GenomeNet

Database: RefSeq
Entry: NC_012994
LinkDB: NC_012994
Original site: NC_012994 
LOCUS       NC_012994             881646 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Zygosaccharomyces rouxii strain CBS732 chromosome E complete
            sequence.
ACCESSION   NC_012994
VERSION     NC_012994.1
DBLINK      BioProject: PRJNA39573
            BioSample: SAMEA3138235
            Assembly: GCF_000026365.1
KEYWORDS    RefSeq; genomic DNA.
SOURCE      Zygosaccharomyces rouxii
  ORGANISM  Zygosaccharomyces rouxii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygosaccharomyces.
REFERENCE   1  (bases 1 to 881646)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 881646)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 881646)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928181.
            The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A
            to G). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..881646
                     /organism="Zygosaccharomyces rouxii"
                     /mol_type="genomic DNA"
                     /strain="CBS 732"
                     /db_xref="taxon:4956"
                     /chromosome="E"
     gene            <2603..>3472
                     /locus_tag="ZYRO0E00132g"
                     /db_xref="GeneID:8204954"
     mRNA            <2603..>3472
                     /locus_tag="ZYRO0E00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498913.1"
                     /db_xref="GeneID:8204954"
     CDS             2603..3472
                     /locus_tag="ZYRO0E00132g"
                     /note="weakly similar to uniprot|P38363 Saccharomyces
                     cerevisiae YML132W COS3 Protein involved in salt
                     resistance interacts with sodium:hydrogen antiporter Nha1p
                     member of a family of conserved often subtelomerically-
                     encoded proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498958.1"
                     /db_xref="GeneID:8204954"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5E3U2"
                     /translation="MFATLYLEFSILLPLARLQYSKMYPNTTVLVRQVLELNPQRDFK
                     KWDDIASKLNLLFYQEHIWNTPYFFYDGQQTQLAFKDNVLRPYHQGKFNGITDADKIQ
                     SARSYMQSIKKDFGLSLRDSLSKPVLNSKLPRDTYRGKFSFYSRYLLVGLTYLFQIDS
                     LLKIVTTFGQKPFEALISLIYWQFLFLIFYRYRYRLLYQEMGTMQAIKFLSIITKVNP
                     EKELNKWDQVARHMNEYLASEENSSHSKRRFLDGKRCLNCYKTYFEPLSVGNGPSEYC
                     ELKEIVEIIKPDA"
     gene            complement(<8207..>9667)
                     /locus_tag="ZYRO0E00198g"
                     /db_xref="GeneID:8204955"
     mRNA            complement(<8207..>9667)
                     /locus_tag="ZYRO0E00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498914.1"
                     /db_xref="GeneID:8204955"
     CDS             complement(8207..9667)
                     /locus_tag="ZYRO0E00198g"
                     /note="similar to uniprot|P50277 Saccharomyces cerevisiae
                     YNR058W BIO3 7 8-diamino-pelargonic acid aminotransferase
                     (DAPA) catalyzes the second step in the biotin
                     biosynthesis pathway BIO3 is in a cluster of 3 genes (BIO3
                     BIO4 and BIO5) that mediate biotin synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498959.1"
                     /db_xref="GeneID:8204955"
                     /db_xref="GOA:C5E3U3"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5E3U3"
                     /translation="MKLPEETKALLRFDREHIWHPYTSMVNPLPVHLVKAAYDCELIL
                     ETQDGSENRVIDGMSSWWCAIHGYNHKELNDALISQASQMSHVMFGGLAHRPAINLVQ
                     KLLKMMNHKELQHCFLADSGSVAVEVAMKMALQYHFTLGKPKKSKFLTISSGYHGDTT
                     GAMSVCDPVGSMHSIYRGYLAENIFARGPSMIPVLPTSGVFRKYGKSFGDRTSWKEDD
                     INDVRDKIENHHDELCAVFLEPILQGAGGMRLYHPQFLIEVRRLCNRYHIPLILDEIA
                     TGFGRTGTTFAFHHCQIYQEQNHIPREMQIDVYPDIICVGKALTGGYLTLSAVVTTPK
                     IALGISSPSSPTGGCMMHGPTFMGNPLACAVANKSLDILMCGYWKQQVHRIEEQLFEE
                     LFVPLMEGAAAKELWLVEDVRIVGAVGVIELKVSIDQEWFQEAFISKGVYIRPFRNLC
                     YIMPPYIISKEQLRKLTTGLVSALREWHSVRANSTV"
     gene            <10096..>10788
                     /locus_tag="ZYRO0E00220g"
                     /db_xref="GeneID:8204490"
     mRNA            <10096..>10788
                     /locus_tag="ZYRO0E00220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498915.1"
                     /db_xref="GeneID:8204490"
     CDS             10096..10788
                     /locus_tag="ZYRO0E00220g"
                     /note="similar to uniprot|P53630 Saccharomyces cerevisiae
                     YNR057C BIO4 Dethiobiotin synthetase catalyzes the third
                     step in the biotin biosynthesis pathway BIO4 is in a
                     cluster of 3 genes (BIO3 BIO4 and BIO5) that mediate
                     biotin synthesis expression appears to be repressed at low
                     iron levels"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498960.1"
                     /db_xref="GeneID:8204490"
                     /db_xref="GOA:C5E3U4"
                     /db_xref="InterPro:IPR004472"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E3U4"
                     /translation="MKPPVFFVTGTDTDVGKTFISSLLVYKWRANYWKPVQTGIESDI
                     GDTATVSNVLVDDSWKPHLFPPRHQLLKPLSPYEAMDYEPGVNVQITDFEIPEGTDEH
                     PLVVEGAGGVAVLVTKKMETIVDLIKELSFKCDRPFYIILVARSTLGTINHTFLTLNY
                     LRSKGLGDKILGVVVNGEQNEGNLKVMREFGVNILATVDYHTSMSEALSDIPSFCSLD
                     LAHNDPASIQKN"
     gene            complement(<14074..>14937)
                     /locus_tag="ZYRO0E00286g"
                     /db_xref="GeneID:8204491"
     mRNA            complement(<14074..>14937)
                     /locus_tag="ZYRO0E00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498916.1"
                     /db_xref="GeneID:8204491"
     CDS             complement(14074..14937)
                     /locus_tag="ZYRO0E00286g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498961.1"
                     /db_xref="GeneID:8204491"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5E3U5"
                     /translation="MSMISDDSEKDLEKCVQMYEEEEIELPEDSSGGKLTYFLAPYFF
                     EKTWFYDIIASLVGAFLSPSLVRLPYFILRDFYHDPYEPKLLDVFSPLWMIIHYFLCF
                     TFSFWNFIDNRKNVDIEKKVLQKLLKEVAETDLMGDPLAWQRIASRVNHFSEEGGYHY
                     SVFYSGEHCMRFFVREIVKPIERQTYDIRCYYEGEICSNFWKNPSNKALTERALANYN
                     KSVENFGELSHTAEKDEFRDGIFEKFHSIFDTSLFYLVMTELGSFMIMMLTFIISVIS
                     CAIFNSFATPH"
     gene            <15270..>15968
                     /locus_tag="ZYRO0E00308g"
                     /db_xref="GeneID:8204492"
     mRNA            <15270..>15968
                     /locus_tag="ZYRO0E00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498917.1"
                     /db_xref="GeneID:8204492"
     CDS             15270..15968
                     /locus_tag="ZYRO0E00308g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498962.1"
                     /db_xref="GeneID:8204492"
                     /db_xref="UniProtKB/TrEMBL:C5E3U6"
                     /translation="MSNKKQSKSKASESHKRGGRENSPRGQHNSPSPQRNNSITDQQG
                     SENGGTGSRTYGIKLAARLFRNPLLSKRGVKHAKEGLKIRSSDKSISGVRCGGSFCLF
                     VYPIFLIGYSIFGFLYGDKNNSIHVFLYGSPLFTAVPYIIQYLNDVDTLLLSIFEIGE
                     KNLLEYFADPGIRELLLIVFEIVGFIYQLVKGRQNFGIFICGIVGFVSYLLGHTLLIL
                     ERKKRPGSVAGDSA"
     gene            <16701..>17774
                     /locus_tag="ZYRO0E00330g"
                     /db_xref="GeneID:8204493"
     mRNA            <16701..>17774
                     /locus_tag="ZYRO0E00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498918.1"
                     /db_xref="GeneID:8204493"
     CDS             16701..17774
                     /locus_tag="ZYRO0E00330g"
                     /note="weakly similar to uniprot|P47187 Saccharomyces
                     cerevisiae YJR161C COS5 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498963.1"
                     /db_xref="GeneID:8204493"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5E3U7"
                     /translation="MESDNESQKPVLPKDLFKNAFTWMFYEISKHRFPSVVSCVYLVI
                     VLVGFWWNFADKNLPLSIVLAAVGLFGILFGLIPAWFQNVKEHPNTKKLVQQVLESNP
                     GVDTRKWDEIANILNLFFYRENIWRTPYFFFNGQHVQRVFKYNVLKPYLGGQFEGVAD
                     ADKIQSAKCYMQSIKVYFELSLKDSISEFFLNSELPRDTHRNKFFFHPRYFFMGFMIC
                     FFQGQILLLVVQLFVQRSFWILPTIINYQYCLLKCYQYGYRFWYPEMDVMQAIKFLAI
                     ITKFSPRKELDKWDQIARYMNQYLMEGNSSHSRNIFFDGKHCLDCYKACFESLSLGNN
                     SLSYDELKEIVEITQPSLNEETD"
     gene            complement(20280..20351)
                     /locus_tag="ZYRO0E00374r"
                     /db_xref="GeneID:8204494"
     tRNA            complement(20280..20351)
                     /locus_tag="ZYRO0E00374r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (TCC) cove score=71.59"
                     /db_xref="GeneID:8204494"
     gene            complement(<21090..>22190)
                     /locus_tag="ZYRO0E00396g"
                     /db_xref="GeneID:8204495"
     mRNA            complement(<21090..>22190)
                     /locus_tag="ZYRO0E00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498919.1"
                     /db_xref="GeneID:8204495"
     CDS             complement(21090..22190)
                     /locus_tag="ZYRO0E00396g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498964.1"
                     /db_xref="GeneID:8204495"
                     /db_xref="GOA:C5E3U8"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:C5E3U8"
                     /translation="MNMSFGSIPVIDLGQAFDNETKPKFLENLRHALITVGFLRLTNF
                     GNYGPTTQDFQNITQQGIEFFELPEEEKKKVEMINSPHFLGYTKLGNEITSGKIDWRE
                     QIDLATELPAPTKDGPLYKQLEGPNLWPDERVLPYFKLTMTSYIDKMSRLSSIFTKLV
                     AESIGLSPNALDTYFKENQQCKMKIVAYPADTHYRNDVEAVQGVGPHKDSDFLTFVYQ
                     ASDHKDTLQVQNFKGEWISVDNIPGSLVVNVGQTLEAITCGVCKATIHQVLRPRKGSG
                     TRLSIPFFRTVDLESKESAVSNISHDVWKLKEERDKTIDRWGIDTGFQYRPDFSQHPA
                     GYAVFRNRIKSHRDVAAKWYPELLAKVLTEIA"
     gene            <25673..>27175
                     /locus_tag="ZYRO0E00418g"
                     /db_xref="GeneID:8204496"
     mRNA            <25673..>27175
                     /locus_tag="ZYRO0E00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498920.1"
                     /db_xref="GeneID:8204496"
     CDS             25673..27175
                     /locus_tag="ZYRO0E00418g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498965.1"
                     /db_xref="GeneID:8204496"
                     /db_xref="GOA:C5E3U9"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5E3U9"
                     /translation="MEGIKRHFDKWKITNRFGYTAMWKNSDLESEADLVSLSKREGDK
                     ENFEAKDLDEVSSTLDDDGKAYGEQYRTCSWLHTTGLILSEYIVLAIMSFPWSYSVLG
                     LFPGLLLTVFVALTTLYTGLIIAEFCEKFPHLRNICDIGQVLFGGYRWAWYATAICFL
                     LNNALIQGLHVLVGAKYLNTITNHSVCTVGFAGITAIISLVFSLPRKFISMSFLGYFA
                     TITMFVSVILAMVFAGVQSHPYGYDGTPVVYKAFPVKGTTYVSGMGAFLNIIYTFVGQ
                     VTYPQFIAEMKNPKDFKKVLWVVCISQIVLYGLVGSIVYVYVGEKYMSAPAYGSLIRA
                     FKIISFSFCVPTIVYAGALYANVSAKFLFFTFFENKPGYVYSYSLKSWLVWFVILVVL
                     WAVAFVIAEVIPFFSDLLSLMSSLFDCWFGFVFWGLAYIRLRKHEYGEAFSFRNLTFK
                     QKINFILSYCLIGIGLYILGPGLYASVQSIINSYKADLYGTVFSCASNGI"
     gene            <28214..>29269
                     /locus_tag="ZYRO0E00440g"
                     /db_xref="GeneID:8204497"
     mRNA            <28214..>29269
                     /locus_tag="ZYRO0E00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498921.1"
                     /db_xref="GeneID:8204497"
     CDS             28214..29269
