="ZYRO0D07392g"
                     /db_xref="GeneID:8204009"
     mRNA            <642360..>643769
                     /locus_tag="ZYRO0D07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496710.1"
                     /db_xref="GeneID:8204009"
     CDS             642360..643769
                     /locus_tag="ZYRO0D07392g"
                     /note="similar to uniprot|Q03557 Saccharomyces cerevisiae
                     YMR293C Uncharacterized ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496755.1"
                     /db_xref="GeneID:8204009"
                     /db_xref="GOA:C5DVK3"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:C5DVK3"
                     /translation="MGSKTALRRIQLIPELQKKYNIFTHIDNSAAEKVLPDDSANSNA
                     PLSHLVAGIKDNIVTKDMPTTCGSKILLDYMSPFDATCVKLLRDAGALLVGKTNLDEF
                     GMGSTGIHSYFGPVRNPLFPNENAVAGGSSSGSAAAVAAGATDFALGTDTGGSVRLPA
                     AYTSTLGFKPSYGRISRFGVIAYAQSLDTVGILAKDLSVLRKVFGVLDKYDERDPTSL
                     SNKLRDAISDRRVKRSTYRIGIPKEFVQGSMAKELMEPLSNFLEKLMKQGHELYPVSM
                     PSMKFALPVYFTISPAEAASNLARFDGIRYGTRSEKGDLEDGTLFSPTRDAFGQVVKD
                     RMVLGNYNLCSEAFKDSYIRAQRLRVKTIDEFDSIFRFPNLLTGSKGNDAGLDLILGL
                     TNDGPPQSIDHYHEEKVSSPINEYKNDIFVTPMSLAGLPVISFPLKRDAPLGVQFAGQ
                     YGDDSTVLDACSLLVDNDN"
     gene            complement(<643893..>648155)
                     /locus_tag="ZYRO0D07414g"
                     /db_xref="GeneID:8204010"
     mRNA            complement(<643893..>648155)
                     /locus_tag="ZYRO0D07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496711.1"
                     /db_xref="GeneID:8204010"
     CDS             complement(643893..648155)
                     /locus_tag="ZYRO0D07414g"
                     /note="similar to uniprot|P40340 Saccharomyces cerevisiae
                     YGR270W YTA7 Protein of unknown function member of
                     CDC48/PAS1/SEC18 family of ATPases potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496756.1"
                     /db_xref="GeneID:8204010"
                     /db_xref="GOA:C5DVK4"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVK4"
                     /translation="MSRHLRTRHNRHEDGPDGPLEDEGFRDDNGIIHTSNRSLRKINY
                     AEIESGFDFLENEDDDPAKGLSIPATDPAEPPLEPTEPTEPAEPTEPEPVDDPNDVYE
                     DDEDDEDVVGNGYRPQNNGHNGRRSRRARSRGRKVTDPEEDDESFHEDDVEEEDDDDE
                     DVDSEGNSAKGEEYYARRRRQREDKNFVVPDPEDDEQENGDEDDDEDISYYRGRRGRG
                     RPKRERSPSPSVNVAKRLRRRTRSAYAAAAVQDADVDGMGHDAVHNPEALSLRDEIRE
                     LQDDSPIQEKRSLRERTKPVNYKLPPPLSEATAENYLERQAAANALKNPSPRGRRGGN
                     YNHNAGPARRLFPTGGPFGGNDVTTIFGKNTNFYHQGPPAISGVGNADANNKLILDSD
                     SSEDEILPLGAKPKPKSDNASKRKKKQEIADLDPLGVDMNVKFEDVGGLDNYIDQLKE
                     MVALPLLYPELYQNFDITPPRGVLFHGPPGTGKTLMARALAASCSSEGRKITFFMRKG
                     ADVLSKWVGEAERQLRLLFEEAKKQQPSVIFFDEIDGLAPVRSSKQEQIHASIVSTLL
                     ALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLPDVRGREKIIKIHTKN
                     WKPPLSVKFVQNLATLTKGFGGADLRALCTEAALLSIQRQYPQIYRSNEKLAVDPNKV
                     KVGVKDFMMALKKIVPSSARSSGDAAQPLPDSIKPLLQFQFENIINKIKRILPEDGES
                     NLGKDSSLIQEYLDYEDFYAFGNNGNGDEDDDGDDQGFAKHEMLTRLAESRVCNPKLL
                     ITGPAGNGQQYIGAALLHYLEQFNVQRLDLASLLSESTRTIEAAIIQGFIEARGRQPS
                     IVFIPNIDIWSQAVPEAAIFTLMSLFRSLQSNEKVFLLGISEVHKDTNILDGPLSHFE
                     FSDNICHIDIPSARQRSDYFTSIVKILRMKPFEFKTKRRRRKPLPALPPAKSESSLDN
                     TGENGEILSSSEALRRKLKTFQHQDMRLKNILKIKLSGLMDLFKNRYKRFRKPPIEDD
                     YLVHLFEPPTDPNWQPAYTKDNNMILEVTTGRRFFNMDLDIVEERLWNGYYSEPKQYL
                     KDIELIYRDANTMGDRERIIKASEMFANAQMGIEDMSTPDFIRECKATRQRDLERQEL
                     FLKDEESRVAAEQKQLTSSEVNPTAGGGADIVGVGDGNQLQAQLRATIPENKEIDDSK
                     INPTISLDFTAPEASEADSPENHDITATGDTTKLLIENSENPESPAEESNKEPEEGKE
                     ENGITGSNLDEPSKDTRKNDSQENVPIHINPQVPHIDATGDNNPKDEDDSKKQESTKE
                     VAGNSAENEQMETSSEPNALHTSEEGPEEYSESEDTSKELKIDESALSTVIKLLDKET
                     EGYTVSRLQEIYSRLVDVAWEDRFSWDKSGTIEKILHIVNHH"
     gene            complement(<648553..>649039)
                     /locus_tag="ZYRO0D07436g"
                     /db_xref="GeneID:8204011"
     mRNA            complement(join(<648553..648947,649018..>649039))
                     /locus_tag="ZYRO0D07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496712.1"
                     /db_xref="GeneID:8204011"
     CDS             complement(join(648553..648947,649018..649039))
                     /locus_tag="ZYRO0D07436g"
                     /note="similar to uniprot|Q03554 YMR292w Saccharomyces
                     GOT1 evolutionarily conserved non-essential protein
                     present in early Golgi cisternae that may be involved in
                     ER-Golgi transport at a step after vesicle tethering to
                     Golgi membranes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496757.1"
                     /db_xref="GeneID:8204011"
                     /db_xref="GOA:C5DVK5"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="UniProtKB/TrEMBL:C5DVK5"
                     /translation="MWLSESQKFGVAFTFGGFLFFLFGILTFFDRALLALGNVLFLTG
                     VLLIIGPQKTYNFFTRPAKRRGCIFFVFGILLILMKWTFTGFIIESLGIAGLFGDFFG
                     AIIQFLRSMPLIGPILSHPAVAPIVDKIAGVNVLPV"
     gene            <650876..>651565
                     /locus_tag="ZYRO0D07458g"
                     /db_xref="GeneID:8204012"
     mRNA            <650876..>651565
                     /locus_tag="ZYRO0D07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496713.1"
                     /db_xref="GeneID:8204012"
     CDS             650876..651565
                     /locus_tag="ZYRO0D07458g"
                     /note="similar to uniprot|P40325 YGR268C Saccharomyces
                     cerevisiae HUA1 uncharacterized ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496758.1"
                     /db_xref="GeneID:8204012"
                     /db_xref="UniProtKB/TrEMBL:C5DVK6"
                     /translation="MGQTSREDLNDTDLPTYDDVIREDQQRLNTGAQPPPPPARPPRR
                     SDHNSPRPGGSSSSLSSSRPPPRINSTTGGSTTRPTKPIPWNYPRGFHCPKCGNTGYK
                     LKNGKSCRSCWRRFAPVNDIHSQNTQVLQTPGYSSWGSSNWYSNPSNFASPWSMAPPR
                     PPTMTTSTFAPPPGGSMAPMGNAPPLVVKPGDPRLGGVLCGECRGSGRVSFLFDEDLC
                     PLCRGLGRIIR"
     gene            <651778..>652509
                     /locus_tag="ZYRO0D07480g"
                     /db_xref="GeneID:8204013"
     mRNA            <651778..>652509
                     /locus_tag="ZYRO0D07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496714.1"
                     /db_xref="GeneID:8204013"
     CDS             651778..652509
                     /locus_tag="ZYRO0D07480g"
                     /note="highly similar to uniprot|P51601 YGR267C
                     Saccharomyces cerevisiae FOL2 GTP-cyclohydrolase I"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496759.1"
                     /db_xref="GeneID:8204013"
                     /db_xref="GOA:C5DVK7"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:C5DVK7"
                     /translation="MHNPRHIESLQRRGTPLNTRPASPYTLNPPVEADGFSWPSVGTR
                     IRADENEEQESKRVDRISGAVKTILEELGEDVTREGLADTPQRYAKAMLFFTKGYQTN
                     IMDDVIKNAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKRVLGLSKLA
                     RLAEMYCRRLQVQERLTKQIAMALGDILKPMGVAVVIEATHMCMVSRGIQKSGSATVT
                     SCMLGCFRAHRTREEFLSLLNKRTI"
     gene            complement(<652782..>654320)
                     /locus_tag="ZYRO0D07502g"
                     /db_xref="GeneID:8204014"
     mRNA            complement(<652782..>654320)
                     /locus_tag="ZYRO0D07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496715.1"
                     /db_xref="GeneID:8204014"
     CDS             complement(652782..654320)
                     /locus_tag="ZYRO0D07502g"
                     /note="similar to uniprot|Q03533 Saccharomyces cerevisiae
                     YMR291W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496760.1"
                     /db_xref="GeneID:8204014"
                     /db_xref="GOA:C5DVK8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="UniProtKB/TrEMBL:C5DVK8"
                     /translation="MAPAIIGKAHSVPLLAAGSTDRAAKCKYVTKGGQLGDGNFSVVR
                     ECMNLHTRDLFALKMVHKMVVRDKMQLVKKELKLLGEISARVKELEDQKRTSMDVFEG
                     HHHVLQLFDYFETNESIALVMQLCDRGDLYEKIIAEGHLDIETQVKSFTACLVSVLEF
                     LHGQGVVHRDVKAENVLFRLRVNTNEPVEFQGKFPYDLTAHDLILADFGFATNINPNT
                     QLKEYVGTLSYIAPEVVRCKGINYMSEREVKALKPYGFAVDIWALGVLTYFMALGYMP
                     FDCDDEDETLECIISQDYYVDANVEKDPKMSEFWSFLQMCFCLDDRQRASAAELKRHP
                     FIRDYFATSTTLNQALFVPHPMKRSGSSRSLKAPNKASSYTNITHMKMDPPSSVLMTP
                     ANSEPIVEPEVAASRQRDLMEVRNTLKRTLSTTALNRELVILPGAIRGLKKNSTFVLG
                     PQPPPDSLMNGCYSTSPQSRSTLSTPISVSRETSSTSFKVVQDTGKDLNYDNDEDDDE
                     GIVV"
     gene            complement(<654719..>656836)
                     /locus_tag="ZYRO0D07524g"
                     /db_xref="GeneID:8204015"
     mRNA            complement(<654719..>656836)
                     /locus_tag="ZYRO0D07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496716.1"
                     /db_xref="GeneID:8204015"
     CDS             complement(654719..656836)
                     /locus_tag="ZYRO0D07524g"
                     /note="similar to uniprot|P53326 YGR266W Saccharomyces
                     cerevisiae probably contains a single transmembrane span"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496761.1"
                     /db_xref="GeneID:8204015"
                     /db_xref="UniProtKB/TrEMBL:C5DVK9"
                     /translation="MSSASDWFESWDSQELYQETVKASTTCAPSSPIKEQGIVCGPVL
                     RLRYVDYKADLYHGSILIVTRNGSKDSAPKIAYVTGPSYPGAANLNLKHGEFEPTMFY
                     SETFSNSEIHMFRYNVTLPLSEYEQTVKYTVNGDAEMHYRFFIPSRDTNFNVISYSCN
                     GFSVSTDTTTFKGSMWFDIIKKHSGVHYNVMLGGGDQIYSDGISLFSDKVRQWVETKD
                     PLKKRNMVADDTFKQDLNHFYMREYLEWYGYGHWKGSTENSKTTQKCFPIALATIPSI
                     NIWDDHDTIDGWGSYSDSLMKTSVFSSIGKASYKYYMLFQHHVSLDEKDAYLQDKMWV
                     LGKEPGPFIGEPSHSVFTRVGPNMAMLGLDCRTERSLKTIVLRSTYDAVFERLIQEAK
                     SQKFDHLLLMLGVPIAYPRMVMLEWLFTSKLLFPLKYLSRKGIVAPGFVNEFNGDVEL
                     LDDLNDHWCARHHKKERNWLLARLQDFGAKYGVRITILSGDVHLASMGRFRSKQRRHR
                     PMASTETQQANAVIDEQPENDERLMVNVISSAVTNAPPPAAVAKVMQKKTPIHRFDRE
                     TDEDAVPMFNFETNGQTPRQLNCFLPQRNWSDIVPIQNVLNNEYMQNFYRLKLGDRLI
                     PGMVTREFGLESVNEVKSDDLKGHRNPPYPVTEGGVMATIHVETESTNINSKTTAYSM
                     PIPELRITKDKISHSGLKHWGEK"
     gene            <657145..>658629
                     /locus_tag="ZYRO0D07546g"
                     /db_xref="GeneID:8204016"
     mRNA            <657145..>658629
                     /locus_tag="ZYRO0D07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496717.1"
                     /db_xref="GeneID:8204016"
     CDS             657145..658629
                     /locus_tag="ZYRO0D07546g"
                     /note="highly similar to uniprot|Q03532 Saccharomyces
                     cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
                     localizes to both the nuclear periphery and nucleolus
                     highly enriched in nuclear pore complex fractions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496762.1"
                     /db_xref="GeneID:8204016"
                     /db_xref="GOA:C5DVL0"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVL0"
                     /translation="MVEESKKRNREEAEENDVEQHEESSEKLSQTFGELELSQPTLKA
                     IDKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIERLHSLKFKPRNG
                     TGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLVKGVNLLIATP
                     GRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEEEMRQIIKILPNEDRQSMLFSAT
                     QTTKVEDLARISLRAGPLFINVVSEKDNSTVEGLEQGYVVCDSDKRFLLLFSFLKRNQ
                     KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVST
                     DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGAKGKGKSLMFLTPNELGFLRY
                     LKAAKVPLNEYEFPTNKIANVQSQLEKLIRSNYYLHQTAKDGYRAYLQAYASHSLKTV
                     YQIDKLDLAKVAKSYGFPVPPKVNITIGASGKTLVNKKRKVNRN"
     gene            <658981..>661236
                     /locus_tag="ZYRO0D07568g"
                     /db_xref="GeneID:8204017"
     mRNA            <658981..>661236
                     /locus_tag="ZYRO0D07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496718.1"
                     /db_xref="GeneID:8204017"
     CDS             658981..661236
                     /locus_tag="ZYRO0D07568g"
                     /note="highly similar to uniprot|P00958 Saccharomyces
                     cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms a
                     complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p
                     which increases the catalytic efficiency of both tRNA
                     synthetases also has a role in nuclear export of tRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496763.1"
                     /db_xref="GeneID:8204017"
                     /db_xref="GOA:C5DVL1"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:C5DVL1"
                     /translation="MSLAISFDKGKGHAQAVTFANNFKIALGLEYAAKGTKTTVNEDN
                     VGPALIQGESFRLFDSNAILRYLLNDFAPQQVDEYEYALSSLEHLLHQKQVPKEHADE
                     CVDKALNNYLTSLEEPLSATRLISFVNAYSLNPDAVKARFPQLPQGISKALASAEKST
                     PRSAQKVERTGAQHVEEGFLVKDQGEEILPQKGEKNIIITSALPYVNNVPHLGNIVGS
                     VLSADIFARYCKARNYNTLFICGTDEYGTATETKALEEKVTPLELCTKYHKIHKEVYD
                     WFQVGFDYFGRTTTPLQTEIAQDIFSKLNDNGFLEEQTMKQLYCPVHNSFLADRFVEG
                     ECPKCHYEDARGDQCDKCGGLLDPFELINPRCKLDNAEPEVKYSDHIFLSLDKLEGRV
                     ADWVNKKSEEGFWSKNSKTITQSWLKDGLRPRCITRDLIWGTPVPLEKYKDKVLYVWF
                     DATIGYLSITANYTKHWQKWWKNPEDVNLYQFMGKDNVPFHTVIFPASQIGTGDQWTM
                     LHHLNTTEYLQYEGGKFSKSRNIGVFGNNAKDSGVSPSVWRYYLTSVRPESSDSHFSW
                     DDFVTKNNSELLANLGNFVNRLVKFVNAKYNGVVPDYDVKNLPGFDSLKSDISQILGS
                     YIAEMEPAHERRGLELAMSLSARGNQFLQENRLDNNLFSNFPAKSDAVVGVGLNIVYA
                     VASVIGPFLPEAAEKIYRMLNAPPLKIDDEFHLAILKGHNINPAEYLFQRIDEKQIDA
                     WRKQYGGGSQQ"
     gene            <661580..>662752
                     /locus_tag="ZYRO0D07590g"
                     /db_xref="GeneID:8204018"
     mRNA            <661580..>662752
                     /locus_tag="ZYRO0D07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496719.1"
                     /db_xref="GeneID:8204018"
     CDS             661580..662752
                     /locus_tag="ZYRO0D07590g"
                     /note="weakly similar to uniprot|P53324 Saccharomyces
                     cerevisiae YGR263C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496764.1"
                     /db_xref="GeneID:8204018"
                     /db_xref="InterPro:IPR019436"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DVL2"
                     /translation="MVASDLNKGPKMGAIVGCASVVWFSIKCLFLVPINIIKDGLIFR
                     HKHGKSLSFDFMHRITIRTLVGNSNDYLIDWFINPYMKRAGDAIRIPNCPRRNTTEHA
                     SIRLTDGDLALVTKSFGAHFEKGVDVEMRWFVKSNTFDAKKDPVIYYIHGGGFRLKEI
                     DSVIVFLGHIHEAYPEAAIVLVDYTLTSAAKNAVFPQQLLECVAGYDWLTAESGCQNV
                     SLIGDSSGGNLALALLELLQLSARPAPKRAAVISPWVNPSLHDEGFAKHEIIDYLPAD
                     KLFEWGDYYTPGPEYIKNPFLNIEHNFETPVWKNVLEQTELLVTYGAEEMFHDQVKRF
                     VEKLKLANPAKFSAENNVVVDDVGAHTSPLFFTKLDLKYWLSYDINRKFIRFLTSS"
     gene            <662910..>663701
                     /locus_tag="ZYRO0D07612g"
                     /db_xref="GeneID:8204019"
     mRNA            <662910..>663701
                     /locus_tag="ZYRO0D07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496720.1"
                     /db_xref="GeneID:8204019"
     CDS             662910..663701
                     /locus_tag="ZYRO0D07612g"
                     /note="highly similar to uniprot|P53323 Saccharomyces
                     cerevisiae YGR262C BUD32 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496765.1"
                     /db_xref="GeneID:8204019"
                     /db_xref="GOA:C5DVL3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010440"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /db_xref="UniProtKB/TrEMBL:C5DVL3"
                     /translation="MSEEIVSRVSNYLTPQVPFKAIAQGAEAVVFTTNVHPYLPAKDS
                     NNKTYVIKYRPPKRYRHPSIDRSLTKHRTLSESRLLAKLFLIPGLKVPQLIACDAYNG
                     YIWIEFLGEDLPNDAGFSNLKNFLWMFAPSDPYDPIVKETLIKVGEQIGLLHWNDYCH
                     GDLTSSNIVLVREGPESWQPYLIDFGLGSTSNMVEDKGVDLYVLERAIVSTHSLFADT
                     YKEWLMHGFCQVYKNNGAEGEKKLKEVLNRFQEVRMRGRKRSMIG"
     gene            complement(<663714..>664973)
                     /locus_tag="ZYRO0D07634g"
                     /db_xref="GeneID:8204020"
     mRNA            complement(<663714..>664973)
                     /locus_tag="ZYRO0D07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496721.1"
                     /db_xref="GeneID:8204020"
     CDS             complement(663714..664973)
                     /locus_tag="ZYRO0D07634g"
                     /note="similar to uniprot|Q74Z76 Ashbya gossypii AGR330W
                     AGR330Wp and weakly similar to YMR289W uniprot|Q03266
                     Saccharomyces cerevisiae YMR289W ABZ2
                     4-amino-4-deoxychorismate lyase catalyzes the third step
                     in para-aminobenzoic acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496766.1"
                     /db_xref="GeneID:8204020"
                     /db_xref="GOA:C5DVL4"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:C5DVL4"
                     /translation="MRPKRNNGSKKELSAGEQKILDTIQQDIIGRYFEPAIGTGGFEI
                     LSTLRYDPSFTHLFPEQHHQHHSQSQNDQEAAKLNEIDTRLQTMDYNDNNLFALPEET
                     DSGKFEEYIGGINDSSSTTGDISLMSLMNECMGTQGSSPPETTLTGSTPSEEELYPIF
                     YQRFLLLGEHFKRLNLSLEFFKWGFQVPIDLLLENLIRAIPDYHEVEDIREKMRLLIE
                     VRNCYKMRVLIYDSGKMRVEAHPIPLPPPPASPTDFTLSTTHYFISNILGGFIPNIPS
                     NWDVFVDTEPTKISPFTTFKTTYRQPYSAARQRMTQLAEKYGTNKKCEILVYNDTFQL
                     MEGSISSVAVIRYKEDDPTQFRFITPPLASGCLCGTMRRYLLKKGLIDEHPIDVRDLC
                     DGEQVILLNGVMGCVKGTIRQSYQKPT"
     gene            <665155..>667623
                     /locus_tag="ZYRO0D07656g"
                     /db_xref="GeneID:8204021"
     mRNA            <665155..>667623
                     /locus_tag="ZYRO0D07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496722.1"
                     /db_xref="GeneID:8204021"
     CDS             665155..667623
                     /locus_tag="ZYRO0D07656g"
                     /note="similar to uniprot|P46682 Saccharomyces cerevisiae
                     YGR261C APL6 beta3-like subunit of the yeast AP-3 complex
                     which functions in transport of alkaline phosphatase to
                     the vacuole via the alternate pathway suppressor of loss
                     of casein kinase 1 function putative beta adaptin
                     component of the membrane-associate clathrin assembly
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496767.1"
                     /db_xref="GeneID:8204021"
                     /db_xref="GOA:C5DVL5"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="InterPro:IPR026740"
                     /db_xref="UniProtKB/TrEMBL:C5DVL5"
                     /translation="MVDSIYRIASALESAKVITMDAAAIATSKLGETSYTTYSKNITP
                     EQLSNLLNSRNPREIKDGMKRIISVMASGETTIDVESYFADVVKNIISDDAKVRIMVC
                     IYLLRYAERDPNLALLSVNSIQKTLSDVDPETRCFSLKALSDMKIPSLFPVVLYTLKK
                     AVTDPSASVRGEVAFSMLKLYREEGEEVVEELEPLLKVLLSDADPLVVSSAIVVLKKC
                     FPQHLDWLHGHFRYYCEIMRELDPWAQNSMIDLLVSYCKQFLPRPTVVDASASADGVQ
                     SAILLPDRFNEIQFPVYDVVNHPDLTLFLQSLEPLIHSMNPSVILSSSNAFYQLATPM
                     QFKKSEFPQALVRTSVFSNNIGVKSSLLQTILILSSLDSSLFLPYTKKFFVLPSDDTR
                     VACLKLKILSNLINEFNVRVIVDQLKYYISTSQCPELVITAANTLAVCGQLSVRWESH
                     VMKWFISHMETSKLPNAVLDSYVNVIRLLNPKRHLKTIMKLSEVLESRKLLADNVRAG
                     IVWLFGEIAAVAYKICPDVLRKLIPHFSFEGPETRNQILLLAAKLLSYDIDNFRESGD
                     VNEYDLDNSRIGQLYKAVAYLSEFDGDYDIRDRARCYSSLFLTRKFEIATLLLQAPKP
                     SPVAASLWSPSSNGEQDLDWESVGLDKNLQEFHRMLPWNENIPETDDDLRKPAALKDY
                     SRYKKSFSSDSFAGKNVSGGINSVSSGDWPLQPTSRQITATAAAAPAKKYRLQSLEEF
                     FSDIPSKQTNKPKRKIVIESSSGEDDEESSSSDESESGDYRGDEDESSSSDESEGGDD
                     RGDEDKGGDKNDDGDEDNASSSSG"
     gene            complement(<667682..>670576)
                     /locus_tag="ZYRO0D07678g"
                     /db_xref="GeneID:8204022"
     mRNA            complement(<667682..>670576)
                     /locus_tag="ZYRO0D07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496723.1"
                     /db_xref="GeneID:8204022"
     CDS             complement(667682..670576)
                     /locus_tag="ZYRO0D07678g"
                     /note="similar to uniprot|P49955 Saccharomyces cerevisiae
                     YMR288W HSH155 U2-snRNP associated splicing factor that
                     forms extensive associations with the branch site-3'
                     splice site-3' exon region upon prespliceosome formation;
                     similarity to the mammalian U2 snRNP-associated splicing
                     factor SAP155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496768.1"
                     /db_xref="GeneID:8204022"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DVL6"
                     /translation="MSKAVQFVGSSDDGNHQLGGSYSIPQDLQNSIRSESTQDEDPDP
                     LQRQMQSRSVQGKQDEYHRRPADANDRKRSLAPAGDESNEVVPPAKKKSRWDVGAYEI
                     PETSREVQKQLVGRLADDLPEKYRLKFFKPSDQKHFAPLLANKPTESLSKSEKQEMSL
                     LLLLLKIKNGDSASRKASMKMLRDKCSDYGPTLILDSILPILLDRTLEDQERHLMIKV
                     IGRVLFKLGGEIKPYTHKVLTVISPLLIDEDPLARATGREIITTLANAAGLVAIITSV
                     SKDIDHEDDYVRNTTSKAMAVVGKALGIANLIPFLNAVCHSRKSWRIRQSGVRIIQQI
                     GILMGIGVLPHLAGLVECLSDSLTDAHIPLRIASANALATLAQNSYPYGIEAFNVVLE
                     SLWRGVRTHRGKILAAFLKCLGSLISLMDAEYAGYYTQEVMRIVKREFSSPDDEMKKA
                     VLLVLQKCSRTEGVTPRYLRENVAQDFFKNFWIRRTALDRQINKMVVFTTVVLSEKIG
                     AKFTIEHLLKPLRDEAEPFRTMAVAAVSRVVDLLGTGELDERLETRLIDAMLVAFQEQ
                     TNKDSSIFKGFGIVAAAFDKRMKPYISPIVSAILDHLRHKDAIARQHAADLCAIFIPV
                     IKNCGELDILNKLNIVLYESLGEVYPEVLGSILGALFTAVCEMDLSIIQPPINQILPT
                     LTPILRNRHKKVQLNSIDLIGRIAALAPESVPPKEWMRICFEMLEMLKSTNKPIRKAA
                     NDTFGLIANAIGPQDVLVTLLNNLKVQERQLRVCTAIAIGIVAKTCGPYIVLPALMNE
                     YKTPETNVQNGVLKAMAFMFEYIGGMSQDYIYFITPLIEDALTDRDLVHRQTGANVIR
                     HIALHCSGAGYEEAFIHMLNLLMPNVFETSTHAIVRILEGLEALSHSVGPGIFMNYIW
                     VGLFHPAKVVRKAFWKVYNNVYVQHTDSLVPYYPLPSEDVYTVEELDILL"
     gene            <670765..>672816
                     /locus_tag="ZYRO0D07700g"
                     /db_xref="GeneID:8204023"
     mRNA            <670765..>672816
                     /locus_tag="ZYRO0D07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496724.1"
                     /db_xref="GeneID:8204023"
     CDS             670765..672816
                     /locus_tag="ZYRO0D07700g"
                     /note="similar to uniprot|P38875 Saccharomyces cerevisiae
                     YHR188C GPI16 Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex that
                     adds GPIs to newly synthesized proteins human PIG-Tp
                     homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496769.1"
                     /db_xref="GeneID:8204023"
                     /db_xref="GOA:C5DVL7"
                     /db_xref="InterPro:IPR007245"
                     /db_xref="UniProtKB/TrEMBL:C5DVL7"
                     /translation="MRLIGMVQLIGIASWIGLFSRVIRAVEAEGTSLGFEIDQDIDLQ
                     GDCNESLGNYKHNCKSGFLSNEGGSETEIEVTETVIEDAPQPTINLRTREDDSIAVKD
                     QIWYPYSEHLSIKPLPKNYLLASFDFDTQSNEFVPGKPSTDFDDYSHYTVFPKAFKPI
                     LDQTSTRQLHLRFTRGFWDAESWGRLPHDGFKSGGSGVEIWAILEADSKDSAFRQWKT
                     LVNSLSGLFCASMNFIDGSKTTFPVESFHPVDDTTLPLFDQNKQLYLVRAALANEPIC
                     TENLTPLVKLFPTKGKSGITTLLDGHKVFDSSWHSLSVDISTDCDDQTERCSHSLQAL
                     VDMVINVPNTLARSENPIPKPLPGDKLRCDLDKPHDAFHCFQLPYETEGSYGLSQLFG
                     KYIQGSSLMSQEPSQVCVDIADSWNTFIQVNGSLFATTDNCFELKDFQQQDIYFESNN
                     TNEVVDVEPVPVYVSRSLTGYGQDRGGLRTVFVNPQDEPVTLIYFESLPWFMRIYLST
                     MHLEDNPQSPVNISLDDILQSTYYMPAADRVRPTHLEYKITIPANTTLAVSYQFDKSL
                     LQYAEYPPDANHGFEIESAVITVIEPTTYQLRTATLLLLLSTPDFSMPYNVIILTSTV
                     MGLIFGTLFNLLVKKMLPVEEADKIQEGNGLRNKIQLFKSRIMAKFNLKRREVKTDLK
                     E"
     gene            complement(<672860..>673768)
                     /locus_tag="ZYRO0D07722g"
                     /db_xref="GeneID:8204024"
     mRNA            complement(<672860..>673768)
                     /locus_tag="ZYRO0D07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496725.1"
                     /db_xref="GeneID:8204024"
     CDS             complement(672860..673768)
                     /locus_tag="ZYRO0D07722g"
                     /note="similar to uniprot|P38874 Saccharomyces cerevisiae
                     YHR187W IKI1 Subunit of the Elp4p-Iki1p-Elp6p-subcomplex
                     of RNA polymerase II elongator complex which is a histone
                     acetyltransferase iki1 mutations confer resistance to the
                     K. lactis toxin zymocin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496770.1"
                     /db_xref="GeneID:8204024"
                     /db_xref="GOA:C5DVL8"
                     /db_xref="InterPro:IPR019519"
                     /db_xref="UniProtKB/TrEMBL:C5DVL8"
                     /translation="MSGSNSNATILLKRVLSLNEFSPLLLCIDSIAQTASYLLDEILY
                     NASKNGQVSVIYVSFESVNCPSYATKFIDVESVGLAKLSQTISSYLPSSSPTSSGPKS
                     VVVVDSMNHIPKNQVAQFMASIGSKHATVLGVYHKDMPEIADPSLEHYPPTLSLLYFM
                     ATTVLEVNPILNKELDEEELKEELVKYLVPRGLNNSRFQLTLTNRRKSGRSLVHDFYV
                     DTNTHSYEVVKETQEADNDDGENPEALQDLTTFNLSTSAKQRMAKDQVALPFLEAQSF
                     NTGGAIVYQFEKDDDFDEEDPYEDPF"
     gene            <674077..>678654
                     /locus_tag="ZYRO0D07744g"
                     /db_xref="GeneID:8204025"
     mRNA            <674077..>678654
                     /locus_tag="ZYRO0D07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496726.1"
                     /db_xref="GeneID:8204025"
     CDS             674077..678654
                     /locus_tag="ZYRO0D07744g"
                     /note="similar to gnl|GLV|CAGL0M13409g Candida glabrata
                     CAGL0M13409g and some similarites with YHR186C
                     uniprot|P38873 Saccharomyces cerevisiae YHR186C KOG1
                     Subunit of TORC1 a rapamycin-sensitive complex involved in
                     growth control that contains Tor1p or Tor2p Lst8p and
                     Tco89p contains four HEAT repeats and seven WD-40 repeats
                     may act as a scaffold protein to couple TOR and its
                     effectors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496771.1"
                     /db_xref="GeneID:8204025"
                     /db_xref="GOA:C5DVL9"
                     /db_xref="InterPro:IPR000357"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="UniProtKB/TrEMBL:C5DVL9"
                     /translation="MPVTYGPQPLRPINVDTRHGFGEQYHSEQFLQSLANDFIFYFDD
                     KRHKTNGNPTPEEEKEEDAQHYYQPIQDWKIMKDRQKTVSAALLLCLNLGVDPPDVIK
                     TQPCARVESWVDPLNFQDSKKAIEQIGKNLQTQYETLSLRTRYKQSLDPCVGDVKRFC
                     NSLRRTSKDDRILFHYNGHGVPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIF
                     VYDCNNAGNIVNNFKKFVQKRIREEQEGIQNTSAPSPSFTNAECFQLASCRSDELLLM
                     SPELPADLFTCCLTCPIEISVRVFLMQTPLKESKYKILFENPITSEFDDDKNSYKSRI
                     PNVNIPGVLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMVAALFRNFL
                     LAKRIMPWYNCHPISDPELTDSIASHPMWQAWDLALDEVLSKLVEDLKNAPPSTDLES
                     QLILQQQESLQSQTPQRNEIKSDTIQAHSRFAVGNLSTMSLANHPAAQSATRKSAASL
                     VQVPQQQQQKQFTGFFEQNLTAFELWLKYASNTRHPPEQLPIVLQVLLSQVHRIRALV
                     LLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELKPILVFIWSRIMSIDYKNTQAE
                     LIKEKGFMYFVSVLVPDWGVLPSPASSSSIAPGSQFSMAASPSLNGSRGQFYPSQGGA
                     YLATHYHSNDTTDEQKAMAVFVLSSFVRDFPLGQRYCFSLDLVDKLSFYLENSEIPLL
                     RQWCAILIGQLCSHNSLYRHICMNAGIINTLLGSLKDPVPEVRTAVLLALKNFISDVD
                     DVDQMFRMQQEMEQQYHQLHAQLQQLRGGSHQQQAHHIEQQQIKLEQQIQHCQIMQLQ
                     MQNIEPRKLKRQEVTNLVAVLGLINDGSPLVRKEVIIFLSQVVYRYINFFIVVAFNEL
                     IEEIIQMEGKDSDAQNFSDKYSVSHGSVFSTVWEALLILAEDPYSENRSLAGQVVDYI
                     LLELSTHKDLSDAFSKIEHYLAKRSVGQNGRSMVSNPQVQLLKKPNLPFSSDKNGKNE
                     STERKKDGSSIRKKGASLSKFFQNLSLGTSRSGSENDLRGMVNDHDSKPAGLSFLSVP
                     HGMAPQATIPRPRKFDGALKLPLESTFLDYSREYFQEPQMRRHETDEPGSVEYSARVW
                     RRNRNESIIQETQAEKKLALYGDWSNRVVTLDNKTQPKLLRFAQFENHLVSVDERDEV
                     TVFDWDSKRTLSRFSNGNPFGTKVTDLKFLNEDDAALLLAGSSDGIVKIYKNIHSNDD
                     LELISAWRGLTDMLLTPRSSGLLTEWQQIRGSLLTTGDVKIIRAWDAHTETVEVDIPA
                     KTSSLITSITSDQLAGNLVVAGFADGSLRVYDRRVDPRDSMVRLWGPGAGSRRTWINN
                     VHMQRGGCRELVSGATNGVVELWDIRMNEPVGMFTDENVQQQNGQRRTTTMTTTQVHE
                     HAPIIATGTKQVKIWTTSGDLLSSFKNQHNTGGVAGTLAVTGIRSTLSSSSAFLSSMA
                     FHPHRMMLAAANSHDTGISIYKCEDRNSEFY"
     gene            678842..678914
                     /locus_tag="ZYRO0D07766r"
                     /db_xref="GeneID:8204026"
     tRNA            678842..678914
                     /locus_tag="ZYRO0D07766r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (CAC) cove score=75.70"
                     /db_xref="GeneID:8204026"
     gene            <679071..>682163
                     /locus_tag="ZYRO0D07788g"
                     /db_xref="GeneID:8204027"
     mRNA            <679071..>682163
                     /locus_tag="ZYRO0D07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496727.1"
                     /db_xref="GeneID:8204027"
     CDS             679071..682163
                     /locus_tag="ZYRO0D07788g"
                     /note="similar to uniprot|P07276 Saccharomyces cerevisiae
                     YGR258C RAD2 Single-stranded DNA endonuclease cleaves
                     single-stranded DNA during nucleotide excision repair to
                     excise damaged DNA subunit of Nucleotide Excision Repair
                     Factor 3 (NEF3) homolog of human XPG protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496772.1"
                     /db_xref="GeneID:8204027"
                     /db_xref="GOA:C5DVM0"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5DVM0"
                     /translation="MGVHSFWDVVGPTARPVRLESLQDRKMAVDASIWIYQFLKAVRD
                     QEGNALKHSHIVGFFRRICKLLYFGIKPVFVFDGGVPALKQDTIRQRKERRQGKRENA
                     AVTARKLLAIQLQKQQEASEKDLSSKTAKKQDDERTSAELFRPQDEWHLPQIPGFKYD
                     LDDQRVVSASNYEEVVNSMDDELEGIDLDSINPSSPEFDELPKSTQYMIISKLRLRSR
                     LRMGYTKEQLEHLFPNSMDFSKFQIDMVRRRNFFTQKLMNVTGIHDGGASRLDQEVVT
                     RISGQLHKEYKLTKTDNGWALGLGELDGSESDKAIVLDDKDVETLKSFGHKVTTASEE
                     EENEDDFEWEDVDVKPRNDKPVEDFSLNAARLPQLSRESSTAGGKSFLDTRPSQASPL
                     KKSHGPTNVIELDEEEENDDDYRKQIEDMELMEALQKSQLEERLRRAAQESAKVRARE
                     ANSTDERDEDDDDDNYLKQIEEIETMEAIQKSRMEERARQEREKQGQEKNNAWGEAME
                     NNAKRLAVNKPALPQEQSPLPPPPPPSTTTSVNENLPTESEQNLNFIVGKIPDFDLSN
                     GGSFLFQDTNAAAKDSKSKDEDKDKDNDKDKKPPAETPTWFQNGIGQTANPFTSSNFV
                     YDKEVSEPNTNTSTTDVLQRVTGLEDGKELENLEEPEQDDDIHEIGELQKGNDEMPDE
                     ERQADDSFSSAEQPESQGPNRAPLVFDYDFSEDDEENIAENMRKEEQEFSTFKNVLNN
                     RVVDNAFMEDELYEQQTKDKRDSDEVTADMITDVQDLLSRFGVPYITAPMEAEAQCAT
                     LMRDRLVDGVITDDSDVFLFGGNKVYKNMFSERNYVEYYDAESIYKNLGLDRNGMIEL
                     AQLLGSDYTNGIKGMGPVSGMEVIAEFGSLEEFRKWHNEGQFDKKKQEQENKFQKDLR
                     RRLVKNEVVLDENFPSETVKNAYLNPEVDNDKTEFVWGTPDLDMLRSFFKRKVGWPQE
                     KTDEVLVPLIRDMNKRKKSKQSTITEFFPREYIQGQRNLNLGKRLSTASGKLKRRKLK
                     "
     gene            <682451..>683284
                     /locus_tag="ZYRO0D07810g"
                     /db_xref="GeneID:8204028"
     mRNA            <682451..>683284
                     /locus_tag="ZYRO0D07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496728.1"
                     /db_xref="GeneID:8204028"
     CDS             682451..683284
                     /locus_tag="ZYRO0D07810g"
                     /note="weakly similar to uniprot|P38872 Saccharomyces
                     cerevisiae YHR185C PFS1 Sporulation protein required for
                     prospore membrane formation at selected spindle poles
                     ensures functionality of all four spindle pole bodies of a
                     cell during meiosis II not required for meiotic
                     recombination or meiotic chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496773.1"
                     /db_xref="GeneID:8204028"
                     /db_xref="UniProtKB/TrEMBL:C5DVM1"
                     /translation="MPQRRHSSQTKLPFSGNAKINVESCPNSFVFGSEPRDKRKRTQK
                     YESSPIPQVSYDEKSTSIPILNVSRNHTNSQGPEYHIPVKSTPSGKVKSYCQGRDSML
                     QQYTFMTYSSGPMLNSMYQNYNLTTTMPYPMHYSSYPINMQPSHSANPNINLNMSKDQ
                     SSQTFPSFFNPRTAHNMPHMEKVNSWIENIPVFQIDEQNWKSECYDSSFAIDWEEEEF