                     /locus_tag="ZYRO0E00440g"
                     /note="weakly similar to uniprot|P38723 Saccharomyces
                     cerevisiae YHL048W COS8 Nuclear membrane protein member of
                     a family of conserved often subtelomerically-encoded
                     proteins regulation suggests a potential role in the
                     unfolded protein response"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498966.1"
                     /db_xref="GeneID:8204497"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5E3V0"
                     /translation="MTTTGIYRSSKHKPKLNVEMPTGHGEGDPILPVYSFRNSFTWTL
                     HEASRNSPLIFALPFLLGIALASFGRKEAICLIVIGLLIIILADWPPLHKNYVLSQNK
                     ELFSTIVLAVDPGVEATKWREAASKMNTALYEQGFWKTLNFFFNEKECRDGFREHVLK
                     LLPSSEASKRYQQAISKLFMSFLEDVPSEFDILPRYRFYEYFSNKCFMFGVLMLAISS
                     AIGIPDEAKRTMYSIYAYGTVKYLYGAIQGKQFSFLDVVPRVKFLATIMHFAPGSDIS
                     KCDEIAGHMNYYLSSKKDWDIPRGCFNEGKDCLNFYKTAFEPLINRNKRGGYLELEDI
                     VLETNKLCGKNTTKIIE"
     gene            complement(<29301..>30023)
                     /locus_tag="ZYRO0E00462g"
                     /db_xref="GeneID:8204498"
     mRNA            complement(<29301..>30023)
                     /locus_tag="ZYRO0E00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498922.1"
                     /db_xref="GeneID:8204498"
     CDS             complement(29301..30023)
                     /locus_tag="ZYRO0E00462g"
                     /note="similar to uniprot|P36087 Saccharomyces cerevisiae
                     YKL070W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498967.1"
                     /db_xref="GeneID:8204498"
                     /db_xref="GOA:C5E3V1"
                     /db_xref="InterPro:IPR007396"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:C5E3V1"
                     /translation="MYIPKQYNVDDIEKQVQIIKDYPLGTLFSSRPVSKGLFGFGKGD
                     ESEQPDSDMCASHIPFFFVESPEGKHKLIAHLSAKNQHANQLENTSKCLVTFQSVDSY
                     ISPSWYPLKEKTHKFVPTWDFAAVHVYGTPKIIRGDKEWLLKMLNLLTNQEEGKRPEG
                     EEFKAKWKVSDAPESFLDGKLKGIIGLEIDITHMESKFKFDQDSSQINVDGVISNLEN
                     EVGGDKGGDMAKFTKECYPDRK"
     gene            <30607..>31947
                     /locus_tag="ZYRO0E00484g"
                     /db_xref="GeneID:8204499"
     mRNA            <30607..>31947
                     /locus_tag="ZYRO0E00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498923.1"
                     /db_xref="GeneID:8204499"
     CDS             30607..31947
                     /locus_tag="ZYRO0E00484g"
                     /note="similar to uniprot|P18544 Saccharomyces cerevisiae
                     YOL140W ARG8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498968.1"
                     /db_xref="GeneID:8204499"
                     /db_xref="GOA:C5E3V2"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5E3V2"
                     /translation="MQQNCIQMNDSLELYKNYPQKNLQENCKNLLGYGPNFVPAVITR
                     AKGSFIYAGDEKILDFTSGQMSTLLGHGQPEVSETIARHAYQLDHLYSGMLSPPVLEL
                     AEKLTGLLPGGLERAMFLSTGSEANEAAIKLAKTYTGKFEIVGLSLSWHGMTGASNAT
                     TYQDGRKNQGPMIPGNLVLPAPNTYRSIFRKPDGSYDWETEMDYGFGLIDAASVGSLA
                     AVIVEPVLSSGGMLVLPDGYLKRLKMHCERRGMLLIVDEAQTAFGRCGALFGFEAHGV
                     VPDILSLSKTLGNGIPLSAVVTSNKIADKTASEHFLFYTTHVNDPLPCAVGSKVIDIV
                     IRDNLVQNSTNMGDLFRSEIALLQKKYDQIGDIRGRGLMTGVEIIDPKTKEADVKLAG
                     QLADKMMELGLSANLIRVPAFGGVFRIAPPITISREEIMLGASIFAQSFKEVLG"
     gene            complement(32250..32349)
                     /locus_tag="ZYRO0E00506r"
                     /db_xref="GeneID:8204500"
     tRNA            complement(join(32250..32294,32313..32349))
                     /locus_tag="ZYRO0E00506r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (GCT) cove"
                     /db_xref="GeneID:8204500"
     gene            complement(<32878..>33987)
                     /locus_tag="ZYRO0E00528g"
                     /db_xref="GeneID:8204501"
     mRNA            complement(<32878..>33987)
                     /locus_tag="ZYRO0E00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498924.1"
                     /db_xref="GeneID:8204501"
     CDS             complement(32878..33987)
                     /locus_tag="ZYRO0E00528g"
                     /note="highly similar to gnl|GLV|KLLA0B03564g
                     Kluyveromyces lactis KLLA0B03564g and similar to YPR191W
                     uniprot|P07257 Saccharomyces cerevisiae YPR191W QCR2 40
                     kDa ubiquinol cytochrome-c reductase core protein 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498969.1"
                     /db_xref="GeneID:8204501"
                     /db_xref="GOA:C5E3V3"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C5E3V3"
                     /translation="MLSSATRLQFAKQAARRYTVSATDGAGKVSSLAVKVHGGSRYAT
                     KDGISHLLSRFNFHNTSGKSALRLVRESELLGGGFESKVDREFITLSATFLKEDLPYY
                     VNALGNVLYKTSFRPYELPESVLPAAKHDLELHNICPVRRAEDLLYNITYRRGLGNPV
                     HYDGVEKVTLDDIKEFASKVYTKENIDIVGEGVNESDLKKFVADSLLNSLPSGTSLVS
                     TATPKTSINKENRARHAGQSAAAIAIPVSKQDFAQYEALARYLTSPLSQLAPSIFKAK
                     LDKQSTTGLFVLSVKGADADTVSANIKNVVSQLKQGVNLSSAKDYVSLQYAIEADTVV
                     SPTPLNFDSIKNFKLGDFNYVAVGDVSKLPYADEL"
     gene            complement(<34682..>35206)
                     /locus_tag="ZYRO0E00550g"
                     /db_xref="GeneID:8204502"
     mRNA            complement(<34682..>35206)
                     /locus_tag="ZYRO0E00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498925.1"
                     /db_xref="GeneID:8204502"
     CDS             complement(34682..35206)
                     /locus_tag="ZYRO0E00550g"
                     /note="highly similar to uniprot|P30902 Saccharomyces
                     cerevisiae YKL016C ATP7 Subunit d of the stator stalk of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498970.1"
                     /db_xref="GeneID:8204502"
                     /db_xref="GOA:C5E3V4"
                     /db_xref="InterPro:IPR008689"
                     /db_xref="UniProtKB/TrEMBL:C5E3V4"
                     /translation="MSLAKPAASKLDWAKVISTLKLTGKTATELSGFKKRNDEARRVL
                     FELQAQPVDVDFSHYRSVLKNRAVVDQIEQSVKAFKPVTVDASKQLSTIEAFEAQALN
                     NAKETETLVAKELKDLQETLKNIESARPFDDLTVDDLAKVRPEIDAKVEEMVKKGKWD
                     VPGYKEKFGDLTVM"
     gene            <35940..>38456
                     /locus_tag="ZYRO0E00572g"
                     /db_xref="GeneID:8204503"
     mRNA            <35940..>38456
                     /locus_tag="ZYRO0E00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498926.1"
                     /db_xref="GeneID:8204503"
     CDS             35940..38456
                     /locus_tag="ZYRO0E00572g"
                     /note="similar to uniprot|P25502 Saccharomyces cerevisiae
                     YKL015W PUT3 Positive regulator of PUT (proline
                     utilization) genes zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498971.1"
                     /db_xref="GeneID:8204503"
                     /db_xref="GOA:C5E3V5"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E3V5"
                     /translation="MQREYLGEEIGEKYDTGDEDTPSSSGSAGYVRKPPRRSTLACVR
                     CRRKHVKCPGGDPCSKCSAARIACEYLEPNKKLTVSMKYLQQLQENLADLKRENVKLQ
                     SIVNTVNSDVTESKIKERATTNGDETAIDASSYKEVPLDEGHGAYDIEKETTDDVDPP
                     VSGDEMELVSNFAQRSGRLVESRTGQRYFVGSSSMTLFGLEIQSLLSKYLSHKGGNED
                     ENTLPNNEDYNENPLLQGPQSNLDQIDVLQEEGNAYKIVLNKNEGNDDISVNFTLPSY
                     SYAIFLVDTFITYNDGCFYFFNEGMVKHGLKIAYEGGAFYNDRTLQTIWFCKVLLIFA
                     IGEMYLGTSNNVNGNKIKDTAKLPGSGFFEEASQIFSCLFSSGRIESVTKEGGIEVML
                     LYAFYLQVADCTVASYFYFGQALRACLISGMHVDAQRDNLTRFELEHRRRLWWTVYMF
                     ERMLSSKAGLPLSFTDNTISTELPGDFDMSKPPPGCEHYIFPEAEYIINCVKIVRINA
                     QILNKLYQRQPNTNILAALKSVVKQLLQWRNNLPSFLQVDFTEKHLKISRLCANLFTE
                     YFQGMNLAIRPLLFHFASVQLKKFRGSNTYINLQNYSSTISALLNCSLQASVNTIRSL
                     WALMDQNMVALFGYMDREYLFTASCTLVLFNAAFGIHEQTYEHLDHALNIFTKMRNLG
                     NNPAGLRRSQLLTLMANFDFHGIMKDMICAHNDSLKPDTQYDAHNFRNVNIVSQTMTD
                     SASLSDIINATLAKSSQINLTKKETQIIEKNSNQFDPLNTADDGELQVLLDKMTKVSQ
                     TDNKLWKEISDQAMWLGSAMDPAIAPGNEMDFGQGKGSNF"
     gene            complement(<38569..>43626)
                     /locus_tag="ZYRO0E00594g"
                     /db_xref="GeneID:8204504"
     mRNA            complement(<38569..>43626)
                     /locus_tag="ZYRO0E00594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498927.1"
                     /db_xref="GeneID:8204504"
     CDS             complement(38569..43626)
                     /locus_tag="ZYRO0E00594g"
                     /note="similar to uniprot|P34241 Saccharomyces cerevisiae
                     YKL014C URB1 Nucleolar protein required for the normal
                     accumulation of 25S and 5.8S rRNAs associated with the
                     27SA2 pre-ribosomal particle proposed to be involved in
                     the biogenesis of the 60S ribosomal subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498972.1"
                     /db_xref="GeneID:8204504"
                     /db_xref="InterPro:IPR021714"
                     /db_xref="UniProtKB/TrEMBL:C5E3V6"
                     /translation="MKSQDIPLVDHEKSAGRNKYKQSGNVDDEVLVNLSNLVHSLENE
                     DDSKDFGPLLEFFHKNYISQAVQSWSYYAQVNNHAKLTESTILLTRTLVVLRSNANAL
                     EYGGILIKLILDNYMKVLYRSLNNIKASLTIPTIHLMKEMIDFNSGQYIEEFTSSFDF
                     SLRSLPKILTVNKNDISSFNPTNKNHRLHIRFEFIRFWLSLISHCTPLLRRDLVIQNS
                     KIMGAWFKQMDKADTAELMEETVEVLCTKFVQEKAFKKMTKTQILNELALSKIYSYFY
                     SSNKSLVKKVNEFFIAYGADPESSVAFPDNLPWYQESPFNTSLKGVPVTVNQKDFRIH
                     NKLLFNALKNFKPWESDMQASTVLKILDHVPELVPPYCHYLASHGTHDPKMTSYWFGC
                     TMLLGRIINLKIPTSMANIQSETAPSLDLVIQAILPAPLTKISLTKALQHEKMIITQL
                     ACQLLVFSFQKLSKVLKLYESKGWGSASAPLRNSFYQSIPDLTIITSVMNQSYLTAKN
                     NKVMQLSLTLLLKYYSTTFPNFFSINMPSSNIYMDIMRKDEFSGIDLAIVDNFLQFQE
                     LNGTQTKWWNAPAGQNSLFTSLLKMASSKNSTNAVASKISQLLQHMFHGTVAFNEVLC
                     SPLWILIYSLQVLSFEDHKNDEVNKIWKLLDETISRCMKMPYRYVDSSKDYEKISPFL
                     VVLCDQWKFIDGQGSLESAAKWICILLRTFIICGESAEGIRRLAESFVGVPKEYLDIY
                     LTFENYETKTKKLCSDESFKLANFQGASFFQHITITPYSKLTKVVRYPVNELDAVGLI
                     WRLQNLVRDRAITFNGMFKEVTDTLLAKLANFSNSNVSFRLISPEVIKNLLPVSGYLD
                     NENMKSYFASQALFQLYHESNLNNPAFEQFIFAWLKDHMDILQSDEPNAMMFASAICT
                     CLQTIHAPTILENYKQINPQSLDIILQKVWEIPNQKVSFKIFEYAMKVPSSNLDQLLA
                     KFIAEDKIIDFQPENFVAQSLEKFPIAFETFARSKWFDFDLLLSYLPRIQGTEVALVA
                     ALSLPESNDSRLQEFLQNVINDCCEKLDRQEISSGALKLFCSRPEMLTKNQQLSAVRH
                     ITTNYHEKYSSEVIKFVRSVNNYDDPNVIAWLNKTILYGTKYFSNATELSPDFSLYLS
                     ELEKLTASVNIWSKVNHTYLQAQHEVILTGFWVNNSRVLQYMIHLLMNGKGKDVQCTR
                     MLQGILNNEKNALKVENNDNFLRFVTAATIFTLFMMDPQQNSTNIVQSKLIELYGGTM
                     SCEDRMILKIIGEIETITSSSWINESCSLELLEEENETAGEYGSRKIVALEREGTFIT
                     LDKNTILNTVNNFPLNRPIIPGQFNWEALFSFYSDNTVYLSNTVGAIYDPEFLMLMSL
                     QSGAGLVTSSTAEDGSTTYKFEIQRYLMSDIFQIILLSLAESGDLQKISLRIIYGMLS
                     SLEEDSQFKYGHIIAVLLKKIVFSFEKAKLEDKPFRIASCIWFAISRLSGLLVNPGSL
                     LHETAFRWVLNSPFIMPNDFPLLQDLTTPNEKFRGYENFYRQLAWVLECLDLGTKTDE
                     DVHFMKQRSILEWLSNLKNLPYLNARLYTMIDSIFYKVQRLEDGGSTLLTRFASASTL
                     ELQDLFLQQQLKRNASSIAKNKNDKRLIRNKLVLETHRVNTSEILLGHTEIMNSQKRV
                     RLWAEDDQENISKRIKN"
     gene            <43920..>44621
                     /locus_tag="ZYRO0E00616g"
                     /db_xref="GeneID:8204505"
     mRNA            <43920..>44621
                     /locus_tag="ZYRO0E00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498928.1"
                     /db_xref="GeneID:8204505"
     CDS             43920..44621
                     /locus_tag="ZYRO0E00616g"
                     /note="similar to uniprot|P40576 Saccharomyces cerevisiae
                     YIR024C (putative) involved in cell cycle control"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498973.1"
                     /db_xref="GeneID:8204505"
                     /db_xref="UniProtKB/TrEMBL:C5E3V7"
                     /translation="MFARFTRPLQKVAAARFYSQVSASATSKQANSKFDKSIIKPILV
                     VIVFGTMLSHVMNQQRLAGEMERRYVLKMEILKDLIERARKGEINIDVQEELKLVNKL
                     FERNKEARFLNDKEAEKLSQISSSQNYSEAEVLQSMNNSTRALEKESLDDLLKSIMDE
                     VSDEPKSSARKSNPKPKQQQSGEFITDRDTLREKAEYERELLQYKPSTDVHLIVENPG
                     ELSSAAGDTKVSKFL"
     gene            complement(<44716..>48036)
                     /locus_tag="ZYRO0E00638g"
                     /db_xref="GeneID:8204506"
     mRNA            complement(<44716..>48036)
                     /locus_tag="ZYRO0E00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498929.1"
                     /db_xref="GeneID:8204506"
     CDS             complement(44716..48036)
                     /locus_tag="ZYRO0E00638g"
                     /note="similar to gnl|GLV|CAGL0F06743g Candida glabrata
                     CAGL0F06743g and similar to YIR023W uniprot|P21657
                     Saccharomyces cerevisiae YIR023W DAL81 Positive regulator
                     of genes in multiple nitrogen degradation pathways
                     contains DNA binding domain but does not appear to bind
                     the dodecanucleotide sequence present in the promoter
                     region of many genes involved in allantoin catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498974.1"
                     /db_xref="GeneID:8204506"
                     /db_xref="GOA:C5E3V8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E3V8"
                     /translation="MSSGTDRQKESDDMSGDKNQNLYDKSNGNHEMLSFNDNYAMILQ
                     KLANDNSHLLTQDLNLNSMGVGPSTSDNNNDNSNNSNNGNSANFPSTRPSDIGNSGNG
                     GDRQNLDALLQHYQSLLTRSASQYPESSAGASVGENNNNINNRNNCSNNTVENNVSGN
                     SVKNSEADTSGKVDSNNNTSTNNNNNGNNNSHNTTTSNNAHNSNNKSMITERPCDHCR
                     RRQTKCVLVPDLADCVQCETKGIKCTFSDLPNNVNKFMGVADTMNPNGKHQRQDNGVD
                     LEGLLKRAKINNNDNVAQYYAELLQNLHESMNNNNNNNNNGSSSIHASAASSAPTPTT
                     MHNNGFVNMLQQGQQQQQPPVSLPPQQQPPPFPSQPSGQYPRSSLYVGPTSSYDLNLI
                     NHIKLDNIDQIQLLPSVSLRKVAPDVLFVLRDNFNEQAFLKQEQEVDMVERLVYPHGK
                     VLIDIFFKLIHPCFPILHERVFLEKYSRSYRELTAPLLASIYSLSIQWWDFHPKLIGF
                     AKPDVVEQLNEIAYRTFFQMIERPKLSIVQTGLLMLQCRSEYPNNWVLCSALVALCEE
                     LGLGIDCQDWRLPRWERGLRRRLAWAVWTQEKWTALVESRNSHLILGRNWMVKLLTEE
                     DFPQNSPVISGSQDTTSRNSMGPENSMGNISLIDMSPTDEDFVSGNLMFQQLVSLTVI
                     LGEIMDTFYTEGATKITTRIEQVLKLAKPLQLKLREWYHSLPPQLSMNKFVPRKFNPN
                     ATLTLAYFAAEITLHRKIISTLKQDTPKELVQVCRTAAKTRLVAAIEFVRDLKSEHIN
                     AFWYTCSTGNLMLIAIFAALLYVTAQTRDEAVVVRDYLRNYIWILRVGSKSFDKSGHA
                     LKSIHVLLSQIPGLLTDELPREFVPTRSQSPMYPASQQWKVPPMMTGPSSMDSQQISP
                     NLSQLRSVPTEILQNLSGLPGDSPRFPMNRSTAQSSPVNISGDVNGSGGSNTYGSGNE
                     SEHSIKASMDQSNSSPKDGQLTSKEESVDTEHPSPDPIMNTSSVGGVDRNLIDPSTLT
                     QNPRGKPITPQSVNGNNEAKDNAPASNADALDKSTTSGGGSSVSPSSIHGKEDTHNAS
                     NEDLNESSPKNLDLENKD"
     gene            complement(<48313..>48828)
                     /locus_tag="ZYRO0E00660g"
                     /db_xref="GeneID:8204507"
     mRNA            complement(<48313..>48828)
                     /locus_tag="ZYRO0E00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498930.1"
                     /db_xref="GeneID:8204507"
     CDS             complement(48313..48828)
                     /locus_tag="ZYRO0E00660g"
                     /note="highly similar to uniprot|P33204 Saccharomyces
                     cerevisiae YKL013C ARC19 Subunit of the ARP2/3 complex
                     which is required for the motility and integrity of
                     cortical actin patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498975.1"
                     /db_xref="GeneID:8204507"
                     /db_xref="GOA:C5E3V9"
                     /db_xref="InterPro:IPR008384"
                     /db_xref="UniProtKB/TrEMBL:C5E3V9"
                     /translation="MSQSLRPYLTAVRYSLEAALTLSNFSSQEVERHNRPEVEVPNTS
                     AELLLQPIHISRNENEQVLIESSVNSVRVSIKVKQADEIEQILVHKFTRFLEQRAESF
                     YILRRSPMPGFSISFLITNKHTETMKTGKLVDFIIEFMEEVDKEISEMKLFLNARARF
                     VAEAYLDQFVY"
     gene            <49836..>51548
                     /locus_tag="ZYRO0E00682g"
                     /db_xref="GeneID:8204508"
     mRNA            <49836..>51548
                     /locus_tag="ZYRO0E00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498931.1"
                     /db_xref="GeneID:8204508"
     CDS             49836..51548
                     /locus_tag="ZYRO0E00682g"
                     /note="similar to uniprot|P33203 Saccharomyces cerevisiae
                     YKL012W PRP40 U1 snRNP protein involved in splicing
                     interacts with the branchpoint-binding protein during the
                     formation of the second commitment complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498976.1"
                     /db_xref="GeneID:8204508"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR002713"
                     /db_xref="InterPro:IPR027237"
                     /db_xref="UniProtKB/TrEMBL:C5E3W0"
                     /translation="MSSESLWKEAKDTSGRIYYYNAKTGESKWEKPRELLSEQELILA
                     KHGWKSSKTSDGKLYYYNAQTKTSRWELPDLPEFKKEVKKEDTTITPEDKEPAHETAD
                     RYANPSQILHTSKKPKEEAAKEFIQMLKDNQVDSIWSFSRIISELGSRDPRYWMVEDD
                     PLYRQQLFEEYFTSRSEEQLLKERMETSKFNEAFWKMLKTKPQIQYYTRWSTAKRLIA
                     NEPIYKHSVVKESAKKQRFLEYVANLREEHEKSQRQLKSQALKELQDYLENILLSSDT
                     GTNGNNTDFPLMKWQSLANNYLFEKNKRYMANKHFKILTHEDVLQVYMDIAKKVEKNL
                     EDKLAALQKVNYTKDRVARDGFKELLRSPDIKIRANSKWHDIYPLIKNDPRFLQMLGT
                     SGSSPLDLFLDVVEEKSITVAAQRSIAQNVLIEKSFQWDESDVNNSRQTIKGHLRDNE
                     QFTNVDDYDMDLIIDQLEQLQGEKQRKQKLLEQRAFEEKKHFFKLMLRRIYGVVKPKP
                     ETWEAALKDIQHTREYRELTDEYVKRQLFDEFNPEIPHARPRPSVPYNPKKRPLGPDI
                     ELDY"
     gene            complement(<51585..>52088)
                     /locus_tag="ZYRO0E00704g"
                     /db_xref="GeneID:8204509"
     mRNA            complement(<51585..>52088)
                     /locus_tag="ZYRO0E00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498932.1"
                     /db_xref="GeneID:8204509"
     CDS             complement(51585..52088)
                     /locus_tag="ZYRO0E00704g"
                     /note="highly similar to uniprot|P15367 Saccharomyces
                     cerevisiae YIR022W SEC11 18kDa catalytic subunit of the
                     Signal Peptidase Complex (SPC Spc1p Spc2p Spc3p and
                     Sec11p) which cleaves the signal sequence of proteins
                     targeted to the endoplasmic reticulum"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498977.1"
                     /db_xref="GeneID:8204509"
                     /db_xref="GOA:C5E3W1"
                     /db_xref="InterPro:IPR001733"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019756"
                     /db_xref="InterPro:IPR019759"
                     /translation="MNLRLELTRFLKLCFVLSSAFMFWKGLSIATNSHSPIVVVLSGS
                     MEPAFQRGDVLFLWNRNERSKVGDVVIYEVQDKSIPIVHRVLREHHNDKNKQLLLTKG
                     DNNAGDDIPLYGRKKIYLQKERDIVGTVKGYVPQLGYVTIWISENKYAKLALMGFLGI
                     SALLSNE"
     gene            complement(<52308..>53504)
                     /locus_tag="ZYRO0E00726g"
                     /db_xref="GeneID:8204510"
     mRNA            complement(<52308..>53504)
                     /locus_tag="ZYRO0E00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498933.1"
                     /db_xref="GeneID:8204510"
     CDS             complement(52308..53504)
                     /locus_tag="ZYRO0E00726g"
                     /note="weakly similar to uniprot|Q03702 Saccharomyces
                     cerevisiae YKL011C CCE1 cruciform cutting endonuclease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498978.1"
                     /db_xref="GeneID:8204510"
                     /db_xref="GOA:C5E3W2"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR015242"
                     /db_xref="UniProtKB/TrEMBL:C5E3W2"
                     /translation="MGRASGSRTAVEAIDLYCRKSNGRALKRLGSCMGANIGKNKSEG
                     RTSIVDQAEKLEKLRLRKLQDGETSITAIDAGVSNFAYSVFKWYKGDELPTLVDWNKI
                     NLCQRFLGKHRLKMSLDPMDTWKVGHGLLDMLTSELAISDLYVLEKQRMRSLSSKNVI
                     ESVLLSNVMEHILFSNLRNKQIHGNLNTDYVVHSSSPQKMAQYWCDLKSLKTLYNRFT
                     QSTGLQPQKDLPFNDADNFHAAKTSKTIRINLVKTILKNAIAPQGYKKCNLTPHWRSN
                     VEQQLNSQKRFKLLDCIGSGPELGTRKDDDLADSFLHGLAWMHWSKTYEGASEIVMKN
                     GGVFDQEILKDFNDYCMSLNTEWSLMSSQMKGELAELNLANDLETSEEEEYTNSARSR
                     KRESKF"
     gene            <53722..>54555
                     /locus_tag="ZYRO0E00748g"
                     /db_xref="GeneID:8204511"
     mRNA            <53722..>54555
                     /locus_tag="ZYRO0E00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498934.1"
                     /db_xref="GeneID:8204511"
     CDS             53722..54555
                     /locus_tag="ZYRO0E00748g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498979.1"
                     /db_xref="GeneID:8204511"
                     /db_xref="UniProtKB/TrEMBL:C5E3W3"
                     /translation="MSSYGRSKKDHFWRKCYRKLAEVSDDSRRQSVRHHSIRRWKNVQ
                     DPRHVEKPIAFDYWAALTPKSRSKPFMPTSISKPRPKRTVSGAATAPASGCSYSKDSL
                     SPQTYSTAETSIPNNDFEPRPTLDPRSNGSFRSNIKSNRFNKVGEMEPGFCLGFMSDS
                     ATGASATSASVYSGGEKSDDSQTSLDSGIFDSRSFESLINSFDWYATNVFKRLETSVL
                     SFLNSKEPNEDKSSAMCSTVSPLRSELPDSVLTPCTGAATQWDYAIDEAIYGQHAKCF
                     I"
     gene            <54938..>56386
                     /locus_tag="ZYRO0E00770g"
                     /db_xref="GeneID:8204512"
     mRNA            <54938..>56386
                     /locus_tag="ZYRO0E00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498935.1"
                     /db_xref="GeneID:8204512"
     CDS             54938..56386
                     /locus_tag="ZYRO0E00770g"
                     /note="similar to gnl|GLV|CAGL0L05302g Candida glabrata
                     CAGL0L05302g and some similarites with YKL088W
                     uniprot|P36076 Saccharomyces cerevisiae YKL088W Protein
                     required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498980.1"
                     /db_xref="GeneID:8204512"
                     /db_xref="GOA:C5E3W4"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="UniProtKB/TrEMBL:C5E3W4"
                     /translation="MVSMDEQGVSRPETKPVSILNSKPSVIRKDNSVKIGNGNANEEK
                     KLDSQLEQVKLTDNHEDMRPRPGASKNSSFENGSFIAGTSANGSVDSSPQKQSGGGGG
                     GTSAVSFTVSEDQKISQHRYSINSKPAKPTDPSSGGQDTALAAKQDHDSPAAEKSSIV
                     HMPGDFIYFDSQASENKAPTPREHPQQHQQQHPKKELIVPNSGPQVPFTEFFQKQDDK
                     KFHILLGATGSVATIKVPQIIDKLFKLYTREKVSIQLIVTKPAEHFLRGLKISTDVKI
                     WREEDEWSGFKKMGDPVLHHELKRWADIFLVAPLSANTLAKIAYGICDNLLTCVLRDW
                     TPSIPVMVAPAMNTFMYINPMTKRHLSILKEDAPYVEVLKPVEKVLICGDIGMGGMRE
                     WNDIVEILRRKISEIYRARDEKDVAMQAEEEEEEEEDEDEDDDEDEDEDEQGKKNLED