                     EDPLLAESNKISFATHDELLFLQAKKFETAIRKLYRLENEPSPTKTDFLVDTESFTDY
                     L"
     gene            <683498..>684553
                     /locus_tag="ZYRO0D07832g"
                     /db_xref="GeneID:8204029"
     mRNA            <683498..>684553
                     /locus_tag="ZYRO0D07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496729.1"
                     /db_xref="GeneID:8204029"
     CDS             683498..684553
                     /locus_tag="ZYRO0D07832g"
                     /note="similar to uniprot|P53320 Saccharomyces cerevisiae
                     YGR257C MTM1 Mitochondrial protein of the mitochondrial
                     carrier family involved in activating mitochondrial Sod2p
                     probably by facilitating insertion of an essential
                     manganese cofactor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496774.1"
                     /db_xref="GeneID:8204029"
                     /db_xref="GOA:C5DVM2"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DVM2"
                     /translation="MGSNESQCNLSLKERMLSAGVGSLLTSLILTPMDVVRIRLQQQD
                     LLPNCSCPSNTDAKVPITHTNTGTVFWQDSCFQDLTCKNSRIRFNGTMEAFTMIAKNE
                     GLTSLWSGISISLLMAIPANVVYFTGYEYLRDTSPLNEKHPGLNPLLCGAFARVIAAT
                     TIAPLELIKTRLQSIPRSSRRNGKMEVIKDLMLEMRKEIKSGGSKALFRGLEITLWRD
                     VPFSAVYWGAYEFCKKHLWYHPLYPTSHANWIQFANSFITGCIGGTIAAIVTHPFDVG
                     KTRMQISLMPQRNNDGLVRSSKFPRNMFKFLDSIRRTEGFGALCVGLPVRIAKIAPSC
                     AIMISSYEVSKRIFSHS"
     gene            complement(<684694..>686211)
                     /locus_tag="ZYRO0D07854g"
                     /db_xref="GeneID:8204030"
     mRNA            complement(<684694..>686211)
                     /locus_tag="ZYRO0D07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496730.1"
                     /db_xref="GeneID:8204030"
     CDS             complement(684694..686211)
                     /locus_tag="ZYRO0D07854g"
                     /note="weakly similar to uniprot|P38871 Saccharomyces
                     cerevisiae YHR184W SSP1 Protein involved in the control of
                     meiotic nuclear division and spore formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496775.1"
                     /db_xref="GeneID:8204030"
                     /db_xref="UniProtKB/TrEMBL:C5DVM3"
                     /translation="MPFNIDMVEPPPELPLHSFLMDPPKSRKRIVNKLKGLLAPSKEF
                     VPRDEFEDIPLRPPAFPLVEDSTKTFLTGNVEPMGLQQQHQQQQEQERQRQHDQQQRN
                     QHQQAKSGIAIPHSIILGDPSAFSNFSSSLHIKHIGLRSCVKRLNTIAQRKLETSKCT
                     QKFLRDLISWGQNSSFDSLDSLELVNEIQLIFQQDLINEQNIAQRLKLLASELDFVCI
                     REQELAQERKNLAISLKKHRYALEKKGEHHDETILLKEKVIAHERAFESYKSHYQFAV
                     SITARHAFKELGIDLYERASDLKETTGEFLRITLQALESVDGDGFVKDLEKIRIVRAE
                     RSWAKLSREQKTNPQSWVDLVSGKKDGDDTLMQKVYQGLPKEYSPLEPRINQQELKLD
                     FPTTELDESTSAIQSGRFNPITSNEYFSPRTGQQENDTKREKLKDDVKETIVRSVDPN
                     VVRNVTGGVPAQRHREETKPPPQNDNPNGFILNFSNISQQFDDAEKHLQENRWLD"
     gene            complement(<686473..>687942)
                     /locus_tag="ZYRO0D07876g"
                     /db_xref="GeneID:8204031"
     mRNA            complement(<686473..>687942)
                     /locus_tag="ZYRO0D07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496731.1"
                     /db_xref="GeneID:8204031"
     CDS             complement(686473..687942)
                     /locus_tag="ZYRO0D07876g"
                     /note="highly similar to uniprot|P53319 Saccharomyces
                     cerevisiae YGR256W GND2 and to uniprot|P38720
                     Saccharomyces cerevisiae YHR183W GND1 6-phosphogluconate
                     dehydrogenase(decarboxylating)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496776.1"
                     /db_xref="GeneID:8204031"
                     /db_xref="GOA:C5DVM4"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012284"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DVM4"
                     /translation="MSADFGLVGLAVMGQNLILNVVDHGFSAVVYNRTTSRVDEFLAN
                     EAKGKNIQGAHSIKEFVDKLKRPRKLMLLVKAGKPVDYLIGDLLPYLEEGDIIIDGGN
                     SHFPDTNRRYEELKQKGIHFVGSGVSGGEDGARWGPSLMPGGDEAAWPAIKSIFQSVS
                     AKSDGEPCCDWVGPAGAGHFVKMVHNGIEYGDMQLICEVYDILKRVGKFEDKEIGEIF
                     EKWNKGVLDSFLIEITTDILKKNDKDGVPLVEKILDTAGQKGTGKWTAVNALDLGQPV
                     TLIGEAVFSRCLSAIKPERTRASKILPGPEIPDGVVKDKKQFVDDLEQALYASKIISY
                     AQGFMLIREAGKEYGWKLNNPAIALMWRGGCIIRSAFLGEITKAYRQDPDLENLLFHD
                     FFTQAVTKAQGGWRRILGISTTYGVPTPALATALAFYDGYRSARLPANLLQAQRDYFG
                     AHTFQVLPECANADFPAGQDIHFNWTGHGGNISSSSYQA"
     gene            complement(<688448..>689122)
                     /locus_tag="ZYRO0D07898g"
                     /db_xref="GeneID:8204032"
     mRNA            complement(<688448..>689122)
                     /locus_tag="ZYRO0D07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496732.1"
                     /db_xref="GeneID:8204032"
     CDS             complement(688448..689122)
                     /locus_tag="ZYRO0D07898g"
                     /note="highly similar to uniprot|P38869 Saccharomyces
                     cerevisiae YHR181W SVP26 Component of Sed5p vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496777.1"
                     /db_xref="GeneID:8204032"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:C5DVM5"
                     /translation="MLLQVLSVVGTVLGFVFLTLSIASGLYYISEIVEEHTQATKRFL
                     TRAIYAIIVLHLLLVLLDGFPIKKSLFAIASYFIYLQNLKTFPFISLTDPIFLLSAAC
                     VLLNHYFWFQFFNESSHIPPQFRFDPNYIPPRRASFAEVASFFGICVWFVPFALFVSL
                     SAGDYVLPTTKQDHRKDDSETNGQPRFRRRAVGLVRVVINNIRDTFKDLIGSNSRSRD
                     SHILGA"
     gene            complement(689291..689362)
                     /locus_tag="ZYRO0D07920r"
                     /db_xref="GeneID:8204033"
     tRNA            complement(689291..689362)
                     /locus_tag="ZYRO0D07920r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (TGT) cove score=84.23"
                     /db_xref="GeneID:8204033"
     gene            <690941..>691933
                     /locus_tag="ZYRO0D07942g"
                     /db_xref="GeneID:8204034"
     mRNA            <690941..>691933
                     /locus_tag="ZYRO0D07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496733.1"
                     /db_xref="GeneID:8204034"
     CDS             690941..691933
                     /locus_tag="ZYRO0D07942g"
                     /note="highly similar to uniprot|P53731 Saccharomyces
                     cerevisiae YNR035C ARC35 Subunit of the ARP2/3 complex
                     which is required for the motility and integrity of
                     cortical actin patches required for cortical localization
                     of calmodulin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496778.1"
                     /db_xref="GeneID:8204034"
                     /db_xref="GOA:C5DVM6"
                     /db_xref="InterPro:IPR007188"
                     /db_xref="UniProtKB/TrEMBL:C5DVM6"
                     /translation="MLHLQPQNILIQKTLSEAFDALNKGTSLTLDRIISDFDYTTFHV
                     SNSPEDKSILLLSIRTKAWQSVQKCQGSIGLLDYLQSKYQGCSGAAISPQPEMGYDLT
                     LQITLSQLTGESLVQLSLLKTIVLSYPFQLAFDEFAQLSSTPVPVEGTPPVSNTLHTV
                     QYRDEESLFIKPASDRITVIFETSFQDETDKIFGKVFLQEFVDARKRNRSIQSAPQVL
                     FSHEPPLELQHQIQPRSDPSKRFVTFVLFPRHFQTQELQFNSVAQLILFRNYFHYHIK
                     CSKAYMHSRMRFRVDSFIKVLNRAKVDEEDDSKGDSSVHAQPTRRTITGRKMVY"
     gene            <692171..>694873
                     /locus_tag="ZYRO0D07964g"
                     /db_xref="GeneID:8204035"
     mRNA            <692171..>694873
                     /locus_tag="ZYRO0D07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496734.1"
                     /db_xref="GeneID:8204035"
     CDS             692171..694873
                     /locus_tag="ZYRO0D07964g"
                     /note="similar to uniprot|P25644 Saccharomyces cerevisiae
                     YCR077C PAT1 Topoisomerase II-associated
                     deadenylation-dependent mRNA-decapping factor also
                     required for faithful chromosome transmission maintenance
                     of rDNA locus stability and protection of mRNA 3'-UTRs
                     from trimming functionally linked to Pab1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496779.1"
                     /db_xref="GeneID:8204035"
                     /db_xref="InterPro:IPR019167"
                     /db_xref="UniProtKB/TrEMBL:C5DVM7"
                     /translation="MSFFGFDTSLPGAGKSKGENPIPEGEKPLDFEETYRGLGDYHEE
                     EEDYLNEETFGANAELGTDFDFGHGSGSTTSQDTSGIQGSVAPASYVTSNRSYLAAAR
                     QGDTQPLEPSVDLKPMESLWGGGAPQLQQQQPQPQKVAETLSMEELERQQRQRQQMAA
                     QQGFVVPPPGYVGPQSFMQQPSPPPQANMYPPSFAAGGLPPQFPMMYQQGQPPAYPPP
                     QEVQQQAAAAQAAQAAQAAQVQARAQAQAQAQAQAQAQAQAQAQVQAQAQAQAQTQAH
                     AAQAQAAQAQAAQAQAVQAQAVQAQAAQAPQFAQPLASPGEAVHAQIQVPGPGAAASP
                     RARFSSPQFGPQHLQRSRGPVRKDPLTAEEQKRLQIRQAKVERILKHSGLMTPRDKDF
                     ITRYQLSQIVTEDPYNEDFYFQVYKIIQYGGVVGESNKDLIARAYLEHSGHRLGGRYK
                     RADVALQRMQSQVEKAVTVAKERPQKNKDHVDTSREGVLGKISSAMNSKAPRRQLQIP
                     APKSESADSAVLDDIASGTPGFSNGSTPALDDVTDSLENVEISQRSRARRRSSYAFSS
                     VDQSSVLSRSGGRKFVLSLIETVYGVVLELEEQLRSGKQIDNSALWDALHIGDESYDV
                     CPFISMLSFDKGIKIMPRIFNFLDKSQKLKLLQTFFDELSHLNIIIISSYKTNDSPTE
                     SQLRKIDLFQSIFLKIIVSFLSNSADFIEIMGLLLYLIKNNNVSFISTSKIGLNLITV
                     LISRAALIKQDINRSNVLSSPEISAWNGVYDKLFTSLETKLSLVFPPKEYMDKVVCAG
                     SRPSTAVSSPSMNSTIQSYDQAYIWQFLASLALSGKLNHQRIIIDEVRDEIFGTINAA
                     EQLGSTEQDQNVSMYKREKLYQDLNLFLNVMGLVARDKEITELK"
     gene            <695006..>695788
                     /locus_tag="ZYRO0D07986g"
                     /db_xref="GeneID:8204036"
     mRNA            <695006..>695788
                     /locus_tag="ZYRO0D07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496735.1"
                     /db_xref="GeneID:8204036"
     CDS             695006..695788
                     /locus_tag="ZYRO0D07986g"
                     /note="some similarities with uniprot|P25659 Saccharomyces
                     cerevisiae YCR076C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496780.1"
                     /db_xref="GeneID:8204036"
                     /db_xref="InterPro:IPR013886"
                     /db_xref="UniProtKB/TrEMBL:C5DVM8"
                     /translation="MSANTKLALSVQLVAIYLQSLGVGSRITNCHEEPNLVRASLADE
                     QNKTLINIIGVGIEPTKAMLSLYQNEKSLGQAILDYEKDLLMDDVTFPINVEEFLESR
                     REQVLISIDSKYKLAPPSRQLPPQEISRQEPSEPVPVGMEIPPPPSVRGSRPPDMPDF
                     EDEYQVRQGPGYSRPQQPLPGYGDSDLYPMGRSNPLLADPLTAPPAGGMILDPAQDAA
                     RRKQMDDMKNRGPGFMPGTKWDDPFGRPGFGGPGAFGPGGFI"
     gene            complement(<695846..>696106)
                     /locus_tag="ZYRO0D08008g"
                     /db_xref="GeneID:8204037"
     mRNA            complement(<695846..>696106)
                     /locus_tag="ZYRO0D08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496736.1"
                     /db_xref="GeneID:8204037"
     CDS             complement(695846..696106)
                     /locus_tag="ZYRO0D08008g"
                     /note="similar to uniprot|Q3E830 Saccharomyces cerevisiae
                     YCR075W-A Identified by homology to Ashbya gossypii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496781.1"
                     /db_xref="GeneID:8204037"
                     /db_xref="InterPro:IPR021591"
                     /db_xref="UniProtKB/TrEMBL:C5DVM9"
                     /translation="MDTQQRQQRLQQSIPKALGTLSFDQNNRLVESTGIGKNRVEDII
                     DISQMELDDDGYGVTQDGEILVNVFKDAGRSVIIYTSASDDD"
     gene            <697122..>698885
                     /locus_tag="ZYRO0D08030g"
                     /db_xref="GeneID:8204038"
     mRNA            <697122..>698885
                     /locus_tag="ZYRO0D08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496737.1"
                     /db_xref="GeneID:8204038"
     CDS             697122..698885
                     /locus_tag="ZYRO0D08030g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496782.1"
                     /db_xref="GeneID:8204038"
                     /db_xref="GOA:C5DVN0"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="UniProtKB/TrEMBL:C5DVN0"
                     /translation="MWLITTFVLVFPIICSYVVVNRYFSFKLHKNTYLLTLSILMLNM
                     IILLFTTYLLPLDIFYGARASIENGSSSEAVTHNFSVIWKFIYWLEFVLCWFVIPVLI
                     SYISLKYACAKQQDPHSSRSQMGQRLALAIYHNIKFYMLCLTGLFFGIVYLVSSTGHG
                     LSDFKPLLISLAHLYSLSYSLVLLSTGLIIFPRNLFAEVSSPKSETVNRLFVELSKSN
                     DDLNDSQLNMLENAERILHSSEVQDDPSFNEMLNQCKIEVQSMLNDRKLSVSNFNAVS
                     TSGSTSISTLEKLNHHYNKFVTHFYNYLHNQTNSDGIIHTLAESQSLSSSSGRWRSIL
                     ITVVAIISTALSVLVAYLEITPNKWGHARVFDGTHWYNFGLEFVLFSYNTLVALYAMS
                     KFKFNNFHLIPNGRSNPSNALYYSLYSSRLLFPLCFNLMVLIPYGENASYDSMNSSFA
                     RTLYNSLIRIPLANYLNKTLPPIFMVFILISYKIDLKQKILLRTLGEEYYYQFFGMMM
                     YEPAGEVNQDAGNTSPTSLFFDNDGPLSQRSRMDEDYEYSLQDGRYLFERASRNSNSN
                     DNTTSNNENTNGDQERPLLYV"
     gene            complement(<698913..>700409)
                     /locus_tag="ZYRO0D08052g"
                     /db_xref="GeneID:8204039"
     mRNA            complement(<698913..>700409)
                     /locus_tag="ZYRO0D08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496738.1"
                     /db_xref="GeneID:8204039"
     CDS             complement(698913..700409)
                     /locus_tag="ZYRO0D08052g"
                     /note="some similarities with uniprot|P40530 Saccharomyces
                     cerevisiae YIL042C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496783.1"
                     /db_xref="GeneID:8204039"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:C5DVN1"
                     /translation="MTKIKFNSGLLKQIWNYSELPQTGISLRQMCQFGANPNPATLFK
                     ASCFVLRELPIRLAHRIKELESLPNGLNKMNDVIQVRDWYTQSFKELYEFAHDRSTSN
                     GKLYQMLYGGLEPDTPMESEVLRNIIQLCYRDEELDSKHGRSNTSVPHRNTFVDDGLV
                     VTKRKWSVSNQSLSSSRGQVLTPKKYYSSPLVTSLEVWPKEILKFNAALFKVLHNIKV
                     RHNATVVTLAKGVLKWKKTCQQNMFDDSVQSFLDRFYMSRIGIRMLIAQHLDLLEPSL
                     HCQNGKSDSYVGSICTKTNITQIAEDAIDNAKLICSEHYGLFEAPEVELLCFPKNATG
                     LNNEIEFMYVPGHLIHMLVETLKNALRATVEKTVESNPGMDVYDLKFPHVKVIICEGL
                     EDITVKISDEGGGIARSNLPLIWTYLYSTMPDDCQLELMKDECDENPRVSSFVNNVPL
                     AGYGYGLALSRLYARYFGGDLKLISMEGFGTDVYLHLNRLSTSSEPLQ"
     gene            <700649..>701449
                     /locus_tag="ZYRO0D08074g"
                     /db_xref="GeneID:8204040"
     mRNA            <700649..>701449
                     /locus_tag="ZYRO0D08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496739.1"
                     /db_xref="GeneID:8204040"
     CDS             700649..701449
                     /locus_tag="ZYRO0D08074g"
                     /note="similar to uniprot|P17261 Saccharomyces cerevisiae
                     YCR075C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496784.1"
                     /db_xref="GeneID:8204040"
                     /db_xref="InterPro:IPR005282"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C5DVN2"
                     /translation="MSFKWGVSEVLGLTYVCCWSVSMYPPLWTNWKRKSASALSVDFV
                     MLNTTGYFYLVISLILQLYRWLPPPQGQELTQEAIALKPKITNFDLCYCLHGFLLNLV
                     LASQLVMGQSMWGFKKERSIRMKPIYSKILFLSLLIFSGLTLHFVNYNATVGWDNLRT
                     LAYCNRLFMLKISMSLLKYVPQVIHNHERRSMKGFAIQGTMLDITGGMASLMQLIWQI
                     ANDKSFNTSVFMANFGKIGLAIVTIVFNFIFLSQWTVYGDGSVVTIKD"
     gene            complement(<701552..>702469)
                     /locus_tag="ZYRO0D08096g"
                     /db_xref="GeneID:8204041"
     mRNA            complement(<701552..>702469)
                     /locus_tag="ZYRO0D08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496740.1"
                     /db_xref="GeneID:8204041"
     CDS             complement(701552..702469)
                     /locus_tag="ZYRO0D08096g"
                     /note="similar to uniprot|P50278 Saccharomyces cerevisiae
                     YNR034W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496785.1"
                     /db_xref="GeneID:8204041"
                     /db_xref="GOA:C5DVN3"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:C5DVN3"
                     /translation="MTTTVPAVFAFHEFAGVAEAVADHVVHAQNHALAKGTKDRKLSF
                     GNSLNGEKDVSRVSSTRSIINVPKDKKSKKEKEVRFKIALSGGSLIQVLHEGLLKRDD
                     VQWGKWDIYFADERLVPFESGESNFGQAKRKIFDLIDVEKYGKPNVFHVNEKLISDPQ
                     ECADNYEKVLIKGFAGRDSVKLPMFDLLLLGCAPDGHIASLFPNFQENLREKLAWVVP
                     VENAPSGPSNRISLTIPVICHSHRVTFVVEGATKAPVVKTIMERPEKGLPSSIVNEGA
                     AGRVSWFVDDDALTDVFVTKKKYKFCCDS"
     gene            complement(<702839..>705076)
                     /locus_tag="ZYRO0D08118g"
                     /db_xref="GeneID:8204042"
     mRNA            complement(<702839..>705076)
                     /locus_tag="ZYRO0D08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496741.1"
                     /db_xref="GeneID:8204042"
     CDS             complement(702839..705076)
                     /locus_tag="ZYRO0D08118g"
                     /note="similar to uniprot|P37254 Saccharomyces cerevisiae
                     YNR033W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496786.1"
                     /db_xref="GeneID:8204042"
                     /db_xref="GOA:C5DVN4"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR010117"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DVN4"
                     /translation="MTLSQGSAPFNVLFIDSYDSFSYNVVRLVEQQSHKGGYGEVRVT
                     TIHNDTFAHVSELKKFLPHFDCLVLGPGPGSPVNGVEDVGLLASLFQDDCLSQIPILG
                     ICLGFQAMCLSQGAQVNELRTIKHGQVYDMELANESKLFKGYPFRFKSTRYHSLHVEP
                     SLGLIPLVHTTDENGELLMAAQVVDKPWFGVQYHPESCCSELGGLLISNFLHLAQEHN
                     EHSGRFDYKKSIYDVNIYDELDKTIDKTPIYENRVDLPTKHISITEYNVCKSPLLTLC
                     ICDSVEDRKFVMASSSQDLHRGRWSIICFPNENSDVLTHYATLNRTTAYKWRDQNVSW
                     KDVNYALENNSRHPCVFSQDKDQFWQTLGQFTSSRLINARPDLPFIGGLVGTLGYEMG
                     DVVPSVQSHHPDAKLVYIENSIVIDHFSGKMYTISLSKEFPAHITQIIDQLPLSDPQL
                     QWPSELPPMKFDIDVSSDESYQSAFDACQDYMHRGDSYEICLTRQTQVTPHGPLTPWR
                     IFQTLVSRNPAPFASFFEFQDLVDLPQDRTLCLLSTSPERFLKWDHDTCELRPIKGTV
                     KKSDEMNLQMATEILKTPKEFGENLMILDLIRNDLYELLPDVHVEEFMSVEEYQTVYQ
                     MVSVVQAHNLSKSIYSGLDVLKHSLPPGSMTGAPKKITVQLLHELEERKRRGVYSGVT
                     GYLSMNNRADWSVNIRCLYSYNGGLRWMCGAGGAITVLSQGESELAELNTKLDSALQC
                     FTRSE"
     gene            <705216..>705437
                     /locus_tag="ZYRO0D08140g"
                     /db_xref="GeneID:8204043"
     mRNA            <705216..>705437
                     /locus_tag="ZYRO0D08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496742.1"
                     /db_xref="GeneID:8204043"
     CDS             705216..705437
                     /locus_tag="ZYRO0D08140g"
                     /note="similar to uniprot|Q6Q546 Saccharomyces cerevisiae
                     YNR032C-A HUB1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496787.1"
                     /db_xref="GeneID:8204043"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DVN5"
                     /translation="MIEVVVNDRLGKKIRVKCLEEDLVGDFKKILSVQIGTPASKIQL
                     VKGGSILKDHISLDDYEIHDNTFLELYYL"
     gene            complement(<705432..>706523)
                     /locus_tag="ZYRO0D08162g"
                     /db_xref="GeneID:8204044"
     mRNA            complement(<705432..>706523)
                     /locus_tag="ZYRO0D08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496743.1"
                     /db_xref="GeneID:8204044"
     CDS             complement(705432..706523)
                     /locus_tag="ZYRO0D08162g"
                     /note="highly similar to uniprot|P32838 Saccharomyces
                     cerevisiae YNR032W PPG1 Putative serine/threonine protein
                     phosphatase required for glycogen accumulation interacts
                     with Tap42p which binds to and regulates other protein
                     phosphatases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496788.1"
                     /db_xref="GeneID:8204044"
                     /db_xref="GOA:C5DVN6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DVN6"
                     /translation="MSMELDKCLENLYQGKLLPEAVVRALCFKLKEMLIRESNVVHIQ
                     TPVTVVGDIHGQFHDLLEIFQIGGPVPDTNYLFLGDYVDRGLYSVETIVLLVVLKLRY
                     PHRIHLLRGNHESRQITQSYGFYTECLNKYGENSKVWHYLTDFFDYLVLCCIIDDEIF
                     CVHGGLSPNVQTIDQIKIIDRFREIPHDGAMADLVWSDPEESNTENGNHREEFYRESS
                     QHFQVSPRGAGYTFGRCVVEKFLHTNSMSRIYRAHQLCNEGFQVYFNGLVTTVWSAPN
                     YCYRCGNKASILELYGKDDFYFNVFEEAPENKLLNENAQANVTNNKILNDYFDSGDEL
                     SENGSTDMDIFSDAYQAKSASSRRVEYFL"
     gene            <706856..>711601
                     /locus_tag="ZYRO0D08184g"
                     /db_xref="GeneID:8204045"
     mRNA            <706856..>711601
                     /locus_tag="ZYRO0D08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496744.1"
                     /db_xref="GeneID:8204045"
     CDS             706856..711601
                     /locus_tag="ZYRO0D08184g"
                     /note="similar to uniprot|P53599 Saccharomyces cerevisiae
                     YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
                     kinase kinase kinase activator of Pbs2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496789.1"
                     /db_xref="GeneID:8204045"
                     /db_xref="GOA:C5DVN7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017240"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DVN7"
                     /translation="MDESDYFNYTGPSQTSDEERRSHYGKRRPDRVRSSSTNSRVFSP
                     GKQQQQQQQQQHGQPSPSPSGIRSPNSTMHVGSSPLNTFVLPVRLQQQGSNTSQQQQQ
                     QQQQQQQQQFSPHELISPRSSRRPSLGGVVATGKHTGPPPSPNKYHKSDHFIKRHSNS
                     NSDVPVTTPTLVMPPELASLNTQNTSAVPTPQPSISQMPSQYNVSNSSSTNVTTPATM
                     TNFSQDTISPSSSTKSSMNVANTSSLSLRAFKKQYVLNEQLYLDKMRNSVPDDYYTRG
                     IAPASMNDDEFESEMDDMLDNNFNGDDELDFGTNFFTAGADKENLVAMSSKYLLHRLE
                     WLRQADPTNPTVEHVFKSLDEKTTSEKDFSLTSFANLSMGTQNLLSQLSDHSLVLERF
                     EWQTMLSNVLKGDIVKSEKSKIANQVERTGMSTQYSGDLWLELKAWMNGKPVPDTKKQ
                     LEVLRTSADSVFREIMEFKLKEDSTPEEAEQVIRPLLNRYYKVTNYWVNLKQMYQSKP
                     ITKTVEFVNRVDSMNCWLTFKQNFEILTKSLKNWVGDEELDMTNIHESSDELANNELF
                     AERIMKEKDIETIFQKKIFFPLAPWILEAKLAFFRYQKHMQEINVTFLSKDLEILLMF
                     PMRLVKEIILIRLAYAKKLKNPTMMMIDQMIEDFTSYIKLSVQLKYTVIVYCQDWPLN
                     VKIDPHFDDTVVEAIHYLFTLLHLKLLDCTKRSFKTFKEADELYKYWEKLKNVGHYID
                     GAGKVIAKEFNRLTLRLLHRLHSYLLQQQNCPPKFDSSSEAEKWLIQLFENLGSMKRK
                     LNRFTNFLTKAFQNSVSYKVENHRLLLKRLKETGHFLIYTGGELEQNGIYLVGSAELL
                     GCSDEDIFKIIYNSEIGCDMIPKLDIRNSLSLYNAVEKGCDPNIMIVQEMDSHGVSYY
                     HILNEFTEAQARFSGRTRAGTNPDLFAEDYQDTQNEMIDLELKLHSLGYVLVLCPGEP
                     MLWEGDMYNLSDGSGIKADDFKNKLSSNTLLLMNQGSSYALEYQCDRFQQVADDSVLF
                     IERRCSFDSVESSLQRINKAYFRFTYSVLSNYSKIINTFRKLPSGIEMLNSVFFFSRD
                     FGRNFLRTNVTTYEKKSVIILLMVKLSVGWLSFLVEDCDPTDQRTFRWCVPAMEFAMQ
                     MTSGWNVLGLDEKQFASLKHNISACMALLISHFDVMGARAGEAEKFLQQARPNIDIQD
                     EMDDNSMLQINSVLRMQAIGNLEKNTKRNPHQIGRVLDDTDKGNKYLLSLASSISNVS
                     MRWQKRSFIGGGTFGSVYSAVNLDNGEILAVKEIKIQDAKTMRKIFPSIKEEMSVLEM
                     LNHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLEHGRIEDEMVTQVYTLELLEGLA
                     YLHQSGVVHRDIKPENILLDFNGIIKYVDFGAARKIARNGTTSLGLNKTSTGEGNNSS
                     TGKESPSIPEGPALHDMIGTPMYMSPESITGSSNKGKFGADDVWSIGCVVLEMITGRR
                     PWAKLDNEWAIMYHVAAGHTPQLPYKEEVSAAGRQFLRRCLVQNAAKRATAVELLLDP
                     WMVQIRELAFGTGEQQESTVVESAPPISE"
     gene            <711937..>713484
                     /locus_tag="ZYRO0D08206g"
                     /db_xref="GeneID:8204046"
     mRNA            <711937..>713484
                     /locus_tag="ZYRO0D08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496745.1"
                     /db_xref="GeneID:8204046"
     CDS             711937..713484
                     /locus_tag="ZYRO0D08206g"
                     /note="highly similar to uniprot|P25382 Saccharomyces
                     cerevisiae YCR072C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496790.1"
                     /db_xref="GeneID:8204046"
                     /db_xref="GOA:C5DVN8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DVN8"
                     /translation="MATVIPPPSKKQRKEAQKTREVDITPSDLPHVSIKFEALDTGEN
                     VGGSLRVPGGISEGQLEQLLNQLQGSAEDPVPYTFSCSVPGKNKEDPPQNVDITDNLW
                     SSLLKPGYKTPEDQITLVFTPRAVFKVRPITRSSAAIAGHGSTILCSAFAPDTSSRMV
                     TGAGDNTARIWDCATQTPLSVLKGHSNWVLCVAWSPDGELIATGSMDNTIRLWESKAG
                     KPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLYTLSG
                     HTNSVSCVKWGGQGLLYTGSHDKTIRVWDIKAGGKCINILKSHAHWVNHLSLSTDYAI
                     RVGPFGPDGKASPSPQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSA
                     KPLARMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQV
                     AWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGQRVCSGGKDK
                     MVRLWTH"
     gene            <713859..>714314
                     /locus_tag="ZYRO0D08228g"
                     /db_xref="GeneID:8204047"
     mRNA            <713859..>714314
                     /locus_tag="ZYRO0D08228g"
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /transcript_id="XM_002496746.1"
                     /db_xref="GeneID:8204047"
     CDS             713859..714314
                     /locus_tag="ZYRO0D08228g"
                     /note="similar to uniprot|P25642 Saccharomyces cerevisiae
                     YCR071C IMG2 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /protein_id="XP_002496791.1"
                     /db_xref="GeneID:8204047"
                     /db_xref="GOA:C5DVN9"
                     /db_xref="InterPro:IPR007740"
                     /db_xref="UniProtKB/TrEMBL:C5DVN9"
                     /translation="MLRLLRLKQLNKPLLRQTIRLQSTVETPKTFNCNEEAELEYQPG
                     FAFSVFPRIQDVHTNDLVGSDSFGKDKYYVERSATGNLPVYIDVKNGGNVFTELRKIH
                     GNVMKLRNDLQEQLPHIPKQNWKCVVQSNKIVIKGDFSQEVKRVLQTTF"
     gene            complement(<714386..>716083)
                     /locus_tag="ZYRO0D08250g"
                     /db_xref="GeneID:8204048"
     mRNA            complement(<714386..>716083)
                     /locus_tag="ZYRO0D08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496747.1"
                     /db_xref="GeneID:8204048"
     CDS             complement(714386..716083)
                     /locus_tag="ZYRO0D08250g"
                     /note="similar to uniprot|P53730 Saccharomyces cerevisiae
                     YNR030W ECM39 Alpha-1 6-mannosyltransferase localized to
                     the ER responsible for the addition of the alpha-1 6
                     mannose to dolichol-linked Man7GlcNAc2 acts in the
                     dolichol pathway for N-glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496792.1"
                     /db_xref="GeneID:8204048"
                     /db_xref="GOA:C5DVP0"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:C5DVP0"
                     /translation="MGWSYLDYGVILLISIYLRKAPFTKVEESFSIQAVHDILNYGIL
                     DISRYDHLQFPGVVPRSFIGPLIIAALTKPFTYASSIFSANSPTQFEWQLLTRAIIGL
                     TNWLGLMYLKNCGEHALETQRLEEQEEDKKNKEEGRPVAIRRPDVNLISMGSWFTVNV
                     LSQFHLIFYSSRPLPNFVLTLPLTNVALGWVLLGNYKQSVFLLAFTAIIFRLEVAALC
                     AGVALLSIFYKKLNWFNAIKFGLMGGIIGMGLTLTVDSYFWRDWCIPEVDAFIFNVIR
                     GKSAEWGIESPAGYFTHYLRTMFVPPTILLMGVIGFRNAPKNIRIVSLAAFFHIFVLS
                     FQPHKEWRFIIYSIPPIILLGSTAAAYIWENLTVKKAFHALIIAVVGISPLISLATSF
                     AFLHVSSMNYPGGQALTDFNEMIIANNITNVTVHMNVPVCMTGVTRFGELDFDKYGII
                     YDKTEDLNELKEKWNTFDYLIDQEGTAASIPFEKHPEKNWEQVSSAQIFIGLDPSVFN
                     GVLKENETPFDFIYRLIKANVNLFSFFSDLIDSAFLRDDIFYTYRRISHDEDHAESQ"
     gene            <716261..>717493
                     /locus_tag="ZYRO0D08272g"
                     /db_xref="GeneID:8204049"
     mRNA            <716261..>717493
                     /locus_tag="ZYRO0D08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496748.1"
                     /db_xref="GeneID:8204049"
     CDS             716261..717493
                     /locus_tag="ZYRO0D08272g"
                     /note="similar to uniprot|P53729 Saccharomyces cerevisiae
                     YNR029C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496793.1"
                     /db_xref="GeneID:8204049"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVP1"
                     /translation="MSALKDYKYNEEEDGELPSLVTGTESDLNDILNHVKSDGGINIV
                     SEDKIARTNLQNSNSDNSTTSSRKIPVSIITGYLGSGKSTLLEKLAQKGSDKKIAVIL
                     NEFGDSSEIEKAMTIRNGENSYQEWLDLGNGCLCCSLKNVGVKAIEDMIQRSPGKIDY
                     ILLETSGIADPAPIAKMFWQDEGLNSNVYIDGIITVLDCEHIVKCLDDVSEQTHWHGD
                     QVVLEDKLTIAHLQIAMADRLIMNKLDRIENDENKIMKLEQRIRSINSEVPMFYTKFA
                     DIGIDKLLDLHAFDARNVPQEGGSGSTFHDPRMSTVTLNFRPLKTQEYDKFEKEFLQV
                     LLWKEMGVCNDNIQGEVHRTKGLLLVDDKVRVLQGVRDTYEVFDGEETSSRTCRIVFI
                     GKSLDQKSIADLLHNVIK"
     gene            complement(<717522..>718469)
                     /locus_tag="ZYRO0D08294g"
                     /db_xref="GeneID:8204050"
     mRNA            complement(<717522..>718469)
                     /locus_tag="ZYRO0D08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496749.1"
                     /db_xref="GeneID:8204050"
     CDS             complement(717522..718469)
                     /locus_tag="ZYRO0D08294g"
                     /note="similar to uniprot|P25334 Saccharomyces cerevisiae
                     YCR069W CPR4 Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin) catalyzes the cis-trans isomerization of
                     peptide bonds N-terminal to proline residues has a
                     potential role in the secretory pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496794.1"
                     /db_xref="GeneID:8204050"
                     /db_xref="GOA:C5DVP2"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DVP2"
                     /translation="MIAGIFFLWIWASMALGRAVPPVLADLSKPKLDQIDRSKVYEPN
                     PPATNSVLMVLEYFDEDQGKPVEHEMTMELYGTVAPKTTRNFQSLARGVKIRYDGQSE
                     EQFQQVSYKDTLFHHVEPGKLIQGGDILEDHIPFSIYGNSWPAENFDLKHDRPGRLCM
                     ANNGPEDQNSQFFITTGMQGEPDFDGKYVVFGQVVAGLDKLIQKIQYTPLGVGGKPIH
                     NVKLKYVLAYDLAIMDNVAQHNAYLKKLEDYRNGDVSKGVTMGLTLAEGEKEEKQLND
                     IMFNDLHHPLTKVLIGVFVLLLVYLVVRHKRVPKALRRV"
     gene            <719929..>721971
                     /locus_tag="ZYRO0D08316g"
                     /db_xref="GeneID:8204051"
     mRNA            <719929..>721971
                     /locus_tag="ZYRO0D08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496750.1"
                     /db_xref="GeneID:8204051"
     CDS             719929..721971
                     /locus_tag="ZYRO0D08316g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496795.1"
                     /db_xref="GeneID:8204051"
                     /db_xref="GOA:C5DVP3"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DVP3"
                     /translation="MPPSDDISKSKYGTGVHKPRKKEFKGKRAVRACDTCRRLKTRCI
                     LSPIPNEFYCLRCESLKIHCSFQDMFGRPESKADEPEGSDPETLKMLIKHGYGTKDAE
                     ITSKLLHTINNNVHRVLQLLEGSSNDKSVSAPPAASASVPHSLPKVNLDVLDSNRIIT
                     PNTRSMEDVSPDLSSSLQSTERRHVLPYLSSPYVLLSQMVSKENLPIPVRKIYDNVGR
                     PPAVDDLVTIKLITLSEALILVDAFRQHYGAWCSFPADQPIEELVENIRSKDGSLLLT
                     TTCVLALRYTDRYHDLKTRVYKNLLYKLKSDLELSLKFMPQTTEFLQAIVILSLYASS
                     FSSDIMSLDAWYLSGIGLQQYITRNIQASLQTALGQGNSFEDESSEIREFTSLRIWNH
                     LCLVHLTHCVFSGRMCVVDEIRLDLCRRVLQLPKATNFDGRMVGEIALELILYNFMQQ
                     CQSAGSTVPGDPTNNLEDVKEDLKDWLEEWNYLFTQPITQFLKFAYHYGYSMIIYSWY
                     HRLYYMVAEEVVIPQGKIDYLQADDKTLIGSCLNEFYPVGRIIDSMPPESQLEMLVHS
                     HRALQEVVRTEFDIFKYLSDQIFFCTVLSSLVCIEISDSLHKTSKDLLNDDKVSEILM
                     DIKIFSLRLQKIREGELRSFWVEEVDLKIPSVILQYHKAIENCLHSKFPNFENPTL"
     gene            complement(<722090..>723622)
                     /locus_tag="ZYRO0D08338g"
                     /db_xref="GeneID:8204052"
     mRNA            complement(<722090..>723622)
                     /locus_tag="ZYRO0D08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496751.1"
                     /db_xref="GeneID:8204052"
     CDS             complement(722090..723622)
                     /locus_tag="ZYRO0D08338g"
                     /note="similar to uniprot|P25641 Saccharomyces cerevisiae
                     YCR068W ATG15 Lipase required for intravacuolar lysis of
                     autophagic bodies located in the endoplasmic reticulum
                     membrane and targeted to intravacuolar vesicles during
                     autophagy via the multivesicular body (MVB) pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496796.1"
                     /db_xref="GeneID:8204052"
                     /db_xref="GOA:C5DVP4"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DVP4"