                     DEDEDEDEDEDDDDDDDDDDEDDEDDDDEVAQ"
     gene            <56602..>56886
                     /locus_tag="ZYRO0E00792g"
                     /db_xref="GeneID:8204513"
     mRNA            <56602..>56886
                     /locus_tag="ZYRO0E00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498936.1"
                     /db_xref="GeneID:8204513"
     CDS             56602..56886
                     /locus_tag="ZYRO0E00792g"
                     /note="similar to uniprot|P87108 Saccharomyces cerevisiae
                     YHR005C-A MRS11 Essential protein of the mitochondrial
                     intermembrane space forms a complex with Tim9p (TIM10
                     complex) that mediates insertion of hydrophobic proteins
                     at the inner membrane has homology to Mrs5p which is also
                     involved in this process"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498981.1"
                     /db_xref="GeneID:8204513"
                     /db_xref="GOA:C5E3W5"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="InterPro:IPR027247"
                     /db_xref="UniProtKB/TrEMBL:C5E3W5"
                     /translation="MSFLGFGGGGQSQVSSQQKVQAAEAELDLVTDMFNKLVDNCHKK
                     CISSSYSEGDLNKNESNCLDRCVAKYFETNIKVGENMQQIGQNFQAAGRL"
     gene            complement(<56974..>57702)
                     /locus_tag="ZYRO0E00814g"
                     /db_xref="GeneID:8204514"
     mRNA            complement(<56974..>57702)
                     /locus_tag="ZYRO0E00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498937.1"
                     /db_xref="GeneID:8204514"
     CDS             complement(56974..57702)
                     /locus_tag="ZYRO0E00814g"
                     /note="similar to uniprot|Q00873 Saccharomyces cerevisiae
                     YKL087C CYT2 Cytochrome c1 heme lyase involved in
                     maturation of cytochrome c1 which is a subunit of the
                     mitochondrial ubiquinol-cytochrome-c reductase links heme
                     covalently to apocytochrome c1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498982.1"
                     /db_xref="GeneID:8204514"
                     /db_xref="GOA:C5E3W6"
                     /db_xref="InterPro:IPR000511"
                     /db_xref="UniProtKB/TrEMBL:C5E3W6"
                     /translation="MSSSPIDESNDSKCPVDHNSREVWLKHAAMKQQQQEQEQQQESK
                     CPVDHESREVWLSQAKQDVECSSEQLAATPEYHTNVALPENRQISSIPRTGSEANWIY
                     PSQKQFYEAMLRKNWDPHAQDMQTVVPLHNSVNERVWNYIKFWEKDQGGESCGGIQLT
                     SFKGDSKKLTPRAWLRSQFLGFSKPFDRHDWSINRCGKSIDYVIDFYSDDDQEKGPQI
                     YLDVRPKLNSVEGIRLRMLKSLGF"
     gene            <58372..>59811
                     /locus_tag="ZYRO0E00836g"
                     /db_xref="GeneID:8204515"
     mRNA            <58372..>59811
                     /locus_tag="ZYRO0E00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498938.1"
                     /db_xref="GeneID:8204515"
     CDS             58372..59811
                     /locus_tag="ZYRO0E00836g"
                     /note="highly similar to uniprot|P08539 Saccharomyces
                     cerevisiae YHR005C GPA1 GTP-binding alpha subunit of the
                     heterotrimeric G protein that couples to pheromone
                     receptors negatively regulates the mating pathway by
                     sequestering G(beta)gamma and by triggering an adaptive
                     response activates the pathway via Scp160p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498983.1"
                     /db_xref="GeneID:8204515"
                     /db_xref="GOA:C5E3W7"
                     /db_xref="InterPro:IPR001019"
                     /db_xref="InterPro:IPR002975"
                     /db_xref="InterPro:IPR011025"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E3W7"
                     /translation="MGCTASTHVFENYGEDDPFLQSQKANDAIEQSLQLGKQNDKNET
                     KLLLLGAGESGKSTVLKQLKLLHKGGFTHQERLQYSQVIWADAIQSMKILVIQARKME
                     IPLDCDDPINKRPLFECKRILLKAKALDHIDAGMAGGSDFLNDYVLKYSERHETKRKV
                     QSTGQARAFDEDENSWLHENKDRAMSGQTIIDDEDGVAQDGKLDLQQILQDLDEDSSN
                     DNMFLKERLQQQWQEQQLRQQQHISNQDIAHAIDQLWKNDRGIKQCFARSNEFQLEGS
                     APYYFDSIMKFADPQYVCTDEDILRGRVKTTGITESDFTIGSSKFKVLDAGGQRSERK
                     KWIHCFEGITAVLFVLAMSEYDQMLFEDERVNRMHESIMLFDALLNSKWFRDTPFILF
                     LNKMDIFEEKVKRMPIRKFFPDYQGRVGNSEAGVKYFENLFLSLNRSNNKPIYVKRTC
                     ATDTQNMKFVLTAVTDLITQQNLKRSGII"
     gene            <60005..>60388
                     /locus_tag="ZYRO0E00858g"
                     /db_xref="GeneID:8204516"
     mRNA            <60005..>60388
                     /locus_tag="ZYRO0E00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498939.1"
                     /db_xref="GeneID:8204516"
     CDS             60005..60388
                     /locus_tag="ZYRO0E00858g"
                     /note="similar to uniprot|P36077 Saccharomyces cerevisiae
                     YKL086W SRX1 Sulfiredoxin contributes to oxidative stress
                     resistance by reducing cysteine-sulfinic acid groups in
                     the peroxiredoxins Tsa1p and Ahp1p that are formed upon
                     exposure to oxidants conserved in higher eukaryotes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498984.1"
                     /db_xref="GeneID:8204516"
                     /db_xref="GOA:C5E3W8"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR016692"
                     /db_xref="UniProtKB/TrEMBL:C5E3W8"
                     /translation="MSLQTSNLNRIVEIPLSQIRRPIAPVLDFGKIDAMVSTMEGKPM
                     ASATCSLEQAEDFKGQLPPVDVLCIRENGQTYYFAFGGCHRFQAYDRKAASEQSDVLV
                     RAKLVPATRHQLKLYVGSSVDEMFR"
     gene            <60873..>61871
                     /locus_tag="ZYRO0E00880g"
                     /db_xref="GeneID:8204517"
     mRNA            <60873..>61871
                     /locus_tag="ZYRO0E00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498940.1"
                     /db_xref="GeneID:8204517"
     CDS             60873..61871
                     /locus_tag="ZYRO0E00880g"
                     /note="highly similar to gnl|GLV|CAGL0L05236g Candida
                     glabrata CAGL0L05236g and similar to YKL085W
                     uniprot|P17505 Saccharomyces cerevisiae YKL085W MDH1
                     Mitochondrial malate dehydrogenase catalyzes
                     interconversion of malate and oxaloacetate involved in the
                     tricarboxylic acid (TCA) cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498985.1"
                     /db_xref="GeneID:8204517"
                     /db_xref="GOA:C5E3W9"
                     /db_xref="InterPro:IPR001236"
                     /db_xref="InterPro:IPR001252"
                     /db_xref="InterPro:IPR001557"
                     /db_xref="InterPro:IPR010097"
                     /db_xref="InterPro:IPR015955"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR022383"
                     /db_xref="UniProtKB/TrEMBL:C5E3W9"
                     /translation="MFTRVARRAFTTTRVNPYKVTVLGAGGGIGQPLSLLLKLNHKVT
                     DLRLYDLKGAPGVAADLSHIPTNSKVSGFAPDNNGLSQALSNTDVVLIPAGVPRKPGM
                     TRDDLFSINASIVRDLASAAGEAAPNAKILVISNPVNSTVPIVAESLKKKGVYSPNRL
                     FGVTTLDSIRASRFISEVQGTNPTQEHVNVVGGHSGITILPLISQTKYSNMDKATKDA
                     LIHRIQFGGDEVVKAKDGAGSATLSMAQAGAVFANAVLSGLAGERDVVANSFVDSPLY
                     KSEGIDFFSSPITLGPEGVTKIHPIGEISSEEAELLAKAKETLKKNIEKGVQFVNN"
     gene            <62013..>62324
                     /locus_tag="ZYRO0E00902g"
                     /db_xref="GeneID:8204518"
     mRNA            <62013..>62324
                     /locus_tag="ZYRO0E00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498941.1"
                     /db_xref="GeneID:8204518"
     CDS             62013..62324
                     /locus_tag="ZYRO0E00902g"
                     /note="similar to uniprot|P36078 Saccharomyces cerevisiae
                     YKL084W HOT13 Mitochondrial intermembrane space protein
                     first component of a pathway mediating assembly of small
                     TIM (Translocase of the Inner Membrane) complexes which
                     escort hydrophobic inner membrane proteins en route to the
                     TIM22 complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498986.1"
                     /db_xref="GeneID:8204518"
                     /db_xref="GOA:C5E3X0"
                     /db_xref="InterPro:IPR008913"
                     /db_xref="InterPro:IPR016694"
                     /db_xref="UniProtKB/TrEMBL:C5E3X0"
                     /translation="MSIRGLLVDDQSRCEHWHLPLDVIALRFRCCDEYYACYSCHQQC
                     TNHEVEKYSLENSQSSPLIMCGICKLQMSFEQYRQLECPRCHSPFNPGCKLHYHLYFD
                     P"
     gene            complement(<62334..>63560)
                     /locus_tag="ZYRO0E00924g"
                     /db_xref="GeneID:8204519"
     mRNA            complement(<62334..>63560)
                     /locus_tag="ZYRO0E00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498942.1"
                     /db_xref="GeneID:8204519"
     CDS             complement(62334..63560)
                     /locus_tag="ZYRO0E00924g"
                     /note="similar to uniprot|Q04749 Saccharomyces cerevisiae
                     YMR068W AVO2 Component of a complex containing the Tor2p
                     kinase and other proteins which may have a role in
                     regulation of cell growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498987.1"
                     /db_xref="GeneID:8204519"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5E3X1"
                     /translation="MLVDPSVRLRDAIIEGNLLVVKRLLKRFPELLTNIDPTNGWSSL
                     HYASYYGRYLVCVYLIQCGHDKQEVHTTFKGNTCAHLSLMNGHEQTTHLLLQYFPQLI
                     DWRGHEGKTPVHIACQHDYFQCFNLLMGVGANLTIKDDYGDTPLHVCLEYGSINCMKM
                     LILQGGIVDDHVKNKKGWKPSDVASTYETTKLYTKVLKEAQMPGNVTKPNFGSYRTPT
                     QSSRAVFDDGPSPILALNSPYSLYSQNGAGGSGGSAIGSGFPHLPRISTSRRPSLATS
                     SKSPVGNIASRFASKESSLSNSSSSLQGRDTLNSSMDKQTRSSAEISPSKRDNRRSSG
                     SGGRTSSGSHTLTNSHGNTADLVNKYLMTENHENRIAGHGEEVSESTPTSPKGIRGRV
                     SLLNIPIAKLRSHDSD"
     gene            <63743..>64987
                     /locus_tag="ZYRO0E00946g"
                     /db_xref="GeneID:8204520"
     mRNA            <63743..>64987
                     /locus_tag="ZYRO0E00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498943.1"
                     /db_xref="GeneID:8204520"
     CDS             63743..64987
                     /locus_tag="ZYRO0E00946g"
                     /note="similar to uniprot|P54730 Saccharomyces cerevisiae
                     YMR067C UBX4 UBX (ubiquitin regulatory X)
                     domain-containing protein that interacts with Cdc48p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498988.1"
                     /db_xref="GeneID:8204520"
                     /db_xref="InterPro:IPR001012"
                     /db_xref="InterPro:IPR021569"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5E3X2"
                     /translation="MSTVTVSYNFSQFRVKVTPSMVLNDVLSQSLQHFRLLQEGGSGK
                     WGLTHNDKPVELDLPWRLMNLPTGVKLELKPLSDDGGDKIIKVRVQAPGYSAKVESVS
                     INANLRTFLQQLSESANWPIQDPGAKLQFFTKTIPISELNDQTLKSLGIMESLSIRLI
                     FPSSTTTDASASMPIPAGTTPAREQEDTHRKVESRKIHQLHQVSAYIPSEKTIASQLN
                     IQEENDDPELTVAHARRYQQMVLRQTGGLGGPMVPRRIKEQQEAAAARRKLVEECLVR
                     VRFPDRTHIEVAFKNDDTMSTIYQIISSSLLNEQLQFKLYQSHPHVELPPSDQKLVED
                     LEFGSKTLLLFESNGKGPFLKGSILKDAKDLADAEDVKLDRSDKVETNDQAEKQDLEP
                     AQPEPKKSTPGKYPKWLKLSKK"
     gene            complement(<64996..>67635)
                     /locus_tag="ZYRO0E00968g"
                     /db_xref="GeneID:8204521"
     mRNA            complement(<64996..>67635)
                     /locus_tag="ZYRO0E00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498944.1"
                     /db_xref="GeneID:8204521"
     CDS             complement(64996..67635)
                     /locus_tag="ZYRO0E00968g"
                     /note="similar to uniprot|Q04748 Saccharomyces cerevisiae
                     YMR066W SOV1 Synthesis Of Var (putative) involved in
                     respiration"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498989.1"
                     /db_xref="GeneID:8204521"
                     /db_xref="UniProtKB/TrEMBL:C5E3X3"
                     /translation="MFRFTSTLRNVVRIQARFYRRRRLPTGTHIPALQQNGLLRDAGE
                     ISLKAKDSHETEENLKKMGFEEWNSNKYMEELILQYLKHANSGVRQSAKNLSNLSKEL
                     KTDTLGPNERLQILFDYLLKECEIEIKMLNQLGPDQLKKSKEVKDKPSDLPIETPEQL
                     EDAVFSDLFDSAENSQNYLNHTDLVYQILTDLNDRKSQGLSVLTLEQLVQVFELAKLI
                     GIEGRRKRGIFLAGNLLYSLGTVRMDPVNESFYIDSLVNYGFYKRAFELFESNRVKVD
                     ERWWYELGMMVALRANYLNKFDKLFIATDLRFGMYPYVSTQVLRLAVRRKLLIGDIKS
                     ANRLTDRFLEMVSVYGCKRFDEAPGNDGKQMINFTTEDQADEFLNEMTPPSDYDFITL
                     IEYHLFRKNIHTAMKLVAKYLETDGITDENYRFLIVQLKFNLLQSFEQLRNSLGPHLN
                     PTTVQEKLDELQKSFDEVRKEHDIDISFSQELLFNNVASLASFPELTKVMEDFVRKRA
                     TADEDLSPSKKFHALLKILLATGKEKEAFFLLFKMEEALLKSRNSPELEGAQFYPEVQ
                     PHHYAVFVEYFTLSKDRFPKSMHSDLEKKVQRIVERMENHGVPYNSVLLAKLLIFYRD
                     FNNFNKCFEIINQVMKEKLVKQLVTDSGHTRFYNRRDVTRPLYVEMWRAYGKYYKIFN
                     KELERVEKKSNYSGWKTQVAKIIKRTRVHPEFPVRTLFTAMIQLDNVLPDTKMYYMIL
                     TTLMRSRDWAIVPGVLCTMTELHGFPLETQFIVYVTKGLEKELLVVISKKHQADGKSV
                     EESNAQAMAKVKELKLRGLILTPRMDHQYSVDDLLPQILMLLKFKNPQDIQFNDVYGA
                     MNELKIEKDNLSELINRVNSEIL"
     gene            complement(<67851..>69179)
                     /locus_tag="ZYRO0E00990g"
                     /db_xref="GeneID:8204522"
     mRNA            complement(<67851..>69179)
                     /locus_tag="ZYRO0E00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498945.1"
                     /db_xref="GeneID:8204522"
     CDS             complement(67851..69179)
                     /locus_tag="ZYRO0E00990g"
                     /note="similar to uniprot|P36080 Saccharomyces cerevisiae
                     YKL082C RRP14 Required for normal pre-rRNA Processing
                     Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498990.1"
                     /db_xref="GeneID:8204522"
                     /db_xref="InterPro:IPR007019"
                     /db_xref="InterPro:IPR029188"
                     /db_xref="InterPro:IPR029190"
                     /db_xref="UniProtKB/TrEMBL:C5E3X4"
                     /translation="MANLLEERLRSNSNAFEGLLSLIPAKYYYDDQTQEQWKAKKKSK
                     TQSKEDKQKKLDPEQQGENSLSTLEVMKEREKDAKPVVLPGEKLKKLKDEEKEREQEV
                     KEDEPSEEIDGTEDIDVVFDDEGNEINLKEDEEEEEEEEHQEEPEEPEKSPAVEEESE
                     EEHKEGSVEQENKESQKSQNKPNLEALRSKLQAKIQDMKERRRAPGTRVRGAPSSREA
                     IIEERKQRLDLRKQKNDSQKQQNNKSGDESESDEDDSDIETQPPTKKAKIEVDANDIM
                     YQNIEFDDGNKITSNLQHLKRGPKKKGPAKNDIRAHLKLLEAKKAKLESKEEMDQINA
                     KEKEKWQRAMLQAEGIKLKDDEKLLRKALKRKEAKKRRSEQEWRDRKLAVTTSKADKQ
                     KRREENLKIRKQNKGVKRSKQQKMKSAYKGNSTMVKRAGFEGRLKSGKKK"
     gene            <69922..>71353
                     /locus_tag="ZYRO0E01012g"
                     /db_xref="GeneID:8204523"
     mRNA            join(<69922..70129,70320..>71353)
                     /locus_tag="ZYRO0E01012g"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="XM_002498946.1"
                     /db_xref="GeneID:8204523"
     CDS             join(69922..70129,70320..71353)
                     /locus_tag="ZYRO0E01012g"
                     /note="similar to uniprot|P36008 Saccharomyces cerevisiae
                     YKL081W TEF4 Translation elongation factor EF-1gamma"
                     /codon_start=1
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="XP_002498991.1"
                     /db_xref="GeneID:8204523"
                     /db_xref="GOA:C5E3X5"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5E3X5"
                     /translation="MSSTLYIIEKSPRGQLVSDLVKYLNLDVKIVTDRESDSTFKKNF
                     PLGKIPAFLGKNGFKLTETIAVIYYLVTLTNDEKIQNQLAGSTAEEKASILKWVSFAN
                     SDAARAAASAVFLLVGLKPFNKKELDTSLEALEQYAQAFEQRLSEYTYLATENVTLAD
                     IVSYYIWAFSFSSALGADFRKKHPQLTRWFNTIGAHPSVQFSHKGFKPVEKALEPPQG
                     KKKEQKKEQKKEQPKQEAAQKAPAAQQPAQEKKPKHPLEVLGKSSFPLEDWKRKYMNE
                     DTRPSSLPWFWENYNPEEWSLWKVEYKYNDELTLTFMSNNLIGGFFTRLFASVKYMFG
                     CLVVYGENNNNGIIGAIMVRGQDYAKAFDVAPDWESYNFTKLDATKPEDKAFVEDMWA
                     WDKPVIVNGEPREISDGKVLK"
     gene            70174..70267
                     /gene="SNR38"
                     /locus_tag="ZYRO0E01034r"
                     /db_xref="GeneID:34467470"
     ncRNA           70174..70267
                     /ncRNA_class="snoRNA"
                     /gene="SNR38"
                     /locus_tag="ZYRO0E01034r"
                     /product="snR38"
                     /note="C/D snoRNA intronic SNR38"
                     /transcript_id="XR_002648406.1"
                     /db_xref="GeneID:34467470"
     gene            <71583..>72761
                     /locus_tag="ZYRO0E01056g"
                     /db_xref="GeneID:8204524"
     mRNA            <71583..>72761
                     /locus_tag="ZYRO0E01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498947.1"
                     /db_xref="GeneID:8204524"
     CDS             71583..72761
                     /locus_tag="ZYRO0E01056g"
                     /note="highly similar to uniprot|P31412 Saccharomyces
                     cerevisiae YKL080W VMA5 Vacuolar H ATPase subunit C of the
                     catalytic (V1) sector"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498992.1"
                     /db_xref="GeneID:8204524"
                     /db_xref="GOA:C5E3X6"
                     /db_xref="InterPro:IPR004907"
                     /db_xref="UniProtKB/TrEMBL:C5E3X6"
                     /translation="MSTTLYTANDFILLSLPRNAAPANSSNSSADSWLQNELIGGRAF
                     VSDFQIPEFKIGSLDSLIVQSEELAKADNQIGSSIGKIVEILTSLNESGSNAYKTVPI
                     NNVPVPEYLENFQWMTRKFRLDKSIEELMKLITDESTQLDSDVRATSTNYNNAKTNLA
                     TAERKKTGDLSIRSLHDIVKPEHFILNSEYLTTVLIAVPKSLKSNFEKTYETLAKNVV
                     PGSAGIISQDSEYILYNVHLFKKSVQDFNAAAREKKFTPREFDYSEELIDQLKQEHDS
                     AAHLEQSLRSQLVRLAKAAYADSFINWFHTKALRVFVESVLRYGLPPDFNTKIIAVPP
                     KNLSKCKAELTEAFGYLSGNAFARNKQGKIVKEDASLHQYAALVDTEYEPFVIYTISL
                     "
     gene            <73042..>75048
                     /locus_tag="ZYRO0E01078g"
                     /db_xref="GeneID:8204525"
     mRNA            <73042..>75048
                     /locus_tag="ZYRO0E01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498948.1"
                     /db_xref="GeneID:8204525"
     CDS             73042..75048
                     /locus_tag="ZYRO0E01078g"
                     /note="similar to uniprot|Q759X8 Ashbya gossypii ADR145C
                     ADR145Cp and weakly similar to YKL079W uniprot|P32364
                     Saccharomyces cerevisiae YKL079W SMY1 not believed to act
                     as a kinesin colocalizes with Myo2p kinesin heavy chain
                     homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498993.1"
                     /db_xref="GeneID:8204525"
                     /db_xref="GOA:C5E3X7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5E3X7"
                     /translation="MQSISNGCTDAIVQPTSIRVVLRLKPLIDEAAKLSYVEDGAGSL
                     SLQDFPQVAGKATFFSDANDTNKFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVS
                     IMAFGSEGSGKTYTMFGNDHEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFA
                     ENVYDLLSLQKNSKVLKTSSDTKTHTLSVKGLRTVSVNSVYELLAYINEGHLRRCHSD
                     SHYRKSRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKST
                     NSSMQNLHQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSST
                     DKADRENTVITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMSTREDSYLTRIKY
                     LEDEVSKLGGTIQQNKNQVSTNKSLTEKNMKLMDQLELYRKSQQTQKSGSEEENLTSQ
                     QNGRIQNEMSEVLDNLMEKCERVIQLQMRLDEELRQKSQMSQQLNYKESKAQALEAMN
                     VKLLEQLNTNENEMRNVLNTNSILRKEMEKWMHVAKTRSEKIEELQNEIQERQVGNVP
                     QNGLLFPPGELNHIRDASKNKKGNWLFGNSSNNALGTRKISNLSNSNNLGTRKVSNVS
                     TSSAVTINSQESNSSKTSHRGLNLHAVRLPSGIENENSSDKNNP"
     gene            complement(<75069..>76568)
                     /locus_tag="ZYRO0E01100g"
                     /db_xref="GeneID:8204526"
     mRNA            complement(<75069..>76568)
                     /locus_tag="ZYRO0E01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498949.1"
                     /db_xref="GeneID:8204526"
     CDS             complement(75069..76568)
                     /locus_tag="ZYRO0E01100g"
                     /note="similar to uniprot|Q04746 Saccharomyces cerevisiae
                     YMR065W KAR5 Protein required for nuclear membrane fusion
                     during karyogamy localizes to the membrane with a soluble
                     portion in the endoplasmic reticulum lumen may form a
                     complex with Jem1p and Kar2p expression of the gene is
                     regulated by pheromone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498994.1"
                     /db_xref="GeneID:8204526"
                     /db_xref="InterPro:IPR007292"
                     /db_xref="UniProtKB/TrEMBL:C5E3X8"
                     /translation="MRSLLHFLSWNLLLLVIQCHTAEVVESVQQRLLSSNFRDDIVSD
                     ETLQRNFPFLKSSCVRDALRTFLPICLKQGVESIESSFKVETAVKLSICEFQVAGLGH
                     IPDSCKNTQTDSMMDCMIQLESSAQWWTTYSGNYQRLSSICFENSLPYEKEQILSLFL
                     NITNIQSEINDNFTRHFYNMMSNVESSSDEHLQTIAQLFKEYLKQFDETFKDKQTEFE
                     GYQDDMQSLIVQNSQFIKKQNVGFMQSMDSLQHMIDGIIMDLKNDEISQQIVEVQNEN
                     LDSLKQMKNLMQEIYQFQRHGQTQMNDEMQLFFENTKKNMDLVTDDVKQSQLRAVEEL
                     RVSLLPSIIEELAPQLSNIKEDLLEDWKSATYLMNTDFQSWNNQINDTFQQISLKLNT
                     TLGAIDNIDRSLSKFEKILTRVSQLITCISTFTQYTFSAVYHFSTSKYVWRFFFITFA
                     IKRFSLQFSWGKLLSPIAAYAQVMAKFCLLIFAIYGGSKLGNIIMSVGT"
     gene            complement(<76768..>78504)
                     /locus_tag="ZYRO0E01122g"
                     /db_xref="GeneID:8204527"
     mRNA            complement(<76768..>78504)
                     /locus_tag="ZYRO0E01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498950.1"
                     /db_xref="GeneID:8204527"
     CDS             complement(76768..78504)
                     /locus_tag="ZYRO0E01122g"
                     /note="weakly similar to uniprot|P32493 Saccharomyces
                     cerevisiae YMR064W AEP1 Protein required for expression of
                     the mitochondrial OLI1 gene encoding subunit 9 of F1-F0
                     ATP synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498995.1"
                     /db_xref="GeneID:8204527"
                     /db_xref="GOA:C5E3X9"
                     /translation="MPTKPRHIPRNFFLDQKSRYQKNGLTPLPHQIIHPFYTPTRAAE
                     LSACSKEVRGKLLEGLKVVPALVTDWKGKPLLRNRFIKFDTVKGVNVWLQGYASRRKE
                     AEGVIYRTLEGQPEKLITPSKLHRSNVPLVDKVTELFGSERTKHLNSAALDSIVDELV
                     NDREKNLFCEDVYIYLLQHHVNSEGKLIAIIESIKSHMEADIDQLKVAETLILQLVLS
                     MQRNRLPVTKELVNAYHQLIDAVNQKFYTNACELQFDPLVTQCILEFHIMSGDLNHSK
                     KLLSHLILNGWALREDLSVKYLQLVESKVRDEDIDTRTLKRFAYISDFRPLLQRAQTP