                     /translation="MIRRHATAITSKGGRYWRLVVTLLIISTVALLVWKKSEPTNDIT
                     IDIDSEDPEDSTFQLASIYRHGVGQVKDAIQKLEVTDEFVIKAGDHYNNEVATNAIDD
                     SVWTTNARYATDNPFGFKFKLKGQKVLMRRLKDRSPEFMEGYLDFALDSPLKASKVSL
                     DWVDEVVEAPNVTDKDTILSLALMSSNAYVRLPHTGDWRNVSLPWNESDPDSYGWDGD
                     GLRGHIFYNEKENVVVLAIKGTSSQGLPGSGEEDTIPNDKINDNLLFSCCCARISYLW
                     TTVCDCYTKSYTCDESCLEKEFRRKDRYYAATMEIYKDVLNNYPDATIWITGHSLGGA
                     LASLLARTYGWPAVGFEAPGELLAAKRLHLPFPPGLPIYEEAVWNIGHTADPIFMGTC
                     NGASSSCSIAGYAMETACHTGKICIYDSVTDLGWRVSMLNHRIHTVIDGVLTEYDQVA
                     HCKQPEPCIDCFNWKYIRDRNAPTTTSTSSTSSKVPTSTSTSSSCVGRNWFGICTSYG
                     LS"
     gene            complement(<723755..>724702)
                     /locus_tag="ZYRO0D08360g"
                     /db_xref="GeneID:8204053"
     mRNA            complement(<723755..>724702)
                     /locus_tag="ZYRO0D08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496752.1"
                     /db_xref="GeneID:8204053"
     CDS             complement(723755..724702)
                     /locus_tag="ZYRO0D08360g"
                     /note="similar to uniprot|P53727 Saccharomyces cerevisiae
                     YNR027W BUD17 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496797.1"
                     /db_xref="GeneID:8204053"
                     /db_xref="GOA:C5DVP5"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DVP5"
                     /translation="MVFNRDAMTRISTRKVLSIQSHVVHGYVGNKAATFPLQYQGWDV
                     DALNTVQFSNHPGYGHFTGFRYDAGHLCEILEQGLAKSLEIQYDAVLMGYLPGVESLR
                     KIGEAVGEMSARDPDLKWVLDPVLGDNGKLYVSGENVDAYKQILRHNKIHLVTPNQFE
                     METLTGVKIQDLESLKSSIEQFQKLYPRVNKIVVTSLELKNGYICACCDGGKIQYASV
                     PRINAHFSGTGDLFSALLLNALVPPAGQTPPTLAQALLLVISLVDLILRRTLELSLSK
                     DDVLPVTINDLKLIQCRDLLVGKHQNKELDAQIRLVDLN"
     gene            <724961..>728035
                     /locus_tag="ZYRO0D08382g"
                     /db_xref="GeneID:8204054"
     mRNA            <724961..>728035
                     /locus_tag="ZYRO0D08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496753.1"
                     /db_xref="GeneID:8204054"
     CDS             724961..728035
                     /locus_tag="ZYRO0D08382g"
                     /note="similar to uniprot|P11655 Saccharomyces cerevisiae
                     YNR026C SEC12 Guanine nucleotide exchange factor (GEF)
                     glycosylated integral membrane protein of the endoplasmic
                     reticulum important for the initiation of transport
                     vesicle budding from the endoplasmic reticulum through
                     activation of the GTPase Sar1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496798.1"
                     /db_xref="GeneID:8204054"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DVP6"
                     /translation="MKFVTANCSIGYPVYGAKFLNNRMLLVAGGGGEGNNGIPNKLTV
                     LRVDFAKKKVIKRFREITLDPNDDSPTTLDVANDTILMGCNENSEKIKKGEGNHHLRK
                     FLFENEHLKFVAGIDFDRSNQPEDYTKLIYLSRDGSVGAVASSAIPTVIRIIDPKELT
                     EKYEIETGHEVKDMHFAPDGKVISYITASTLEVISIVTGRFIIRKTDFDSNYSLSKIK
                     FLTDDVVLIAAALKKGPGIVMIKISLRSGSATVLKTKFITNKFKGVTAMDVDHKNELA
                     VLAGSDNSLAIVKLKDLSLGRTFKQVHSFAITRVSFSSDSGLIASVSAANTVHVIKVP
                     ENFAQSTSIWSKLLKLLLNFVFIALLAFLAQISLKYDLHNRLSKFVKDWYEERRNRAI
                     VKREDSEQVTLVGAVSSEVPSSVVPTYSISSETISNVVEPTISFSSGLISEEKATTAN
                     DVTTKSSVASVPLITSLQSSSDQISPSAESTTKESSDSSTSTTSTTSSSASTSTPVEQ
                     NVASDSTISESESSAPTTSASATTTDTLAGISEQTAVSSLSHHGATPKSGDFDTVAEP
                     VNKETIDEAVVLETSTKPADSVETTSAIGTTPESAGGHSMTSETLEEPSSSSQETYAS
                     STTTTAVPLTNSVVPSSKSTTSSVETTTSESLTSFQTPTDLTSESALTASSEITTVPS
                     SHTHEQHDKSTSLAAAEIDSTSEAKLDTSLAQTPSSSSKEVSATGSISPDDVTLEIAA
                     ETPSSSDSSSVSSKTVSTTPSSEASSVVSESSASTPEVSETSSSTFTTSIASSNTASN
                     IPSSSITTTVTEDVSAASTTTPTAAAASVSETLTTETTSSVISSASDHSLDSSSKVSP
                     PSETTTTSAAVTKESEPTSSDSTIVFTEEATTSIPPPVNLASDTESSSEGSDATSLSS
                     SISRDQAKATPTSNQISDSIHSEEIVPEYGEHLQTGSKPLHTHQETAATTEGVDSVSS
                     SVSFSQTTKKTDDFSTTSTPKVDEPTQDVDVSAKDEKDVAQEDFVEEVELNE"
     gene            complement(<728281..>729510)
                     /locus_tag="ZYRO0D08404g"
                     /db_xref="GeneID:8204055"
     mRNA            complement(<728281..>729510)
                     /locus_tag="ZYRO0D08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496754.1"
                     /db_xref="GeneID:8204055"
     CDS             complement(728281..729510)
                     /locus_tag="ZYRO0D08404g"
                     /note="similar to uniprot|P10862 Saccharomyces cerevisiae
                     YCR066W RAD18 Protein involved in postreplication repair
                     binds single-stranded DNA and has single-stranded DNA
                     dependent ATPase activity forms heterodimer with Rad6p
                     contains RING-finger motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496799.1"
                     /db_xref="GeneID:8204055"
                     /db_xref="GOA:C5DVP7"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004580"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:C5DVP7"
                     /translation="MNYNVSDATDFSHTSIPQLSQLDTLVRCHICKDLLKIPVLTPCS
                     HTFCSLCIREYLTREPKCPLCLSELRESNLRSEFLVNEIIESYRSVRDELLESLKEDQ
                     RNNAEKSLIELTDDDNDDDLQIVGTNQKEEVKRDKNEKSVGKVTKPSTSTGLNSLLNS
                     QRDKSKTKEKLAQCPICSNFYPIQALERTHLDECLTMQSLDESTDVKKRTPTPPSPRI
                     KSPKSSSKPKRAVNAKDDISHVDKYLSSFNTGQRRERLPKINFTSMSLSQIKQKLASL
                     SLPTHGSRQNMIARYNHYEVLWNSNFCDAIEPVDESELRRQLASWEASHNPSNGNNGT
                     NIISKMMRRANQGNSYQKLLADFKTDNFQRKSWILMFRKDFKNLIQEAKRSIPRESKT
                     TGSVDNQIAVPENTEKE"
     gene            complement(<729931..>731631)
                     /locus_tag="ZYRO0D08426g"
                     /db_xref="GeneID:8204056"
     mRNA            complement(<729931..>731631)
                     /locus_tag="ZYRO0D08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496755.1"
                     /db_xref="GeneID:8204056"
     CDS             complement(729931..731631)
                     /locus_tag="ZYRO0D08426g"
                     /note="some similarities with uniprot|P25364 Saccharomyces
                     cerevisiae YCR065W HCM1 Forkhead transcription factor
                     involved in cell cycle specific transcription of SPC110
                     encoding a spindle pole body (SPB) calmodulin binding
                     protein dosage-dependent suppressor of calmodulin mutants
                     with specific defects in SPB assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496800.1"
                     /db_xref="GeneID:8204056"
                     /db_xref="GOA:C5DVP8"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:C5DVP8"
                     /translation="MSSGKLCDNDLNQYNNCLMALEDGPPLLEGASKRSFLDMTTSGG
                     KEMITPPNSTIRKSGPQDLSLNGLRPPLSPALSSPIASRPKKQRSEGNSGSSGSSGSL
                     RSNGNFTLQELLESLEKRRDNGELTKKPPYSYATLIGLAILQSALGKLTLSQIYNWIS
                     VHFPYYKQKDAGWQNSIRHNLSLNDAFIKTEKSNDGKGHFWQVKPGCETKFFKGETGS
                     YEDVRSKLRDLDRFFDNPEEEDVEETEGPTSGLAAPAFQQPRRLHISADEEEEEEEEE
                     EEEEEEEEEEEDDDDDDDEDGDEDDEHRAVDGPHIGNDESYNNSIFHIHSSPGAAPLH
                     LKDLHTRDSFPDDNDEGANNEFGNVKRYPDTIFSPQDFKKYSCSFNSSFEETSPRPTR
                     VDEPLFDSNDFAIDEEHQLRQSPLENVSQMDLLKTPKASSGPNYERTPMRFITSPRDG
                     SASMKRWQTPSHLFEDLYCSPLFKSVCTPMKEGLPGVSPRNVSAPDIMSSNRRTKISS
                     SGLFGVDVYAVWKRATESTMSRNNDNGNNQKLGIPFKSTPSRERDGNMGDTTDGDKER
                     "
     gene            complement(<731953..>732390)
                     /locus_tag="ZYRO0D08448g"
                     /db_xref="GeneID:8204057"
     mRNA            complement(<731953..>732390)
                     /locus_tag="ZYRO0D08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496756.1"
                     /db_xref="GeneID:8204057"
     CDS             complement(731953..732390)
                     /locus_tag="ZYRO0D08448g"
                     /note="similar to uniprot|P25337 Saccharomyces cerevisiae
                     YCR063W BUD31 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496801.1"
                     /db_xref="GeneID:8204057"
                     /db_xref="GOA:C5DVP9"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="UniProtKB/TrEMBL:C5DVP9"
                     /translation="MPTAPPPGFEKIKPALDEFESQLRQIHHAKTSRIAAKKDENPWE
                     ILRISNERSRYIFNLFYKRKAISRDLYEWLLKNRLADRQLIAKWKKKGYEKLCCLKCI
                     QRKETNHGNVCICRIPRAQLLEKDRNTFHQCNNCGCHGCSSTD"
     gene            complement(732822..732920)
                     /locus_tag="ZYRO0D08470r"
                     /db_xref="GeneID:8204058"
     tRNA            complement(join(732822..732866,732884..732920))
                     /locus_tag="ZYRO0D08470r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (CGA) cove"
                     /db_xref="GeneID:8204058"
     gene            complement(<733481..>735235)
                     /locus_tag="ZYRO0D08492g"
                     /db_xref="GeneID:8204059"
     mRNA            complement(<733481..>735235)
                     /locus_tag="ZYRO0D08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496757.1"
                     /db_xref="GeneID:8204059"
     CDS             complement(733481..735235)
                     /locus_tag="ZYRO0D08492g"
                     /note="similar to gnl|GLV|CAGL0K09218g Candida glabrata
                     CAGL0K09218g and some similarites with YCR061W
                     uniprot|P25639 Saccharomyces cerevisiae YCR061W Protein of
                     unknown function green fluorescent protein (GFP)-fusion
                     protein localizes to the cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496802.1"
                     /db_xref="GeneID:8204059"
                     /db_xref="InterPro:IPR018825"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ0"
                     /translation="MSNSAKKIVWLVLLLAVGLAHAHEMEDMDMDMDESSPEPTNTTM
                     PLASVSPVPFEPKHPHGLPILQRPGLTAGEKLYWDQYNSTSYFNTDKGNRAALHYHVL
                     SLVSSIVFFYPICLVLHSIKSSWYLLALLVNLIVVLSSLFSLSVFASTFPEDWYPNNC
                     YSKTSWILFFTILVHFVSAVVTKASRWVVGSNALHDYNDGGFIPLQEMAPTPEDEPEE
                     EAEREETEDSLQRHKDEQALRNRRDNFLSRLLGGEFVQRVARNFGTPFEIIYRTLNYP
                     LFIYLMVDCGIGLAVGCLMGKGARIFNLLAHWIKGGVFFVLGLVSLARYCGVGKGHGW
                     AWNKIIVKRDPLRSRSSAWKRFFSPRGTITMEGIESFLIFFYGSTNVFLEHLAGAGGA
                     WTAKDLQHVSIAFMYIGTGLCGLLTECKLNQWKFEHVMQHSEGLDREEVEQASPGYSP
                     NPFPTFTIFWTGILMSQHAQASEASRLIHMQWGYLLSYGSFFRLLTFVFLFLVPNKDL
                     RPSLPFTELISSFCLMCGGLVFMESTDQVVEALEYRGFTPMFSFNISVGFVALLMGWE
                     MVLLFWRNWLEKRQSSQL"
     gene            <735838..>736566
                     /locus_tag="ZYRO0D08514g"
                     /db_xref="GeneID:8204060"
     mRNA            <735838..>736566
                     /locus_tag="ZYRO0D08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496758.1"
                     /db_xref="GeneID:8204060"
     CDS             735838..736566
                     /locus_tag="ZYRO0D08514g"
                     /note="similar to uniprot|P25637 Saccharomyces cerevisiae
                     YCR059C YIH1 piecemeal microautophagy of the nucleus
                     (PMN)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496803.1"
                     /db_xref="GeneID:8204060"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ1"
                     /translation="MSDEVLALEAIYPELVKRHVEDGSVLWLTVPEREHVSVQVSVSS
                     EYPSLAAPSLVDVKGADNDCRKQLESLLHRCWEDAGGEVCLYEFMAESTSVVPEKEED
                     DNDVREEVSVPLVNPFEGWKISEPVYDRGSTFVGYATSTEIEEEALERLDRLKCDSKI
                     RRGQHVMCAWRMKRQLNGREIVFQDCDDDGETASGGRMLNLLVAMGVWNVMVVVVRWF
                     NGTHIGPDRFRHINSVAREAVLQL"
     gene            complement(<736600..>736842)
                     /locus_tag="ZYRO0D08536g"
                     /db_xref="GeneID:8204061"
     mRNA            complement(<736600..>736842)
                     /locus_tag="ZYRO0D08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496759.1"
                     /db_xref="GeneID:8204061"
     CDS             complement(736600..736842)
                     /locus_tag="ZYRO0D08536g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496804.1"
                     /db_xref="GeneID:8204061"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ2"
                     /translation="MSESNGKLSSRVMNMKFMRQTFDQPVEPPKPVRDGSQWNKSNKR
                     KVVKIKKPQKKVVKSGVSISQLKGSPNAKREYSNDQ"
     gene            <736975..>739713
                     /locus_tag="ZYRO0D08558g"
                     /db_xref="GeneID:8204062"
     mRNA            <736975..>739713
                     /locus_tag="ZYRO0D08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496760.1"
                     /db_xref="GeneID:8204062"
     CDS             736975..739713
                     /locus_tag="ZYRO0D08558g"
                     /note="highly similar to uniprot|P25636 Saccharomyces
                     cerevisiae YCR057C PWP2 part of small (ribosomal) subunit
                     (SSU) processosome (contains U3 snoRNA) Eight WD-repeats
                     with homology with G protein beta subunits flanked by
                     nonhomologous N-terminal and C-terminal extensions
                     regulatory protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496805.1"
                     /db_xref="GeneID:8204062"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ3"
                     /translation="MKADFKFHNLLGTVYRQGDLVFTQDGSNLLSPVGNRVSVFDLVH
                     NKSFTLDYEHRKNIATMDLNRQGTLLISVDEDGRAILVNFKSRTVLHHFNFQDHCYKI
                     KFSPDGKWFAVAVGRFLQIWRTPSVTEDRQFAPFVRYRVHAGHFQDLLSLSWSYDGRF
                     ILTTSKDLTSRLWSVYSEDKELASTTFAGHRDYVMGAFFSNDQEKIYTLGKDGALFQW
                     EYTSKDEEEDPEEEPDLSKYRWRITNKHFCLNGRNKVKCVSFHAAANLLIIGFDNGEF
                     RIYELPHFTLLQQLSMGQNPVDTVTINSTGEWLAFGSRQLGQLLVYEWQSESYVLKQQ
                     GHFDSMNSLTYSPDGSRVVTASDDGKIKVWDVVSGFCIVTLEGHTSSVTGIQFAKRGQ
                     VLFTSSLDGTVRAWDLIRYRNFRVFTSVERIQFTCVAVDPSGEVVCAGSTDSFDIHVW
                     SVQTGQLVDQLAGHEGPVSCLSFSRETSTLASASWDRTIRVWSIFGRSQQVEPIEVFS
                     DVLAISTRPDGEQVACSTLHGQITIFDITAAKQVGNIDCRKDIISGRHLEDRFTAKNS
                     QRSKFFTTINYSFDGLAIVAGGNNNSICLYDVANEVLLRRFVVSKNMTLNGTLEFLNS
                     KRLTEAGSLDLIDDAGENSDLEDRIDNTLPGSNRGGDLSTRRVRPEVRVTSIQFSPTA
                     TAFAAASTEGLLVYSIDDTLVFDPFDLDVDVTPQTTLESLKKKSYLESLVMAFRLNED
                     YLIQRIYEAIPASQINLVSSSLPVVYVGRILKFIADYAMESQHIEFNLLWIKALLCSH
                     GSYINLHKQDFASAMRSIQRFLGRIAKDVVATSKTNTYAYRFLTSTQGKIDGEDDEQG
                     QDGGDASEEEDGLNGLDEDEKMTDHEDEEEWQGFEDKKKQLPLQDDGESDDEEDLI"
     gene            <739885..>741456
                     /locus_tag="ZYRO0D08580g"
                     /db_xref="GeneID:8204063"
     mRNA            <739885..>741456
                     /locus_tag="ZYRO0D08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496761.1"
                     /db_xref="GeneID:8204063"
     CDS             739885..741456
                     /locus_tag="ZYRO0D08580g"
                     /note="similar to uniprot|P25355 Saccharomyces cerevisiae
                     YCR054C CTR86 Essential protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496806.1"
                     /db_xref="GeneID:8204063"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019156"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ4"
                     /translation="MALEEVTVICEFEKVLNECPEGFEPYQLLLTQLDPIVRRSSQDE
                     EYRQCLANAEDIWQSLRRVLQNLKGTDNTQDIRSIYLRCLRGLFILMRNLSVSNQMIP
                     QQLRLHKVAVEAFVKAVMNSICHDEMEISLYVAATSFLYNITKTAVGLDKETFESLDP
                     FLKYPLNHLSQSEQILYPYMMFFLNLTYNDEFLYRLLRPKDQTDILYELLMRVTSVQD
                     HNDDQNYWAHLSNKDEIDSLDAILMKIFINIVTSESLGPYLQNARTSDHRKFSRISRI
                     SQLIVASRENWDKFQLTGIMSWCFTLMRQTAQETEQYFQQKIDEEDKAEPLHETLNIC
                     LDVISHLSANDHVQQYILSYQGLETLISLLRILQQNLIRINFYKGIDGSIKSIKATDS
                     KSDKIDDKQILSRRIDLTTNQIRASNFPGSKSFIIEILASLAHENAMVKDKVRELHGL
                     ELVLSNCVIDDNDPFIKERSIICIKFLLKENAANQDFVAQLEAQKSVPDETLADVGYE
                     VKIGTDGKIRLQSKN"
     gene            complement(<741538..>743079)
                     /locus_tag="ZYRO0D08602g"
                     /db_xref="GeneID:8204064"
     mRNA            complement(<741538..>743079)
                     /locus_tag="ZYRO0D08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496762.1"
                     /db_xref="GeneID:8204064"
     CDS             complement(741538..743079)
                     /locus_tag="ZYRO0D08602g"
                     /note="highly similar to uniprot|P16120 Saccharomyces
                     cerevisiae YCR053W THR4 threonine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496807.1"
                     /db_xref="GeneID:8204064"
                     /db_xref="GOA:C5DVQ5"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ5"
                     /translation="MVSPSQVYRSTRSSDKQTYSFEDVVIQGLASDGGLFVPPEIPQV
                     SQDVLFGKWAKLSFQDLQFEIMRLYIPQDEIPDADLKDLITRSYSTFRSSDVTPVAKN
                     ITGDKENLHVLELFHGPTYAFKDVALQFLGNLFEYFLERTNKDLPSEQRKKITVVGAT
                     SGDTGSASIYGLRGKKDVSVFILYPTGRISPLQEEQMTVVPDKNVQTLSVQGTFDKCQ
                     DIVKAIFGDKEFNSRHNVGAVNSINWARILSQMTYYFYAYFQATGGKAEKLKFVVPSG
                     NFGDMLAGYFAKKMGLPVEKLVIATNENDILDRFLKSGVYERSDEVASTHSPAMDILV
                     SSNFERLLWYLALEYLADGDSLKAGQIVNDWFQQLKTEGKFQVEKVIVEGALKDFASD
                     RVSNEETLATIKKVYEVSQNPQHYILDPHTAVGVTAAERLIAADKDNSIHYVSLSTAH
                     PAKFAEAVNQALSSFGTYSFERDVLPDELRKLSTMEKKIKLVDRADLKLIESIIDEES
                     AKMGL"
     gene            complement(<743306..>744898)
                     /locus_tag="ZYRO0D08624g"
                     /db_xref="GeneID:8204065"
     mRNA            complement(<743306..>744898)
                     /locus_tag="ZYRO0D08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496763.1"
                     /db_xref="GeneID:8204065"
     CDS             complement(743306..744898)
                     /locus_tag="ZYRO0D08624g"
                     /note="similar to uniprot|P53628 Saccharomyces cerevisiae
                     YNR023W SNF12 73 kDa subunit of the SWI/SNF transcription
                     activation complex homolog of Rsc6p subunit of the RSC
                     chromatin remodeling complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496808.1"
                     /db_xref="GeneID:8204065"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ6"
                     /translation="MSQLPNRIPVRNVKGGGPVPAGSNGVASENGKVPLTASKQTNPT
                     PTTQPTDTYIPNHLSDLVPELKSYEQLKESEKRVDVFLARKRIDLQQSVSQWNNSKSG
                     ITTSHNKNDVKYLRIFVSNIAENQPWQDENNDIQNASWTMRIEGRLLDTQEVQDPARP
                     KFSSFLQAIAVDFKKPRDDDDDEDENSKGEDGPKAEDQDVDMDGTRNDSLVGLSLPMQ
                     MPSNPNDNNVQEEKPKSDITDAVEWHFDPINPVDFDGLDIKRNGSENIECTLTIQLKG
                     VTGELLEYSPELAAVIGLSQGSLHEAVYSLYKYILINGLLTNDENNLRAPTSTSSDST
                     NGENTIVKLDPSLTKLIRQRPAPGSDEPLPTTLRLSEMLKLVNAHVSPIRSIKVDYTV
                     RVDKASTYGELVFDVEVPNFAQQSKEEDEVKREGLSLLSDFNKLTADLKPQLQELEAR
                     NAALLLQLNASAKKYQFFNELSKNPVGVLQEYIASSSNALKVLSGDEGFNEDTVRRSQ
                     FYKDNEQMLFESLGVLLSNGRM"
     gene            <745100..>745534
                     /locus_tag="ZYRO0D08646g"
                     /db_xref="GeneID:8204066"
     mRNA            <745100..>745534
                     /locus_tag="ZYRO0D08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496764.1"
                     /db_xref="GeneID:8204066"
     CDS             745100..745534
                     /locus_tag="ZYRO0D08646g"
                     /note="similar to uniprot|P53724 Saccharomyces cerevisiae
                     YNR022C MRPL50 Mitochondrial ribosomal protein of the
                     large subunit not essential for mitochondrial translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496809.1"
                     /db_xref="GeneID:8204066"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ7"
                     /translation="MFKPTSICLSALSKRTKRVKVQILKDFPQFLLYRGEVAQVKPSL
                     MRNYLHNYNGARYILQDNDIDLELMKSFEQRQEELRSAKSESKTKEDAVHTADTTPDK
                     SSTQSPAQTTAPQSQQQEPEKPKGVLEKDITVKDIKIPGLDL"
     gene            complement(<745633..>746850)
                     /locus_tag="ZYRO0D08668g"
                     /db_xref="GeneID:8204067"
     mRNA            complement(<745633..>746850)
                     /locus_tag="ZYRO0D08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496765.1"
                     /db_xref="GeneID:8204067"
     CDS             complement(745633..746850)
                     /locus_tag="ZYRO0D08668g"
                     /note="similar to uniprot|P53723 Saccharomyces cerevisiae
                     YNR021W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496810.1"
                     /db_xref="GeneID:8204067"
                     /db_xref="InterPro:IPR012879"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ8"
                     /translation="MSGLLAPVLKLSELVNSFNDEYVSTPYEELKQMTILQRLSRYNW
                     TFEIGGILVIAIVFALYKLGLYYNTRMTDGLFTQLNDYFKNDQQFARVGFANKDGSKL
                     QYLDEQQKTWFTTFATGRSAVESICVRAHLYGRSNPAAMLMERLLGTFFPSMTVKDLD
                     EYCEIVVKPNGIYVANETAKPNANVSDILNNFKFVTSVVHKSSMNEVRRDNYYLSLTR
                     TTESAKLPVEYVYMSEMNQLNEFISHYAPNFFQVLREASSILHCISFTDLPTEKPLTE
                     KKWNANLLPRAVIRTSIPSNKAQFKALKDVIGSVIAVYDNFTKDLVQKNPHVFITNDL
                     LKKTSQLRSQELAKIVKTMKQVEREMALEKKHEAEKEQRRLLKQSGDAEKFDQKKRDR
                     RERRAKNKQKVRM"
     gene            complement(<747083..>747709)
                     /locus_tag="ZYRO0D08690g"
                     /db_xref="GeneID:8204068"
     mRNA            complement(<747083..>747709)
                     /locus_tag="ZYRO0D08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496766.1"
                     /db_xref="GeneID:8204068"
     CDS             complement(747083..747709)
                     /locus_tag="ZYRO0D08690g"
                     /note="highly similar to gnl|GLV|CAGL0C03003g Candida
                     glabrata CAGL0C03003g and similar to YCR051W
                     uniprot|P25631 Saccharomyces cerevisiae YCR051W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496811.1"
                     /db_xref="GeneID:8204068"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DVQ9"
                     /translation="MNVWIAASDGRTSVVEKLLQENYQRDGNVKDPNGYTPVHAAAAY
                     GHIELLRKLCQEYGGNINVKDSDGDTPLHHCEDAHTAKVILEELGGDISLQNEEGKTA
                     LQSAEEDGEFPELIQYLRIKSGISADEGSLGIDADQWAQFKDNIRYTMESEPASDDPE
                     SMARRQRLEEILSGDNPEEELQSYIREVIRSQNATQDDAEAPDTKRRK"
     gene            <747839..>748579
                     /locus_tag="ZYRO0D08712g"
                     /db_xref="GeneID:8204069"
     mRNA            <747839..>748579
                     /locus_tag="ZYRO0D08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496767.1"
                     /db_xref="GeneID:8204069"
     CDS             747839..748579
                     /locus_tag="ZYRO0D08712g"
                     /note="highly similar to gnl|GLV|KLLA0C09130g
                     Kluyveromyces lactis KLLA0C09130g and similar to YNR020C
                     uniprot|P53722 Saccharomyces cerevisiae YNR020C
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496812.1"
                     /db_xref="GeneID:8204069"
                     /db_xref="GOA:C5DVR0"
                     /db_xref="InterPro:IPR019165"
                     /db_xref="UniProtKB/TrEMBL:C5DVR0"
                     /translation="MSDPTTIPPPGELQKPNPPSDPNSTKGFHWWRRTFQYKTGIGLT
                     PKEKQNYENDYHFVLQKKQCQQCYEYRDWILKYSPTVRFMAQQISKLNGNSDGQVLPF
                     DESKIVCDACPEWRSGGFHPELGILLCQNRIRDKWHLEDTLAHEMVHYFDNLKWQVDW
                     LNLKHHACSEIRASSLSGECRFSAEFHRRGFGFAIAKGHQDCVKRRATLSVMGNPNCK
                     GEKEAEKIVNEVWDSCFNDTRPFDEIYR"
     gene            complement(<748638..>750452)
                     /locus_tag="ZYRO0D08734g"
                     /db_xref="GeneID:8204070"
     mRNA            complement(<748638..>750452)
                     /locus_tag="ZYRO0D08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496768.1"
                     /db_xref="GeneID:8204070"
     CDS             complement(748638..750452)
                     /locus_tag="ZYRO0D08734g"
                     /note="similar to uniprot|P53629 Saccharomyces cerevisiae
                     YNR019W ARE2 Acyl-CoA:sterol acyltransferase isozyme of
                     Are1p endoplasmic reticulum enzyme that contributes the
                     major sterol esterification activity in the presence of
                     oxygen"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496813.1"
                     /db_xref="GeneID:8204070"
                     /db_xref="GOA:C5DVR1"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="UniProtKB/TrEMBL:C5DVR1"
                     /translation="MTKPLMQDERFLRIRKLNSGGNRRKSIALEQEEEEEREDGLELV
                     KEVSLDELKKTADEGVKSLPEGSRASRGASPDKGAIIATGTDSVEGSDEEHIKLRLRR
                     LYNDANLNGPEKRYSFFGDVAFEYRPTILDGAINDPMKTRFEGPTLEKQIRAKKTAVK
                     LEGTNNHVIIDNCELTPSFSGLYVLFWLTVAFMSMNMCINYYYEHGRTFRDSAILKFM
                     TTDIFTVGFVDLVMYLNIYMVFFIHKACKSKWIKWSSTGMVITSTLEFAYLIFYLYLP
                     EHILGLHWLAKIFLFLHSLVLLMKMHSYAFYNGYMWNILDELNFSTKQLKKKSSISDP
                     KVITVLERSRSFCKSEIESQSSSPQDVFPNNINLKNFFMYTMYPTVVYQIEYPRTPIV
                     RWGYVFEKICAIFGTIFVMMALAQSSMYPLALKALSLREKTWLSAGERLQQWGFILIE
                     YIPSFIVMYLLVFYLIWDAILNCIAELTKFGDRYFYGDWWNCVSWDEFSRIWNVPIHK
                     FLLRHVYHSSMSALQLNKIQATLMTFLLSSIVHELSMYVLFGKLRFYLFFFQMGQLPL
                     VAMSNSKIIKRNPIVGNLFFWLGICTGPSVLCTMYLTF"
     gene            <751141..>751953
                     /locus_tag="ZYRO0D08756g"
                     /db_xref="GeneID:8204071"
     mRNA            <751141..>751953
                     /locus_tag="ZYRO0D08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496769.1"
                     /db_xref="GeneID:8204071"
     CDS             751141..751953
                     /locus_tag="ZYRO0D08756g"
                     /note="highly similar to uniprot|P25627 Saccharomyces
                     cerevisiae YCR047C BUD23 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496814.1"
                     /db_xref="GeneID:8204071"
                     /db_xref="GOA:C5DVR2"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DVR2"
                     /translation="MSRPEELAPPEVFYNDNESNKYTTSTRVQHIQAKMTLRALELLN
                     IPPNSFVLDVGCGSGLSGEILTEEYGHVWCGLDISPSMLATGLTREVEGDLMMQDMGQ
                     GVPFRAGTFDAAISISAIQWLCYADTKYHEPQKRLMRFFNGLFASLKKGGKFVAQFYP
                     KDDDHVEQIQHAAKLAGFSGGLVIDDPESKKNKKYYLVLTSGAPSVQDQQVNLEGVTM
                     DEQEKISNARRKKNERESTKNYVMRKKELMKRRGRQVTHDSKFTGRKRRPRF"
     gene            <752137..>752652
                     /locus_tag="ZYRO0D08778g"
                     /db_xref="GeneID:8204072"
     mRNA            <752137..>752652
                     /locus_tag="ZYRO0D08778g"
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /transcript_id="XM_002496770.1"
                     /db_xref="GeneID:8204072"
     CDS             752137..752652
                     /locus_tag="ZYRO0D08778g"
                     /note="similar to uniprot|P25626 Saccharomyces cerevisiae
                     YCR046C IMG1 Mitochondrial ribosomal protein of the small
                     subunit required for respiration and for maintenance of
                     the mitochondrial genome"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /protein_id="XP_002496815.1"
                     /db_xref="GeneID:8204072"
                     /db_xref="GOA:C5DVR3"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:C5DVR3"
                     /translation="MYSFPRLRVGLISQVRSYQIPTTTRKVIPVYPPVEQRQKPNLLQ
                     TLTDVNLKSLDPQGWKRQLVSKNSRQSLRAGDVVRVVYDQSKCSHDNFVGYVLSVNRK
                     ELVQDSSLLLRNQISKTAVEMRVPVFSPLIERIDLLKKTDGKRQRNRHYYIRGTKLDV
                     GDLEAGLRKRK"
     gene            complement(<752758..>753432)
                     /locus_tag="ZYRO0D08800g"
                     /db_xref="GeneID:8204073"
     mRNA            complement(<752758..>753432)
                     /locus_tag="ZYRO0D08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496771.1"
                     /db_xref="GeneID:8204073"
     CDS             complement(752758..753432)
                     /locus_tag="ZYRO0D08800g"
                     /note="similar to uniprot|P53721 Saccharomyces cerevisiae
                     YNR018W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496816.1"
                     /db_xref="GeneID:8204073"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="UniProtKB/TrEMBL:C5DVR4"
                     /translation="MKILSKEEIEAHKYHTIAGGVKGAIAGFAIAGAVWKFAPIRYPR
                     FQPRRWPWSIKTAFWISPPTLMTAICAEEASNKFDSMMYSSGGESADALEEHRKWKEM
                     SMKQKLVEGLSNNKYKIIVGAWAASMYGSWVVVDKDPIMTKAQKAVQARMYAQFITVG
                     LLLASMGLSMYERKLHPNKEQVREKQRWDRLLADVEAEEKTSHDGVAGFRDNSQRVNS
                     KIFKYE"
     gene            <754340..>755812
                     /locus_tag="ZYRO0D08822g"
                     /db_xref="GeneID:8204074"
     mRNA            <754340..>755812
                     /locus_tag="ZYRO0D08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496772.1"
                     /db_xref="GeneID:8204074"
     CDS             754340..755812
                     /locus_tag="ZYRO0D08822g"
                     /note="similar to uniprot|P25381 Saccharomyces cerevisiae
                     YCR045C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496817.1"
                     /db_xref="GeneID:8204074"
                     /db_xref="GOA:C5DVR5"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="InterPro:IPR010259"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:C5DVR5"
                     /translation="MRFSSVLLSLLIGSASAEEYLIRFKSPDGFQFFMNSAKDHTKNF
                     KEFFHNKISHTFSFGSFRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQE
                     LQQNYHGDNLDDEDGFNPFKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYY
                     YKWHKGRNINAYIIDTGIYKEHKDFCGRAIFGRDFTGEGPGDRNGHGTHVAGIVGSSN
                     FGVAKKVNLIEVKALNNRGQGNLTTVISAVEFAVNHCKSSGKKGCVANLSLGAVRNSV
                     INQAIKAAHEAGLIIVVAAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGP
                     CVDIFASGVKVKSLSAFPPHKPIAFSGTSMASPSVTGLVAILLDKGVEPENIKAKLVE
                     LATHDLLQRRTLFFKPGTPNRIAFNGMEREDDEYDDAVYPIVDLESLVQELQNYQPPP
                     LEVNNKDGKFDIINFKDDSPLPMGTIDLTKRKILSPGEEN"
     gene            complement(<755964..>756608)
                     /locus_tag="ZYRO0D08844g"
                     /db_xref="GeneID:8204075"
     mRNA            complement(<755964..>756608)
                     /locus_tag="ZYRO0D08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496773.1"
                     /db_xref="GeneID:8204075"
     CDS             complement(755964..756608)
                     /locus_tag="ZYRO0D08844g"
                     /note="similar to uniprot|P32897 Saccharomyces cerevisiae
                     YNR017W MAS6 Essential protein of the mitochondrial inner
                     membrane component of the mitochondrial import system"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496818.1"
                     /db_xref="GeneID:8204075"
                     /db_xref="GOA:C5DVR6"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005681"
                     /db_xref="UniProtKB/TrEMBL:C5DVR6"
                     /translation="MGWFSRSEPQEQKNSQEQDSNLEQTLGFDPSQLTNVSNVIQTPG
                     ALDVNKLHPLAGLDKGVEFLDLEEEQLSTMEGSQGLIPSRGWGDDLCYGTGAVYLIGL
                     GSGGAYGFFEGLRNIPPNSPGKLQLNTVLNHVTRRGPFLGNNMGVLAMMYNLINSSID
                     SYRGKHDTVGSIGAGAITGAIFRSSRGLKPMGYASAMMAGAAGSWSLVKKSLLN"
     gene            <756977..>757498
                     /locus_tag="ZYRO0D08866g"
                     /db_xref="GeneID:8204076"
     mRNA            <756977..>757498
                     /locus_tag="ZYRO0D08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496774.1"
                     /db_xref="GeneID:8204076"
     CDS             756977..757498
                     /locus_tag="ZYRO0D08866g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496819.1"
                     /db_xref="GeneID:8204076"
                     /db_xref="UniProtKB/TrEMBL:C5DVR7"
                     /translation="MQMQAPQPILVIDPTEAARLQRAHRHLHVSFDLFSTELQRLEAT
                     KIFLPQWQYPEQENNEEWAMVPSPSPIVSQETSHSALDVQIQSYRSYAAKCNGRMRFW
                     ESARRRNQPEGERIFSDSDYDNDEDDTICAEMDYQLHSEDEKQEVEEQDQTEPGLTAL
                     KKLYRAYQAIIHT"
     gene            complement(<757575..>757835)
                     /locus_tag="ZYRO0D08888g"
                     /db_xref="GeneID:8204077"
     mRNA            complement(<757575..>757835)
                     /locus_tag="ZYRO0D08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496775.1"
                     /db_xref="GeneID:8204077"
     CDS             complement(757575..757835)
                     /locus_tag="ZYRO0D08888g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496820.1"
                     /db_xref="GeneID:8204077"
                     /db_xref="UniProtKB/TrEMBL:C5DVR8"
                     /translation="MSIRSESFNTTTMPTDANEEESQSTLSWLFGSIVSGVKSFNDTL
                     TDFVKTIDVVDADTDTDAEEDDDSNDAPSSTKKQENLVQPHT"