                     LFFAALVPYCRHFGELYSLLTVITEKVHNTREVFDVTLLSMIEATTHMGKNNRYKSAN
                     LYELHRTVLPYYDNNLPAKFVKAFALQFAKFNNWSAIAGFFKQYPSYFTPNSIASLLS
                     ASQEGVTDSTNYPGGVVQMRKIFIWEYVLPLYSKMSLRARSSISATFDTPKLFTEAIK
                     QELKLVSAGQADVMNELIAMGYESNLLRFIPATTWEDIFRVPHLVAALKPFSQEIESL
                     SGKAAGATESSQ"
     gene            complement(<78626..>79330)
                     /locus_tag="ZYRO0E01144g"
                     /db_xref="GeneID:8204528"
     mRNA            complement(<78626..>79330)
                     /locus_tag="ZYRO0E01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498951.1"
                     /db_xref="GeneID:8204528"
     CDS             complement(78626..79330)
                     /locus_tag="ZYRO0E01144g"
                     /note="weakly similar to uniprot|Q04734 Saccharomyces
                     cerevisiae YMR063W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498996.1"
                     /db_xref="GeneID:8204528"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y0"
                     /translation="MKLAVKFCLALLTVSLIFQLFAIISTPLSSIPLSTSPGFEYGVF
                     GYCNTNIHKCSSRKIGYSLEFAPHPMPPNKVPTLPSGLKYSVTKLLVVHPLSFAITLT
                     LYVLIFLMSHQQLANSPMFLLSIALFSLPTFLICLLSFLVDLLVFSSDLCWPGWLMLP
                     ATIVIAVCCSLLWNLRSTVSIKNYETLQSSRANTIETHSMHDWRDRTRIPSIIRSDDH
                     SKPLLEPELTYTSTID"
     gene            <81297..>83180
                     /locus_tag="ZYRO0E01166g"
                     /db_xref="GeneID:8204529"
     mRNA            <81297..>83180
                     /locus_tag="ZYRO0E01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498952.1"
                     /db_xref="GeneID:8204529"
     CDS             81297..83180
                     /locus_tag="ZYRO0E01166g"
                     /note="similar to uniprot|P36009 Saccharomyces cerevisiae
                     YKL078W DHR2 Predominantly nucleolar DEAH-box RNA helicase
                     required for 18S rRNA synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498997.1"
                     /db_xref="GeneID:8204529"
                     /db_xref="GOA:C5E3Y1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y1"
                     /translation="MLLPVQVHSDEILSHILSHDTTILIGETGSGKSTQIPQLLLKYG
                     KIAITQPRRVAAINLATRVAQETNSRVGDTIGYSVRFDHRTSSKTRCKYVTDGMLLRE
                     MINDKELKNYDTVIIDEAHERTVLTDLIIGFLKELQGRRKLRIVIMSATLNAESFSRF
                     FHNAPILHVRGRRFPVQQLYLREPCDDLVEIAIRCVVQINAGEPLGDVLCFLPGQEEI
                     DRAVTFLERIGPEIRSRGFPVMVGMPLYASLPPSEQLKVFQRIKGKQQSRKIIFCTNV
                     AETSITVPGVKYVVDSGLRRVKVWRHALNLSTLLTVPVSRASAQQRSGRAGRECAGKC
                     YRLFQESDFEKMPAVTEPEIARCDVTEPLLLLKRHGVDDVLNWSWFEHPGKESILQAL
                     GELLLLGALDAKGSLTPLGYRMSSLPLPPQLGVVLIAAEDKQKHCLDTCIDIVACLSV
                     ENVLLSPPWEQRDIVNERRTAICHRASRWGDLVLYKELWDHYFRTSLTGDEKKTFCQE
                     LYVNQRAMRQVQKVRGQLRSLFRLHEDPDPTAHHALETEEIPAVITCFLSGYPKNLAI
                     LHPDRSHKIVTTGETVQPHPASTLFTQRKTDCPAILYTEYVYTSKGYARNVSRLELSW
                     LSS"
     gene            <83763..>85724
                     /locus_tag="ZYRO0E01188g"
                     /db_xref="GeneID:8204530"
     mRNA            <83763..>85724
                     /locus_tag="ZYRO0E01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498953.1"
                     /db_xref="GeneID:8204530"
     CDS             83763..85724
                     /locus_tag="ZYRO0E01188g"
                     /note="similar to uniprot|P39932 Saccharomyces cerevisiae
                     YDR536W STL1 Glycerol proton symporter of the plasma
                     membrane subject to glucose-induced inactivation strongly
                     but transiently induced when cells are subjected to
                     osmotic shock"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498998.1"
                     /db_xref="GeneID:8204530"
                     /db_xref="GOA:C5E3Y2"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y2"
                     /translation="MAASSVSEKDIPPDNRHTMGDLEKGSLIESASSSRERYSTIAKK
                     EDGNEKQTYGGETPPSSDSPVVRGNGAESLPRDLPEGDSYDQLGFEPPKGIKAYMFSR
                     TAHAGARGLRLRVLCSATAVIAFLLFGYDQGLMSGVISGDEFNNEFPATKEKATHKRT
                     TVVIQGAVTACYELGCFVGSVFVMFFGEKIGRKPCIIMGALITIVGATISTVAFHHAW
                     GLGQFVVGRVVTGVGTGLNTSSIPVWQSEMAKPNVRGRLINLDGSTIALGTMIAYWLD
                     LGFSFIKNSVQWRFPVSLQILFALVLFFGIIQMPESPRWLIGQKRVQEAKYILACLND
                     CSMDDDEIVAEVTMLIDTARRFENKKRSIKDLLTNGKTQNMNRAIIAASTQFMQQFTG
                     CNAAIYYATILFQQTLKRSRTVALIVGGAFSTVYFFSTIPTFYLVENLGRRPMFLIGV
                     TGQCLSFVITFACLTHPTPEHGKGAAVGLFLFIVFFGLAMLPLPWIYPPEVASMRVRA
                     ATNALSTMCNWLTNFAVVMFTPVFIQTSQWGTYFFFALMNFIYIPVVFLFYPETAGRS
                     LEEIDVIFAKAHVEHAQPWRVAAKLPKLSMTEVEDYSSALGLYDDENEKEGIEGGEGD
                     EEPQENALFTAEPLNGSSSSRESERAPHA"
     gene            <86975..>88753
                     /locus_tag="ZYRO0E01210g"
                     /db_xref="GeneID:8204531"
     mRNA            <86975..>88753
                     /locus_tag="ZYRO0E01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498954.1"
                     /db_xref="GeneID:8204531"
     CDS             86975..88753
                     /locus_tag="ZYRO0E01210g"
                     /note="similar to uniprot|P39932 Saccharomyces cerevisiae
                     YDR536W STL1 Glycerol proton symporter of the plasma
                     membrane subject to glucose-induced inactivation strongly
                     but transiently induced when cells are subjected to
                     osmotic shock"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498999.1"
                     /db_xref="GeneID:8204531"
                     /db_xref="GOA:C5E3Y3"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y3"
                     /translation="MGKRTQGFMDYVFSRTSTAGLKGARLRYTAAAVAVIGFALFGYD
                     QGLMSGLITGDQFNKEFPPTKSNGDNDRYASVIQGAVTACYEIGCFFGSLFVLFFGDA
                     IGRKPLIIFGAIIVIIGTVISTAPFHHAWGLGQFVVGRVITGVGTGFNTSTIPVWQSE
                     MTKPNIRGAMINLDGSVIAFGTMIAYWLDFGFSFINSSVQWRFPVSVQIIFALVLLFG
                     IVRMPESPRWLMAKKRPAEARYVLACLNDLPENDDAILAEMTSLHEAVNRSSNQKSQM
                     KSLFSMGKQQNFSRALIASSTQFFQQFTGCNAAIYYSTVLFQTTVQLDRLLAMILGGV
                     FATVYTLSTLPSFYLVEKVGRRKMFFFGALGQGISFIITFACLVNPTKQNAKGAAVGL
                     YLFIICFGLAILELPWIYPPEIASMRVRAATNAMSTCTNWVTNFAVVMFTPVFIQTSQ
                     WGCYLFFAVMNFIYLPVIFFFYPETAGRSLEEIDIIFAKAHVDGTLPWMVAHRLPKLS
                     MTEVEDYSQSLGLHDDENEKEEYDEKEAEANAALFQVETSSKSPSSNRKDDDAPIEHN
                     EVQESNDNSSNSSNVEAPIPVHHNDP"
     gene            <89104..>90417
                     /locus_tag="ZYRO0E01232g"
                     /db_xref="GeneID:8204532"
     mRNA            <89104..>90417
                     /locus_tag="ZYRO0E01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498955.1"
                     /db_xref="GeneID:8204532"
     CDS             89104..90417
                     /locus_tag="ZYRO0E01232g"
                     /note="highly similar to uniprot|Q04728 Saccharomyces
                     cerevisiae YMR062C ECM40 Mitochondrial ornithine
                     acetyltransferase, catalyzes the fifth step in arginine
                     biosynthesis; also possesses acetylglutamate synthase
                     activity, regenerates acetylglutamate while forming
                     ornithine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499000.1"
                     /db_xref="GeneID:8204532"
                     /db_xref="GOA:C5E3Y4"
                     /db_xref="InterPro:IPR002813"
                     /db_xref="InterPro:IPR016117"
                     /translation="MKFSSVLKQSAKYAAHVPKSGVFPRGFQVGSIASGVKKNGNLDL
                     GVLVNTNKSYESSAASVFTTNKFKAAPVILSQRVLEEKNGKGINAIVVNSGCANSVTG
                     EVGLQDATQMAKLIDEKLGATSPSTLIMSTGVIGQRLQMDKISKGVSQLFANNSFGSD
                     FNSWLNIAKSICTTDTFPKLITSNFTLKNGTQYTLTGMAKGAGMICPNMATLLGFIVT
                     DLPIESKALSKMLKFATDRSFNCISVDGDMSTNDTINMIANGAVKTDEITEDSPEFLQ
                     VRDQVTQFAQKLAQLVVRDGEGATKFVTVKVQNSSTFADAKIIAESISNSMLVKTALY
                     GKDANWGRILCAIGYAKLDNLDSLQTDKLNVSFVATDNSEPRELKLLVNGVPQLNIDE
                     ERASQILALPDLEVLVDLGTGNEEAQFWTCDLSHEYVTINGDYRS"
     gene            complement(<90540..>92498)
                     /locus_tag="ZYRO0E01254g"
                     /db_xref="GeneID:8204533"
     mRNA            complement(<90540..>92498)
                     /locus_tag="ZYRO0E01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498956.1"
                     /db_xref="GeneID:8204533"
     CDS             complement(90540..92498)
                     /locus_tag="ZYRO0E01254g"
                     /note="similar to uniprot|P25298 Saccharomyces cerevisiae
                     YMR061W RNA14 Cleavage and polyadenylation factor I (CF I)
                     component involved in cleavage and polyadenylation of mRNA
                     3' ends bridges interaction between Rna15p and Hrp1p in
                     the CF I complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499001.1"
                     /db_xref="GeneID:8204533"
                     /db_xref="GOA:C5E3Y5"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y5"
                     /translation="MSSAATPELSVGTNQPNGLPGNEGDNDIVNGIRRKIELNPADIL
                     PYLELVQYYESKDSFQESREVYNSLHDKFPTYSPLWTLQLKGELQRDEFEFVEKMLAQ
                     CLSGKLANNDLPLWSTYLDYVRRRNNLITGGQEARAVVVKAFELVMDKCAIFEPKSSQ
                     FWNDYLSFLEQWKPVNKWEEQQRLDMIRTLYKRMLCVPFENIEKMWNRYTEWEQDVNS
                     LTARKFIGELSSEYMKARSLYQEWSHITKGLRRSYPVSVSTANKNNVPQTGEGMDPSQ
                     LQIWLNWIHWEKENKMSLNQDLLNRRITYIYKQSVQYMLFAAEMWYDYAMYIPDVSER
                     QQILYTAVLANSDSPSLTFKLAESYETDNKFDEVKRCFEDCTNALLQGYQAMANEQDD
                     DSMPVFKQRKKLTFVFCVYMNAMKRLAGLSAARMVFGKCRKLKRILTHDIYIENAYLE
                     FQNQNDYKTPCKVLELGLKYFQTDALYVNKYLDFLILLNRDSQIKTLFETSVEKIQDL
                     TGLKSIYKKMISYESKFGNLQNVYSLENRFFERFPQENMIEIFTDRYRIQEENLIKEL
                     ELTYLADDLLSSSDLTELTGSSLKRTRETQDKLQSNKKQKNKIGIPEDIINVLAILPK
                     RQYFKAPLLDPQSLINYLNDQVELPSPK"
     gene            <92776..>93699
                     /locus_tag="ZYRO0E01276g"
                     /db_xref="GeneID:8204534"
     mRNA            <92776..>93699
                     /locus_tag="ZYRO0E01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498957.1"
                     /db_xref="GeneID:8204534"
     CDS             92776..93699
                     /locus_tag="ZYRO0E01276g"
                     /note="similar to uniprot|P50110 Saccharomyces cerevisiae
                     YMR060C SAM37 Component of the mitochondrial outer
                     membrane sorting and assembly machinery (SAM) complex
                     required for the sorting of some proteins to the outer
                     membrane after import by the TOM complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499002.1"
                     /db_xref="GeneID:8204534"
                     /db_xref="GOA:C5E3Y6"
                     /db_xref="InterPro:IPR019564"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y6"
                     /translation="MSEFSISVYLWGETGKPSLVSPESIALFWFLNSYYGDYKSIEVV
                     FANNTDLSPNEELPLLVENGKKWSGFVDIVSYLMEKMQNNDDVETTLLKDGLLEFTGE
                     LSVLTEYQMYLNKINYETFTRKAFSQLLHWPMWYNTPMNYRTRARQRCSNTLGYLMHD
                     DDPDSLESLELESTRLPQSKAFQATQDRKMRSKEELQNVKHNLQYLTRLKDYLRTWSQ
                     VRNSIPHQNDTIPADFLLWANLFVQLNLPDGEKVGQQVKDAVNDDFHQLVQSKIDQLS
                     SLEPRVFQRDPIFQEQGNVIMSIYHYVHKFV"
     gene            complement(<93711..>94115)
                     /locus_tag="ZYRO0E01298g"
                     /db_xref="GeneID:8204535"