     gene            <758822..>765862
                     /locus_tag="ZYRO0D08910g"
                     /db_xref="GeneID:8204078"
     mRNA            <758822..>765862
                     /locus_tag="ZYRO0D08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496776.1"
                     /db_xref="GeneID:8204078"
     CDS             758822..765862
                     /locus_tag="ZYRO0D08910g"
                     /note="highly similar to uniprot|Q00955 Saccharomyces
                     cerevisiae YNR016C ACC1 Acetyl-CoA carboxylase biotin
                     containing enzyme that catalyzes the carboxylation of
                     acetyl-CoA to form malonyl-CoA required for de novo
                     biosynthesis of long-chain fatty acids or YMR207C
                     uniprot|P32874 Saccharomyces cerevisiae YMR207C HFA1
                     Mitochondrial acetyl-coenzyme A carboxylase, catalyzes the
                     production of malonyl-CoA in mitochondrial fatty acid
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496821.1"
                     /db_xref="GeneID:8204078"
                     /db_xref="GOA:C5DVR9"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:C5DVR9"
                     /translation="MYFFGSIDLRPAVSFARSACLFVCLSTFFFSFVFVFSLFDNPTT
                     FPISIQQYYTREKNKNKKNQTTKRLDSDCSGSNTNIKTISSLFRQIRFNFVSSLPRLR
                     LTRCFHFNRTQLKMSEESLFEVSSKVGVEEIADYAKEHAKLPASFIGYRTVDKAEESP
                     LKDFVRNHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDDRAVQFVAMATPEDL
                     EANAEYIRMAEQYVEVPGGTNNNNYANVDLIVEIAERADVDAVWAGWGHASENPDLPE
                     TLANSKRKILFIGPPGNAMRSLGDKISSTIVAQHAKVPCIPWSGTGVDKVRIDYESGL
                     VCVDDEIYKQGCSTSAEDGLERAKKIGFPVMVKASEGGGGKGIRQVHRAEDFIPLYNQ
                     AANEIPGSPIFIMKLAGRARHLEVQLLADQYGANVSLFGRDCSVQRRHQKIIEEAPVT
                     IAKPDTFKEMEKAAVRLGKLVGYVSAGTVEYLYSHDDDQFYFLELNPRLQVEHPTTEM
                     VSGVNLPAAQLQIAMGIPMHRIRDIRMLYGMHPQQSTKIDFEFANEESSTTQRKPTPK
                     GHCTACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVGNNGGIHSFSDSQFGHI
                     FAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEKNTITTGWLDDLIS
                     QKMTAEKPDPTLAVICGAATKAFIASEAARQNYINSLKKGQVPSKSLLQTMYPVEFIH
                     EGKRYKFTVAKSADDRYTLFINGSKCEVRIRKLSDGGLLIAIGGKSHTIYWKDEVSAT
                     RLSVDSMTTLLEAEDDPTQLRTPSPGKLVKFLVDNGDHIDGGQTYAEVEVMKMQMPLV
                     AQESGVVQLLKQPGSTIAAGDIIAILSLDDPSKVKHALPFEGMLPDFGAPIIEGTKPA
                     YKFRSLETTLQNILNGYDNQVIMNPSLQELIKVLRDPQLPYSEWSMQISALHSRLPPK
                     LNEQLSQLVDRSSKRNALFPARQLNKLLESATKQPDSDPSLTPVVEPLLDVTRRYANG
                     LEAHEHSVFVKFLEEYYNVEKLFSSTTEDNVILKLRDEYSDNLEKVVVIVLSHAKVAA
                     KNNLILAILRHYQPLCKMSSQVASIISGPLKHIVELESKATARVALQAREILIQGALP
                     SVKERSEQVEHILKSSVVRPTYGATNPKRSEPDMEVLKDLIDSNYVVFDVLTPFLSYP
                     DPAVAAAAAQVYVRHAYRAYTIGEVKVCEGTTTPICKWKFQMPSAAFTSIPQIKTKFG
                     MNRAISVSDLTYVADPENSPLRTGILVSAEHLDDVDDSLAQSLETIPNTSSSAAAAGP
                     VPDRSVSSSSLSNVTNVYVQSTDGFESEADVLSRLREILDSNKQELISSAIRRITFIF
                     GYSDGSYPKYYTFKGPAYEEDKTIRHIEPALAYQLELGRMSNFNIKPIFTENRNIHVY
                     EAVGKSTPLDKRFFTRGIIRTGRIRDDISIQEYLTSEANRLMSDILDNLEIIDTSNSD
                     LNHIFINFSAVFDVSPEDVEAAFGGFLQRFGKRLLRLRVASAEIRIIIKDPETGAPVP
                     LRALINNVSGYVVKTELYTEVKNANGDWVFKSLGKPGSMHLRPIATPYPVKEWLQPKR
                     YKAHLMGTTYVYDFPELFHQALVSQWQKFSPKTKLNDNFFIANELIEDENGELTEVDR
                     EPGANTIGMVAFKITAKTPEYPRGRQFVIVSNDITFKVGSFGPQEDEFFNKVTEYARK
                     RGIPRIYLSANSGARIGIAEELVPLFQVAWKDPKDSTKGFDYLYLTSEGLRELKKYGK
                     DHSVVTERVVENGEERHLIKAIIGVDEGLGVECLRGSGLIAGATSKAYQDIFTITLVT
                     CRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKVLGREVYTSNLQLGGTQIMYNNG
                     VSHLTASDDLAAIEKILAWLSYIPAKRNMPVPILETEDKWDREVEYFPPKEETYDVRW
                     LIAGRDSPEGFERGLFDKDSFMETLSGWAKGVVVGRARLGGIPMGVIGVEIRTMQNLT
                     PADPANPDSTESVSQEAGQVWYPNSAFKTAQAIRDFNHGEQLPLMILANWRGFSGGQR
                     DMYNEVLKYGSFIVDALVDYKQPIMIYIPPTGELRGGSWVVVDPSINKEHMEMYADKE
                     SRAGVLEPAGMVGVKYRREKLLATMSRLDDTYRSLKEKLSDASLSPEEHQEISKKLSI
                     REKQLLPIYSSISVQFADLHDRSDRMLAKGVIRKELQWVNSRRFFFWRLRRRLNEEYL
                     MRRLDVELPLASRLEKIARLRSWYPASVDHENDRQVASWIEENFQLLDEHLKALKLES
                     FAQSLAKSLRSDHDNVITGLSEVLKMMSAEDKEKIIKSLK"
     gene            complement(<766146..>767267)
                     /locus_tag="ZYRO0D08932g"
                     /db_xref="GeneID:8204079"
     mRNA            complement(<766146..>767267)
                     /locus_tag="ZYRO0D08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496777.1"
                     /db_xref="GeneID:8204079"
     CDS             complement(766146..767267)
                     /locus_tag="ZYRO0D08932g"
                     /note="similar to uniprot|P53720 Saccharomyces cerevisiae
                     YNR015W SMM1 Dihydrouridine synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496822.1"
                     /db_xref="GeneID:8204079"
                     /db_xref="GOA:C5DVS0"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:C5DVS0"
                     /translation="MLSFAGKLVLAPMVRAGELPTRILAIRNGADLVWGPEIIDKKLI
                     QCKRHVNEKLGCVDYLVDGTTSPVFRTCPQIEKGKIVFQIGTSTPSLAIQAALTVIQD
                     VDGIDINAGCPKHFSIHSGMGAALLRTPDKLCEILCELVEKVGRPYGKTISVKIRLLD
                     NREDTLQLINRLCQTGISHLTVHCRTTPMRNREQPIRGYIKEIYEVCQTNGVTLIING
                     GIKSRSHFQEIQRDLELPKEIGGMMADCAEQNPTVFLDSPIEWFDVVKQYVRIANDYD
                     NNLGNTKYMISRIVPGKSKFYQFFARCKTFQEIEHVLGLLGPKGDPLGDPLPFIENCR
                     QQEKLAKQRTNELKSKQRQAEKRQSLEQEGVQESKKIKT"
     gene            <767612..>770215
                     /locus_tag="ZYRO0D08954g"
                     /db_xref="GeneID:8204080"
     mRNA            <767612..>770215
                     /locus_tag="ZYRO0D08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496778.1"
                     /db_xref="GeneID:8204080"
     CDS             767612..770215
                     /locus_tag="ZYRO0D08954g"
                     /note="some similarities with uniprot|P47179 Saccharomyces
                     cerevisiae YJR151C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496823.1"
                     /db_xref="GeneID:8204080"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:C5DVS1"
                     /translation="MFKNFKARIRSGSSQLKSSGAHGLDKLAKSGSKRSASGSAATTS
                     SNNRKSRNDGHDDGIDQQRSISAPGTSQPGYQSHFADNRSPRQAYRPPPIGAGDELTY
                     SPVPSSKSFPKSTRHYSQENPYSERNSLTMLGGPNHYVYDNAAYDTNDKEFNIFSKPD
                     GITPCSSRLVVQSLTSAFKESISHVGDTKVLQQVVKPNLHHFSKEEVQEVKRLICKLF
                     PYDGCTLKDQALKKSINESFGDNVIRLTVALRIIWSSFPRGIIPWDSYYKFTKWESQT
                     GFPPESFHFRFSKFLPDRNYTFCTFAFLEFLLCILLQKNKLMLDKSIQMDLIFTAGAT
                     AFVRDPSYCSPANEETPPVIRSYYQRGNALHRLFVGYIRSLNHERKMTDVYLLDIFQI
                     EQYPPRPYKARSAKALTLTIPKGNPDGNDFTSLISQAASAKKRFYASSSSFSRIENAF
                     LDQFEEQTLRVIMSFFSESSNRYITTFDDGFDADFLQGASKRNKSHTRKVSDDNMVAT
                     WLQMAKEQNGFDELLDVLENNHMPEGGTLALGAPAATMGPTSRRDRTEAADSSVRIGK
                     TDITEWIINSWKYEMFMSRVQNTLLIKLTKKVDECNWLVLSCEENVNMNPKAIPPPAK
                     HPPIPKERPHRLQQPKVTIREPATHSLPSVKESVPTDFSHLPVDLPIPESFVEAEPKP
                     ESKPLPNPAEESLKGPISETVREPSTESNADASVEPTKVSNASSVVESTKVSNASSVA
                     EPTKESNASLAEEPIKEHNANASVEPTEESNASSVVEPTEKSNASSVMEPTKESNVDA
                     AEEPTKQPVKSSVPSNDALIAKLNNVGISPSAIDTRYEKNGNRTARSSRNILGDLLES
                     CYSGNEVEAIN"
     gene            complement(<770360..>770665)
                     /locus_tag="ZYRO0D08976g"
                     /db_xref="GeneID:8204081"
     mRNA            complement(<770360..>770665)
                     /locus_tag="ZYRO0D08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496779.1"
                     /db_xref="GeneID:8204081"
     CDS             complement(770360..770665)
                     /locus_tag="ZYRO0D08976g"
                     /note="some similarities with uniprot|P53719 Saccharomyces
                     cerevisiae YNR014W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496824.1"
                     /db_xref="GeneID:8204081"
                     /db_xref="UniProtKB/TrEMBL:C5DVS2"
                     /translation="MPSGERPVSVQIRIRHGEAGQQPEPGDNVFTVLDLQNQNDKDYQ
                     QCSNFSDFSQCCSRSTSPKCRRVSVCSCPSPETQASPCDRHHHRRNSIAVKFEKRSD"
     gene            <771821..>774349
                     /locus_tag="ZYRO0D08998g"
                     /db_xref="GeneID:8204082"
     mRNA            <771821..>774349
                     /locus_tag="ZYRO0D08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496780.1"
                     /db_xref="GeneID:8204082"
     CDS             771821..774349
                     /locus_tag="ZYRO0D08998g"
                     /note="similar to uniprot|P27514 Saccharomyces cerevisiae
                     YNR013C PHO91 Low-affinity phosphate transporter deletion
                     of pho84 pho87 pho89 pho90 and pho91 causes synthetic
                     lethality transcription independent of Pi and Pho4p
                     activity overexpression results in vigorous growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496825.1"
                     /db_xref="GeneID:8204082"
                     /db_xref="GOA:C5DVS3"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:C5DVS3"
                     /translation="MKFSHSLQFNAVPEWSSKYISYSQLKKLIYALQKEQLYGTKNLD
                     NETQPLLSGDEIYVSRFISALDTELKKIDKFYLSQETGLMANYRELEDDVRDLEQDLL
                     NNRVDSLEDVYPRRRSAGSARYSSASSLEAGGGDDDIHSGFSTRSQSHLENDNVGSDI
                     YQARSRTTNNTWGSSSQAHFISPAMERRIILKKRIIAVYTQLSELKSYIELNCTGFSK
                     ICKKFDKSLQTDIRQSYLDSLKKRSHVFNPQTIETVQKCITAAVVTYARLSQDSFSYP
                     PAEEGSNVLDIETAESELSSHLREHVVWERNTVWKDMMNLERKAQNVKAETRMSKLAQ
                     NLKAKEGAGRTVEVPAEVTMVPETLAEIRKMNWSQLGRLLLLQTAALKFLLITNIFIL
                     LLCFSPLKNVLQKNCFAILVYASLLWATETIPLFVTSLLVPMLIVILPVLQDPSTGKA
                     MDPLSSSQYILSTMWNSVIMLLLGGFTLAAALSKYNIAKVLSTYILSSAGTNPKIILV
                     TNMGVALFVSMWVSNVAAPVLCYSIIQPLLRTLPRDSSYAKSMILGIALASNIGGMAS
                     PIASPQNIFSIGLMDPQPSWAEWFIVSLPVCALCIFGTWVLLLLTFPLDPSLKLLQLH
                     PLRDPFTIKQWFVTIVCCGTIVLWCMSNRLSGIFGEMGVISIIPLLIFFGTGLLTSDD
                     FNNFMWTIVILAMGGNTLGKAVTSSGLLATIASVIKESVEDKPIFVIVLLFGVVILMT
                     ATFVSHTVAAMIIVPLMSEIGANLPSGNHSRLLIMVAALLCSCAMGLPTSGFPNVTAI
                     SMINEVGDRYLTVGTFITRGIPASLICYVCIVTVGYGLMVLVGF"
     gene            complement(<774474..>775937)
                     /locus_tag="ZYRO0D09020g"
                     /db_xref="GeneID:8204083"
     mRNA            complement(<774474..>775937)
                     /locus_tag="ZYRO0D09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496781.1"
                     /db_xref="GeneID:8204083"
     CDS             complement(774474..775937)
                     /locus_tag="ZYRO0D09020g"
                     /note="similar to uniprot|P27515 Saccharomyces cerevisiae
                     YNR012W URK1 converts ATP and uridine to ADP and UMP
                     Uridine kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496826.1"
                     /db_xref="GeneID:8204083"
                     /db_xref="GOA:C5DVS4"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DVS4"
                     /translation="MTASNTPSPTILESTNVAKVHHSDANGHHSKSKRFQYLPPWTTP
                     YVIGVGGPSGSGKTSVAAKIVSSLNVPWTVLISLDNFYKPLNAEQRRTAFENNYDFDH
                     PTALDLDLAYEAISSLKEGKKTTIPVYSFVEHNRIPNKNITIYGASIIVLEGIYTLYD
                     KRLLDLMDLKIYVDADLDVCLARRLSRDIVYRGRDLEGCLEQWERFVKPNAERYLRPK
                     MKEADAIVPSLTDNGVAVELIINHIKSRLQQKSEEHLKELIELGHSDLVNVSEHPSLH
                     ELVPTNQVNAIITMLLNKMTSRYDFVFYFDRIATILLTQVLSDIPVYEKCTIETPEGT
                     TIPDALKCDFNQITAINLIESGDCFMHSLKKTIPNIVTGKLLVQSDSRTGEPQLHFKL
                     LPPDITNYKMVLLTEAQMISGASMIMSTQVLLDHGVELENIKVVVFLATEISIRRILN
                     AFDGKVDIYVGKIVTKNELNRCDWAKARFVGAKYFGW"
     gene            <776116..>778812
                     /locus_tag="ZYRO0D09042g"
                     /db_xref="GeneID:8204084"
     mRNA            <776116..>778812
                     /locus_tag="ZYRO0D09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496782.1"
                     /db_xref="GeneID:8204084"
     CDS             776116..778812
                     /locus_tag="ZYRO0D09042g"
                     /note="similar to uniprot|P20095 Saccharomyces cerevisiae
                     YNR011C PRP2 RNA-dependent ATPase in the DEAH-box family
                     required for activation of the spliceosome before the
                     first transesterification step in RNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496827.1"
                     /db_xref="GeneID:8204084"
                     /db_xref="GOA:C5DVS5"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVS5"
                     /translation="MSAADTGGDEHFQTGKGKRRTKRTFESHDGNNEKPLDDNDELQE
                     NGKPLVQPLDGITEDVDEMKQLRLLARQRYLSHREREKLVILAKELEYLEQDIEKYGW
                     ENLTQSERDDITLKRDLVSLIEHREDAGVQKFNLQEDYVNNEGKLDVERKKALLNDRS
                     GYRQHEDEGKRKHMWEEKQLRKAVKKDDDIDEIKLPGADKYEFVFDDNAMVDYEDEEE
                     VLPGKDSEQDNHLLEQLEIEQKRITSVQETRKFLPVYRYRKELLEAIKEHQILIIVGE
                     TGSGKTTQLPQYLVEDGYTQGGKFQIAVTQPRRVAATAVAARVADEMDVVLGKEVGYS
                     IRFEDKTTADKTILKYMTDGMLLREFLVDPELQKYSCIMIDEAHERTLATDILLGLLK
                     DILSHRKDMKLLISSATMNATKFSRFFNNCPIFNVPGRRFPVDIHYTVQPEANYLHAV
                     ISTVFQIHTREPLPGDILVFLTGQDEIENMAEKMEMIAGKLGEKAMPMIITPIYANLP
                     QDQQNRIFIPTPPSCRKVVLATNIAETSLTVDGIKYVVDPGYVKENSFVPSTGMTQLL
                     TVPCSRASVDQRAGRAGRVGPGKCYRIFTKWSYYNELELMPKPEVLRTNLSSVVLLLL
                     SLGITNLVDFQLLDKPSVSSLSKSLENLYLLGALNSKGTITKLGRIMCEFPCEPEFAK
                     VLHTAATHEMCHGVLEECIDIVAMLHEAKSLFVGSKNPNPGSHVVGQVDSDHMLYWEI
                     YNEWRNSNYSKMWCQDHKLQYKTLCRVRNIRDQLFQCADKLGLVALNESARRELVDKQ
                     ANSALTARITKCFIGGFPMNVAQLGTNAYRTVGKKSTSGLDVYIHPSSVVIHSTRDGK
                     KPCKFVLYQQLMLTSKEFIRDCLPIPRESWLEEMVPQLFQSR"
     gene            <779202..>780245
                     /locus_tag="ZYRO0D09064g"
                     /db_xref="GeneID:8204085"
     mRNA            <779202..>780245
                     /locus_tag="ZYRO0D09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496783.1"
                     /db_xref="GeneID:8204085"
     CDS             779202..780245
                     /locus_tag="ZYRO0D09064g"
                     /note="highly similar to uniprot|P50107 Saccharomyces
                     cerevisiae YML004C GLO1 Monomeric glyoxalase I catalyzes
                     the detoxification of methylglyoxal (a by-product of
                     glycolysis) via condensation with glutathione to produce
                     S-D-lactoylglutathione expression regulated by
                     methylglyoxal levels and osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496828.1"
                     /db_xref="GeneID:8204085"
                     /db_xref="GOA:C5DVS6"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR004361"
                     /db_xref="InterPro:IPR018146"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:C5DVS6"
                     /translation="MFSRVFSRLGLIKQHIRTMSTKTSEAQYYTKKIASAVGDPSLRF
                     NHTCLRIKDPSASVEFYKKHFNMTLLSKKDFPDMKFSLYFLVMTKENLPKNEKGENLV
                     FANRGILELTHNWGTEADPEYKVNNGNVEPHRGFGHICFSVANVESTCQRLESEGVKF
                     QKRLVDGRQKNIAFALDPDGYWIELIQYINESGEGPKTDLGNRFNHTMVRVKDPVKSL
                     EFYQNVLGMTLHRVSEHANAKFTLYFLGYDIPQGDSTGSAETLLELTHNWGTENDPDF
                     HYHNGNAQPQGYGHICITCKDPGALCEEIEKKYNEQVVWSPKWNHGKMKNLAFIKDPD
                     GYSIEIVPAELVL"
     gene            complement(<780326..>781966)
                     /locus_tag="ZYRO0D09086g"
                     /db_xref="GeneID:8204086"
     mRNA            complement(<780326..>781966)
                     /locus_tag="ZYRO0D09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496784.1"
                     /db_xref="GeneID:8204086"
     CDS             complement(780326..781966)
                     /locus_tag="ZYRO0D09086g"
                     /note="similar to uniprot|O59831 Schizosaccharomyces pombe
                     SPCC965 Putative amino-acid permease C965.11c and weakly
                     similar to YFL055W uniprot|P43548 Saccharomyces cerevisiae
                     YFL055W AGP3 Low-affinity amino acid permease may act to
                     supply the cell with amino acids as nitrogen source in
                     nitrogen-poor conditions transcription is induced under
                     conditions of sulfur limitation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496829.1"
                     /db_xref="GeneID:8204086"
                     /db_xref="GOA:C5DVS7"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DVS7"
                     /translation="MEDTKDPQDIETYSIASNKVGYHNNDHGDTILENGLKAGLKDRM
                     INLIALCGIIGPGVFIGMGTALAKGGPVGLIVGFSIVGVLVLSMMACIGELNSAFDFH
                     FAIHGSRYVSQGFGATLAIYYVILWVTNIIGEYTSLTSSMEAYTTKIPTYGWYLIFWA
                     AFSVFQLFDVSWWGECEYILGFVKLFYLSGYYIFSIVYAAGGIKGHKPDNPFGTHPLK
                     SGFKGIANSFVYAGVFYSGVEGVSVIAAEARNPRRAIPKAVKNTVFRIFFVYYGLTIF
                     YGITVPYDDPILNNHQSAMKSPMTIAMTEAGWKNSKYFVATMIWITCISSINTAIYFA
                     SRSLFTLCKAGYGPKIFTKVNSRGIPYVAIHSCHILGFLSILSYSSGSSNAYSYIVNV
                     GGVASFIVWTGICVIHIRFRKGWIKQGYSLESLPYKAPLFPWLDYVGLIIGIVLTLVQ
                     GWSCFKPFDYKAFIDGYILLALFPVFWFCYDFFYFKKGFIKYKEMDFETGRRPDLDDN
                     SGLETGKTELLNQKETSSMEFIVEEVEGTKGSTLKEKS"
     gene            <782402..>783634
                     /locus_tag="ZYRO0D09108g"
                     /db_xref="GeneID:8204087"
     mRNA            <782402..>783634
                     /locus_tag="ZYRO0D09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496785.1"
                     /db_xref="GeneID:8204087"
     CDS             782402..783634
                     /locus_tag="ZYRO0D09108g"
                     /note="similar to uniprot|O59832 Schizosaccharomyces pombe
                     SPCC965 SPCC965.12 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496830.1"
                     /db_xref="GeneID:8204087"
                     /db_xref="GOA:C5DVS8"
                     /db_xref="InterPro:IPR008257"
                     /db_xref="UniProtKB/TrEMBL:C5DVS8"
                     /translation="MSIDERFESLCQKVPIVDTHNDFPYLLRVQLHNELHCDGNKFDF
                     GSMLTSHTDLVRLKKGKVGIQFFSCFIECKDDDYLYEDFNKPNAAVRDTLEQIDVVQR
                     LADEYPGELNFVETADEALESFTRSHGQSISITLGIEGLHQCDLSLAVLRQYYRLGVR
                     YITLTHNCDNPFATAASSIAAGKPDHGLTCYGVDCIKEMNRLGLIVDLSHVSHKTMVD
                     TLKVTRAPVIFSHSSVYTLTNHERNVRDDVLQMVKNNGGVVCINFFPVFLQRQAGGEV
                     TIDDAVRHIKYVVDTIGWDHVGLGSDFDGIPKGPIGLEDVSKYPDLIRRVWEETGAAE
                     KDIAKLMGLNVFRVWKRCEDVAKSWDQSDTPVESNWSERRWEFFEYCKDFPEIYPGSF
                     TAQQNVYKDTQLLDNSKK"
     gene            <784422..>787298
                     /locus_tag="ZYRO0D09130g"
                     /db_xref="GeneID:8204088"
     mRNA            <784422..>787298
                     /locus_tag="ZYRO0D09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496786.1"
                     /db_xref="GeneID:8204088"
     CDS             784422..787298
                     /locus_tag="ZYRO0D09130g"
                     /note="highly similar to uniprot|P16862 Saccharomyces
                     cerevisiae YMR205C PFK2 Beta subunit of heterooctameric
                     phosphofructokinase involved in glycolysis indispensable
                     for anaerobic growth activated by fructose-2
                     6-bisphosphate and AMP mutation inhibits glucose induction
                     of cell cycle-related genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496831.1"
                     /db_xref="GeneID:8204088"
                     /db_xref="GOA:C5DVS9"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:C5DVS9"
                     /translation="MTVDIPLVNGTYSFTIKAYSEESFKKAIEFYKTFLLLEHRSDSA
                     TSALLFNGVVSLKIELQEDASKQREVDSVCEDLKANGSIKDWRGMVNESFVFKTGDIL
                     FSKQSLVDLKLPYQSYPNEVSPMQVYTIDPLGNVIGVTSTKNAVSTKPTHPSIPDHEG
                     RTTALTSKVPSYGDLKSADSEPREKAVEASNVKAQKAIGIMTSGGDAPGMNACVRAVV
                     RTAIHKGCRAYAIMEGYEGLVRGGPEYIKEFTWDDVRGWSSLGGTDIGTARCMEFKER
                     KGRLKGAQHMIEAGIDALIVCGGDGSLTGADLYRSEWPSLVQELLETGVISQEQYDRY
                     KHLNICGTVGSIDNDMSTTDATIGAYSALDRILKAIDYVEATANSHSRAFVVEVMGRN
                     CGWLALLAGISTSADYILIPEKPSSSREWEEQMCGIVTKHRQRGKRTTIVIVAEGAIT
                     NDLEPITSKDVHKILSGKLGLDTRITTLGHVQRGGSPVAYDRILATLQGVEAVNAVLD
                     STPDTPSPLIAVNENKIVRKSLVDSVRLTKSVADAIQEKDFKKAMSLRDTEFIEHLNN
                     FMAINSADHNEPELPSDKRLKIAIINVGAPAGGANSAVYSMATYCMSRGHKPYAIYNG
                     WSGLCRHESVRSLDWASMLGWQSRGGSEIGTNRVTPEEADIGMVAYYFQKYQFDGLII
                     VGGFEAFASLNQLERARDSYAAFRIPMVLIPATLSNNVPGTEYSLGSDTSLNALVEYC
                     DVIKQSASSTRGRVFVVECQGGNSGYLATSASLACGAQVSYVPEEGISLDQLTLDIET
                     LDKQFEMSEGRNRFGKLILTSGNASKAFSAEALAKVMTSESNGMFEAKAAIPGHVQQG
                     GLPSAIDRTRATRLSIKAVNFVEDQQDVMINARHDDDEFDVHDRKLSQTAAVLGVRGS
                     HVLFTSVRKLWDTETEIKNRTPKIIHWQATRDIADRLVDRKRID"
     gene            <787739..>788602
                     /locus_tag="ZYRO0D09152g"
                     /db_xref="GeneID:8204089"
     mRNA            <787739..>788602
                     /locus_tag="ZYRO0D09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496787.1"
                     /db_xref="GeneID:8204089"
     CDS             787739..788602
                     /locus_tag="ZYRO0D09152g"
                     /note="some similarities with uniprot|Q03694 Saccharomyces
                     cerevisiae YMR204C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496832.1"
                     /db_xref="GeneID:8204089"
                     /db_xref="GOA:C5DVT0"
                     /db_xref="InterPro:IPR024758"
                     /db_xref="UniProtKB/TrEMBL:C5DVT0"
                     /translation="MIGNGTNFIGTMNNPLDLNIPKKRKRDVNRQRLSAHKVSLFQYS
                     NVKAISCTDGNKNTSPLLSNGPLELYQIVTPAPNNYDKSQEMNYLSLGRNGNIVHPIL
                     PRLQVKKLKTNGVRFLITFYNPERYWELEFLPNNDDKDLWAIVDDFEKIISKICVYKS
                     VEEIRGENVNENEEKEDDDEDDDEDELDYLLNESEQAQDSNPRLEVIRREETRASRET
                     STDEFINQAFKRAIRALSNPRDATTNRPRRHSTFIARRPHQQQPQQNDVMSKRFSYQG
                     LPLRIASDPTN"
     gene            complement(<788633..>789277)
                     /locus_tag="ZYRO0D09174g"
                     /db_xref="GeneID:8204090"
     mRNA            complement(<788633..>789277)
                     /locus_tag="ZYRO0D09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496788.1"
                     /db_xref="GeneID:8204090"
     CDS             complement(788633..789277)
                     /locus_tag="ZYRO0D09174g"
                     /note="some similarities with uniprot|P03069 Saccharomyces
                     cerevisiae YEL009C GCN4 Transcriptional activator of amino
                     acid biosynthetic genes in response to amino acid
                     starvation expression is tightly regulated at both the
                     transcriptional and translational levels"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496833.1"
                     /db_xref="GeneID:8204090"
                     /db_xref="GOA:C5DVT1"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C5DVT1"
                     /translation="MSVQSLFENKLDSPVPGCLGAEIADSFFLEDEQAMFELDPPQHQ
                     ETWEPLFGTGEDANVESSTGVGSTEVEGVLQELATGSSDVDFGIAVDSVPEFPVSEIP
                     APVSDFVLPTPQPDPKPRSRASRVSKVDKLGVVSYNRKNRNAPLTPVLCESDDPVAMK
                     RARNTEAARRSRARKLERMSQLEERVEELLAKNEELEKRNRQLEQRLALSETGA"
     gene            <790847..>792331
                     /locus_tag="ZYRO0D09196g"
                     /db_xref="GeneID:8204091"
     mRNA            <790847..>792331
                     /locus_tag="ZYRO0D09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496789.1"
                     /db_xref="GeneID:8204091"
     CDS             790847..792331
                     /locus_tag="ZYRO0D09196g"
                     /note="some similarities with uniprot|P40002 Saccharomyces
                     cerevisiae YEL007W Hypothetical ORF and some similarities
                     with YHR177W uniprot|P38867 Saccharomyces cerevisiae
                     YHR177W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496834.1"
                     /db_xref="GeneID:8204091"
                     /db_xref="InterPro:IPR018608"
                     /db_xref="UniProtKB/TrEMBL:C5DVT2"
                     /translation="MDIGPTFKGYIEDENDVLLVLQATLDGKLKHIPRRPYEVERRYL
                     IVSGSIFVFIEEISGIKRWTDGVSWSPSRISGKFLMYKELDKSVQYPPMGSNRKRSGT
                     TSTFSSPSSSSPSSPKLKMSSLTPDQVGTGGDRRGLVPASPSSGSSGSSNNSLVHAHF
                     STPHQAFSPLHQHRHQHQHDSKYTGFVKKTMSVRIKTPDMMSPETLHIVSYYAVEDVQ
                     SGKLIRPRDLPFFSGTKPSQELLIAMENTSLGSHSKSGSSTAVNSPLATGANTSGKMK
                     FIGINSTAGSMRDSQPQQQQKQKLENNDNFYQRQEQQQLQQSKPVLPNMQPLPGLRIP
                     SLTSIYNINNNNNNNSQPNGGTALPPHPKFTRFIGSPLPNPYLNNPHQSYQLTNARNT
                     TTANAPPPPPPPPPAPPMINKLNERFYSFPPGYVYYGSSPHQNSSLFYPLPTTAPSTM
                     ATATQLPHPPTSTNTNTTSTNVPDLQDGTSSGPTFRRAPADAGD"
     gene            <792744..>793802
                     /locus_tag="ZYRO0D09218g"
                     /db_xref="GeneID:8204092"
     mRNA            <792744..>793802
                     /locus_tag="ZYRO0D09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496790.1"
                     /db_xref="GeneID:8204092"
     CDS             792744..793802
                     /locus_tag="ZYRO0D09218g"
                     /note="similar to uniprot|P40556 Saccharomyces cerevisiae
                     YIL006W Pvruvate transporter of the mitochondrial inner
                     membrane member of the mitochondrial carrier family has
                     putative mouse and human orthologs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496835.1"
                     /db_xref="GeneID:8204092"
                     /db_xref="GOA:C5DVT3"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DVT3"
                     /translation="MLEDGNNHEYLVPDVAAASSSDVVEPCRSEIIDNDGSRLGGTQI
                     VAISGALAGFLSGVAVCPLDVAKTRLQAQGMQSQNENKYYRGMFGTLRTIYRDEGPRG
                     MYKGLVPIVLGYFPTWMIYFSVYEFCKDLYPALFPGYDFISHSCSAISAGAVSTICTN
                     PIWVVKTRLMLQTHVSTNPTHYKGTRDAFRKIWNQEGIKSFYAGLIPSLLGLFHVAIH
                     FPVYEKLKITFKCYGDSDLRSGRSLHLGRLILASCCSKMVASLITYPHEILRTRMQLK
                     SNLPSTVQKRLFPLIKNTYQREGFRAFYSGFATNLFRTVPASAITLVSFEYVRDHITS
                     LNDSILSPPPLPRKSSPN"
     gene            <794163..>796271
                     /locus_tag="ZYRO0D09240g"
                     /db_xref="GeneID:8204093"
     mRNA            <794163..>796271
                     /locus_tag="ZYRO0D09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496791.1"
                     /db_xref="GeneID:8204093"
     CDS             794163..796271
                     /locus_tag="ZYRO0D09240g"
                     /note="similar to uniprot|P40557 YIL005W Saccharomyces
                     cerevisiae EPS1 protein disulfide isomerase related
                     protein involved in endoplasmic reticulum retention of
                     resident ER proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496836.1"
                     /db_xref="GeneID:8204093"
                     /db_xref="GOA:C5DVT4"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C5DVT4"
                     /translation="MRLLKLLSALYLIIGIARSSSVSSDYDGEFEPRAPLGEKEFRQE
                     LKSGLHLVEFYSPYCPHCRDFAPTWHETWRKFRKEGERLNISFVQVNCVKDGDLCYDE
                     AITEYPAIKLYGPEGFIKNYPNEYERTEGDLINFARQEALDPINMEATDLEISSKFLN
                     AQDFNELLAGKGKQPYLVSFWPSDDHEDPLAGSKSYDFCPECQTFQKLWPQITKKLLL
                     QGVATGHINCETLPNLCHEMEFHKLVNGAQAVDNYPRVALVLPGKGVNNLFIYENGFS
                     SSVWSYEDFAVRAISNSEAPEITLEQIVELVRQDFQFPESKNLPVPSQALHVVFAYSP
                     ENVVTEDFHVLEHLVKHLAKVPNAYLHKSKDDVSTAAKVSLDYMYEKINYNRSEPVKL
                     PKTDYLELNLVPQSPTFYIFKEGDWVPHLYVGDSTTETRNVEALAKWFNESALPVISE
                     VTPYNFGQLLSFQPSDYDAVAIQLVDLTDAESIKTSNEQLKNFIKAAYDYEDVRMQNV
                     VNVRAEKRANKNKRIKELKAAKASSDKIGKVYHEEIKFEDKNKVILGYVDISKGPHVL
                     EDLGFHRGRDDYKSGDVLVVDSYSSAFTEKDVFGNRLTTDSMYALRETLVKLILPELS
                     HFHERLESQELSFNYSRGLDIFEPMRKHKVWRYFFIVGALVLIVKAPSFYKKFKSNKK
                     YKAKRSTVGILGQPSKRSKD"
     gene            complement(<796541..>796936)
                     /locus_tag="ZYRO0D09262g"
                     /db_xref="GeneID:8204094"
     mRNA            complement(<796541..>796936)
                     /locus_tag="ZYRO0D09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496792.1"
                     /db_xref="GeneID:8204094"
     CDS             complement(796541..796936)
                     /locus_tag="ZYRO0D09262g"
                     /note="similar to gnl|GLV|CAGL0J02090g Candida glabrata
                     CAGL0J02090g and weakly similar to YIL004C uniprot|P22804
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496837.1"
                     /db_xref="GeneID:8204094"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C5DVT5"
                     /translation="MDRSLHQRDNTRTRLFDTNFNQPASPYAQPKKADYSQSSLAQLE
                     SQSEQDVGVMGQKIKALKNLSVRMGDEIRGSNHTLDQLGDTFENTTMKLKGTFKNMMV
                     MAQKSRISIKMWLLIFFVVGIFFFWVRIR"
     gene            <797243..>798088
                     /locus_tag="ZYRO0D09284g"
                     /db_xref="GeneID:8204095"
     mRNA            <797243..>798088
                     /locus_tag="ZYRO0D09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496793.1"
                     /db_xref="GeneID:8204095"
     CDS             797243..798088
                     /locus_tag="ZYRO0D09284g"
                     /note="similar to uniprot|P40558 Saccharomyces cerevisiae
                     YIL003W CFD1 Highly conserved putative P-loop ATPase
                     localized in the cytoplasm has a potential role in
                     assembly of iron-sulfur clusters in proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496838.1"
                     /db_xref="GeneID:8204095"
                     /db_xref="GOA:C5DVT6"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR015223"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028600"
                     /db_xref="UniProtKB/TrEMBL:C5DVT6"
                     /translation="MEEPMSASLEALSQIKHIFLILSGKGGVGKSSVTTQAALALCNL
                     GYKVGVLDIDLTGPSLPRMFGLEGQSILQSQQGWIPVPIPVPDDIKGTLKVISLGFLL
                     DDRGNSVVWRGPKKASMIKQFISSVAWGELDYLLIDTPPGTGDEHISIAEQLRWSNPD
                     GAIIVTTPQSVATADVKKEINFCRKVELDILGIVENMSGFICPHCAECTDIFSSGGGS
                     KLAETYSVPYLGAIPIDPRFVELIENQSTAGELLVRSYHESSIFSVFKEILNKLLEQQ
                     KPPRF"
     gene            complement(<798117..>798908)
                     /locus_tag="ZYRO0D09306g"
                     /db_xref="GeneID:8204096"
     mRNA            complement(<798117..>798908)
                     /locus_tag="ZYRO0D09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496794.1"
                     /db_xref="GeneID:8204096"
     CDS             complement(798117..798908)
                     /locus_tag="ZYRO0D09306g"
                     /note="some similarities with uniprot|P40003 Saccharomyces
                     cerevisiae YEL005C VAB2 Protein with a potential role in
                     vacuolar function as suggested by its ability to bind
                     Vac8p green fluorescent protein (GFP)-fusion protein
                     localizes to the cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496839.1"
                     /db_xref="GeneID:8204096"
                     /db_xref="UniProtKB/TrEMBL:C5DVT7"
                     /translation="MSGDNSRRRRKKFTFKTIENDKSYNELKELPVIPSHRQLLEGSI
                     FDAVGPNFKQLKEDISSLYSVIERDVSNENRQIGLVELQLKKSLKRVNHAYNEVAVER
                     DQNRAASYNSRLLGNFFDKEDNVQNSVNEIDVLVSGILSNIVQIDNKFPKKSQMLKED
                     LVNKQHYPLLFQLLNEKFPKVSSPLSTPSIPLPPQSIPSQNSLERSSPKESSHDETET
                     ATPPQNKIKTQFMPPTLRRKICAPSTSTTLENINASEIINIKRSE"
     gene            <799742..>800153
                     /locus_tag="ZYRO0D09328g"
                     /db_xref="GeneID:8204097"
     mRNA            join(<799742..799760,799837..>800153)
                     /locus_tag="ZYRO0D09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496795.1"
                     /db_xref="GeneID:8204097"
     CDS             join(799742..799760,799837..800153)
                     /locus_tag="ZYRO0D09328g"
                     /note="similar to uniprot|P40005 YEL003w Saccharomyces
                     cerevisiae GIM4 subunit of the heterohexameric cochaperone
                     prefoldin complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496840.1"
                     /db_xref="GeneID:8204097"
                     /db_xref="GOA:C5DVT8"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR027235"
                     /db_xref="UniProtKB/TrEMBL:C5DVT8"
                     /translation="MDQRNNNFQLKYNEYKNTLEELQEKVIELGRDKDEHEVVLKTLN
                     DTDPIRKCYRMVGSSLVESDVKTTIPILETNNKKITETISTMKSELIKTAQEFEKWKK
                     DNKIQVVRQ"
     gene            complement(<800278..>801555)
                     /locus_tag="ZYRO0D09350g"
                     /db_xref="GeneID:8204098"
     mRNA            complement(<800278..>801555)