     mRNA            complement(<93711..>94115)
                     /locus_tag="ZYRO0E01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498958.1"
                     /db_xref="GeneID:8204535"
     CDS             complement(93711..94115)
                     /locus_tag="ZYRO0E01298g"
                     /note="similar to uniprot|Q04675 Saccharomyces cerevisiae
                     YMR059W SEN15 Subunit of the tRNA splicing endonuclease
                     which is composed of Sen2p Sen15p Sen34p and Sen54p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499003.1"
                     /db_xref="GeneID:8204535"
                     /db_xref="GOA:C5E3Y7"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR018593"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y7"
                     /translation="MDSDYTDVTNRIGESTFRLVWDNLAYAQLWEQLRTRDEQVEWQG
                     QTLQIIEGKPPHKLSNDDDGGNENDHGIEYVLPIEMSQYKAGKLTFKCLDLIFDQLCP
                     PDARRITLALANSDGTVMFYFVYKGIHKPKRN"
     gene            <94332..>95522
                     /locus_tag="ZYRO0E01320g"
                     /db_xref="GeneID:8204536"
     mRNA            <94332..>95522
                     /locus_tag="ZYRO0E01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498959.1"
                     /db_xref="GeneID:8204536"
     CDS             94332..95522
                     /locus_tag="ZYRO0E01320g"
                     /note="similar to uniprot|P36081 Saccharomyces cerevisiae
                     YKL077W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499004.1"
                     /db_xref="GeneID:8204536"
                     /db_xref="InterPro:IPR028000"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y8"
                     /translation="MRSRFQILASFLLFLLHINWVNGYRPIVQPGEKLTTSEEPKPWY
                     RTIYGDKVEIVTPTVVAGVTFSRKPLETPDPLEPWVSLNKNGIPKTIKPEIKNGRTKN
                     GHPDYSTFFKEVHTKTLGYDDLKAENMDYGDVHEEEVFEDEDETYTSLNPIVRCTPKR
                     YFNKGHSKNIPSEPFCTPHEDSIWNVGKTYFLTWYTHFFRDEHSNEVVERVRIHMAYI
                     REKSNEKGVLKRDAPSATFFHSEWIKNADGVYPIEILHEWLQGVRTRKIVISVQPETV
                     SDAEFDPLTHGVFVYLDEGSRVYKQTNKELALNDAGITDDKWYYVVVSIPTAVIVALV
                     LMYFFIIANRRYSDFSEVTNKAWQKKHRVLGKVTDFKKYKNMKNRPYSELPMHNKGNP
                     GKQS"
     gene            complement(<95551..>96861)
                     /locus_tag="ZYRO0E01342g"
                     /db_xref="GeneID:8204537"
     mRNA            complement(<95551..>96861)
                     /locus_tag="ZYRO0E01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498960.1"
                     /db_xref="GeneID:8204537"
     CDS             complement(95551..96861)
                     /locus_tag="ZYRO0E01342g"
                     /note="similar to uniprot|P36083 Saccharomyces cerevisiae
                     YKL075C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499005.1"
                     /db_xref="GeneID:8204537"
                     /db_xref="UniProtKB/TrEMBL:C5E3Y9"
                     /translation="MLSSDEVRREECTCNCGLPPCKTNDRKPRNLVRGNMHRHRRPKT
                     TRPKKRFRFSKCMDFEGTDYNLITSVEYLNEKYDIRKSHYIEKFIKCIHKKIDHDVNK
                     ISDNYVHSLGPWVKIKFFLLLVTLSQRGGPEYWMDKDQNDDSATTNIDEDKDNKTHSN
                     RHNHNKTENDTKKNAIFSLTEHIMRQNINQDFTESTYDENYVFSSIWANFMEGLMNHY
                     LEQVIVPHSEMKVCQQLYKPMMKIISLYNEYNELMEKSEHNGFLPAPGDTKDPLKLGK
                     SVAETYEVGDCVTQERLQRAQKLLWQARQDIPKTISKELTLLSEMYSTLSADEQDYEL
                     DEFVCCAEEYVELEYLPSLIDVLFQNCGSINFWKIMIVLEPFFYYIEDVGDDGDTESQ
                     NGTNDEMLDESGGDGGELLHSFKPDPRVIILEKICEVAARQKWI"
     gene            complement(<97201..>99147)
                     /locus_tag="ZYRO0E01364g"
                     /db_xref="GeneID:8204538"
     mRNA            complement(<97201..>99147)
                     /locus_tag="ZYRO0E01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498961.1"
                     /db_xref="GeneID:8204538"
     CDS             complement(97201..99147)
                     /locus_tag="ZYRO0E01364g"
                     /note="similar to uniprot|P38993 Saccharomyces cerevisiae
                     YMR058W FET3 Ferro-O2-oxidoreductase required for
                     high-affinity iron uptake and involved in mediating
                     resistance to copper ion toxicity belongs to class of
                     integral membrane multicopper oxidases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499006.1"
                     /db_xref="GeneID:8204538"
                     /db_xref="GOA:C5E3Z0"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z0"
                     /translation="MILSLALVFLLFQQVLGATHVYNWTTGWGYANPDGIKRREVVTC
                     NGEFPWPSVRVTKGDRVIINLTNGFNDSNTTLHVHGMFQNGSTQMDGPPFLTQCPISP
                     NDTFTYNFTVSDNAGAYWYHSHTDAQYEDGMRGLFIIDDGENNKNFPYDYDEEVLLEI
                     GEWYDQTVAKLKPAFLSLTNPTGAEPIPQNLLINNTRNLTWNVEPNKTYLLRIVNTGG
                     FVSQYFWLEDHEMEVVEVDGVVTEKNATDMLYITVAQRYSVLVRTKDNKDKNYAIMQK
                     YDDSMLDKIPKHLLLNQTSYMTYDSSKPKPEEAYVNSLDNFLDDFYLVPYHKQELLPE
                     PDHRIELTVAMDNLISGKNYAFFNNITYTTPKVPTLMTVLSAGKYASNSYIYGTNTNT
                     FVLKRNEIVEIVLNSQDTGTHPFHLHGHVFQTIARAGAVDDNDPPLPFDPKNHTSFPE
                     YPMLRDTIYVRPQSNFVIRFRADNPGVWFFHCHIEWHLIQGLAIVLVEDPEGIQSNPS
                     QYLTDSHKRVCKNSGVPIEGNAAGTTDWFNLALENKQEKSIPSGFTAKGYVAFVFSCV
                     AGVLGLITITIYGLMDLQNVEEKVIEDLQIPATDLLEEDDDEEIETNQVYAKSGKSEG
                     GTLEEEQKLRDHETTKEVSKTSSK"
     gene            complement(<100442..>100702)
                     /locus_tag="ZYRO0E01386g"
                     /db_xref="GeneID:8204539"
     mRNA            complement(<100442..>100702)
                     /locus_tag="ZYRO0E01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498962.1"
                     /db_xref="GeneID:8204539"
     CDS             complement(100442..100702)
                     /locus_tag="ZYRO0E01386g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499007.1"
                     /db_xref="GeneID:8204539"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z1"
                     /translation="MISTEYTGPYLTRYEGVGRPLDNSEKLVLYELVTPQDSQVMPTD
                     NYEHADTTTISRTFRSFRGGSAKRSTNRGNNGIVKRVKKLFA"
     gene            <101663..>102559
                     /locus_tag="ZYRO0E01408g"
                     /db_xref="GeneID:8204540"
     mRNA            <101663..>102559
                     /locus_tag="ZYRO0E01408g"
                     /product="ADP/ATP carrier protein"
                     /transcript_id="XM_002498963.1"
                     /db_xref="GeneID:8204540"
     CDS             101663..102559
                     /locus_tag="ZYRO0E01408g"
                     /note="similar to uniprot|P18238 Saccharomyces cerevisiae
                     YBR085W"
                     /codon_start=1
                     /product="ADP/ATP carrier protein"
                     /protein_id="XP_002499008.1"
                     /db_xref="GeneID:8204540"
                     /db_xref="GOA:C5E3Z2"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z2"
                     /translation="MQQDFLVNFLMGGVSAAVAKTCAAPIERVKLMMQNQGEMMKQGA
                     LDRRYAGIAECFTRTIKTEGLLSLWRGNTANVLRYFPTQALNFAFKDKIKAMFNVGRD
                     QGYGRWLSANIASGGAAGGLSLGFVYSLDYARTRLAADASHHGAERRFKGLADVYKQT
                     YATDGILGLYRGFAPSVVGIMVYRGLYFGLYDSIKPVLLTGKWERSFPASFLLGWVVT
                     TAASTASYPLDTVRRRMMMTSGQQIKYTGAWHCLTSIYEQEGFRAFFKGCGANIVRSI
                     AAAGVISLYDQLQLLMFGKTFK"
     gene            <102660..>103598
                     /locus_tag="ZYRO0E01430g"
                     /db_xref="GeneID:8204541"
     mRNA            <102660..>103598
                     /locus_tag="ZYRO0E01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498964.1"
                     /db_xref="GeneID:8204541"
     CDS             102660..103598
                     /locus_tag="ZYRO0E01430g"
                     /note="highly similar to uniprot|P26448 Saccharomyces
                     cerevisiae YMR055C BUB2 Mitotic exit network regulator
                     forms GTPase-activating Bfa1p-Bub2p complex that binds
                     Tem1p and spindle pole bodies blocks cell cycle
                     progression before anaphase in response to spindle and
                     kinetochore damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499009.1"
                     /db_xref="GeneID:8204541"
                     /db_xref="GOA:C5E3Z3"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z3"
                     /translation="MSSIERFLSQPPLIIQSSLAQLRYLVLSEGLPTGNDKNIQRTRC
                     YTWSVLSRTSMERCTQIYISYVQLGSAPQPIYHKIKNDTFRTLQTDPKFITTVSEDAL
                     LRCLSSFAWQCIELKNVQDPRLPPQLSTYVQGMNVLLAPLLYSCPSEPMAFQLFSTLC
                     YQIIPTYLNSNLTGVHNGAKLLDICLKIIDPKLSKFLSDNLLTAEIYGIPSILTLCSC
                     NRPLDQVCKLWDFMFAYGFHMNILFVVAILVTIRHQILRSESPMNLLTRQLPEFDADE
                     IIKLGVGFLAKIPQSVYSLLVEHLTNLNIKIPYNDY"
     gene            complement(<103615..>105072)
                     /locus_tag="ZYRO0E01452g"
                     /db_xref="GeneID:8204542"
     mRNA            complement(<103615..>105072)
                     /locus_tag="ZYRO0E01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498965.1"
                     /db_xref="GeneID:8204542"
     CDS             complement(103615..105072)
                     /locus_tag="ZYRO0E01452g"
                     /note="some similarities with uniprot|P36084 Saccharomyces
                     cerevisiae YKL074C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499010.1"
                     /db_xref="GeneID:8204542"
                     /db_xref="GOA:C5E3Z4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z4"
                     /translation="MGNDDNEHALEDLRSKIIASMSNEPSSNKRTALAGDEMHNNKRQ
                     RNRDDGSRGYKNGYSGPNYPKRHQSNPRSRYQAQQQQKRFPPRPQYSRYQGNAASNTS
                     VGKFREEDLAHVVPLGERKRMRPTKWDITPKGFESVPTERAKLSKLFPQPGKPHELDR
                     DKLEKVIAQGGTNNRRTRILFEDADGNHLIFSRMSCRIIVRGTTDSMDLNRIEAYLNG
                     FVQAIDREYHVKEVVQGPSHLVLEFNDAVCTTIVLSCRSFISKELDFDGSDWQRPQEY
                     VQQVDSSERLCGPEILAVEGLVHGEEKELTDQGFKVVFMEPIFTISQENQERLFTGCA
                     LVEVEEEPSANGSLRWFKPNESHMKQNISYMTFQGLPKLATDQVRVPSRVLLLMNLVD
                     PLDLKLEAFAQEVKTTLESTLHKVESVRMKKPSADFRLNLERIGEGVGNVYVKFQDVE
                     SAEAAMENLPHRKFNGRSVLCCYVAESDFETLGIL"
     gene            <105281..>107998
                     /locus_tag="ZYRO0E01474g"
                     /db_xref="GeneID:8204543"
     mRNA            <105281..>107998
                     /locus_tag="ZYRO0E01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498966.1"
                     /db_xref="GeneID:8204543"
     CDS             105281..107998
                     /locus_tag="ZYRO0E01474g"
                     /note="similar to uniprot|P36016 Saccharomyces cerevisiae
                     YKL073W LHS1 Molecular chaperone of the endoplasmic
                     reticulum lumen involved in polypeptide translocation and
                     folding member of the Hsp70 family localizes to the lumen
                     of the ER regulated by the unfolded protein response
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499011.1"
                     /db_xref="GeneID:8204543"
                     /db_xref="GOA:C5E3Z5"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z5"
                     /translation="MRNSIVLLLISIWSIWCHFTLAAVVGVDYGQQFIKAMVVSPRAP
                     MELIFTPEAKRKEISGLAIKSLGGDKGEIERIYGSALGSMATRFPKNTLLHVKSLLGK
                     TINDEGEISTYLNEHPGIDIVPNKRNSLSFVVGDEQYPVEEVTAMNLQETINRANLLL
                     REKDPSGSDLVDKLALTVPEYFDQYQRRALLDSGSLTTDALDTYLVPDGLSVVINFVL
                     KKRDFKGKSYYVVYDMGGGSTKASLFSIEQPENETEPLRIEFGGYGYDSQLGGSNFTL
                     QVASLIENKFLSKRKDITAEKLHRNPKAVAKIVQAAEKAKLILSANSEASISIESVLE