                     /locus_tag="ZYRO0D09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496796.1"
                     /db_xref="GeneID:8204098"
     CDS             complement(800278..801555)
                     /locus_tag="ZYRO0D09350g"
                     /note="similar to uniprot|P33767 YEL002C Saccharomyces
                     cerevisiae WBP1 wheat germ agglutinin-binding protein
                     oligosaccharyl transferase glycoprotein complex beta
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496841.1"
                     /db_xref="GeneID:8204098"
                     /db_xref="GOA:C5DVT9"
                     /db_xref="InterPro:IPR005013"
                     /db_xref="UniProtKB/TrEMBL:C5DVT9"
                     /translation="MVSIFITFFLALCGNVYAASVHASKTLVLYDERLDQLDSFSNFL
                     DDLKSREYEIDYYTANSTADIELYEGENRLYDNLIVLPVKGKHINKLISDKTLLQFYN
                     DGGDILSVTSPGAVPDSIRLFLNQLGIFPSPKGYELVDNVQGSLKIGSSEYRGSRIYE
                     AKDGDSISLSSSSAALLDNREQIFPILAAPRTSYTGATSKDPWSVGSQGFLAAAFQNL
                     KNARVAWLGSVDFLKNEFYGSNGNFVQEVAKWVFQEKNVIKSVSASHFHADGTSYEEV
                     PYKIKDTVIYEVGFSEWNGEKWVPFITDDIQFELKMLDPYYRLTLKPGRQEGEVQYYT
                     TGEFNLPDHHGVFTFETDYKRDGFSFAVQRDVKPIRNLAHSEYARSWDISNAVIYLSS
                     IFSVIFAWIIFIIFFITASPAVSKSVNTSKKNN"
     gene            complement(<801844..>802095)
                     /locus_tag="ZYRO0D09372g"
                     /db_xref="GeneID:8204099"
     mRNA            complement(<801844..>802095)
                     /locus_tag="ZYRO0D09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496797.1"
                     /db_xref="GeneID:8204099"
     CDS             complement(801844..802095)
                     /locus_tag="ZYRO0D09372g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496842.1"
                     /db_xref="GeneID:8204099"
                     /db_xref="UniProtKB/TrEMBL:C5DVU0"
                     /translation="MVFHCFSPPSFLEPKYLLDPVSCCSLSTCSRRTAIFSSMVSSLF
                     SISSAVCSPSCRAFQACANSLGSTPLLLVVSSTVIQENV"
     gene            complement(<802253..>805078)
                     /locus_tag="ZYRO0D09394g"
                     /db_xref="GeneID:8204100"
     mRNA            complement(<802253..>805078)
                     /locus_tag="ZYRO0D09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496798.1"
                     /db_xref="GeneID:8204100"
     CDS             complement(802253..805078)
                     /locus_tag="ZYRO0D09394g"
                     /note="similar to uniprot|P40559 YIL002C Saccharomyces
                     cerevisiae INP51 Phosphatidylinositol 4 5-bisphosphate
                     5-phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496843.1"
                     /db_xref="GeneID:8204100"
                     /db_xref="GOA:C5DVU1"
                     /db_xref="InterPro:IPR000300"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="UniProtKB/TrEMBL:C5DVU1"
                     /translation="MRIFIGRSPRSIVLSSNGYNLSFRRIFGVSGNQQQQQQNIKTPV
                     VALKSIPDHELTEENGYVEIKNRILNGLLGLVSVNGDLFVAVITGVQKVGFPRWRQED
                     GHIVTTENVYKVLDVDFHSLDTPVFDSLFQEISEQNYEKLTNEHPCGAFKKLFSDGTF
                     YFSRNFDISNVLKSHGLAHSMDYTIDNQDKNFIWNSNLVTELINWRSRIAAEEKQCFD
                     GEFLTFLMRGFYKTQVVDMVDSLATITLVSRISAESKQNAFDLDGIDEDGRVSNFIET
                     EIIVTTSNFIFSYTQVNGNVPLFWETTEGQLLYGRKLKLTKSLEHTQAAFDRHFDNIA
                     SKYGVVSVVNLMKPKSESQESLGNGYKTCADLKGIKFTNVDYGSGLLTKTPHKLLYLL
                     KQDIYEFGTVVYNRDKGVYIGKQTGVFRISAFDSIERPNTVERLVSREVLELATNELS
                     GLDITSAFLKVHDRLWSENYYWIERTYSKNVRNPGKYKKIYTKLFSSKIKLYDPLHST
                     ISHHLRQRRSTYTFERNISVFAGTFNLSGKVPAEDLSSWIFPEPGRQEDMYVIGLEEV
                     VELTPGRMLTTDPYLKQHWEKIILSHLNSSGERKYGCPWSSQLGAIMLMLFVSETQYP
                     RVKHIEGDVKKTGFGGMTSNKGAVAVSFKYSATKFCFLVSHLAAGLENVEQRHNDYKT
                     IVKNIRFPSSLRIRDHDAIIWMGDFNYRILMPNEEVRRLIVERKYGSLFEKDQLNQQM
                     IAGEAFPYYNEMEINFDPTYKFDPGTKTYDTSEKMRIPAWTDRILSRGEVLKQLTYGC
                     APDILFSDHRPVYATFSAQVTVVDEQKKAALSSYIYSKIAEKLATINEEEKIAILNAG
                     GPLIDGIDEESVSTVHEDTPASAKHKRTLKPPSSELRRWWLGNGKQVKVVLDVDSKQY
                     MVNPKKPVNPFMENEEPLFVQKPNHHT"
     gene            <805323..>806861
                     /locus_tag="ZYRO0D09416g"
                     /db_xref="GeneID:8204101"
     mRNA            <805323..>806861
                     /locus_tag="ZYRO0D09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496799.1"
                     /db_xref="GeneID:8204101"
     CDS             805323..806861
                     /locus_tag="ZYRO0D09416g"
                     /note="similar to uniprot|P40560 YIL001W Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496844.1"
                     /db_xref="GeneID:8204101"
                     /db_xref="InterPro:IPR000210"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR013069"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DVU2"
                     /translation="MDKNFNDLCYACRIGDTDNADRLISTGVNLNGLDEFDNSPLFLA
                     SLCGHEEVVKLLLERGAVCDRDRFEGARCVYGALNDSIRDILVKRDISKAVDINQPFV
                     MHISSLFKDWSLNTHDIQISPPKEINDNGLKLHKFLLSTRSLKLRYNLSTVWNNKSKL
                     TTDIPTSVLNIITKFIYLIPVLHEINMSDYNTLLQISLQWDLELLSEYLNRLKDVADS
                     SEKSTLMAEYQYRFTEDARDQLKRFVNDNILKCSIDLHSTTNFEEGIQFAENCVAFPD
                     LLLLVENFNEDKRIYPCHLAILSRANYFRMMFSLPMEEKATYQEYKDFKDSRRLPLIS
                     LPSCDFEVAEIILRYLYHDSSEIPWQYAIDVLLMADFLLEDRMKSMAAVVMTQSKDFL
                     EKHSIFDILYVAWETKMERLEQFAAKVIAFDLKNYTKETELKNAIIKSSQMISVREET
                     DTIELVDDIRFYLLEKYAFEPDDIDILSEEKDIQLLKASGILDYQQDVAIIDNLLDEL
                     TLQA"
     gene            complement(<806911..>807669)
                     /locus_tag="ZYRO0D09438g"
                     /db_xref="GeneID:8204102"
     mRNA            complement(<806911..>807669)
                     /locus_tag="ZYRO0D09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496800.1"
                     /db_xref="GeneID:8204102"
     CDS             complement(806911..807669)
                     /locus_tag="ZYRO0D09438g"
                     /note="weakly similar to uniprot|P40006 Saccharomyces
                     cerevisiae YEL001C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496845.1"
                     /db_xref="GeneID:8204102"
                     /db_xref="GOA:C5DVU3"
                     /translation="MASINIELEQTLLHVTIKIKLSYSKMKLFQLTLFLLVNAFLALA
                     SSESVDVESSSNETAVEEPSTIDFDVGYNILEHLDTDLSRGVEFSMQEVATFNYSFTN
                     NEKVNVSVVGVAGSVISTPDGYQVANITEQPIGPVPIGVNETANFQAGVQLILPEGNF
                     YMLPVLNVMKDGEPLRVGIRPLLITVNPPPLSFFNPSFLSVQILLGLLIAGATYAFIT
                     FDKSETKRKPAKNAKPVAVDQSWLPDTYKKPEKP"
     misc_feature    807719..807885
                     /note="Centromere Zyro0D"
     gene            complement(<808223..>809092)
                     /locus_tag="ZYRO0D09482g"
                     /db_xref="GeneID:8204103"
     mRNA            complement(<808223..>809092)
                     /locus_tag="ZYRO0D09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496801.1"
                     /db_xref="GeneID:8204103"
     CDS             complement(808223..809092)
                     /locus_tag="ZYRO0D09482g"
                     /note="similar to uniprot|P40561 Saccharomyces cerevisiae
                     YIR001C SGN1 Cytoplasmic RNA-binding protein contains an
                     RNA recognition motif (RRM) may have a role in mRNA
                     translation as suggested by genetic interactions with
                     genes encoding proteins involved in translational
                     initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496846.1"
                     /db_xref="GeneID:8204103"
                     /db_xref="GOA:C5DVU4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DVU4"
                     /translation="MSVEEASQRQEQLSGSKQEVPMESKDEGCVVDGKEQSQEKEGQN
                     VLDDQLKGLSIEDNIELKGPPKLSREEKYTLQVEADARSIFVGNISPDVTPEIIEEHF
                     AECGEIKRITLLHDKHTGVPKGYAYVQFESSEVQENALKLNGTELKGNKINVYKKRTN
                     LPGYHRYSQDQRPVYYPNQWGYTYTGFPDFKGMNFFPPYPFQPDQRKHFGGFNYSYRG
                     KQRNNYRGGRRGNGARHFHKYEGRPRQNDQRQDVDQQQILENGEQFSSNENPSDEQPR
                     KELKDSDGAQTLN"
     gene            <809724..>810428
                     /locus_tag="ZYRO0D09504g"
                     /db_xref="GeneID:8204104"
     mRNA            <809724..>810428
                     /locus_tag="ZYRO0D09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496802.1"
                     /db_xref="GeneID:8204104"
     CDS             809724..810428
                     /locus_tag="ZYRO0D09504g"
                     /note="similar to uniprot|P40007 YER002W Saccharomyces
                     cerevisiae NOP16 Constituent of 66S pre-ribosomal
                     particles involved in 60S ribosomal subunit biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496847.1"
                     /db_xref="GeneID:8204104"
                     /db_xref="InterPro:IPR019002"
                     /db_xref="UniProtKB/TrEMBL:C5DVU5"
                     /translation="MTSVRRRKMNKSSVGKATRRNKDRQRKINIASNPIIAANWDYNL
                     TLKQNYKRLGLTAQLQKPAGGEEADYSKDQRKEPLVKPEIEDESDEDDEDKQEEEEND
                     KSDDEEEFDASKIPEGEARIKRDENGNVLEVIYGQKKNFDPSEDEQQNENQADNESAK
                     TEVVRQLEEIANAPRAKKERDMSAREEEWLERLYNKHGDNYRKMFFDNKLNIYQQSEG
                     DLRKRIRAWKKKHNIE"
     gene            complement(<810563..>811955)
                     /locus_tag="ZYRO0D09526g"
                     /db_xref="GeneID:8204105"
     mRNA            complement(join(<810563..811818,811925..>811955))
                     /locus_tag="ZYRO0D09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496803.1"
                     /db_xref="GeneID:8204105"
     CDS             complement(join(810563..811818,811925..811955))
                     /locus_tag="ZYRO0D09526g"
                     /note="highly similar to uniprot|P29952 YER003C
                     Saccharomyces cerevisiae PMI40 mannose-6-phosphate
                     isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496848.1"
                     /db_xref="GeneID:8204105"
                     /db_xref="GOA:C5DVU6"
                     /db_xref="InterPro:IPR001250"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR016305"
                     /db_xref="InterPro:IPR018050"
                     /db_xref="UniProtKB/TrEMBL:C5DVU6"
                     /translation="MSDSFFRLDAGYQQYDWGKIGSSSAVAQFASHSDPSLKIEEDKP
                     YAELWMGTHPKVPSLRHDDKKSLRDIIATDPKKILGSAVCDKFQTTNSLPFLFKILSI
                     NKVLSIQAHPDKALGKVLRAQDPTNYPDDNHKPEMALAVTDFEGLCGFKPLEEIADEL
                     NRIPELRNIVGEEVANEFSRKIHSGAVGGSSEDEENKKLLQAVFGKVMNASDEVVAQN
                     ARNLVKRAHERPNDFNNSDLPELIIRLNEQFPDDVGLFCGCLLLNHCKLQAGEGMFLR
                     AKDPHAYINGDIVECMAASDNVVRAGFTPKFKDVDNLVSMLTYSYDPVEEQKMKPKPW
                     EKSSGAGVTTNFDPPIEEFAVMYTTFKDAVGTRHFEGLEGASILITTKGNGEITANGT
                     TLKAEPGYVFFIAANTSVDLKALDTDFTTFRAFTSL"
     gene            <812531..>813208
                     /locus_tag="ZYRO0D09548g"
                     /db_xref="GeneID:8204106"
     mRNA            <812531..>813208
                     /locus_tag="ZYRO0D09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496804.1"
                     /db_xref="GeneID:8204106"
     CDS             812531..813208
                     /locus_tag="ZYRO0D09548g"
                     /note="similar to uniprot|P40008 Saccharomyces cerevisiae
                     YER004W FMP52 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496849.1"
                     /db_xref="GeneID:8204106"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DVU7"
                     /translation="MSALILGATGLCGGSFLRNAIASDKFTEVFTITRRELPSDADNV
                     KQIVETDSSKWAQLFPETGVKFYFSAFGTTRAAAGSAENFYKIDHDLNVELAKAAKTK
                     GCTTMVLVSSVGANENSMLPYFKDKGEIERDILALDFDHTIILRPGPLLGRQKSKGFL
                     DGITCKLSSAIYGTPLQSLFSHPVYGEDVGKVGVDLALQSAALGAKSEKVRIVTSSEI
                     RDIASKI"
     gene            <813464..>815401
                     /locus_tag="ZYRO0D09570g"
                     /db_xref="GeneID:8204107"
     mRNA            <813464..>815401
                     /locus_tag="ZYRO0D09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496805.1"
                     /db_xref="GeneID:8204107"
     CDS             813464..815401
                     /locus_tag="ZYRO0D09570g"
                     /note="similar to uniprot|P40009 YER005W Saccharomyces
                     cerevisiae YND1 Yeast Nucleoside Diphosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496850.1"
                     /db_xref="GeneID:8204107"
                     /db_xref="GOA:C5DVU8"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:C5DVU8"
                     /translation="MPNSGNDRYGIVVDAGSSGSRANIFKWEDPESLIHRKEDPNHGH
                     ILHSVPKIYQEDGWTKKVTPGLSSYGNKPHEAFSKHIKPLLEFAQNIIPAEKIKDTPI
                     FIQATAGMRMLPPKKKDKILKKLCKSIKRSTGFLLEDCSSQIQVIDGETEGLYGWLGL
                     NYLFGHFNDYDTSTSSHFTFGFMDMGGASTQIAFAPSVSGEVEKHRDDITTVYLKSIN
                     GEVQKWDVFVSTWLGFGANEARKRYLAQLINSLPENTNDRDDDDFSTLQLSDPCMPKN
                     CRTSFDFKNKNFKVLGTGNYEQCLKSIYPLLLKHLPCIDEPCLFNGVHAPQIDFYNDK
                     FVGTSEYWYTANDVFKLGGAYNFEKFSAQVKEFCGNDWDNIQANHQKGLYHDIPAKFL
                     ADSCFKANWVLNVLHEGFGLPRAGVDKIDDIGQHPLFQSAEKINERELSWTLGRILLY
                     ASGGVMAGANDVTVGVMPSSNSAATSGKKFLAGAIGAPQYGGHPIISTFKFVMLLLIA
                     VIFWFFCIKRGSALELKNWINSLYIKIKYSQLRSDIQTRLEEGTLHRNENTSNNDANY
                     PLDDREGFKFRSKSMFNICEDVRQSGPRQPIHQTLSFTGPPNFHSSSAASSPQVSKGL
                     RPAFSLADFSKFKDKDSKLND"
     gene            <815689..>817227
                     /locus_tag="ZYRO0D09592g"
                     /db_xref="GeneID:8204108"
     mRNA            <815689..>817227
                     /locus_tag="ZYRO0D09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496806.1"
                     /db_xref="GeneID:8204108"
     CDS             815689..817227
                     /locus_tag="ZYRO0D09592g"
                     /note="similar to uniprot|P40010 Saccharomyces cerevisiae
                     YER006W NUG1 GTPase that associates with nuclear 60S
                     pre-ribosomes required for export of 60S ribosomal
                     subunits from the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496851.1"
                     /db_xref="GeneID:8204108"
                     /db_xref="GOA:C5DVU9"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR014813"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DVU9"
                     /translation="MALRKKTSKRTSTRLREGIKKKAAAHRRKERKLTKKDPTWKSKS
                     KKDPGIPSSFPYKGKILEEIEHAKVKSLEEKEIAKQQKLEAKRRAMEAGEMDEDMNED
                     EDEEDQNGLAALVESAQHAAEEYEDANGEPDAMDEDDDNLDVINYNVDFYGDSEEGDS
                     ELDKSRKAYDKIFKAVVDASDVILYVLDARDPEGTRSRKVEEAVLQSQGKRLILLINK
                     VDLIPPYVLEQWLNVLRSSFPTIPLKSAPGATTATSFNKKLSQSVTANALMESLKKYA
                     TNNNLKRSIVVGVIGYPNVGKSSVINALISRRNGSSKACPVGNEAGVTTSLREIKVDN
                     RLKILDSPGICFPSETKKKSKTDQEAELALLNALPPKHIVDPYPAVLLLIKRLSKSPE
                     MTEDFKKLYELPPIPAGDADTFTKHFLIHVSRKRGRLGKGGVPNMASAGLSVLNDWRD
                     GKIKGWTLPKASKDAVTHSLNAGQQQPPEKVEQATMVSEWSKEFDLDGLFASLDSAID
                     AEKK"
     gene            <817421..>818914
                     /locus_tag="ZYRO0D09614g"
                     /db_xref="GeneID:8204109"
     mRNA            <817421..>818914
                     /locus_tag="ZYRO0D09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496807.1"
                     /db_xref="GeneID:8204109"
     CDS             817421..818914
                     /locus_tag="ZYRO0D09614g"
                     /note="similar to uniprot|P39937 Saccharomyces cerevisiae
                     YER007W PAC2 Microtubule effector required for tubulin
                     heterodimer formation binds alpha-tubulin required for
                     normal microtubule function null mutant exhibits
                     cold-sensitive microtubules and sensitivity to benomyl"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496852.1"
                     /db_xref="GeneID:8204109"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DVV0"
                     /translation="MVHKVNDRVQIDGKSCTIRFVGEIHRWPGSITYGVEWDDSKRGR
                     NSGTIDDQEYFKTAVPNAGSFLKETKWSLLLDSGVSFYEALQEKYGKPKREKEDIYLG
                     TKRVESFGFEKLTVEEQDLGKLQGLCLDHCKISCLESGRNKISNNYSNIFELDLSYNL
                     LADVREICEFISHFRDLKFLDLSGNYFTKGWHSLDQYSFPAVTVLYLSNCRLDLNQLR
                     QLLKIFPSVEILDASKNYLKDIDSTDVDFPISVGELILSGNSIRYLPPSLSRWNLHTL
                     NLSHNAIENISNVPTTDLKNLDLSHNLIADWKTLDQLNIGFPELHSLRVNGNLFFENR
                     EDRLAQFYLVIARFNHLNILNGSLLSKKEREEARLFFVSQVSRGLVQYDKSCELWCRL
                     YYQYAPRYEIEGIEESWLGSQILSLRVKQEETQTILNLTILSSYTVRNLKRIICQQLS
                     MNILKITLSYFIAPSVLEEVSQDFTPVSDLNLTNGDILYVKRKQSEH"
     gene            complement(<819030..>819640)
                     /locus_tag="ZYRO0D09636g"
                     /db_xref="GeneID:8204110"
     mRNA            complement(join(<819030..819564,819630..>819640))
                     /locus_tag="ZYRO0D09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496808.1"
                     /db_xref="GeneID:8204110"
     CDS             complement(join(819030..819564,819630..819640))
                     /locus_tag="ZYRO0D09636g"
                     /note="similar to uniprot|P89886 Saccharomyces cerevisiae
                     YER007C-A TMA20 Protein of unknown function that
                     associates with ribosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496853.1"
                     /db_xref="GeneID:8204110"
                     /db_xref="GOA:C5DVV1"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016437"
                     /db_xref="UniProtKB/TrEMBL:C5DVV1"
                     /translation="MFRKFAKEDVHSRSNVKSSVQRSLKSKLVSQYPKLEDVIDELIP
                     KKSQVELIKCEDKIQLYSVDGEILFFQKFAELIPTLKLVHKFPDAYPTVQVDRGAIKF
                     VLSGANIMCPGLTSPGASLPEAPGYEKDSVVVINAENKESALAIGKLMMSTEEIKSIN
                     KGHGVEMIHHLSDPLWHFNLD"
     gene            <820293..>821951
                     /locus_tag="ZYRO0D09658g"
                     /db_xref="GeneID:8204111"
     mRNA            <820293..>821951
                     /locus_tag="ZYRO0D09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496809.1"
                     /db_xref="GeneID:8204111"
     CDS             820293..821951
                     /locus_tag="ZYRO0D09658g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496854.1"
                     /db_xref="GeneID:8204111"
                     /db_xref="UniProtKB/TrEMBL:C5DVV2"
                     /translation="MTKQTITLVSHSVCGKRKADEAEISPRVSIKVVDDETWTTFHYS
                     NNPPVFWGSNKRNNWRSIVSSPLFKNSTSSAVDDDTKPTKRLHKEEKVVENQIKNSVT
                     ASVEKPQQFHLRDGGTVSPIEHGAKDSTITAEANEIKIITAAAPATTITGSESEEKVH
                     KIRFWCNKRVGAPEKSSTSQGEANRERSSKKHQIRRWLNKEGPETILAQRIKKARYDF
                     SLAAAEAAMVAAVRNRAKKAAKAGAFTAAAVTRVIAAEMCPHASHGSIADAISEACKD
                     VAKTSLVQRAENGDYLRLHGLFHYHYKFRGPDYYKALEPCCYYTMKSDGEPTIHCKMD
                     EPVETFRGSAVANDSPLVLFLKQVAEEGGRTSQNDTDTDIDEDVDSHVQTKPRSEIPT
                     VPTRAKDEIMPAKKGEQDSKPPHNKQQLDKSPVLSGESDVSTTPKLQLDDFFIIKSGD
                     IGSDVRSQAVPLKPTVKRHKDEDCSYGVDKTSMLTPIKHFLETLDLHPTIDENVNPDA
                     ERGKSLPRTVSKCIWHDKTLEPTSQFRIGSQYLSIRTSSVGMVR"
     gene            <822060..>823580
                     /locus_tag="ZYRO0D09680g"
                     /db_xref="GeneID:8204112"
     mRNA            <822060..>823580
                     /locus_tag="ZYRO0D09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496810.1"
                     /db_xref="GeneID:8204112"
     CDS             822060..823580
                     /locus_tag="ZYRO0D09680g"
                     /note="similar to uniprot|Q12374 Saccharomyces cerevisiae
                     YPR155C NCA2 Protein involved in regulation of
                     mitochondrial expression of subunits 6 (Atp6p) and 8
                     (Atp8p) of the Fo-F1 ATP synthase functions with Nca3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496855.1"
                     /db_xref="GeneID:8204112"
                     /db_xref="InterPro:IPR013946"
                     /db_xref="UniProtKB/TrEMBL:C5DVV3"
                     /translation="MITDKYVLESLDKLSQRGSPSEQLESYIQSVSRSIQQGKYRRIS
                     LPIKTLKEIKEDSLTVNYVAILCYYVLTNECLLKLPRAYEAVRYFKSAQSSQRNQLLY
                     SLQTAPERLWKSLPGLPKHPIRSDLLSRLTQCEDFANRYTESLGRLMVEFRAGDQLPP
                     KEELQRRLNALSQFLQLDSVNIVEILQATEKLTEGIGSATTAVTRNVPPVKPPSFVTR
                     YWPAAFLALCYGPTSLMALWQSRETIKRFVQENVIDFVRGLIINWVYTPLRQVWATVR
                     HDDDSSIAVMSQGTLSSESSSLTRMIVHFMQENTSQPLNEEQLVSQVEKGDLTQFLKI
                     YETQLEHPVRNIASGALIRSLLIQIQKTKVDGSLALNGIDRMLQSQQLVFGVVALSPA
                     LVIIYTLTTSAYRLCKIGRLWSYESQHKEILSRSLNNAERLLNYDGVEAEESYWNQGL
                     LAIEVTTVYQMGLTLLPRNMRKEWTRDVAELTDPKLSLRSRLNVVYRIYHTYSKYF"
     gene            complement(<823900..>824376)
                     /locus_tag="ZYRO0D09702g"
                     /db_xref="GeneID:8204113"
     mRNA            complement(<823900..>824376)
                     /locus_tag="ZYRO0D09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496811.1"
                     /db_xref="GeneID:8204113"
     CDS             complement(823900..824376)
                     /locus_tag="ZYRO0D09702g"
                     /note="weakly similar to uniprot|Q06449 Saccharomyces
                     cerevisiae YPR154W PIN3 Protein that induces appearance of
                     [PIN ] prion when overproduced"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496856.1"
                     /db_xref="GeneID:8204113"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DVV4"
                     /translation="MGGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCN
                     GRVGMFPSNYVKPAFSGGFDRPAAPPPPQYDQKAMASQPSGGNAMWQQPSPYPPPSTN
                     YYQPPPPQQQQPQPMVVQQEQGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF"
     gene            complement(<825339..>825758)
                     /locus_tag="ZYRO0D09724g"
                     /db_xref="GeneID:8204114"
     mRNA            complement(<825339..>825758)
                     /locus_tag="ZYRO0D09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496812.1"
                     /db_xref="GeneID:8204114"
     CDS             complement(825339..825758)
                     /locus_tag="ZYRO0D09724g"
                     /note="similar to uniprot|Q06HN0 Saccharomyces cerevisiae
                     YPR153W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496857.1"
                     /db_xref="GeneID:8204114"
                     /db_xref="UniProtKB/TrEMBL:C5DVV5"
                     /translation="MRSFITTNDVPVGYETPSFPSLYWPTESRTSLHVIYDVSAIWKF
                     TLYWSLIFNFGFYALTGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGN
                     IYSSGLFSMSTWIPFCCAVAQVLYDFTASFSSSASIL"
     gene            complement(<825992..>826753)
                     /locus_tag="ZYRO0D09746g"
                     /db_xref="GeneID:8204115"
     mRNA            complement(<825992..>826753)
                     /locus_tag="ZYRO0D09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496813.1"
                     /db_xref="GeneID:8204115"
     CDS             complement(825992..826753)
                     /locus_tag="ZYRO0D09746g"
                     /note="highly similar to uniprot|P23638 Saccharomyces
                     cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
                     the only nonessential 20S subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496858.1"
                     /db_xref="GeneID:8204115"
                     /db_xref="GOA:C5DVV6"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DVV6"
                     /translation="MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGI
                     VLAAERKVTSKLLEQDTSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTY
                     NEDIPVEILVKRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGW
                     KAISVGANTSAAQTLLQVDYKDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKL
                     GENGKLYQKVFKPEEIQTLLVKNGITKAGEDEDEE"
     gene            <826977..>828359
                     /locus_tag="ZYRO0D09768g"
                     /db_xref="GeneID:8204116"
     mRNA            <826977..>828359
                     /locus_tag="ZYRO0D09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496814.1"
                     /db_xref="GeneID:8204116"
     CDS             826977..828359
                     /locus_tag="ZYRO0D09768g"
                     /note="similar to uniprot|Q06525 Saccharomyces cerevisiae
                     YPR152C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496859.1"
                     /db_xref="GeneID:8204116"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="UniProtKB/TrEMBL:C5DVV7"
                     /translation="MARIWREYVAPDGRKYYYNAVTKQSTWHKPESLDEMDENRGVKR
                     FKKIESKPHVALELYHGWHLVICDTGKKFYYNVETNESAWNLPDEGSRNLIDALDKNK
                     LVALIGLARGYSPGGLHIYEELVTDLVKLRQEREAKRAEGDQEKDEATGEEVKDEDEE
                     KDKANGEEVKEEDRDQNDGEDNDAQNGLVAGYSSSSESEDEGEGEGEGEEPLNIPITE
                     SVEEPVDISGDKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEE
                     WCAHAISGDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIKNDN
                     KSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENLS
                     NDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKML
                     ELNDYLKIYV"
     gene            complement(<828446..>831988)
                     /locus_tag="ZYRO0D09790g"
                     /db_xref="GeneID:8204117"
     mRNA            complement(<828446..>831988)
                     /locus_tag="ZYRO0D09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496815.1"
                     /db_xref="GeneID:8204117"
     CDS             complement(828446..831988)
                     /locus_tag="ZYRO0D09790g"
                     /note="similar to uniprot|P53280 Saccharomyces cerevisiae
                     YGR134W CAF130 Part of the evolutionarily-conserved
                     CCR4-NOT transcriptional regulatory complex involved in
                     controlling mRNA initiation elongation and degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496860.1"
                     /db_xref="GeneID:8204117"
                     /db_xref="UniProtKB/TrEMBL:C5DVV8"
                     /translation="MVKKRKSKTNSSNVTESAFNGNGNNINKEEYIPLGALKDEDMLD
                     LKMISLEELLAERELDYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAG
                     LSVLALLKPSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFL
                     LKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKW
                     LRRAISYGNGVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDD
                     KEIEAVSQIESNDQEERIQIIDQIRSAIQDISSASLNSGFYGDEDRSALEEYSDNYHH
                     QVNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVLKLNNSSSPLLQLQFKIVAG
                     LVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIID
                     ASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIY
                     KLYEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAA
                     ALRAIVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAELRSHAAALLALGS
                     ELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKT
                     HARKGFGRRCNCIFDDDEMLEDEDYENEYEGHKAPKQILPQQNPTTSVSMSTTGKPHA
                     IRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIE
                     SLLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDS
                     TFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSF
                     DENNENDNGDESISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLT
                     EKSKEWIGEEPMEDEATINDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECV
                     FELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVEN
                     DNINGNEAVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVV
                     YEGNEILPLPESETPMSLLDYLVDNYPPNVEHYE"
     gene            <833123..>833680
                     /locus_tag="ZYRO0D09812g"
                     /db_xref="GeneID:8204118"
     mRNA            <833123..>833680
                     /locus_tag="ZYRO0D09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496816.1"
                     /db_xref="GeneID:8204118"
     CDS             833123..833680
                     /locus_tag="ZYRO0D09812g"
                     /note="similar to gnl|GLV|CAGL0L08426g Candida glabrata
                     CAGL0L08426g and weakly similar to YPR151C uniprot|Q06524
                     Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
                     protein required for degradation of unstable forms of
                     cytochrome c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496861.1"
                     /db_xref="GeneID:8204118"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:C5DVV9"
                     /translation="MMSKRLFSTATIRSFKRKCCSSDIFRSMPRVPTTQFLESRELTR
                     DILFSGYRPVMYPVKENPLFKERTRNGELTDELQSRHNSGLRQGRTQEEEKESGEEYS
                     VIAGPRGCGGIASGGASGTWRNGAKMPSKLLPYSWWSTTSMGMEFFPEWEGVPRHVVR
                     KLKPFDRGHDTLDILESIKVNGNPK"
     gene            833908..833980
                     /locus_tag="ZYRO0D09834r"
                     /db_xref="GeneID:8204119"
     tRNA            833908..833980
                     /locus_tag="ZYRO0D09834r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.19"
                     /db_xref="GeneID:8204119"
     gene            complement(<834023..>834493)
                     /locus_tag="ZYRO0D09856g"
                     /db_xref="GeneID:8204120"
     mRNA            complement(<834023..>834493)
                     /locus_tag="ZYRO0D09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496817.1"
                     /db_xref="GeneID:8204120"
     CDS             complement(834023..834493)
                     /locus_tag="ZYRO0D09856g"
                     /note="some similarities with uniprot|P40185 Saccharomyces
                     cerevisiae YIL051C MMF1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496862.1"
                     /db_xref="GeneID:8204120"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="UniProtKB/TrEMBL:C5DVW0"
                     /translation="MRKGYYYLEYGTTKLCKTTVGTASNMSRVDWNQLGTSNPLLSPA
                     FVVSSAHHLVFTSGCLGTDDQDQLPECPAEQTKNAFENLSKVLEASGSSLSSVIKVLL
                     FVKDPALVPVVNRIYQKYFPEKPARSCIVVAFPNPKVQVELECVAVTKSRESKL"
     gene            complement(<834515..>834976)
                     /locus_tag="ZYRO0D09878g"
                     /db_xref="GeneID:8204121"
     mRNA            complement(<834515..>834976)
                     /locus_tag="ZYRO0D09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496818.1"
                     /db_xref="GeneID:8204121"
     CDS             complement(834515..834976)
                     /locus_tag="ZYRO0D09878g"
                     /note="similar to uniprot|P29340 Saccharomyces cerevisiae
                     YGR133W PEX4 Involved in peroxisome biogenesis Member of
                     ubiquitin-conjugating protein family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496863.1"
                     /db_xref="GeneID:8204121"
                     /db_xref="GOA:C5DVW1"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:C5DVW1"
                     /translation="MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRG
                     PSGTPYEGCNFRLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWS
                     PAWDLLHVVQAIGQLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYIKS"
     gene            <835139..>835990
                     /locus_tag="ZYRO0D09900g"
                     /db_xref="GeneID:8204122"
     mRNA            <835139..>835990
                     /locus_tag="ZYRO0D09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496819.1"
                     /db_xref="GeneID:8204122"
     CDS             835139..835990
                     /locus_tag="ZYRO0D09900g"
                     /note="similar to uniprot|P40961 Saccharomyces cerevisiae
                     YGR132C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496864.1"
                     /db_xref="GeneID:8204122"
                     /db_xref="GOA:C5DVW2"
                     /db_xref="InterPro:IPR000163"
                     /db_xref="InterPro:IPR001107"
                     /db_xref="UniProtKB/TrEMBL:C5DVW2"
                     /translation="MSSRLAETVAKVAIPLGIVASGIQYSMYDVRGGSRAVIFDRLSG
                     VQQEVVGEGTHFLVPWLQKAVIYDVRTKPKSIATNTGTKDMQMVSLTLRVLHRPQVLQ
                     LPHIYQNLGLDYDERVLPSIGNEVLKAIVARYDAAELITQRELVSNTIRDELSNRASE
                     FSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAERAKFLVEKAEQIRKVSVIRAEGEA
                     EAAESISKALAKAGDGLLLIRRLEASKDIAQTLANSSNVTYLPSQQSGGGQEGTSQSL
                     LLNLGRT"
     gene            <837954..>840722
                     /locus_tag="ZYRO0D09922g"
                     /db_xref="GeneID:8204123"
     mRNA            <837954..>840722
                     /locus_tag="ZYRO0D09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496820.1"
                     /db_xref="GeneID:8204123"
     CDS             837954..840722
                     /locus_tag="ZYRO0D09922g"
                     /note="similar to uniprot|Q06593 Saccharomyces cerevisiae
                     YPR194C OPT2 Oligopeptide transporter member of the OPT
                     family with potential orthologs in S. pombe and C.
                     albicans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496865.1"
                     /db_xref="GeneID:8204123"
                     /db_xref="GOA:C5DVW3"
                     /db_xref="InterPro:IPR004648"
                     /db_xref="InterPro:IPR004813"
                     /db_xref="UniProtKB/TrEMBL:C5DVW3"
                     /translation="MLNKFWHTKGPSVQEGEEKEEEYQDVFEGVEMNGENKPEVKHEV
                     RETNSSIESEKVDGDFGNTTNYYSDKPEIGVVETIISPSGKVSDEQWTVLLKKAGFDN
                     PDNITDIPADLKYVASQIVNMSLEEAAEVLKLGAEYHADDPNLSSDEYNDFVKLSELN
                     PVTLHPFEEDALELKAVAGLLHFHSPYKAVRACVSPQDDYESPVETFRSYFLALVWAI
                     IGSGFNEFFAHRLMVITISSSMVQLLLFPMGSLWAKIMPYWSFPIWKGKRIHLNIPQP
                     WSQKEQMFSTVLFSIAVSSFYMDSVILTLKMFYKEKVSFGYQFFTSIAVQFLGFGFAG
                     SLRRFVIYPSHAIWPSQLQTMALNKALFSKKTEKGGRGLTSQTFFYICVAFTFFYEWL
                     PTYLFQILSTFNWMTWIKPDNFNLAMVTGSMGGVGINPIASFDWNVINYYSALVTPLF
                     SYANQMAGGLIAAICVLAIYYSNQFDCQYLPMFSNALFTNTGTEYDVTSIINSKAEVD
                     VNKYQNYSPPYYSAGNLFCYGVFIASYPLLFAYSFLTQWKVLLRAFKDWASAIWSLTK
                     KHTWLYSWRESSHALEEFHDPHSRMMRRYNEVPDWWYYIVLILSIVIGIAALEGYHTN
                     TPIWSLFMAVGLNAVFLIPITILEATTALQLGLNVLIEIIMGYALPGNPQALMLIKAF
                     GYNIDGQADSYVGNLKLGHYSKIPPMALFRGQMFMVLIQTLVSLGVLNWSISNIKDYC
                     QPNQESKFTCPDAITYYNASVLWGAIGPKRIFEGVYPILKWCWLIGAIIGIGLGLWKL
                     LIPRFYPLWFNPLLVVGGMLNMAPPYNLTYMTPGAIANFFSQFYMRKYHLRIWQKYNY
                     VLVAGFQTGLVISSIIIFFSVQYKEKPISWWGNDVINNGLDAAGPPKKNVSLTPRGYF
                     GPEYGHFP"
     gene            complement(<840971..>841306)
                     /locus_tag="ZYRO0D09944g"
                     /db_xref="GeneID:8204124"
     mRNA            complement(<840971..>841306)
                     /locus_tag="ZYRO0D09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496821.1"
                     /db_xref="GeneID:8204124"
     CDS             complement(840971..841306)
                     /locus_tag="ZYRO0D09944g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496866.1"
                     /db_xref="GeneID:8204124"
                     /db_xref="UniProtKB/TrEMBL:C5DVW4"
                     /translation="MVLESKAVSKKSQESIAEKGNGELRGNLKERPRVTYSGPGVVYP
                     LEIPHMEICHRLKLWIPLIRKHVNRLAFAVCEISGRFSFPSYYCYSFCSFHRRCTFRI
                     LVSCPIGAI"
     gene            <841449..>841985
                     /locus_tag="ZYRO0D09966g"
                     /db_xref="GeneID:8204125"
     mRNA            <841449..>841985
                     /locus_tag="ZYRO0D09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496822.1"
                     /db_xref="GeneID:8204125"
     CDS             841449..841985
                     /locus_tag="ZYRO0D09966g"
                     /note="weakly similar to uniprot|Q12207 Saccharomyces
                     cerevisiae YPR149W NCE102 and to uniprot|P53279
                     Saccharomyces cerevisiae YGR131W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496867.1"
                     /db_xref="GeneID:8204125"
                     /db_xref="GOA:C5DVW5"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:C5DVW5"
                     /translation="MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMF
                     AAAFGIVADSFYGILANIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNR
                     HYLDSNKITQGSTSRCREAQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSS
                     RRRRTQQANVGVPTISQV"
     gene            <842706..>845690
                     /locus_tag="ZYRO0D09988g"
                     /db_xref="GeneID:8204126"
     mRNA            <842706..>845690
                     /locus_tag="ZYRO0D09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496823.1"
                     /db_xref="GeneID:8204126"
     CDS             842706..845690
                     /locus_tag="ZYRO0D09988g"
                     /note="weakly similar to uniprot|P53278 Saccharomyces
                     cerevisiae YGR130C Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496868.1"
                     /db_xref="GeneID:8204126"
                     /db_xref="UniProtKB/TrEMBL:C5DVW6"
                     /translation="MFRSKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVA
                     DRAEKSPSIKSSSRASARKSHLGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKV
                     HPKELGYRTMGRGSRRAKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHD
                     YTEGGKKKSGAKKGVKSTKSKPSAKSPGKPAIKAVSKSNDELETIPDNEVGSQYTFET
                     LPDGASYDYLIETEEVPAGAAHGKMSSKPVKLVRKGEKESKKEEATPDAESFNSKGPS
                     PEPATPEAGLKSKAEEQAGNELKEVPETSSTSKKAESKVESSAKDVVGDEKAEKAEKT
                     ENLLDRSEPLDAAKDSADKATRFKEGPVEKIPDTVIGDETLEIAPEKGAHGAAADVKK
                     GAKEAKKQSESDEGVVEATKVAAGEPESYEGAGVTENDSTPGPMVDDVHSDVSVTSPP
                     VDYAAVPRVVTFPEVEKKRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLS
                     KAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIK
                     DDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQ
                     KEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHK
                     KAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANE
                     KLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEAVAAGLKKQHEEE
                     LRKMKQDYEKRLQELKEHQSKQTAEAEATKARAAENETHGGVATHSVKSSGASGASGT
                     DGIKSTGAKSTGAKSTGAKSTDAKSTGAKSTDAKSTDAKPNATKSGVGATTKSTGPQA
                     TDSTSGKVHNPFTDSGVTKSKETRELTDNQGKPSGVVPYGSNVASGSTANDNRNTKQN
                     PSASRESSLFDYETEEEIRSVY"
     gene            <845993..>847141
                     /locus_tag="ZYRO0D10010g"
                     /db_xref="GeneID:8204127"
     mRNA            <845993..>847141
                     /locus_tag="ZYRO0D10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496824.1"
                     /db_xref="GeneID:8204127"
     CDS             845993..847141
                     /locus_tag="ZYRO0D10010g"
                     /note="similar to uniprot|Q06523 Saccharomyces cerevisiae
                     YPR148C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496869.1"
                     /db_xref="GeneID:8204127"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:C5DVW7"
                     /translation="MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRL
                     SIKTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYP
                     PNLPESFSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHEC
                     GEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLE
                     QLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQ
                     EPTNEPAKEEEKPTPAEPAEAQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSE
                     AVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN"
     gene            complement(<847175..>847804)
                     /locus_tag="ZYRO0D10032g"
                     /db_xref="GeneID:8204128"
     mRNA            complement(<847175..>847804)
                     /locus_tag="ZYRO0D10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496825.1"
                     /db_xref="GeneID:8204128"
     CDS             complement(847175..847804)
                     /locus_tag="ZYRO0D10032g"
                     /note="similar to uniprot|P53277 Saccharomyces cerevisiae
                     YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
                     involved in pre-mRNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496870.1"
                     /db_xref="GeneID:8204128"
                     /db_xref="InterPro:IPR013260"
                     /db_xref="UniProtKB/TrEMBL:C5DVW8"
                     /translation="MAIKGSQGSQMDLDQFIKDFNALKKKSWEISVENRKLVNAESKE
                     LAAGRKPRVYQLEAPEPSLPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQ
                     DMAKYTYDKELNKLHKDTMLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDM
                     DKTATERYEARRREMERSNVQNASSGGGYINEKNKQFNEKLDRQMPQSP"
     gene            <847992..>849986
                     /locus_tag="ZYRO0D10054g"
                     /db_xref="GeneID:8204129"
     mRNA            <847992..>849986
                     /locus_tag="ZYRO0D10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496826.1"
                     /db_xref="GeneID:8204129"
     CDS             847992..849986
                     /locus_tag="ZYRO0D10054g"
                     /note="similar to uniprot|P53276 Saccharomyces cerevisiae
                     YGR128C UTP8 Nucleolar protein required for export of
                     tRNAs from the nucleus also copurifies with the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496871.1"
                     /db_xref="GeneID:8204129"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018843"
                     /db_xref="UniProtKB/TrEMBL:C5DVW9"
                     /translation="MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITI
                     GISESAISQYILNPTPKLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLN
                     ASVKPVDADTVLDTDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQ
                     LQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIK
                     ELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQK
                     VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGS
                     EFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLF
                     SDDESDAGDNADSDEVVAFAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRER
                     FICDQEFLSKVVRLILDSFDQEYPRALTFLLTHPLFPTDCTRGLLERFRNHPRLFKQA
                     IVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVN
                     FLISPKDEELIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNA
                     RLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL"
     gene            <850134..>851051
                     /locus_tag="ZYRO0D10076g"
                     /db_xref="GeneID:8204130"
     mRNA            <850134..>851051
                     /locus_tag="ZYRO0D10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496827.1"
                     /db_xref="GeneID:8204130"
     CDS             850134..851051
                     /locus_tag="ZYRO0D10076g"
                     /note="similar to uniprot|Q06522 Saccharomyces cerevisiae
                     YPR147C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496872.1"
                     /db_xref="GeneID:8204130"
                     /db_xref="InterPro:IPR019363"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DVX0"
                     /translation="MSIRYLAGARLPTSVLHIKPKSPSPSSPLFVWIPGNPGIVQYYE
                     EFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKD
                     RPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVK
                     YLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALG
                     LAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYR
                     DRNLEISVSQDLAHSFIVKHSKYIVDEYF"
     gene            complement(<851071..>851901)
                     /locus_tag="ZYRO0D10098g"
                     /db_xref="GeneID:8204131"
     mRNA            complement(<851071..>851901)
                     /locus_tag="ZYRO0D10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496828.1"
                     /db_xref="GeneID:8204131"
     CDS             complement(851071..851901)
                     /locus_tag="ZYRO0D10098g"
                     /note="similar to uniprot|P53275 Saccharomyces cerevisiae
                     YGR127W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496873.1"
                     /db_xref="GeneID:8204131"
                     /db_xref="InterPro:IPR008551"
                     /db_xref="UniProtKB/TrEMBL:C5DVX1"
                     /translation="MLARRWIYPLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLD
                     QGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKFANQFSELDNTGDFNFFYGDC
                     KNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQGEETWPKVQLAKKNLRKL
                     IEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLG
                     TTTHAGFYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDLN
                     "
     gene            <852141..>853195
                     /locus_tag="ZYRO0D10120g"
                     /db_xref="GeneID:8204132"
     mRNA            join(<852141..852192,852258..>853195)
                     /locus_tag="ZYRO0D10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496829.1"
                     /db_xref="GeneID:8204132"
     CDS             join(852141..852192,852258..853195)
                     /locus_tag="ZYRO0D10120g"
                     /note="similar to uniprot|Q06675 Saccharomyces cerevisiae
                     YDR318W MCM21 Protein involved in minichromosome
                     maintenance component of the COMA complex that bridges
                     kinetochore subunits that are in contact with centromeric
                     DNA and the subunits bound to microtubules"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496874.1"
                     /db_xref="GeneID:8204132"
                     /db_xref="GOA:C5DVX2"
                     /db_xref="InterPro:IPR018464"
                     /db_xref="UniProtKB/TrEMBL:C5DVX2"
                     /translation="MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHP
                     VVKEFESVFTKFPKLYEVLARENQIVDSNDNDTSDEPSTVDSSFVKRRKLEFSDGSVQ
                     NKMFDKSIADLLGDTSSSTSPGKRRSKLQNFKGLESQVSIENAYRLFGITFFPLVDPS
                     DINFQRNDINRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNSWSLFKHTIPAFIDL
                     ESIFQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLISNLEIDLQIA
                     AVSFDIQGMKRVRLFLQDDQVISCDTFDDDELKMLLLGPVKELKLKLGRLLAS"
     gene            complement(<853192..>853959)
                     /locus_tag="ZYRO0D10142g"
                     /db_xref="GeneID:8204133"
     mRNA            complement(<853192..>853959)
                     /locus_tag="ZYRO0D10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496830.1"
                     /db_xref="GeneID:8204133"
     CDS             complement(853192..853959)
                     /locus_tag="ZYRO0D10142g"
                     /note="similar to uniprot|Q06676 Saccharomyces cerevisiae
                     YDR319C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496875.1"
                     /db_xref="GeneID:8204133"
                     /db_xref="InterPro:IPR019388"
                     /db_xref="UniProtKB/TrEMBL:C5DVX3"
                     /translation="MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFL
                     NPNNFINQIFAYRGNQIWTILFCGLAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKE
                     YAVKIILKNLLLAIIFLFIDNIFILTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGH
                     FCFLVSISMILWLELQHLESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSI
                     YYHTLLEKILGCAMGYICPIIMYWLIPNHDIVRKVLY"
     gene            <854166..>856364
                     /locus_tag="ZYRO0D10164g"
                     /db_xref="GeneID:8204134"
     mRNA            <854166..>856364
                     /locus_tag="ZYRO0D10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496831.1"
                     /db_xref="GeneID:8204134"
     CDS             854166..856364
                     /locus_tag="ZYRO0D10164g"
                     /note="highly similar to uniprot|P38604 Saccharomyces
                     cerevisiae YHR072W ERG7 Lanosterol synthase an essential
                     enzyme that catalyzes the cyclization of squalene 2
                     3-epoxide a step in ergosterol biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496876.1"
                     /db_xref="GeneID:8204134"
                     /db_xref="GOA:C5DVX4"
                     /db_xref="InterPro:IPR002365"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR018333"
                     /db_xref="UniProtKB/TrEMBL:C5DVX4"
                     /translation="MTKLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQ
                     SKYVQWLLQLPSFPKPSPKIHSGNAKKFNALEACKNGASFYQLLQDPDSGIFPCQYKG
                     PMFMTIGYVVVHYVAGIEIPKPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAIN
                     YVNLRLLGLPRDHPVCVKARRTLHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPET
                     WLLPYFLPIHPGRWWVHTRAIYLPVSYLSLIRYQCPLTPLLQELREELYVKPFNSIDF
                     GSNRNTVCGVDLYYPHSKVLDLMNSVLVFYEKHLRFNWINTMAKNRVYGLIKKEIANT
                     DYLCIAPVNQAFCALVTLIEEGVNSPQFKRFQFRFNDALFHGPQGMTMMGTNGVQTWD
                     CAFTIQSLFTAGLAEKEQYYETVVRAYEFLNRAQFQDECVPGSFRDLRKGAWGFSTKT
                     QGYTVSDCTAESIKAIIMVKKSPFYAKVHSLIDDERLCQAIDVLLSLQNVGPFEYGSF
                     ATYEMIKAPLLMEKLNPAEVFGNIMVEYPYVECTDSAVLGLTSFHDYCDYRRDEISDR
                     INIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFALEALHSVGEDYHNSKIVQKGCDFLV
                     DRQMADGGWGETMKSCELHTYVESQESMVVQTSWVIIALLLSKYPNKSVIDRAVKFLE
                     TRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKALGLYVNAFGKEAI"
     gene            complement(<856401..>858308)
                     /locus_tag="ZYRO0D10186g"
                     /db_xref="GeneID:8204135"
     mRNA            complement(<856401..>858308)
                     /locus_tag="ZYRO0D10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496832.1"
                     /db_xref="GeneID:8204135"
     CDS             complement(856401..858308)
                     /locus_tag="ZYRO0D10186g"
                     /note="similar to uniprot|Q06677 Saccharomyces cerevisiae
                     YDR320C SWA2 auxilin-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496877.1"
                     /db_xref="GeneID:8204135"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR015228"
                     /db_xref="UniProtKB/TrEMBL:C5DVX5"
                     /translation="MGDPFADLLTQFKGGESKPQNQGNKPLAAQYSENNTRETSSSLS
                     LQPEPVTTASNYKIDDDFEQLFGIKSNTNTNNSDVNNRPNTTNQNEFDSAIDLLQITP
                     EKQRQSAEREPEQLVDEVRDMEVAKLMSLGYSIDGANTSYEQGMLYDDVIEERKKKKL
                     HRRELQRLMAETNWERETPETNNDESGKNNVDLFSIASGIFNKGKKIVDHLSLFPDEE
                     NDLLPYRSERLKQRQTFEPELPRRPRKDPTPNPRTQGTPQVEYESTLQYQQPTIQAQE
                     GDLLGDFQDKLSLRSQGNKSTSASQSPSNETLLDFDAPSANSTSASVSVSRQGSVVPT
                     VPITEIELSGYNEFKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMAS
                     QLKTGQYKESLHVASMALKLFPEDTTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEH
                     SENFQEAFNAYQSLIEKNFCTNKIMDGKRRCQKVLNPEKPKVVQKKPASSKSPSPSPN
                     HSDKKYKNLQKVKEDNRKQAEEDTQRHALYDRVYDQIKLWESGKANDIRHLLSNLQTV
                     LTWVDWKPVSPADLVMPKKVKITYLRAVAKTHPDKISDSLPLDKKMIAESVFSSLSSA
                     WEKFKSENDIN"
     gene            <858591..>858785
                     /locus_tag="ZYRO0D10208g"
                     /db_xref="GeneID:8204136"
     mRNA            <858591..>858785
                     /locus_tag="ZYRO0D10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496833.1"
                     /db_xref="GeneID:8204136"
     CDS             858591..858785
                     /locus_tag="ZYRO0D10208g"
                     /note="highly similar to uniprot|Q6Q547 Saccharomyces
                     cerevisiae YHR072W-A NOP10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496878.1"
                     /db_xref="GeneID:8204136"
                     /db_xref="GOA:C5DVX6"
                     /db_xref="InterPro:IPR007264"
                     /db_xref="UniProtKB/TrEMBL:C5DVX6"
                     /translation="MHLMYTLGPDGKRAYTLQKVTEEGEITKSAHPARFSPDDKYSRQ
                     RVTLKRRYGLLPGQQQQQQQ"
     gene            complement(<858919..>859137)
                     /locus_tag="ZYRO0D10230g"
                     /db_xref="GeneID:8204137"
     mRNA            complement(<858919..>859137)
                     /locus_tag="ZYRO0D10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496834.1"
                     /db_xref="GeneID:8204137"
     CDS             complement(858919..859137)
                     /locus_tag="ZYRO0D10230g"
                     /note="highly similar to uniprot|P69851 Saccharomyces
                     cerevisiae YDR320C-A DAD4 Essential protein component of
                     the DASH complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496879.1"
                     /db_xref="GeneID:8204137"
                     /db_xref="GOA:C5DVX7"
                     /db_xref="InterPro:IPR013959"
                     /db_xref="UniProtKB/TrEMBL:C5DVX7"
                     /translation="MENPHEQVQINILSRILSNVERLNQSVSTLNQELANINRKNNNL
                     EIMGQICENYHNSIQFNLDTTGNRKPPL"
     gene            <860458..>863109
                     /locus_tag="ZYRO0D10252g"
                     /db_xref="GeneID:8204138"
     mRNA            <860458..>863109
                     /locus_tag="ZYRO0D10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496835.1"
                     /db_xref="GeneID:8204138"
     CDS             860458..863109
                     /locus_tag="ZYRO0D10252g"
                     /note="similar to uniprot|Q759H7 Ashbya gossypii ADR300C
                     ADR300Cp and weakly similar to YHR082C uniprot|P38691
                     Saccharomyces cerevisiae YHR082C KSP1 Nonessential
                     putative serine/threonine protein kinase of unknown
                     cellular role overproduction causes allele-specific
                     suppression of the prp20-10 mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496880.1"
                     /db_xref="GeneID:8204138"
                     /db_xref="GOA:C5DVX8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DVX8"
                     /translation="MTLDYEVYKEGGILNDRYQKVEDISEGSYGFVSLAKDTHKKKLV
                     AVKHFFKIEDKDEGEEDRKENDKKNDDRKSLCYEAICEIDIQTKLGNEHRNIVKLLDH
                     FDSYIVLEYCSGGDLYEAIKGGLVPRKTKKITYILQQMIDAIEFCHSKGVYHRDIKPE
                     NVLITNLFEWTIKLSDWGLATTDKTSIDRNVGSERYMAPELFESNLDIGERKEPYSCA
                     KVDVWSLGIVFLNTVFSKNPFSVANQTDKAFCYFAANREALFDVFSTMSLDFFQVLRY
                     SLTIDPTNRDLQKMRQELLNLSEYTLDDEYYNSLDDDLAVEEEPPSVAIPPSSAPAPA
                     PVSLLTPASSAEHKKHIEKRRASDVKEITPISDERAKDVQRQDGRAKSVPKFKFQKKS
                     HPSMGKTTEAKPIKYNQKNHYNFGRSNNNFYHTRRKPIKDSRKPLGIPTPNTHINNFF
                     DDYRKARNNNNYHSNNYARSSNSYHNGSDWHSNGFNTRDFFTPPSVHNRYMEGIFSNG
                     KKHGHYNNNNNRQRRSSFSQSSNNNVRNFLRATSPGRHSPGKYIPPNARNHHNWSLDS
                     EPPNTNTYHEQFTKSGSDSSSGGGNGANDMDDVLFTLEENDNDFVNDLDSLSLHDSNQ
                     GKASTPTELQRPTSADMPTVQVTGENDDLPDLLKSPAPEPHQGLYPTTGGLNNFLKPL
                     AGNGNEDSGHSDSDSNRNVNYETNNPIPQQTKPPRKSSESDSKYKAGVYIPPHHRRNS
                     VSNPVANEATLSVTNNSLNYSTSFQARRQSGGNSYRHRPFIPPMNNNHSDFTTAVQDN
                     DIFAQTSSDALLFEDDDVPTRTLPRFNANHPGERSMFGPYEIYDNGALPLGKARAGRK
                     SSTFQEEAVGSLEQYKNNWLILQQQQD"
     gene            complement(<863358..>864590)
                     /locus_tag="ZYRO0D10274g"
                     /db_xref="GeneID:8204139"
     mRNA            complement(<863358..>864590)
                     /locus_tag="ZYRO0D10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496836.1"
                     /db_xref="GeneID:8204139"
     CDS             complement(863358..864590)
                     /locus_tag="ZYRO0D10274g"
                     /note="similar to uniprot|P49018 Saccharomyces cerevisiae
                     YDR331W GPI8 ER membrane glycoprotein subunit of the
                     glycosylphosphatidylinositol transamidase complex that
                     adds glycosylphosphatidylinositol (GPI) anchors to newly
                     synthesized proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496881.1"
                     /db_xref="GeneID:8204139"
                     /db_xref="GOA:C5DVX9"
                     /db_xref="InterPro:IPR001096"
                     /db_xref="InterPro:IPR028361"
                     /db_xref="UniProtKB/TrEMBL:C5DVX9"
                     /translation="MMLGIWRYLLVVLLVIQPVFGLVESKHTNNWAVLVSTSRFWFNY
                     RHMANVLSMYRTVKRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNQDHAIDLYGDSV
                     EVDYRGYEVTVENFIRLLTDRWSEDQPKSKRLLTDENSNIFIYMTGHGGDDFLKFQDA
                     EEIASEDLADAFEQMYEKKRYNEIFFMVDTCQANTMYSKFYSPNILAVGSSEIDESSY
                     SHHSDVEIGVAVIDRFTYYSLEFLEGIEKDSNVTLQDLFDSYTFEKVHSHAGIRRDLF
                     QRDPKDVLITDFFANVQNVIPDQGKEEAIAAAASKVNDAGENDLFGPNVLNLALERTT
                     RESKNSTDNVTSRWVPHFTKTRQLNGNDFTRVVSSDNTYPRIIAVVTILLTSAVYCLI
                     PRSGTPKPTTKEQRLPYM"
     gene            complement(<864792..>866261)
                     /locus_tag="ZYRO0D10296g"
                     /db_xref="GeneID:8204140"
     mRNA            complement(<864792..>866261)
                     /locus_tag="ZYRO0D10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496837.1"
                     /db_xref="GeneID:8204140"
     CDS             complement(864792..866261)
                     /locus_tag="ZYRO0D10296g"
                     /note="similar to uniprot|Q06682 Saccharomyces cerevisiae
                     YDR330W UBX5 UBX (ubiquitin regulatory X)
                     domain-containing protein that interacts with Cdc48p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496882.1"
                     /db_xref="GeneID:8204140"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DVY0"
                     /translation="MMDKVADFMAITGAENGELADQFIEMAGGDLETAISLFFEHGGN
                     SQLGAATQRDDDLAQRLQNEAYGGETSGNGDDYVRPPDQARHETLAETHVFPGSFGGY
                     GGSFQHLRGARDMFDDSRPPGVFNQRLDDDMSDSTSDSSNSAQDDSDDDGLQELVEVP
                     ALELDEDGNIRQYTRMVPRPRTLSKEERLARLFRPPFDMISKRDLDSARSKAKKKSKW
                     IMVNVQDSGVFQCQALNRDLWSSKDVKKVVKPNFVFLQYQFDSRNAEPYINFYGLRSK
                     DDLPHIAILDPLTGERLKQWNRQVPKPENFINEIEDFLTQFSLDPKVANPTIKEPTPE
                     PDPTTLTEEQQMELAIKQSLGASAEQPIDVDEQESAQEKPKPLQEQPTEFPISEPDLF
                     STIQAVPHEEPPNKPGVTTRIQVRTGDGGRMVRRFNVEDPVRTIYEVIKAQMEGFDHE
                     KFTLGSHQREDLIGKLDMTIQDAGLKNSSLLLEKVEDEE"
     gene            complement(<866412..>867080)
                     /locus_tag="ZYRO0D10318g"
                     /db_xref="GeneID:8204141"
     mRNA            complement(<866412..>867080)
                     /locus_tag="ZYRO0D10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496838.1"
                     /db_xref="GeneID:8204141"
     CDS             complement(866412..867080)
                     /locus_tag="ZYRO0D10318g"
                     /note="similar to uniprot|P38801 Saccharomyces cerevisiae
                     YHR081W LRP1 Substrate-specific nuclear cofactor for
                     exosome activity in the processing of stable RNAs homolog
                     of mammalian nuclear matrix protein C1D which is involved
                     in regulation of DNA repair and recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496883.1"
                     /db_xref="GeneID:8204141"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="UniProtKB/TrEMBL:C5DVY1"
                     /translation="MEDINKFKPYIAHLDRQLQDLRPLLESLNAKSLDEQLLLLSDER
                     QRLDLTNTYAYLLSSLMFAHMKVLNCRDMSSVMGELARVKRYMDSAKQLDSSEEQKEQ
                     NKHEEQNRAKQVINRALTPSISQANFQGKHTKFESKDDTNSSDDDGSKDKEDKVDVST
                     KKKNLPGRTKGKSETVPSKSKNQHGKSTKGSGASSTKTGKSNRVSKPSTSSKPKGKVN
                     KSNR"
     gene            <867201..>867650
                     /locus_tag="ZYRO0D10340g"
                     /db_xref="GeneID:8204142"
     mRNA            <867201..>867650
                     /locus_tag="ZYRO0D10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496839.1"
                     /db_xref="GeneID:8204142"
     CDS             867201..867650
                     /locus_tag="ZYRO0D10340g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496884.1"
                     /db_xref="GeneID:8204142"
                     /db_xref="UniProtKB/TrEMBL:C5DVY2"
                     /translation="MPEDKTVSKPVPALQTHAKRLCNIATKSSEIKWTSEDNFKLQSL
                     DAQLVKLLSEYESLLNDKNRSIIAAGRVEKPSFSRSSFYHREQPWDKSHSFRLAPPPV
                     TNNSSRTKASQRSQQADARLLLSNLPLLQNLKNLQHLNNNANRRDGR"
     gene            <867776..>869086
                     /locus_tag="ZYRO0D10362g"
                     /db_xref="GeneID:8204143"
     mRNA            <867776..>869086
                     /locus_tag="ZYRO0D10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496840.1"
                     /db_xref="GeneID:8204143"
     CDS             867776..869086
                     /locus_tag="ZYRO0D10362g"
                     /note="similar to uniprot|P28795 Saccharomyces cerevisiae
                     YDR329C PEX3 peroxisomal membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496885.1"
                     /db_xref="GeneID:8204143"
                     /db_xref="GOA:C5DVY3"
                     /db_xref="InterPro:IPR006966"
                     /db_xref="UniProtKB/TrEMBL:C5DVY3"
                     /translation="MATPGNGRSIVRRHRGKIVFSLAIFGSLVTAGSVFLWLVKRWLY
                     RQQLRLTEQHFIKEQIRRRFAQTQEDSLYALYELIPVFSLVVGRKLDLEELVIALRDK
                     KLNKMGNRASDDGISSGISTSVTSNGAPGSLQGGGETRSKAELWNELKTKSIVKLVTV
                     AYTVSSLLLLTRLQLNILTRREYLETAVKMAVEKEGKDEGLSNWFKSIWTDAHANSSN
                     SSSTTSSSSSGNSKASYINEQAFLSLSWWLLNRGWLEYEAVAQESVESEFGSLSPRDT
                     LSLEEFGNRLTNVFVNVNERILKSSKLQQALLPSRQMELFVLQQTLDPEALGVVQRDS
                     TILSQLLNETTQCIESTASAVVLESLINESFQYIMTQVESNTSTKKRSGQGYQIAVFS
                     IACKDCCTSVLKSGVVSMDNELLSRLDTCPQLEDLSASVYSNFG"
     gene            <869244..>869753
                     /locus_tag="ZYRO0D10384g"
                     /db_xref="GeneID:8204144"
     mRNA            <869244..>869753
                     /locus_tag="ZYRO0D10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496841.1"
                     /db_xref="GeneID:8204144"
     CDS             869244..869753
                     /locus_tag="ZYRO0D10384g"
                     /note="similar to uniprot|P52286 Saccharomyces cerevisiae
                     YDR328C SKP1 evolutionarily conserved kinetochore protein
                     that is part of multiple protein complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496886.1"
                     /db_xref="GeneID:8204144"
                     /db_xref="GOA:C5DVY4"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016072"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="InterPro:IPR016897"
                     /db_xref="UniProtKB/TrEMBL:C5DVY4"
                     /translation="MPESQVVLVSGEGEKFTVDRKIAERSLLLKNYLNDMHDSVLDDS
                     DEDEDVVMPIPNVRSSVLQKVIEWAEHHRDSTFPDEDDDDSRKSAPMDSWDREFLKVD
                     QEMLYEIIQAANYLNIKPLLDAGCKVVAEMIRGRSAEEIRRTFNIVNDFTPEEEAAIR
                     RENEWAEDR"
     gene            <870165..>874577
                     /locus_tag="ZYRO0D10406g"
                     /db_xref="GeneID:8204145"
     mRNA            <870165..>874577
                     /locus_tag="ZYRO0D10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496842.1"
                     /db_xref="GeneID:8204145"
     CDS             870165..874577
                     /locus_tag="ZYRO0D10406g"
                     /note="similar to uniprot|Q06681 Saccharomyces cerevisiae
                     YDR326C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496887.1"
                     /db_xref="GeneID:8204145"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:C5DVY5"
                     /translation="MGLKKMLQHHKEKQREKAIKKKAKRGTQGRSSLSLVRGDSGGND
                     IAKRRITTEVAGPGNPNGSNKAATGVRSSHSERSEPEVSKTSSEGTTTDQPNSYNRAN
                     ETFNIHVPLDLRHESTNAKSIRDSNKYDMVPPKMHDPSVTSPSFPTTSRVAGASNNQE
                     RPANSAPAATKASGGLQKSATTTTLETNGGGNNKSSDAQDHGIFGTIMSMAHNAAVHI
                     PKINESTPDLDSQGSGLNSPLISPLSSAAPSVKTSPVLNNHSGSRDRVAHKNLGLEEG
                     APVDGNTDGVQDSSVIHNPPDTPDTKNKTFLRNLDHLLSSSGSTEGGNTNKNDTANNN
                     TSNEENVSETPQTDSLRAGPMSRSNTKHSLRQLVERSDAPKRNLSDGKVKFEPSSGKQ
                     PAKATFGKGGLSLDQFDDPSLQGSTPEQTPKKSQDFINDRTNGENSYTQIQLPQIHGA
                     TELEDGYDSHGFKRQHERNGSSANLTVPGPRSISEADLSNHGRRDRAFSTSERKHSGS
                     LSPGGAEEGLRNSRSSLGLDYSAAIEPSTAGLSPSGERKPRRDSKKFLKRRSFSPANI
                     GMKVIPQISLKGPMNKVRTSSDYVTGVAHFANATGSGVTGLAGGVASGLSSGFPRLRA
                     STFGSQMDIDNPGAVVGNTVELSNIEYASERKNQEFHNLFKESVGSDERLVADHSCAL
                     SRDILLQGKMYISDRQICFYSNILGWVSSVLIPFEEVVQIEKKTTAGIFPNGIVVDTL
                     HTKYAFASFISRDATFDLMTDVWNQIILGKRHLIVNNSYNDGETLSSGMNGGKTSDSS
                     DFEDEDEDSIMDSDHRVSSDGDVENEDIGNHSFGPSTHPPTTADYKPSANEKMINESI
                     INAPLGKVVNVMYGDDVSNLEAILKAQKNYELSPIPNIMGTKKREYSYTKPIPGSFGP
                     SKTKCLMTETLDHYDLENYVKGVQISKTPDVPSGNSFVVKTTFLFTWAPNNATKLNVY
                     VSVDWSSKSWIKGAVEKGTFDGVTDSSKILVQELTTRAAKPLTGASSNGGGTIKKKER
                     QSDVGEEVVEDLPNLPTQGPVTHPPTNNGYKKEKDDVIVDPNANIQAPLGTVFSLLFG
                     DDTAYLKRIIEKQKNFELSEIPKFSGNSRDYNYIKPLGAAIGPKQARCYITETIEEKD
                     FNSHVMVRQVSKCPDVPFGNNFAVHTKIYLSWGPHNSTNMYVVTSIAWSSKTLLKGTI
                     EKGSIDGQKDSTKIMIEELKDIIADAPVKKITGKKSSKYNKHHGHRKGVSAKKSVDEK
                     ARNKGETQSSADGANIGNKNNVEGKGGILGFLMSVFENFDITSLRGIITILASTFFII
                     WFLRHLLSGGYKHEVQIIKPGRMLLDGTEYHYVPSIKTLYEVYEEDVRKSGKGRYQYG
                     KPDEHDVIMEAEGNIWNWLLDRANATEPLTNHVQGQYEQKVHYLNNHSAHKLQQLRET
                     VRITEMQLEKMKHALENHNNLLSLEDTSVQQQRQ"
     gene            <874984..>875997
                     /locus_tag="ZYRO0D10428g"
                     /db_xref="GeneID:8204146"
     mRNA            <874984..>875997
                     /locus_tag="ZYRO0D10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496843.1"
                     /db_xref="GeneID:8204146"
     CDS             874984..875997
                     /locus_tag="ZYRO0D10428g"
                     /note="weakly similar to uniprot|Q08651 Saccharomyces
                     cerevisiae YOR246C Protein with similarity to
                     oxidoreductases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496888.1"
                     /db_xref="GeneID:8204146"
                     /db_xref="GOA:C5DVY6"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DVY6"
                     /translation="MTEPAPGYSKINWLYEMYYGFRPNQPKFLPKDYPDLTGKTAIVT
                     GSNTGIGASVVQLLYEKNCDVISVVRNEQKGLAAKENTLKELPNSKGSITVVGGCDFL
                     DLNNVKPTAHKVIEILNGRPLSIIIHNAGLMAPVNTGTSVQGYEAMFSTNVMGPQLLQ
                     HFLDPVFLKKDDPLKRIVWVSSCAHLMGFKEYGINWENPTFEGVPIKQRPRNMTLYGQ
                     TKAANLLQSHAWALKHAEAVEKIGAVSVACFPGNLRTELTRDWGFINTIAPYFLGTSL
                     QGAYSELYAALSPDLTTKDHGAYVVPYGEVHNPREDITAAYKNGSDAKLYQMVENWIS
                     KYF"
     gene            <876131..>876500
                     /locus_tag="ZYRO0D10450g"
                     /db_xref="GeneID:8204147"
     mRNA            join(<876131..876246,876335..>876500)
                     /locus_tag="ZYRO0D10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496844.1"
                     /db_xref="GeneID:8204147"
     CDS             join(876131..876246,876335..876500)
                     /locus_tag="ZYRO0D10450g"
                     /note="highly similar to uniprot|P89114 Saccharomyces
                     cerevisiae YHR079C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496889.1"
                     /db_xref="GeneID:8204147"
                     /db_xref="InterPro:IPR010760"
                     /db_xref="UniProtKB/TrEMBL:C5DVY7"
                     /translation="MSTTVRSSINKKQAEVEQLKAARDTLLQEFQKLSAELSIQSQPK
                     DVVSLHIQRLKEYNELRDTGLRLTQLIADEKRCKVKEVFEEMGYDMIDY"
     gene            <876899..>880357
                     /locus_tag="ZYRO0D10472g"
                     /db_xref="GeneID:8204148"
     mRNA            <876899..>880357
                     /locus_tag="ZYRO0D10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496845.1"
                     /db_xref="GeneID:8204148"
     CDS             876899..880357
                     /locus_tag="ZYRO0D10472g"
                     /note="similar to uniprot|P32361 Saccharomyces cerevisiae
                     YHR079C IRE1 Serine-threonine kinase and endoribonuclease
                     transmembrane protein that initiates the unfolded protein
                     response signal by regulating synthesis of Hac1p through
                     HAC1 mRNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496890.1"
                     /db_xref="GeneID:8204148"
                     /db_xref="GOA:C5DVY8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR006567"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR010513"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR018391"
                     /db_xref="InterPro:IPR027295"
                     /db_xref="UniProtKB/TrEMBL:C5DVY8"
                     /translation="MRLLQRALFVILWINLCLGLDLWPQWASGKLIRDESQGTEAASP
                     RVTNVEYYTTIPTALRRKGARQDKVAGSTLPTGTPVRWNQTPTLISHNGSLKNDLKYV
                     SGGKSALIPRQHERALEKVSLAGILLATDVEGGLHALNRDNGQLLWSIDSSHTKPLIH
                     VVEPPRAQTKETLIIEPYGEGNIYYFNVYQGLQKLPVSIAKLIASSPMHLKTDIVVDD
                     FGTVVEDEKIYTGSRSTAMYVIDATKGDILSAFGPGTENKKYKKDSDICATRGLEPEG
                     CKNVLVIGKTTYHLGIHSRDGTTYNVTYSSWQQNTLDTPLSSLSSLTGDNTYIASFRD
                     RSLLAINADFKIAKWVSSNFPGIINSIFDIFTDENAGENIIIPHRFTSPDEASFPRGK
                     VFLSQIENDSWFALSGENYPSLVEAAPTAKYGLSERWRAPSLFYNEDLFATAVTGVHT
                     LQNRKFEEISDMSTSRKPLISVQEREPLLLEPSTSNLPLGLEDDSTSRNMALETYISP
                     EELEAYRLKVQEQIAHEIIQQNQGSFIYLMGRLIYRVIESGLVFLFALFVLAFLQRFK
                     VIPPLHILFEKSGLISVEDIKVDNLEINDEMSNEKRPTANNGTGDSEETLKISRESTP
                     STTDNPNSPTDDEEETALKVEDEVTLKGGEEGTTIVEKEKKKRKRGTRGGKKLKKKQS
                     SSSQAVEQIRAIGTIQLENGLKTLTVSEKILGYGSSGTVVLQGSFQGRPVAVKRMLLD
                     FCDIASQEIDLLTESDDHPNVVRYFCSETTEKFLYIALELCNLTLEELIELKKPSEGF
                     QATLKTWDPINILYQIASGVSHLHSLKIIHRDIKPQNILVASPKKVIAAGYKADNNGN
                     LRILISDFGLCKKLEADQSSFRTSLSNAGGTSGWRAPELLHESTRKLIESMSVYDKDN
                     DEDNESATNSIYDPATKQSLTKGIDIFSMGCVFYYILSKGGHPFGSRYIREANILKNN
                     YDLSGLNQTLKDRSLVFEAKDLIAQMIQMNPLKRPSALRVLNHPLFWSNSKKLEFLLK
                     VSDRFEVERRDPPSELLCKLESHSNQVIPNNDWTSKFDKDFMDNLGKYRKYSGEKLMD
                     LLRALRNKYHHFMDLPEDLAAVIGPVPDGFYNYFIKRFPNLLLEIYHVVQENLKDDQI
                     LCNFIE"
     gene            complement(<880439..>883555)
                     /locus_tag="ZYRO0D10494g"
                     /db_xref="GeneID:8204149"
     mRNA            complement(<880439..>883555)
                     /locus_tag="ZYRO0D10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496846.1"
                     /db_xref="GeneID:8204149"
     CDS             complement(880439..883555)
                     /locus_tag="ZYRO0D10494g"
                     /note="similar to uniprot|Q06680 Saccharomyces cerevisiae
                     YDR325W YCG1 Yeast Condensin G"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496891.1"
                     /db_xref="GeneID:8204149"
                     /db_xref="GOA:C5DVY9"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR025977"
                     /db_xref="InterPro:IPR027165"
                     /db_xref="UniProtKB/TrEMBL:C5DVY9"
                     /translation="MDISEETADDVNMRIFHSIADVFQKAQSTYAGHRKHVAVLKKIQ
                     TKAVDRGYESAFNYWFSMLVTKVLPLRKSEPVGNRLVKLVAAFVASLDRELELARNNQ
                     SGELDPEHGEVYSRFVDHFVRHILRGIESKDRNVRYRVVQLLAVIMDNIGEIDESLYN
                     LLTWSLNKRIYDKEPNVRIQAVFCLTKFQDDDEKEVIEQNDPEDAIHKLMSLIQNDPS
                     AEVRRASMLNLVDMRMTRPYILERARDVNLINRRLVYSRILKQMSGQCFDKVDFKIMD
                     QLIKWGLDDREESVRKACNRLLSYDWLNMFGGDIIEFLEKLNVTKSSVADKAMECLFQ
                     TRDDIIPKLNFPQNIWREFTVETVFLLRCFYTHCVDNNLHEIIESNFPEASKLADSLN
                     FYLQKILVEEEKNALSDLERSHVEFIIEQLLIISKEYDYSDEIGRRSMLTVVRNMLSI
                     FELPESLIKIGLQVLKSLSINESDFVTMVIEIINDLRDDDIERQEKEQGEDEASKGEN
                     DDDDDDDDAIESFQQSVENLVNNGVTSREELVKNLKPPRKARPETVVVCLTRSSHMLE
                     LVNMSLEQNILITSLIDSLITPAVRNTEPKIRELGVRNLGLCCLLDVQLATESMYILG
                     MCVSKGNASLKKIALQVIVDIFSVHGSRVVDGEGKVDSISLHKIFYKVLKNDDLPDCQ
                     VVAAEGLCKLFLADVFTDDDLFETLVLSYFSPVNSNNEPLIQAFAFCIPVYCFSHSQH
                     QERMAKIATDVLLRLCMLWEDLQEDEDEEVDRDAMLKPNIIFQQLLHWTDPRKLINRS
                     EEEAAKDNVQLTFMLDFSKAFSKIERKDIKKMLLTNINAAFIASGQDYKLLKELGEHL
                     DDIVENEKLDTVSLNSLQKFKIALEKVKEEACEKSNISKDDDDSLDEQYSQILESSIH
                     PTDLNEENEQSENFIPEENGEENASFRNADESKESEMSSGKKRTRSEREGVIDANNSS
                     NEKMDSSTSGMSVESQSKNSNLPHKFEEDSDVDMSGETQDLSTAGNSKTNSANLSHNY
                     GSSDYSHS"
     gene            <883922..>886171
                     /locus_tag="ZYRO0D10516g"
                     /db_xref="GeneID:8204150"
     mRNA            <883922..>886171
                     /locus_tag="ZYRO0D10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496847.1"
                     /db_xref="GeneID:8204150"
     CDS             883922..886171
                     /locus_tag="ZYRO0D10516g"
                     /note="similar to uniprot|Q06679 Saccharomyces cerevisiae
                     YDR324C UTP4 Nucleolar protein component of the small
                     subunit (SSU) processome containing the U3 snoRNA that is
                     involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496892.1"
                     /db_xref="GeneID:8204150"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ0"
                     /translation="MPDKSRIRTIKMSGEGSIALHRSRFINFETGNITAVSFSHKSNV
                     GKLTPSDLRLAIGRSNGTIEIWNPRNGWFQEMVIRSGKDRSIEGLCWSNVAGEPLRLF
                     SIGGSTVVTEWNLATGLPLKNYDCNAGVIWSISVNENQDRLAVGCDNGTVMIIDISGG
                     PASLDHDTILMRQEARILSLTWKENDFIIGGCSDGKVRIWHAKVDDPNRGRLSQTMKV
                     DKSKKESTLVWSVIYLPGRNQIVSGDSTGAVKFWDFQFATLAQSLKVHEADVLCLTTD
                     ATNTHVFSAGVDRKIFQFTFVNSKWTNTSNRLLHGNDVRSMCSYQSGGADFLVSGGAE
                     KRVVISTLSSFADGKFRKMPVFVPFTKNILANVEQRLVVMWHESTVKIWNVGQELDSV
                     KNYRLVAKLVLKDEQDISACDMSPDGQVLVVARPSTTKVFHLQPASTKLLVTKLDNGF
                     LSQTGCKLVKFIDNSKLVAVSSDDELFTLDLESEEDETANYIELPEVPRTKSSVKVPY
                     LNTINHLEVQGPLAVISRYCGAVDTVNLETNKSHSLVRLMNFITVIKINKKRNTVILV
                     TAENKIFEFKISQDDEETGLLTPWSKNNTENMPKQWQTIREKCMGIFYDQSSPDKIWF
                     WGPTWISRLDFTTDFPLSKRRKTKKHGPDGLTITDESNFLNDGDEDDENDLDMDENLD
                     IISSQFSNFRQKDAHKSKSENSNFFFSEKYRPILYADVLSDQEVIIVEKPASMGISTG
                     AFDLPKLVF"
     gene            complement(<886303..>887889)
                     /locus_tag="ZYRO0D10538g"
                     /db_xref="GeneID:8204151"
     mRNA            complement(<886303..>887889)
                     /locus_tag="ZYRO0D10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496848.1"
                     /db_xref="GeneID:8204151"
     CDS             complement(886303..887889)
                     /locus_tag="ZYRO0D10538g"
                     /note="similar to uniprot|P38799 Saccharomyces cerevisiae
                     YHR078W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496893.1"
                     /db_xref="GeneID:8204151"
                     /db_xref="InterPro:IPR015672"
                     /db_xref="InterPro:IPR022535"
                     /db_xref="InterPro:IPR025969"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ1"
                     /translation="MGDVLMVIGLILTSLLTYHWSYGRLWFLVDSLFEAIVAPASTGT
                     MEKIPQLEIDDNHFLYKLYANYSVSSTKILKAMRIIFSMAMVSYVVTIEIVLWQIKSA
                     DAKQQANFISTWIWPLVSLVLSVLLILVQPFFALMMFLNKFFDDKMDMDGLIIVTSGV
                     LLVIMTALNFTTIGPFKYTENILTKLSIVGITVMAMLSAVASVSTLYYTYTTLRSRIK
                     YSSADHSQKVFDDNSTGTLLWYADDMVIKKIEEYQKHMDESIKILTRLDKEHGGKESP
                     MRVQLIDKIGWYQLELGQLEGRLREPKMMQTTKKAFQLSFLLYCFQKIVMTFTKRIPL
                     IITDFMRGRQYSQLEENSLGADPLAITIANILDIIFFRFNYQHDLDALTRQISLIIST
                     SLFVCSFSTVATTISYMIALLPTRFRILAMYAIHSGESPSELPQFKKGVKESHYCKTP
                     SIIKNLFVSELSGVYVVATILTIRSNLPFDVSQKVNELLGERFTVPNVVIDSWFEMIY
                     ALFCIFTIIGIKAVEWTLLE"
     gene            <888085..>889635
                     /locus_tag="ZYRO0D10560g"
                     /db_xref="GeneID:8204152"
     mRNA            <888085..>889635
                     /locus_tag="ZYRO0D10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496849.1"
                     /db_xref="GeneID:8204152"
     CDS             888085..889635
                     /locus_tag="ZYRO0D10560g"
                     /note="similar to uniprot|P32609 Saccharomyces cerevisiae
                     YDR323C PEP7 Multivalent adaptor protein that facilitates
                     vesicle-mediated vacuolar protein sorting by ensuring
                     high-fidelity vesicle docking and fusion which are
                     essential for targeting of vesicles to the endosome
                     required for vacuole inheritance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496894.1"
                     /db_xref="GeneID:8204152"
                     /db_xref="GOA:C5DVZ2"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR021565"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ2"
                     /translation="MDKEGGGNSSGGRQQSGKVTNISCPVCGESIEGLTKLNNHLDID
                     HGFDNGSPEVQKRNSKNPKTSKVQQIVKNHWQRPDSYGRAVCQECGSSSKKSNAFINC
                     RKCGLIYCNLHCKNIIKLNTDAQYDPLHGKWYACCYRCFSERPGYNDYGSFVDKTSSF
                     IGLRETKNEDKRLRLLQLENRLVRLVNGIASIHAKCKSSILMSFTMRNEASELERTVT
                     PWRNDRGVLDCSVCFKPFGLTLWKHHCRLCGNIVCNRDETGCSSEISLQHLVNAAKDL
                     PYQQKVSDLAEIDHSIRLCYKCIRSLYGERKFKKDLQKPKPQLLSLCESLESTSKLIT
                     DTISHMEKFMIRMDDSKIAEQIPKEEDMTESKKMRTKLLRSVAMYNSLARQVSRITPA
                     NPTEAKIKRSVQVASSTFINEKILSLKRVPGMIDDSPRTSSPIREPDKVKSTDLLFNN
                     LTISEVKKYREELMVLKEQKFLVESMIEEAKKQRKFDEVATLSTNLNELSEQIATTQG
                     NLGEQGFT"
     gene            <889961..>893152
                     /locus_tag="ZYRO0D10582g"
                     /db_xref="GeneID:8204153"
     mRNA            join(<889961..889966,890039..>893152)
                     /locus_tag="ZYRO0D10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496850.1"
                     /db_xref="GeneID:8204153"
     CDS             join(889961..889966,890039..893152)
                     /locus_tag="ZYRO0D10582g"
                     /note="similar to uniprot|P38798 Saccharomyces cerevisiae
                     YHR077C NMD2 Protein involved in the nonsense-mediated
                     mRNA decay (NMD) pathway interacts with Nam7p and Upf3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496895.1"
                     /db_xref="GeneID:8204153"
                     /db_xref="GOA:C5DVZ3"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR007193"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ3"
                     /translation="MDDERRLELSELNTRAWNGEEVFPLKQAKLDSSIKRNTGFIKKL
                     KLGITKDSKASLLKDLSEVSLEKYLSEIINTTDEGLQNVPNKNDDVAAVVEVISGLHQ
                     RFNTRFTCELMALFLNHFACPQEDSISEKEASTRVSKMRTNVRIFTELYLVGIFNSLD
                     NVTSKDALPVFLRKRLAKKESVLVSILKEVLSFNFNDGFSSSIATLFVKKFPQLFEEN
                     NLADKYIHDKDLKYLLQGIFKKFTEVVSARAVQLNKRTKKLIKEHQKCQIRTGKETDD
                     FLEEYNATLPQYEKFKSAALVLTEFFKLDPPELNEEVEAQEDEAAKPSVITNATGVSP
                     SQKVWENDEVRKFYEALPNIDEIHDQSLKNNADPAGDKVNNFFRELEEADTKEAIDHL
                     SVLYWSENLDNKATRKRLMKFFIENKDWSKLRLYSRFFATNSKYFHELIEEFVNYVDS
                     GFRSQLHSSKINVKNIIFFSEMVKFMQLPIYLIFHKIRTLIINLHVPNNIEILTVLFE
                     HLGIFLINKPEYKAHMEKMMALLKEKKRDRQLSINLKGAMDNLITLVYPPSIKSLNAS
                     TKELSPEQQFYHILIRRELQSFEVGRVVKLLRRAHWKDETVRDTLFDLFVRPEELSYQ
                     NISIMAKVLSELYKYQRNFVITCIDELLEKVERGLEINDFTHSMHRVAEVRYLTELYS
                     FALIKPNVLLDTMYLILKYGHNGKGSYLFSPNDIDEADNYFKIQLLSTMLLNLRRNTS
                     MLSKKLPLFLRFYEYYTFTKEQPLPQETQFSLQTTFQKYEDEDGFERSSTLQESAVRL
                     TSMVKSLSGAQGDVTKETSSTNLTKTNSGADSSEDESDDEDEEELSGVDDTVEDVEEE
                     ADGEEDESDEDDEESEEDEDGEDEDADSEDEDDSYRDVVADRDIEQKRMYDEYQAKLK
                     DENERKMEDELEQQLQKMMQDSMDSRKNEKIASAKIPLVGANKTNSNFVAEPTETEGN
                     EQESRIAGQQPKRVAFTFLNKSGKKTQSRTLRLPSNVDFVSGVLEEEERLKNEREKIK
                     NIVLQRAFD"
     gene            complement(<893194..>894282)
                     /locus_tag="ZYRO0D10604g"
                     /db_xref="GeneID:8204154"
     mRNA            complement(<893194..>894282)
                     /locus_tag="ZYRO0D10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496851.1"
                     /db_xref="GeneID:8204154"
     CDS             complement(893194..894282)
                     /locus_tag="ZYRO0D10604g"
                     /note="similar to uniprot|P38797 Saccharomyces cerevisiae
                     YHR076W PTC7 Mitochondrially localized type 2C protein
                     phosphatase expression induced by growth on ethanol and by
                     sustained osmotic stress possible role in carbon source
                     utilization in low oxygen environments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496896.1"
                     /db_xref="GeneID:8204154"
                     /db_xref="GOA:C5DVZ4"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ4"
                     /translation="MFAKAGLRPIYGSTARGAARRPFLGRQWQGMLWMLVLITSIIVG
                     WSLIHVDFAVYGQLRRGFFSGKGSWGWQSGTSSTVPQDGSQQFNYKAVVAFQPKDRDD
                     PVYKALAGKFSPTGEDNYFIRSVNPTEFYAGVADGVGGWAEHGYDSSAISRELCSAMS
                     EFALSVGVPPKKLIELGYDKIQKEGTVQVGGTTAIVAHFTPEGKLQVANLGDSWCGVF
                     RNDQLAFQTKYQTVGFNAPYQLAIVPEQMVKEAERRGGSYIRNQPADADEYTFQLEKG
                     DIVFLATDGVTDNVATEDMELFLKDNQSLVGSDLQKASQEFVDKTVQLSKDPDFPSVF
                     AQEVSRLTGQRYMGGKEDDITLVVVKVE"
     gene            <894604..>894879
                     /locus_tag="ZYRO0D10626g"
                     /db_xref="GeneID:8204155"
     mRNA            <894604..>894879
                     /locus_tag="ZYRO0D10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496852.1"
                     /db_xref="GeneID:8204155"
     CDS             894604..894879
                     /locus_tag="ZYRO0D10626g"
                     /note="similar to uniprot|P81449 Saccharomyces cerevisiae
                     YDR322C-A TIM11 Subunit e of mitochondrial F1F0-ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496897.1"
                     /db_xref="GeneID:8204155"
                     /db_xref="GOA:C5DVZ5"
                     /db_xref="InterPro:IPR008386"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ5"
                     /translation="MSTANVLRYSALGLGVFFGLKNDMGNKKTASQKAADDAFQAKLK
                     LVDEARAEYGRLHNPAPTTQSKEINLEDPNLDIGAAILQAVDSLGSN"
     gene            complement(<895020..>896087)
                     /locus_tag="ZYRO0D10648g"
                     /db_xref="GeneID:8204156"
     mRNA            complement(<895020..>896087)
                     /locus_tag="ZYRO0D10648g"
                     /product="mitochondrial 54S ribosomal protein YmL35"
                     /transcript_id="XM_002496853.1"
                     /db_xref="GeneID:8204156"
     CDS             complement(895020..896087)
                     /locus_tag="ZYRO0D10648g"
                     /note="similar to uniprot|Q06678 Saccharomyces cerevisiae
                     YDR322W MRPL35 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL35"
                     /protein_id="XP_002496898.1"
                     /db_xref="GeneID:8204156"
                     /db_xref="InterPro:IPR008914"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ6"
                     /translation="MLRRSLSTSTRLQSSKVWSDFSGSRPQSFSIPSAQIKRSILEGT
                     PASGPPSIKRRFNRVKYTPPEHIDETFKLCYDFVESKAAQVYEKASKAQTVEEKEKLL
                     AEAELHNPEVQYNFQYHDKLENDPRIIDYEQPVYRLLGKQHWESYGQMLLMQRLESLA
                     VIPDTLPTLVPRTEVNIRFPFSTGINKWVEPGEILSTNATSLPPVFKIQEYEPVDPNT
                     QYTILVVNPDEPDLANDTFTTTLSYGLANVKVSYNDNLVDSRKFDQSNVLVDYLPPVP
                     EKNVGNQRFAVWVFRQRHPVEQPSGQLSRDNFDIRSFAKTQGLIPVGAHVWRSHWDSQ
                     ADTIRAKYGLPAGRIFSRIRT"
     gene            <897201..>899807
                     /locus_tag="ZYRO0D10670g"
                     /db_xref="GeneID:8204157"
     mRNA            <897201..>899807
                     /locus_tag="ZYRO0D10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496854.1"
                     /db_xref="GeneID:8204157"
     CDS             897201..899807
                     /locus_tag="ZYRO0D10670g"
                     /note="weakly similar to uniprot|P32454 Saccharomyces
                     cerevisiae YKL157W APE2 Zinc-dependent metallopeptidase
                     yscII and to YHR047C uniprot|P37898 Saccharomyces
                     cerevisiae YHR047C AAP1' Arginine/alanine aminopeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496899.1"
                     /db_xref="GeneID:8204157"
                     /db_xref="GOA:C5DVZ7"
                     /db_xref="InterPro:IPR001930"
                     /db_xref="InterPro:IPR014782"
                     /db_xref="InterPro:IPR024571"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ7"
                     /translation="MSDQEQDFTLPKSFNPNHYEISLKKLDAEKKIFQGHVRVHFQCV
                     IPDQKIYLNARDLVIENVQVQLNNGQSLKVVSQDYDHRLEAIVIDVGENISDSFTVAI
                     DYQGKIQTNMSGFYRSNYKDLKTNEDKFMLSTQFEATDARGTFPCVDEPARKATFKVS
                     VTADSHLTVLSNMPEQSSQVEGNETEHIFHTTPRMSTYLVAWAVGEYEFIEGKTEKTI
                     YPTLQDYSVVDGTSSTQAALPIRVYTAVGKKNQGKFALSVATKVVDLFSQLFKIPYPL
                     PKLDLLCVESYSHNAMENFSLITFRTTALLVDDSDDVSPAALQKVAYVVSHEIAHQWF
                     GNLVTMQWWDELWLNEGFATWVGYYAVSVFFPHWDVESMVMLESHEAALQLDSLKESH
                     PVKVGLRDPKDVDQAFDTISYLKGCSVLEMVSGYLGQDDFLAGVALYLEINKWGNATM
                     EDLFDCIGKVAKVEILSKVKPWLLELGYPILDVKKSGDQLSLTQSKANTDSLWWVPLL
                     PTRDGEFIKQSDLTTRTTQLEAGSKYTLFNTDGYAFYRVNYESLELIDSLCDNISRLS
                     SRSKMGLLSDFCSLRPLSDYLHLVDKTMKVHDPKDVYVWKSIHSSLLKTRTIVYNAVA
                     PELMASFDRYVLQLVEPWINDALTNLENPTTQDSNDPYAFARTLFYHSILTIAGKLSH
                     PKVVALARKLYQRNEINAHNRSIVLGTVLSQPDTTRAIFDQVVEVLEGAVLEEMETIL
                     RCLGSVTNPELFEPCFQLLFKVEPMNVQFLPEAFLTNPHIHSSILSFVQQNSSALIDR
                     LVVNQTVIGRFLSFTFAYFQGEETVHKIKSIFEGRDISAYDRVLRQTLEKIEANTRFC
                     NENIGALEKFLK"
     gene            <900133..>901284
                     /locus_tag="ZYRO0D10692g"
                     /db_xref="GeneID:8204158"
     mRNA            <900133..>901284
                     /locus_tag="ZYRO0D10692g"
                     /product="carboxylesterase-mitochondrial 37S ribosomal
                     protein YmS2"
                     /transcript_id="XM_002496855.1"
                     /db_xref="GeneID:8204158"
     CDS             900133..901284
                     /locus_tag="ZYRO0D10692g"
                     /note="similar to uniprot|P38796 Saccharomyces cerevisiae
                     YHR075C PPE1 Protein with carboxyl methyl esterase
                     activity that may have a role in demethylation of the
                     phosphoprotein phosphatase catalytic subunit also
                     identified as a small subunit mitochondrial ribosomal
                     protein"
                     /codon_start=1
                     /product="carboxylesterase-mitochondrial 37S ribosomal
                     protein YmS2"
                     /protein_id="XP_002496900.1"
                     /db_xref="GeneID:8204158"
                     /db_xref="GOA:C5DVZ8"
                     /db_xref="InterPro:IPR016812"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ8"
                     /translation="MGDDIRRKLILKQLDQANLAAGDEGEEENDLGELPSIKSNSMGS
                     QKQSPNGTVPAGNGDETTWKQFFDHNERIKIRNRNLEFNTYYSLPNSINAPSIPIFIL
                     HHGAGSSGLTFATLAQQISSQLNGNCGYFTFDARGHGTTRPLEPSKGLQYDRQSYIDD
                     FVELLEQFYSKHLTQLGAVKLSLVLVGHSLGGSICTFSHMQLPEHLRNKVLGVFMLDI
                     VEEAAILALKNVHSFLSKTPNVFQSYQDAIDWSIRRGMSKNRSSAEIAVPACFHQMTS
                     GKVVRITNLRDFEPYWDTWFVGLSERFVSLPTSKLLLLAGNENLDKELIIGQMQGKYQ
                     LVVFQDSGHFIQEDTPVKTAITLIDFWRRNDSKNIVIKTNWGAKNFTSQ"
     gene            complement(<901336..>903480)
                     /locus_tag="ZYRO0D10714g"
                     /db_xref="GeneID:8204159"
     mRNA            complement(<901336..>903480)
                     /locus_tag="ZYRO0D10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496856.1"
                     /db_xref="GeneID:8204159"
     CDS             complement(901336..903480)
                     /locus_tag="ZYRO0D10714g"
                     /note="highly similar to uniprot|P38795 Saccharomyces
                     cerevisiae YHR074W QNS1 Glutamine-dependent NAD()
                     synthetase essential for the formation of NAD() from
                     nicotinic acid adenine dinucleotide"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496901.1"
                     /db_xref="GeneID:8204159"
                     /db_xref="GOA:C5DVZ9"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="InterPro:IPR003694"
                     /db_xref="InterPro:IPR014445"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR022310"
                     /db_xref="UniProtKB/TrEMBL:C5DVZ9"
                     /translation="MSNLITLATCNLNQWALDFEGNRDRILESIKIAKEKGARLRVGP
                     ELEITGYGCLDHFLENDVNLHSWEMYAQIIRKPETHGILLDIGMPVMHKNVRYNCRLL
                     SLDGQILFIRPKIWLANDGNYREMRFFTPWMKTGVVEEFFLPPVIQKVTEQQSVPFGD
                     AVIHTLDTCIGTETCEELFTPQSPHIAMSLDGVEIITNSSGSHHELRKLNKRLDLIAS
                     ATSRCGGVYLYANQRGCDGDRLYYDGCALIAVNGKVVAQGSQFSLKDVEVVTATVDLE
                     EVRSYRASVMSRGLQASLTETKFKRIHVPVELAPLALRFDMKIAPTKTREPFYHIPEE
                     EIALGPACWLWDYVRRCNGSGFFLALSGGIDSCATATITYSMCRIVFQEIQEGNEQVL
                     KDARKVARAAEDWIPSSPEEICNKILHTSFMGTENSSKETQSRSAELSKRIGSYHVDL
                     KMDKIVSSVVSIFEVATGKKPIFKIFGGSQIENLALQNIQARLRMVLAYLFAQLLPWV
                     RGTPNTGGLLVLGSANVDECLRGYLTKYDCSSADINPIGGISKTDLKRFIAYATKNFD
                     MPILEDFLNATPTAELEPITKDYVQSDEIDMGMTYEELSKFGYLRKVEKCGPYSMFLK
                     LLHEWTPKLSPTQVAEKVKKFFFFYAINRHKQTVLTPSYHAEQYSPDDNRFDLRPFLI
                     NPRFPWASRKIDEVVAQCEGRNTGDLNIMSID"
     gene            complement(<903897..>905033)
                     /locus_tag="ZYRO0D10736g"
                     /db_xref="GeneID:8204160"
     mRNA            complement(<903897..>905033)
                     /locus_tag="ZYRO0D10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496857.1"
                     /db_xref="GeneID:8204160"
     CDS             complement(903897..905033)
                     /locus_tag="ZYRO0D10736g"
                     /note="highly similar to uniprot|P38986 Saccharomyces
                     cerevisiae YDR321W ASP1 Cytosolic L-asparaginase involved
                     in asparagine catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496902.1"
                     /db_xref="GeneID:8204160"
                     /db_xref="GOA:C5DW00"
                     /db_xref="InterPro:IPR004550"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR020827"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="InterPro:IPR027474"
                     /db_xref="InterPro:IPR027475"
                     /db_xref="UniProtKB/TrEMBL:C5DW00"
                     /translation="MVNNRLEITTICPDAENSLFTIESSELEAQRAAAVAAASEPDQH
                     RTLPRIKILGTGGTIASKGASSSQTAGYHVDLTIQELLESIPDISSVCEIEYEQLCNV
                     DSKDINEEILFKIYRAVSDSLQSFDGIVITHGTDTMAETAFFIENTIDFGELPVVFVG
                     SMRPSTSVSADGPMNLYQAICIASDSKSRGRGVLVSLNDQISSGYYITKTNANSLESF
                     NVRQGYLGNFFNNEVHYYYPPSKPLGCHKFKLRLEDSSPISKLPKVCILYAHQAMDSE
                     MIDIAAGRYQGMVVAALGAGTLPETVNERCLAQDIPIVFSKRAMDGMVPNANLPKATE
                     KSNCNIIASGYLNPEKSRMLLQLCLAKKYTMEETRHVFRGVYGG"
     gene            complement(<905442..>908351)
                     /locus_tag="ZYRO0D10758g"
                     /db_xref="GeneID:8204161"
     mRNA            complement(<905442..>908351)
                     /locus_tag="ZYRO0D10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496858.1"
                     /db_xref="GeneID:8204161"
     CDS             complement(905442..908351)
                     /locus_tag="ZYRO0D10758g"
                     /note="similar to uniprot|P38713 Saccharomyces cerevisiae
                     YHR073W OSH3 Member of an oxysterol-binding protein family
                     with seven members in S. cerevisiae family members have
                     overlapping redundant functions in sterol metabolism and
                     collectively perform a function essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496903.1"
                     /db_xref="GeneID:8204161"
                     /db_xref="GOA:C5DW01"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DW01"
                     /translation="METIDVQSRSFVIRWLGGIQGDEIEYQVKPLKKSVKLDIYKKPR
                     SSLYGNSPSAVHIAPDTKALLDYTTKSLNSRSSLAVPDTKSGGESVSSPQDPKRSLTL
                     SNIQQQSQEIPLQERLNTTGFKLVKSVGIVAGNKRESGLLNVKDNDYYYAFVLDNTYS
                     KNAKKKVLFSAAVVNQEETKSARSVRFPQSPALPPQASFVNLQKDDVLRVEQGRYLQG
                     YLFKKRRKRHQGFKKRFFSLDYKYGTLFYHLNEKNQTCRGEIVIGISTVSANKKDRLI
                     IIDSGMELWVLKAIDNSTWKIWVDALQSCLSQRALKKEDQTPKGKPEEPKRSEGLQLF
                     NSTRPSRLNFDEDLSYNPLPDESYEEFALQLKLLQERVEQCKEESLLYASQQNNSKGH
                     PLSRTSTASSFEEKNKEPAFSSTSDSGESLGSLLNPSSRPGHQLYQKLCDLELIVSRF
                     VQQGHVLFKDHQQLSRQMRDHKATTLSLFSNDEYFDATENMERGVIMLDVDDTEANTN
                     ETLSSTMDSEHKLSVVAQREKSPLSESPAIRSSLREPPHTYRSPLQSRPSTHRGPSPE
                     QIPIFTTTEAEDEHQYQQGMKKDLYPLPWKGQIKRRNDVRPQDTTPPSILSFMRKNVG
                     KDLSSIAMPVTVNEPVTILQTVAEMFEYADLLTEAACHPEENSKCLQYVSAFAVSCLS
                     IYRDKTRVLRKPFTPLLAETFELVREDLGYRLIAEKVSHKPLVLAFHAEHELWECCYT
                     VSPVQKFWGKSMELNNEGTIHLKFKPSGLTFEWAQPTTMLKNLIAGERYVEPINELEI
                     QSSNGGKATVAFKNTGMFGGRSEDLTINILSSKREKSQVTGKWTDSLRENETQRTIWK
                     VGDLVPDSRKKYGFTVFTSNLNEITELEHGQLPPTDSRLRPDLRAYEEGRTDQAEKLK
                     LKLEKDQRERRTRGEDVKPQFFKKTAKNEWQIIDGLQNYWEKRKRQDWTSITPLW"
     gene            <909226..>910482
                     /locus_tag="ZYRO0D10780g"
                     /db_xref="GeneID:8204162"
     mRNA            <909226..>910482
                     /locus_tag="ZYRO0D10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496859.1"
                     /db_xref="GeneID:8204162"
     CDS             909226..910482
                     /locus_tag="ZYRO0D10780g"
                     /note="highly similar to uniprot|Q08911 Saccharomyces
                     cerevisiae YOR388C FDH1 NAD()-dependent formate
                     dehydrogenase may protect cells from exogenous formate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496904.1"
                     /db_xref="GeneID:8204162"
                     /db_xref="GOA:C5DW02"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:C5DW02"
                     /translation="MFRLPQLSARVVSGVSNSTAMRSANVAKKFSFPKTFSTSSTNMA
                     KGKVLLVLYEGGKHAKEQSKLLGAIENELGIRNFIESNGYELVSTIDKDPEPTSRVDK
                     ELKDAEIVITTPFYPAYITKSRIDQAPNLKLAVTAGVGSDHVDLDAANKRNITVVEVT
                     GSNVSSVAEHVMTTILVLLRNYNGGHAQAVNGEWDIAGVAKNEYDLEDKVISTVGAGR
                     IGYRVLERLIAFNPKKLYYYDYQDLPAEAVKRLNDVSQLLNGRGDIVQRVERLEDMVS
                     KSDVVTINAPLHEGTKGLFNKELLSHMKEGAYLVNTARGAICNAQDVADAVKSGKLAG
                     YGGDVWDVQPAPKNHPWRSMNNKDQIGNAMTVHISGTSLDAQQRYAEGVKNILQSYFT
                     KKFDYRPQDVIVKDGKYATRAYGQKK"
     gene            <911004..>912956
                     /locus_tag="ZYRO0D10802g"
                     /db_xref="GeneID:8204163"
     mRNA            <911004..>912956
                     /locus_tag="ZYRO0D10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496860.1"
                     /db_xref="GeneID:8204163"
     CDS             911004..912956
                     /locus_tag="ZYRO0D10802g"
                     /note="similar to uniprot|Q06683 Saccharomyces cerevisiae
                     YDR332W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496905.1"
                     /db_xref="GeneID:8204163"
                     /db_xref="GOA:C5DW03"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR006935"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DW03"
                     /translation="MFRLLRRCLTFSKPLRWYSQAVQLRDYQQHVIDKCLESLKDNKR
                     RIGVSLATGGGKTVIFANLIKQLSQQTPHRALVLVHRRELVLQAAQTIKKFMPLARIQ
                     IEMGKYVCQDVKDCDVIVASVQSLIRRLDNYESTDIDLVIVDEAHHAVANSYLRILDH
                     FKKDIPVVGFSATFERADHKALSTVMDEIVYHKGILEMINDNWLCEGKFTTVKIDADL
                     NSVERASGSDDFKLDQLSRVMNIPEINGLVLKTYLHKSKEQPGGFNSTLLFAVDIKHV
                     KALHHLFVSYGIKAECVTSETKARERDQIIDNFKKGDVKVLINCGIFTEGTDMPGIDC
                     ILLCRPTRSRSLLVQMIGRGLRLHHSKDFCHIIDFVGASDIGVVSVPTLAGIDNFQGD
                     LDGATLQDLQEIKEQITATKKKHSEVQKLENESFNNWMKNKSCFDLTLTTFENFKSFY
                     NQEHGDSTLPTAGTSSDDSLLNSSPYPFVKFAKNSWGLSLLSGHHLRIYKEGIKATKF
                     NYTLKLYREIPIYLRDVTSTRYVPRELLSTDNLMQILGNVEQVISDLSTSKTGEGPVR
                     NFTKFAKWRTDPATSKQKSAIHKKLTSRLTKRSDLMDSLNSEDIKRYTSGMKKGEAAN
                     ILFATNIAPVYPLDSLLRVLRFKKNM"
     gene            <913096..>914064
                     /locus_tag="ZYRO0D10824g"
                     /db_xref="GeneID:8204164"
     mRNA            <913096..>914064
                     /locus_tag="ZYRO0D10824g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496861.1"
                     /db_xref="GeneID:8204164"
     CDS             913096..914064
                     /locus_tag="ZYRO0D10824g"
                     /note="similar to uniprot|P14693 Saccharomyces cerevisiae
                     YHR083W SAM35 Essential component of the sorting and
                     assembly machinery (SAM complex aka TOB complex) of the
                     mitochondrial outer membrane which binds precursors of
                     beta-barrel proteins and facilitates their insertion into
                     the outer membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496906.1"
                     /db_xref="GeneID:8204164"
                     /db_xref="InterPro:IPR021211"
                     /db_xref="UniProtKB/TrEMBL:C5DW04"
                     /translation="MTIFAVPGPVKALFDHFPLQTYPPISKRDDAMNYEFAQRTYDFQ
                     GPNAVQDDINNTFTLGVYNTFQESSSDVALATDPWCLYAQLALCKKNSLKLPQVTRAE
                     SGRPSKPQQKMALLSPLATQNESLPILVEGHNKRFIRSADSIQDTLKNRAAEEPQQLM
                     YISLLDHVIYDCWITQVLYHLDDDDFLKLYSFESSPGRNNSLVQRLVVQSLKLSLIKR
                     NEFHLRHKVLAKNMESTAVSYKSASLLEIMGPILERCQKVLLQFEKLLQDKPFVNSPT
                     YMELKIASYILCIMNLPANVPLRIFLEEQCKYLVHHSRAILNGLKN"
     gene            complement(<917878..>920139)
                     /locus_tag="ZYRO0D10868g"
                     /db_xref="GeneID:8204165"
     mRNA            complement(<917878..>920139)
                     /locus_tag="ZYRO0D10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496862.1"
                     /db_xref="GeneID:8204165"
     CDS             complement(917878..920139)
                     /locus_tag="ZYRO0D10868g"
                     /note="similar to uniprot|Q05468 Saccharomyces cerevisiae
                     YDR333C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496907.1"
                     /db_xref="GeneID:8204165"
                     /db_xref="InterPro:IPR006994"
                     /db_xref="UniProtKB/TrEMBL:C5DW05"
                     /translation="MSISSHLISSHVLNFSLLITSEKFQYFNILQKVKLFDQNFRVSR
                     PEMSSRALRKLQNDQELLDSLLGSPKTSDEKPKKSDIESKTQNANIFALMNDGDDEEG
                     SDREVDQNQESPKNQEEEKPKVQLPTRSQKKAKKKNKKSSKGSKKSEEPLEESNNDDD
                     DDNDDGELEAMIQQYKKHDALKYGVQDFDHKEDEEYDITLESFAHACKFYDLKNDSGF
                     TQFPASCLQCCTGFFNNDFRKLDPHFEFKLLFDDISAESLEDIESMSSTHISPQQLKQ
                     VQRLKRLVRNWGGKDHRSVPTGPGSAAHRLQFTKIQEDWLPTPRGELSMQSLGTDDLC
                     EWQLWQRPTDWKDVVEEDVNNWRKKVSFYKFEPLNPDISKKAMTEFYLSVILHPDHES
                     LIHLISSKFPYHVPALLQVALITIRQGDRSNTSGLIQRALFVFDRALRAGIKFDSLSC
                     QLPYTYFFNRQFFLAIFRYILLLAQRGAVATAGEWCKALWSLSPLEDPLGCRYFIDHY
                     LLLNKEYHYLIELSKSPLMTCYRQWYTLGLALGTVLSYLRLENPQSAREELVRAFKYH
                     AHSLASLFVEKLRGDPSLTQGLEFQADSTQVLETKAYGTRFGISWQKPENLNFLNTEL
                     TNLFKKFQTQDLEIAPAVSQEEVTVNPFFVEGIPVNLLRFSVLSEESPVMASIPTSVW
                     SNHEVYEFDILPPTPTTKESRDFVEDVRTFINDQELARSQMDVDQDEALLSQIRQLSL
                     EQFLEENPNVAPE"
     gene            <920208..>921158
                     /locus_tag="ZYRO0D10890g"
                     /db_xref="GeneID:8204166"
     mRNA            <920208..>921158
                     /locus_tag="ZYRO0D10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496863.1"
                     /db_xref="GeneID:8204166"
     CDS             920208..921158
                     /locus_tag="ZYRO0D10890g"
                     /note="similar to uniprot|P38803 Saccharomyces cerevisiae
                     YHR085W IPI1 Protein of unknown function essential for
                     viability may be involved in rRNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496908.1"
                     /db_xref="GeneID:8204166"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024679"
                     /db_xref="UniProtKB/TrEMBL:C5DW06"
                     /translation="MSKTKKQKQKAQDFQKKKLKVGKPKAKASNVTDTSFVSRTISVK
                     NQHLGEHDDDLTKRLSLLKHHNSTVRKETLQTFQKMIPTIINTRMMTPLLTQCIPLMC
                     DESRQVRSTLMDLFNEVGQHNDQVLKLLCKMLVLYVNMAMTHITSAIQADSAKFLSCL
                     LKYCGDEICRQAFVKLLTGLFSLLGWNQTKSQSARKLNAKQTAAYMDTLYELIRQGCQ
                     ESVQADTDTELRSSTNQHLIPDYPQPYEYLKLFTRQLQTKDSPSTMVDLSTQDLGARQ
                     RVLKEQNLPIIHRQLDIYIKEGGETGKSANSLKKLLEDLQ"
     gene            <921315..>921809
                     /locus_tag="ZYRO0D10912g"
                     /db_xref="GeneID:8204167"
     mRNA            <921315..>921809
                     /locus_tag="ZYRO0D10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496864.1"
                     /db_xref="GeneID:8204167"
     CDS             921315..921809
                     /locus_tag="ZYRO0D10912g"
                     /note="similar to uniprot|Q08689 Saccharomyces cerevisiae
                     YOR253W NAT5 Subunit of the N-terminal acetyltransferase
                     NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
                     proteins which influences multiple processes such as the
                     cell cycle heat-shock resistance mating sporulation and
                     telomeric silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496909.1"
                     /db_xref="GeneID:8204167"
                     /db_xref="GOA:C5DW07"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DW07"
                     /translation="MSRDIVSLDNVYANRLGTFVKLTNSILPVQYPDSFFQEIVQNKN
                     GKETSFAQLAFYSEVAVGAVKAKLIANKKGGILPHGMYIEVLAVLEHYSGKGIGTKLL
                     EYVESEAKKHYQHALYVHVASDNVRAITWYKKRGFEQDGDVLLDYYKNTTGSANALVL
                     KKTF"
     gene            complement(<921917..>923908)
                     /locus_tag="ZYRO0D10934g"
                     /db_xref="GeneID:8204168"
     mRNA            complement(<921917..>923908)
                     /locus_tag="ZYRO0D10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496865.1"
                     /db_xref="GeneID:8204168"
     CDS             complement(921917..923908)
                     /locus_tag="ZYRO0D10934g"
                     /note="similar to uniprot|P14906 Saccharomyces cerevisiae
                     YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
                     Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP and
                     Lhs1p forms a channel competent for SRP-dependent and
                     post-translational SRP-independent protein targeting and
                     import into the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496910.1"
                     /db_xref="GeneID:8204168"
                     /db_xref="GOA:C5DW08"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR027137"
                     /db_xref="UniProtKB/TrEMBL:C5DW08"
                     /translation="MALNYDYDETSETWPFFLLTLLLVILVPLTLSQVYSLFNDSIDS
                     QEIQDPRQRSIERKVEQISDSHTESSVWRFRRAFGKRSSKIWQKRNIVIIVGWVLVAM
                     VVQSISQNDSIQDSRTVLFDPYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAP
                     EARTKMEEMYVQITKAYESLTDENVKENYLRYGHPDGPQSTSHGIALPRFLVDGAASP
                     LVVLSYIVLLALIMPYFVSQWWSRTQAYTNKGIHTRTASHFVDRLINYKPSEVITVEL
                     IIHWLSEAYEFELLYPNLTADDFEQILLDHINRRDSSKIADTNAKYRIVAKCHSLLHG
                     LLDIACGFRNTDIAIFTIETFKCIVQAVPHTPYRQILQLPNVNKTRFLEGLTDEVHTV
                     GKLFTYDDKKIGQMLGIDDEDLLKETLTVAANIPQLRVLKAEFVVPGEKQVTPLSTPH
                     ISVKVLVHSAKQRVIPADKFPAEMLEESEDFEHQRDPFVIMEQEPLIPYSYAPYFPTK
                     RRNAFCCLVGLQKDGKLIQTPVVVQKLSLVNLDKDLDKRTVKELGPSFKPEEWKIATI
                     KLPLGQQAPAENGDVYFRVIIKSTDYFTTDLDFSICMHVTSAPVQEPQEVEEDEETEN
                     DSAEEDEEEDDDEEGSDSDYSDIDTDTEVEEDSGKVKNT"
     gene            <924444..>926276
                     /locus_tag="ZYRO0D10956g"
                     /db_xref="GeneID:8204169"
     mRNA            <924444..>926276
                     /locus_tag="ZYRO0D10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496866.1"
                     /db_xref="GeneID:8204169"
     CDS             924444..926276
                     /locus_tag="ZYRO0D10956g"
                     /note="similar to uniprot|Q99257 Saccharomyces cerevisiae
                     YPL169C MEX67 Poly(A)RNA binding protein involved in
                     nuclear mRNA export component of the nuclear pore ortholog
                     of human TAP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496911.1"
                     /db_xref="GeneID:8204169"
                     /db_xref="GOA:C5DW09"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR005637"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:C5DW09"
                     /translation="MNGVNNVNNISMLAQQQQLQSRVKIGVRNWQNATVQDLMNFLSR
                     TTRISVVDAMVEGPLVVGHVASRADAESLLKWNGIRFAGNNLKFEILSDSGNDGAGAN
                     STITLLKNFLYKRYNAQTKMLDLGNLHADPDLVQKGLFSSISTQSKMFPALMKLASKE
                     PQLVVESINLSDNNLKDISGITTLAQTFPYLKNLCLANNQISRFRTIEVWKNKFKELR
                     ELLMINNPISNDKLYRSEMMRLFPKLVILDNVMIRDEQKLTSIYSIPMKIQPFFFENN
                     EIGPSSTDFVTNFLNFWDTDRMQLLGLYTPQSQFSISVDSSIPPSSVTESDQNPSFGY
                     YLSHSRNISKVSSEKSIEQRLSLGPEAMSEVFRAIPKTKHHLQDMPDEYSMETVTYPQ
                     INGFIVTLHGFFEETGKPDADTNNKSSAGRSRRFNHGHNSTNNRLFKKSFDRTWVIVP
                     TGTGVVVASEMLTVRPFAANAWVQQPGPVPQQPQPQPPLAPQIDPMNPSLNASPPPPQ
                     PQIGMGGLPVPMGVPPQQPGMPPMSAPAPAPVPMAPTLQLPLEVQTRLNPIQLELLNK
                     LHIETKLNAEYTFMLAEQSGWNYDVAIKGFQNSVNNIPREAFIP"
     gene            <926565..>927449
                     /locus_tag="ZYRO0D10978g"
                     /db_xref="GeneID:8204170"
     mRNA            <926565..>927449
                     /locus_tag="ZYRO0D10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496867.1"
                     /db_xref="GeneID:8204170"
     CDS             926565..927449
                     /locus_tag="ZYRO0D10978g"
                     /note="weakly similar to uniprot|Q08692 Saccharomyces
                     cerevisiae YOR255W OSW1 Protein of unknown function
                     required for the construction of the outer spore wall
                     layers"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496912.1"
                     /db_xref="GeneID:8204170"
                     /db_xref="UniProtKB/TrEMBL:C5DW10"
                     /translation="MRAPPPPRRSKSRYLTTCYLRIKQVFTGSKLKKRWHLHKLHKFR
                     RKGQLAVSPISGIHVEDMVNLPTGLQNRSSKGKPLLIAAFSKGCTKSPQLRLLQRNKF
                     YGLPMTKRKYKLKSFDTTVTEKKTATTITQRTHLCAPRVGSLKKATSKDADIKVIFHN
                     NNVIKSINLEEESHTTSYSPQLLEFAPQQSIRIKDYPSLARRPLGLAEISENENVNDN
                     NPNGYLRLRNEKSKSGPLAPAINPPAPSLSIDSGSTAVSADMRTNLFQWKTFIRITKY
                     SNKHRLVSYSRLITSYTS"
     gene            complement(<927573..>928028)
                     /locus_tag="ZYRO0D11000g"
                     /db_xref="GeneID:8204171"
     mRNA            complement(<927573..>928028)
                     /locus_tag="ZYRO0D11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496868.1"
                     /db_xref="GeneID:8204171"
     CDS             complement(927573..928028)
                     /locus_tag="ZYRO0D11000g"
                     /note="highly similar to gnl|GLV|CAGL0F03553g Candida
                     glabrata CAGL0F03553g and similar to YPL170W
                     uniprot|Q12091 Saccharomyces cerevisiae YPL170W DAP1 Heme-
                     binding protein involved in regulation of cytochrome P450
                     protein Erg11p damage response protein related to
                     mammalian membrane progesterone receptors mutations lead
                     to defects in telomeres mitochondria and sterol synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496913.1"
                     /db_xref="GeneID:8204171"
                     /db_xref="GOA:C5DW11"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:C5DW11"
                     /translation="MSFLMKLVFGGYNTSEDPTGVTEAPSADQGSKNNDGPVVEGKFY
                     PRTLYKYNGHDHESILIAVKGKVFDCSQSRQFYGPSGPYTSFAGHDASRGLALNSFDM
                     ETVRGWDQPIDTLEDLTPQEQESLDSWYEFFESKYPCLGTLEPEPGVNV"
     gene            <930195..>931772
                     /locus_tag="ZYRO0D11022g"
                     /db_xref="GeneID:8204172"
     mRNA            <930195..>931772
                     /locus_tag="ZYRO0D11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496869.1"
                     /db_xref="GeneID:8204172"
     CDS             930195..931772
                     /locus_tag="ZYRO0D11022g"
                     /note="similar to uniprot|P32913 Saccharomyces cerevisiae
                     YOR132W VPS17 Peripheral membrane protein required for
                     vacuolar protein sorting"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496914.1"
                     /db_xref="GeneID:8204172"
                     /db_xref="GOA:C5DW12"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR014461"
                     /db_xref="UniProtKB/TrEMBL:C5DW12"
                     /translation="MPSEPNSSIDTTAENTNNENQPSTSTGVVKKPAKTHKFIVKVTA
                     LERVGNSTNQRENPIVIFDLFTDVPAFRKQQHRGVKKTADEFKELFRYLVAAVQETFV
                     PSLPATCSSYGPNTDEDRHKTMKNYQEWLERIAADPLLLKNEEVAFFVQSDFGTYSPI
                     NNPPTQPASGLKRKTLKQLAPPYDEVLQLAEFRPLVKSVHRVSQEVQSKLSKVSKQRR
                     LLSQEETALGQGFTALQNDTHAHSGLYKRFGRVLAAAGDVDSVESTLEVATFADAMGW
                     LVKDTYVVKEALTNRHLIMRELLQAQQSSRGKQEHARKLRAKRDASPLKVDEALRALR
                     AATLLEQELTAKQRLITNNMLSMRSQWLQWYESFVTSAIKEFTLRKIEYERKKLTLLE
                     RVRHDVRRADNAGGLSRLGREAHPPSLLRSPPRNSQGLEGDDWAGDQRRRSSLLSQHD
                     SVTNTDFDRVVTADEQQTLNPTVTSDPTAAESTDASGDNAGGTGTTTYSANGEQDIND
                     TSLDARNAASLLGLATF"
     gene            <932267..>934795
                     /locus_tag="ZYRO0D11044g"
                     /db_xref="GeneID:8204173"
     mRNA            <932267..>934795
                     /locus_tag="ZYRO0D11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496870.1"
                     /db_xref="GeneID:8204173"
     CDS             932267..934795
                     /locus_tag="ZYRO0D11044g"
                     /note="highly similar to uniprot|P32324 Saccharomyces
                     cerevisiae YOR133W EFT1 Elongation factor 2 (EF-2) also
                     encoded by EFT2 catalyzes ribosomal translocation during
                     protein synthesis contains diphthamide the unique
                     posttranslationally modified histidine residue
                     specifically ADP-ribosylated by diphtheria toxin or
                     uniprot|P32324 Saccharomyces cerevisiae YDR385W EFT2
                     Elongation factor 2 (EF-2)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496915.1"
                     /db_xref="GeneID:8204173"
                     /db_xref="GOA:C5DW13"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DW13"
                     /translation="MVAFTVDQMRSLMDKVANVRNMSVIAHVDHGKSTLTDSLVQKAG
                     IISAAKAGEARFMDTRKDEQERGITIKSTAISLFAEMSDTDVKDIKQKVDGNSFLVNL
                     IDSPGHVDFSSEVTAALRITDGALVVVDTVEGVCVQTETVLRQALGERIKPVVCINKV
                     DRALLELQVTKEDLYQSFSRTVESVNVIVSTYADEVLGDVQVYPSQGTVAFGSGLHGW
                     AFTIRQFANRYAKKFGVDKNKMMEKLWGDSYFNPKTKKWTNKDTDADGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPVLLEKLEINLKADEKDLEGKALLKVVMKKFLPAADAL
                     MEMIVMHLPSPVTAQNYRAEQLYEGPSDDQFCQAIKKCDPTSDLMLYVSKMIPTSDKG
                     RFYAFGRVFAGTVKSGQKVRIQGPNYVPGKKDDLFLKAVQRIVLMMGSRTEPIDDCPA
                     GNIVGLVGIDQFLLKTGTLTTNEAAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVMTYISESGEHIVAGTGELHLEICLQDLENDHAAIPLKISPPVVAYRET
                     VEGESSQVALSKSPNKHNRIYLKAEPIDEEVSLAIENGKINPRDDFKARARVMADDYG
                     WDVTDARKIWCFGPDGNGPNLVIDQTKAVQYLNEIKDSVVAAFQWASKEGPIFGEQMR
                     SVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPRIQEPVFMVEIQCPEQAV
                     GGIYSVLNKRRGQVVSEEQRPGTPLFTVKAHLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWSSLSSDPLDPETKAGQIVTAARKRHGMKEEVPGWQEYYDKL"
     gene            <935159..>937030
                     /locus_tag="ZYRO0D11066g"
                     /db_xref="GeneID:8204174"
     mRNA            <935159..>937030
                     /locus_tag="ZYRO0D11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496871.1"
                     /db_xref="GeneID:8204174"
     CDS             935159..937030
                     /locus_tag="ZYRO0D11066g"
                     /note="similar to uniprot|Q04149 Saccharomyces cerevisiae
                     YDR386W MUS81 Helix-hairpin-helix protein involved in DNA
                     repair and replication fork stability functions as an
                     endonuclease in complex with Mms4p interacts with Rad54p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496916.1"
                     /db_xref="GeneID:8204174"
                     /db_xref="GOA:C5DW14"
                     /db_xref="InterPro:IPR006166"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR011335"
                     /db_xref="InterPro:IPR020819"
                     /db_xref="UniProtKB/TrEMBL:C5DW14"
                     /translation="MSLPSNLKNLYAEWLQEFISALNPKQEQLTLTYEKARRNLLDVD
                     DTIYYPRDLKKVKGIGDTIMRRLEKRLKEYCDELGVEMPQPAASAAARGTKRGTTTLR
                     SNITDVIGGEPPPKKLRKYIPKKRSGGYGILLALLEANAVIPKGISKDDTIGLAQKYC
                     DHSLSPNFATKEFKGAWASITALKKHEFVFEEGRPKRYSLTEEGVNMAKILKSTDDIK
                     FPRELENSQNVAADGEKDAAVDEYEFTANYSELLGVEAPFDEELSFDRDKSLLDITFQ
                     DLESTPRIRKTAKSTAGTGHSSPISSQYRSLSAPAGETFTPETKALRRRFGGTSYELW
                     TKGSYEIFPIIDHREVKSQSDRDFFLKAFIRRGMKSEVRQLALGDIIWIAKNKKSGTE
                     AVLNTIIERKRLDDLALSIRDNRFMEQKSRLDKTGCKNKYYLIEETMSDVVEGMTEAL
                     KTSIWLILVYYRFSIIRTTNSDATVERLHSLHTVLQEEYSNRDLLVINPHNLQNQDDY
                     RYELEKFRREFEKSKTIECCHNFQCFQEILGKGELSTIGELTIHILMFIKGISIEKAV
                     AIQSVFPTLKHILTAYAECESPEEAKLLMFKKFGNAPGVKKISKNLSEKIADVFNKI"
     gene            complement(<937064..>938680)
                     /locus_tag="ZYRO0D11088g"
                     /db_xref="GeneID:8204175"
     mRNA            complement(<937064..>938680)
                     /locus_tag="ZYRO0D11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496872.1"
                     /db_xref="GeneID:8204175"
     CDS             complement(937064..938680)
                     /locus_tag="ZYRO0D11088g"
                     /note="similar to uniprot|Q04162 Saccharomyces cerevisiae
                     YDR387C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496917.1"
                     /db_xref="GeneID:8204175"
                     /db_xref="GOA:C5DW15"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DW15"
                     /translation="MDSESPPARNGLNDVDDVYSDLYSTISQVTATTANDVDQLPYPI
                     TFRNLIIFVGATVGGLLFGYDTGVISGVLLMLKPQDISLDVVTDFQKELITSVTCLGS
                     FFGSIIAFPTADKYGRKSTMALCCTVFVVAAIWMALSTSLTFLVIGRLIVGVAVGVAA
                     QCVPVYLSEISPASTRGLVLALNTLAITGGQLISYVVSLSMQNVQHSWRYLFGLAALP
                     AIIFLLILDFIPESPRWLISKGEFADALDSLRAIYPTAPLQLVSLKLKWLILDIGKLR
                     KYQDAEDPLLVRTHSTSRYIGVNDEPLSESSPSQDNNLVVSAESRTRHKMEPRAKRAL
                     LVGCTLMFFQQVSGINAFLYYSAIIFAQFEVKNPLVPAMAVAATNFVFTLVALKCVDP
                     IGRRSMLLYTIWIMTIGLFLSSVGFDKNNTKLILVALLIFVGGYASGMGSIPWSSVEF
                     LPLNRRSFGAACISCTNWLSNTVVSVSYLSIANVMGMDRAMIMFAVFTILNWIFVYYY
                     YPEVKGLTLEEIGKVFENGIDVSYVYRNYH"
     gene            <939064..>940443
                     /locus_tag="ZYRO0D11110g"
                     /db_xref="GeneID:8204176"
     mRNA            <939064..>940443
                     /locus_tag="ZYRO0D11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496873.1"
                     /db_xref="GeneID:8204176"
     CDS             939064..940443
                     /locus_tag="ZYRO0D11110g"
                     /note="similar to DEHA0G12903g and some similarites with
                     YDR388W uniprot|P39743 Saccharomyces cerevisiae YDR388W
                     RVS167 BAR adaptor protein subunit of a complex
                     (Rvs161p-Rvs167p) that regulates actin endocytosis and
                     viability following starvation or osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496918.1"
                     /db_xref="GeneID:8204176"
                     /db_xref="GOA:C5DW16"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:C5DW16"
                     /translation="MSFKGFTKAVARAPQSFRQKMNMGEQVEDPVYEDAERRFKELEL
                     EVKKLSEESKRYSQAVNGMLNHQIGFAQAMEEIFKPISGQMSDPNAAVPEDNPQGIEA
                     SEQYRALVAELQETLKPDLALIEDKIIKPCLELLKTIGYIRKMATKRNHKKIDLDRRN
                     NTYKKYETKSNPSPKDEEKLFKAQAELEVAKHEYDYYNDMLKDQLPQLFSLEAQFVQP
                     LFVSFYYMQLNIFYTLYTKTGEMKIPYFDMSTDIVEAYHFKKGNVDEQCDSLTITKFK
                     LGYSKAKLEMTKKRYGSGAQSPTESSSGLSSPKSPEAQLAYAGAPGAAAGGYTSPTSY
                     GSHPGFTSPQNSYAHPSYGAPEGAPPAYSTAASPYTTATASPVASTFHPPAPAAAAAA
                     GAAAAPSVETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFP
                     GNYVQLNKM"
     gene            <941141..>943336
                     /locus_tag="ZYRO0D11132g"
                     /db_xref="GeneID:8204177"
     mRNA            <941141..>943336
                     /locus_tag="ZYRO0D11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496874.1"
                     /db_xref="GeneID:8204177"
     CDS             941141..943336
                     /locus_tag="ZYRO0D11132g"
                     /note="some similarities with uniprot|P17121 Saccharomyces
                     cerevisiae YDR389W SAC7 GTPase activating protein (GAP)
                     for Rho1p involved in signaling to the actin cytoskeleton
                     null mutations suppress tor2 mutations and temperature
                     sensitive mutations in actin potential Cdc28p substrate
                     and some similarities with uniprot|Q12128 Saccharomyces
                     cerevisiae YOR134W BAG7 Rho GTPase activating protein
                     (RhoGAP), stimulates the intrinsic GTPase activity of
                     Rho1p, which plays a role in actin cytoskeleton
                     organization and control of cell wall synthesis;
                     structurally and functionally related to Sac7p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496919.1"
                     /db_xref="GeneID:8204177"
                     /db_xref="GOA:C5DW17"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5DW17"
                     /translation="MHTGTANRAVSPPPPPLLSTPVASTPSRRGSFKMDEENRRLNIN
                     SNTLPIRPSLSNKAHSYTSVPKGSDSNQNRDFKNHRDSFLANRNHFTGKVFGVSLSES
                     LGIASAEVIVQSELVSFGRIPIVVAKCGAYLKAHGLETSGIFRIAGNGKRIKELQYIF
                     SSPPDYGSKFTNWDGFTVHDIASLLRRFLNNLEEPLIPLELYEDFRAPLKDRPRILRY
                     MANRAAVRSTSQLHQSQSNTQSQHQTQVPHPGPKPLARNNHENSGNEEDRENDGDGEQ
                     DEEANSAEAEERKKKKLRHKRRLIRDVRSAIKDYERLFSDISNDAKQLTIYLLDLLSL
                     FSRQSQFNLMTARNLATIFQPSILSHPRHDMDPKEYELSRIVTEFLIEYSYDLLPHLL
                     KMAKKEQKEKQRQNISLMIPKPQKLVVTDEENNSVTQQITPVTADSQSNKYINTPNSD
                     TNNDPDFNPNDTNINNADNDNYINNTNSNENDDVMGSAGGSFRVRPDSPGFSFNPTNP
                     IPSRATSPISPHPRNSIQIPKRPRPHSRSIGSAPVPPDVIASNGRRSRLFPLWPRPGI
                     LSDSGDLTTTEDEGDECWGVDDENRDGFHSPISINSSSRPNLLSIPKFNRSFSGNSTT
                     SSFNKRPMSLVFQDSRNNNSIDELEEATYSPQSPTSQNFRNFSGSSGGNAGSGGGSGN
                     ENQFFLQQAKNASRESIDDGSDERNSNSRSKRVSWFQKFKSRSRSGTIS"
     gene            complement(<943550..>945451)
                     /locus_tag="ZYRO0D11154g"
                     /db_xref="GeneID:8204178"
     mRNA            complement(<943550..>945451)
                     /locus_tag="ZYRO0D11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496875.1"
                     /db_xref="GeneID:8204178"
     CDS             complement(943550..945451)
                     /locus_tag="ZYRO0D11154g"
                     /note="similar to uniprot|P52488 Saccharomyces cerevisiae
                     YDR390C UBA2 Nuclear protein that acts as a heterodimer
                     with Aos1p to activate Smt3p (SUMO) before its conjugation
                     to proteins (sumoylation) which may play a role in protein
                     targeting essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496920.1"
                     /db_xref="GeneID:8204178"
                     /db_xref="GOA:C5DW18"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:C5DW18"
                     /translation="MGRESSITRIVGPENYAKLQQFKCLIVGAGGIGSELLKDCILMG
                     FGEIHIVDLDTIDLSNLNRQFLFRQKDIKQPKSTTAVKAVQHFSNSKLVPYQGNVMDT
                     NQFPLHWFDQFDIFLNGLDNLAARRYVNKISQFLKKPLIESGTSGFDGYIQPILPGNT
                     ECFDCTKKETPKTFPVCTIRSTPSQPIHCIVWAKNFLFNQLFTSDQSSTTGDSDGNDW
                     GTDDKEEIERIKQETNELHDLQQIVHHQDKVHITDILKKLFVKDIEKLLQLDNLWKSR
                     AKPTPLTDDLIDSAKDGHDSTDLNAIWSLEEQISQFINVTEKLMDRIVEEDYNIEFDK
                     DDQDTLVFVATAANIRSHIFGIPIKTVFDIKQIAGNIIPAIATTNAIVAGLSTLTALR
                     LLNFLPYAKTNSGLDVNMAFTARASNLSKDRYLSNPKLAPPNCNCAVCAKVARGVVKI
                     TEKGLEKLTLSQLIDLLKKKYNYPSETSLIDTSDQRLLVDFDFEDLLDRTLSQAKLHD
                     GSVILFSDEEGDESEMYRKPLEIYLDVVEESAINSEIELPALEIPLFTPPKQEEEDEG
                     KETSTEESPEKEEDKNGIVILDEDEGKDEKDGTTTKRPRSPDQTENDSKRAKTSKNHN
                     DENGVIELD"
     gene            complement(945843..945913)
                     /locus_tag="ZYRO0D11176r"
                     /db_xref="GeneID:8204179"
     tRNA            complement(945843..945913)
                     /locus_tag="ZYRO0D11176r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.56"
                     /db_xref="GeneID:8204179"
     gene            complement(946162..946232)
                     /locus_tag="ZYRO0D11198r"
                     /db_xref="GeneID:8204180"
     tRNA            complement(946162..946232)
                     /locus_tag="ZYRO0D11198r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.96"
                     /db_xref="GeneID:8204180"
     gene            <946652..>947758
                     /locus_tag="ZYRO0D11220g"
                     /db_xref="GeneID:8204181"
     mRNA            <946652..>947758
                     /locus_tag="ZYRO0D11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496876.1"
                     /db_xref="GeneID:8204181"
     CDS             946652..947758
                     /locus_tag="ZYRO0D11220g"
                     /note="highly similar to uniprot|P28241 Saccharomyces
                     cerevisiae YOR136W IDH2 Subunit of mitochondrial
                     NAD()-dependent isocitrate dehydrogenase which catalyzes
                     the oxidation of isocitrate to alpha-ketoglutarate in the
                     TCA cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496921.1"
                     /db_xref="GeneID:8204181"
                     /db_xref="GOA:C5DW19"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004434"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C5DW19"
                     /translation="MFKSQVCRRAVARMFSSKQPSIGKFTGKPDPKTGNYKVSFIEGD
                     GIGPEISKSVKDIFAAAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPL
                     ATPVGKGHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIE
                     HAIVPGVVQSIKLITREASERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVA
                     KELQSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSL
                     GLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEK
                     AVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL"
     gene            <948040..>948693
                     /locus_tag="ZYRO0D11242g"
                     /db_xref="GeneID:8204182"
     mRNA            <948040..>948693
                     /locus_tag="ZYRO0D11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496877.1"
                     /db_xref="GeneID:8204182"
     CDS             948040..948693
                     /locus_tag="ZYRO0D11242g"
                     /note="some similarities with uniprot|Q03640 Saccharomyces
                     cerevisiae YML072C TCB3 Contains three calcium and lipid
                     binding domains localized to the bud green fluorescent
                     protein (GFP)-fusion protein localizes to the cell
                     periphery mRNA is targeted to the bud via the mRNA
                     transport system involving She2p C-terminal portion of
                     Tcb1p Tcb2p and Tcb3p interact"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496922.1"
                     /db_xref="GeneID:8204182"
                     /db_xref="UniProtKB/TrEMBL:C5DW20"
                     /translation="MRVRDTKMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNR
                     TQAVLRRSRDESVNAELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHR
                     TKAMQCDKKGIAYYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNR
                     GKLISTNLDKGIVNFRLNYPVAEVEEEPEAQHFLSDYRYPDDESQYEEKMYGKNVVV"
     gene            complement(<948942..>950585)
                     /locus_tag="ZYRO0D11264g"
                     /db_xref="GeneID:8204183"
     mRNA            complement(<948942..>950585)
                     /locus_tag="ZYRO0D11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496878.1"
                     /db_xref="GeneID:8204183"
     CDS             complement(948942..950585)
                     /locus_tag="ZYRO0D11264g"
                     /note="similar to uniprot|Q12242 Saccharomyces cerevisiae
                     YOR138C RUP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496923.1"
                     /db_xref="GeneID:8204183"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="UniProtKB/TrEMBL:C5DW21"
                     /translation="MNAQQSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQ
                     PVNQPQSAPMPGFAPGSLSGVMTNQIDDDEDDDSSSSERELSPPLPPRDSPGFSGMSE
                     GVEIEIQSPKKSLVTDPTVVIPLPHSLFENYFALFSLSMCQYLPHLMAKPELGDLMYN
                     PKWAQGSSDPSTSFIQQLQRLCSVVNASFSDRCYVSAKLFAAVLDAPLKRKLAEAEHL
                     HEVLPSFIRSLIHALEECGCYAEDQIRSLFVSSALSSECKSLLSVLQFMPEEYESSLY
                     AMFNALLYPELEEGEESGNSLLDLAPVLTIVFDEMDADTEVTSNRGVDVPLEFYPQLY
                     TKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTLKFINSTLDYLQRDNQS
                     KEIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHPTYLINEAMERGLIDEPY
                     LLAMVVLSPGHYLQRSRSGQWKMIRTDSNMIRISDCAPSQVQATIRQHTTFPSKTPLM
                     LLYVKSSHVSVDTIVSKSLESNEGITNFLRIDQEELNKE"
     gene            <952637..>954790
                     /locus_tag="ZYRO0D11286g"
                     /db_xref="GeneID:8204184"
     mRNA            <952637..>954790
                     /locus_tag="ZYRO0D11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496879.1"
                     /db_xref="GeneID:8204184"
     CDS             952637..954790
                     /locus_tag="ZYRO0D11286g"
                     /note="some similarities with uniprot|P20134 Saccharomyces
                     cerevisiae YOR140W SFL1 Transcription factor with domains
                     homologous to Hsf1p and to myc oncoprotein required for
                     normal cell surface assembly and flocculence"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496924.1"
                     /db_xref="GeneID:8204184"
                     /db_xref="GOA:C5DW22"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027722"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C5DW22"
                     /translation="MANQEDMSDSNAGQTQTSTNLSGPSAVPPGGAAAGSMTGPNANS
                     NTVPGQGSGTGSGTASNGSSGSSGSSHPPLQSTVFIHKLYNILEDDDLKDLIWWSPSG
                     LSFLIRPIEKFSRALATYFKHTNIASFVRQLNMYGFHKVSNDHGKSSEHDSASNSRTN
                     NSNSSDNNNNSNADVQEDIKIWKFRHSTGLFKRGDIEGLKYIKRRSSRNISHSSVRKN
                     SNSNGHTNNSSAGTNTNSGSTNDTNSTSGSITSMFGNVQFHDEEQEQLRQPQSQHIPH
                     SQQHQQPTNEHLPHQHQLHLQQQQQQQQQQQQQQQQHQRGILSETEPGFFTSQTPQMH
                     PSLTYTSFPNHPTAQPAPNNSDPFLESRYAELSQSYNVLRYEYNSLQYRHDEALGYLK
                     GVNMDMVHVLELLESLVTIQTSSEPSPQEFSGLEQELLRFKALLMSRVHRNSDAQVQQ
                     PSQRSFGENRPLSSISVPTSHSNVPSLVQHVFAVPARPSSAVNVVQPASTTGSASSAP
                     VPAPTPAPPPPPPQATDHFSGPRMMMMNPFESTGNGSKRNMSILMDPLAPAPNLMLGM
                     SPSHPQPFMNSSPVTASAAGYRAPRQTDRSSKISLVASKNSHSSNNSDSSSGSGSLSH
                     QHVASGGTPAGQGVGASAGAAPIKEEQQTMTMVEPPRPPSAKEQGDIVRPIPTRSLGS
                     SENTRGSSGVYSLLNDERPASPLDGEMTPTKKVKL"
     gene            complement(<955212..>957818)
                     /locus_tag="ZYRO0D11308g"
                     /db_xref="GeneID:8204185"
     mRNA            complement(<955212..>957818)
                     /locus_tag="ZYRO0D11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002496880.1"
                     /db_xref="GeneID:8204185"
     CDS             complement(955212..957818)
                     /locus_tag="ZYRO0D11308g"
                     /note="similar to uniprot|Q12386 Saccharomyces cerevisiae
                     YOR141C ARP8 Nuclear actin-related protein involved in
                     chromatin remodeling component of chromatin-remodeling
                     enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002496925.1"
                     /db_xref="GeneID:8204185"
                     /db_xref="GOA:C5DW23"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027668"
                     /db_xref="UniProtKB/TrEMBL:C5DW23"
                     /translation="MSQEAESEPVYEEPIDIPLEEEDDDDEDDEADEVGESHTPSTTQ
                     QKLRAEAEAHGDADEDEDMDTMHANASRSGTSTPLGNANTAAGDDDEMDDDELDDDDG
                     DENNKKRDSQGKFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGI
                     EKVETNTLPPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTP
                     DVADLKRENGNTTELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSC
                     VAIPKSELHNQIPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHE
                     QVINFNKVSKPELIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSF
                     NIASPDYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETL
                     IRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCI
                     TLDYGSDDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLY
                     NFIKRIPGQQAEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPIS
                     RDIFTDNLDDWRSLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDI
                     RQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWR
                     PRILSHTSFPDL