                     DVDFKTKITKQEFEDSLSDSASEIVKPIKVALDGQFWDEKIDPKQVSGIILTGGSSRV
                     PIVQYKLAEYMGENKILKSVNADEAAVDGATIRGIKLFEAFRTKPLNITERSISDYAV
                     TLNQKGENVVVFPKGTVFPTKRTLELGNAKDLPKDFDIKLWENGLPFQSVKTKTSGAD
                     DIYSPEKCPNGVIYNATFSISQNRLFNLDKVEAICLKDGSSSVEKPQNETGKKSNLGS
                     SKRSVKLTISSEGSNIKAMSSDEQLRLREYIRILDQKDAARFELEEAKNLLEALLYDA
                     RSYLELEEVVEKGPQSYLGKLSEAVTKHLSWLEDEADETTKLEVIQRSSEVQQLRDKL
                     EAYLQSLSEPLDSKQFQSILNNATKLLEQIDLTQINQQEQVASLKDKFEELGHNVEEQ
                     YAKIKLPHHIAAPLSSWNDTVSAFKEVIKLVEYAKSSAFKKMGREQLFEIKSAFDIAS
                     AELESIIDYFGKARDYRLHELQAWIQKAEKTKKRKEERLKKKMEDKEKEKESKSSSTV
                     SGNPSTAESESSTVPTTTTTASASASTTSPQNKQGTSSSTATTPLHDEL"
     gene            complement(<108148..>110847)
                     /locus_tag="ZYRO0E01496g"
                     /db_xref="GeneID:8204544"
     mRNA            complement(join(<108148..110756,110823..>110847))
                     /locus_tag="ZYRO0E01496g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498967.1"
                     /db_xref="GeneID:8204544"
     CDS             complement(join(108148..110756,110823..110847))
                     /locus_tag="ZYRO0E01496g"
                     /note="similar to uniprot|P37296 Saccharomyces cerevisiae
                     YMR054W STV1 Subunit of vacuolar-ATPase V0 domain one of
                     two isoforms (Stv1p and Vph1p) Stv1p is located in
                     V-ATPase complexes of the Golgi and endosomes while Vph1p
                     is located in V-ATPase complexes of the vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499012.1"
                     /db_xref="GeneID:8204544"
                     /db_xref="GOA:C5E3Z6"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z6"
                     /translation="MVREEAIFRSADMTYVQLYIPLEISREIACLLGNLGTLMFRDLN
                     KDLTAFQRGYVGQIRKLDEVERLVLYMQEVSDKHAEATWKYILHTDEQGNDIQRPSVT
                     QLVSEMQTHSHDIINAAMGEIHEFEGRVKRLDDSLTNLKEKLNGLLEQRYVIFEVTRF
                     LQSHPGLFGRMGREERELRDVDEFRLNLDELSETLSDTFSFEDGTEPTDEQQQQQEAL
                     NDQMEFEADQNLLEIGFHDRFMIAGSIRRDKVEVLNRILWRLLRGNLIFQNFAIDEPL
                     LENGEKVEKDCFFVFTHGEYLLQKVQRVVDSLNGRVVSLAHCTHREIQKLNDRISEIQ
                     QIAYATESTLHAELLVVSDQLPVWNAMVKREKYIYATLNLFKQETHGLVAEGWLPTLE
                     LTTISDAMKDYSETVGSEYSTVVSVIHTNRAPPTYHRTNKFTQAFQSICDAYGTATYK
                     EVNPGLATIVTFPFMFAIMFGDLGHGFILMLIGVFLLMMEKKFETMQRGEIFDIVFTG
                     RYVITLMGAFSVYTGLLYNDIFSKSMTIFKSGWKWPSNFKKGESIVAEQTGTYPFGLD
                     HAWHGTDNGLIYTNSYKMKLSVIMGFLHMTYSFMFSLVNYRYKKSRVDIIGNFLPGLI
                     FMQSIFGYLTWAILYKWSKDWIKDNKPAPSLLNMLINMFLSPGHIDDQLYSGQNVLQI
                     LLLLAALACIPWLLLYKPLTLKKQHSGVSLNGYESVNRSEGVDELTADLQATEGDGMI
                     VTDYHGHEENEEFNFGEVMIHQVIHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLW
                     DMTIKNAFSPKNSGSPLAVTRVVLLFAMWFVLTVCILVLMEGTSAMLHSLRLHWVEAM
                     SKFFEGDGYPYEPFTFKNLVE"
     gene            <111190..>113505
                     /locus_tag="ZYRO0E01518g"
                     /db_xref="GeneID:8204545"
     mRNA            <111190..>113505
                     /locus_tag="ZYRO0E01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498968.1"
                     /db_xref="GeneID:8204545"
     CDS             111190..113505
                     /locus_tag="ZYRO0E01518g"
                     /note="similar to and similar to YMR053C uniprot|P46679
                     Saccharomyces cerevisiae YMR053C STB2 Protein that binds
                     Sin3p in a two-hybrid assay and is part of a large protein
                     complex with Sin3p and Stb1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499013.1"
                     /db_xref="GeneID:8204545"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z7"
                     /translation="MTLETPTSNVFQSPKAVDSKKTTHKTSTVEPLVSFIFPDVRALH
                     EIRLESFVELQYKEITVHGFEIYVVEQWAAERKLSTVITSYTGNSQDTIHAVQVVLPK
                     DPEKWPGRFKEYYEDLSIFAKARVMPKGSIFITNLATVPSTLNLLHVECGDVRAIWKD
                     FEVNFDLKRLRCGGRSALLLGGTSTAAEDKFGQLYKISIDFGERKVLLKELEQCEHFP
                     HLQRNYHPVIELVTMIQVCLSYFNLYHSAKDGLLCDKTEAAVANFWSKLAKYYFGIER
                     PKNEGISGPATVAALISLVLSCYYKLQVEDCISSKDPFEEEEFFAGIYSFQKKHGITR
                     GTNPVYLDDLTLQRLFEVSAKTSSSDIFKFKKVVKSTVSDITGKGNPMHLCNEILTTD
                     LDVMVKNIHSGSIGLLWRGKGRLRRNFYKGYDNFCEIKFSRGDPELLLEKQANEMQGD
                     GSESQESTSSADQEKNVFDNNLVRYSTSSSSVSASSMFCNYDKTTYATNFGLNKLYHG
                     EYFRRNSMPFLSDGTHDPMLETKKNDDTVKGLHRSNSLSQVQDVVEPWSLPFDPSVVR
                     MARDLLKINNLIQVQEREEKEKQTYMRENEVCHAGHGESFDTDFDHVLSGLQGCHQVY
                     NHKVKKLEENNKEVEKKQLLLFGEMRALSSLTSKFKYDMGILDMRMRDVEESISQFDK
                     KLAAVQKLLVDQGLGKALGTELLVDKEQLESCLKDFLEAENTKYEGLCCRMCSKKYFK
                     QIHNDLKAWTSWAFNKFFNKDTKLTENEEIM"
     gene            complement(<113522..>114142)
                     /locus_tag="ZYRO0E01540g"
                     /db_xref="GeneID:8204546"
     mRNA            complement(<113522..>114142)
                     /locus_tag="ZYRO0E01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498969.1"
                     /db_xref="GeneID:8204546"
     CDS             complement(113522..114142)
                     /locus_tag="ZYRO0E01540g"
                     /note="similar to uniprot|P46671 Saccharomyces cerevisiae
                     YMR052W FAR3 Protein involved in G1 cell cycle arrest in
                     response to pheromone in a pathway different from the
                     Far1p-dependent pathway interacts with Far7p Far8p Far9p
                     Far10p and Far11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499014.1"
                     /db_xref="GeneID:8204546"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z8"
                     /translation="MDGSSSDNFEYILQLTKILSAECRANRQERDKVEHLFKRLAKQS
                     YVNYEQLSGNVSPRKKELFDKISTPTEEDQLIMQNYELVKQIELQEYMNNKVWLLINE
                     INEHLSSIRNFVIERKLAASKDVTNFIDEKFTVNGQRLDMSCQVLRNEINVSKGKSEL
                     VIQEFKHLVQEIDWNLVPKNSKDFIKFQSKLKMLENRYNISIDLPI"
     gene            114351..114451
                     /locus_tag="ZYRO0E01562r"
                     /db_xref="GeneID:8204547"
     tRNA            join(114351..114386,114416..114451)
                     /locus_tag="ZYRO0E01562r"
                     /product="tRNA-Trp"
                     /note="tRNA-Trp (CCA) cove"
                     /db_xref="GeneID:8204547"
     gene            complement(<114616..>116364)
                     /locus_tag="ZYRO0E01584g"
                     /db_xref="GeneID:8204548"
     mRNA            complement(join(<114616..115953,116050..>116364))
                     /locus_tag="ZYRO0E01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498970.1"
                     /db_xref="GeneID:8204548"
     CDS             complement(join(114616..115953,116050..116364))
                     /locus_tag="ZYRO0E01584g"
                     /note="similar to uniprot|P27697 Saccharomyces cerevisiae
                     YGL119W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499015.1"
                     /db_xref="GeneID:8204548"
                     /db_xref="GOA:C5E3Z9"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E3Z9"
                     /translation="MSTRRTLYHIYCLGSSARSVLSGSWDIGKESLGSWINTSTLTRP
                     ILNEYQWFYDPKWEEAKKLAEDTRNLHSGKPHLKKSRKKVGPTTKGTREYSTSTKVPP
                     EEEESQRPQRELQSSEVPSSRLARLFHYGSLAAGVGIHAATEGITEVAKGRTPTWKQL
                     ILSDSNVERITKTFSQMRGAALKVGQILSFQDDKVLPRDLYEILSRVQNSAHYMPQRQ
                     LDKVLKAEFGDNWKSNFAKFDRIPIAAASIGQVHNAVLPNGDKVVVKIQYPGVKDSID
                     SDLNNIMMVLGASRLLPKGLFLDKTIDNARKELKWECDYVREAQCLQQFEKLLEDDPV
                     FEVPHVYPDLTTSNVITMSRMEGIEIMKLAPSTPQHLKDYIAGNIMKLCLQEIAVFHC
                     MQTDPNWANFLYNHKTHKIELLDFGASRVFPDEFISDYRKLLTYATLGDHEMVRKLSQ
                     DLGYLNGLESQAMVDAHVRSVITLGEPFSGPIDKPFSFRDQTVSDRIRANIGLMLDER
                     LCPPPEETYSLHRKFSGIFLLCARMGATIPCSKYFHDFFHLE"
     gene            <116792..>119119
                     /locus_tag="ZYRO0E01606g"
                     /db_xref="GeneID:8204549"
     mRNA            <116792..>119119
                     /locus_tag="ZYRO0E01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498971.1"
                     /db_xref="GeneID:8204549"
     CDS             116792..119119
                     /locus_tag="ZYRO0E01606g"
                     /note="highly similar to uniprot|P53131 Saccharomyces
                     cerevisiae YGL120C PRP43 RNA helicase in the DEAH-box
                     family involved in release of the lariat-intron from the
                     spliceosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499016.1"
                     /db_xref="GeneID:8204549"
                     /db_xref="GOA:C5E400"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E400"
                     /translation="MGTKRRLSEKAEHVSALESSVPERAAEIAEELNKKHPHQTEEKL
                     VHHDLGEFNSMVRHHTNASQAQKLEDGKVNPFTGRPFTAKYVDILKIRRELPVHAQRD
                     EFLKIYQENQIMVFVGETGSGKTTQIPQFVLFDEMPHLQNTQVACTQPRRVAAMSVAQ
                     RVAEELDVNLGEEVGYSIRFENKVSNKTILKYMTDGMLLREAMEDHDLKRYSCIILDE
                     AHERTLATDILMGLLKQVVVRRPDLKLIVMSATLDAKKFQSYFHSAPLLAVPGRTFPV
                     ELYYTPEFQRDYLDSAIRTVLQIHATEGAGDVLLFLTGEDEIEDAVRKIQLEGDQLVR
                     EEGCGPLTVYPLYGSLPPHMQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVY
                     VVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEDAFKKE
                     LIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLND
                     DGDLTPLGRLASQFPLDPMLAVMLIGSFEFHCSQDILIIVAMLSVPSVFIRPTKDKKR
                     ADEAKNQFAHPDGDHITLLNVYYAFKSDEVYEYGVQKWCRDNYLNYRSLAAADNIRVQ
                     LERIMVRYNLELNTTDYESPKYFDNIRKALASGFFMQVAKKRSGGKGYITVKDNQDVL
                     VHPSTVLGHDAEWVVYNEFVLTTKNYIRTVTSVRPEWLIELAPAYYDIHSFQKGDVRY
                     SIERVKERMEQMQELHNDKHKKKGKKEGKEKHKHT"
     gene            <119378..>119770
                     /locus_tag="ZYRO0E01628g"
                     /db_xref="GeneID:8204550"
     mRNA            <119378..>119770
                     /locus_tag="ZYRO0E01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498972.1"
                     /db_xref="GeneID:8204550"
     CDS             119378..119770
                     /locus_tag="ZYRO0E01628g"
                     /note="similar to uniprot|P53130 Saccharomyces cerevisiae
                     YGL121C GPG1 Proposed gamma subunit of the heterotrimeric
                     G protein that interacts with the receptor Grp1p involved
                     in regulation of pseudohyphal growth requires Gpb1p or
                     Gpb2p to interact with Gpa2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499017.1"
                     /db_xref="GeneID:8204550"
                     /db_xref="UniProtKB/TrEMBL:C5E401"
                     /translation="MTGLSESFLQLTMLGDGSPNEDVLQLLMYSNFREQLSESAQELH
                     NITDRILVHRASRSVTSIEAHGLILPLMAMLIESRERAKRIYRDALSSRMSTTTDWNI
                     DPLCDEVHEELIRTNDLLKLYPRRESLW"
     gene            <120273..>121784
                     /locus_tag="ZYRO0E01650g"
                     /db_xref="GeneID:8204551"
     mRNA            <120273..>121784
                     /locus_tag="ZYRO0E01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498973.1"
                     /db_xref="GeneID:8204551"
     CDS             120273..121784
                     /locus_tag="ZYRO0E01650g"
                     /note="similar to uniprot|Q75E99 Ashbya gossypii AAR178C
                     AAR178Cp and some similarites with YGL122C uniprot|P32505
                     Saccharomyces cerevisiae YGL122C NAB2 Nuclear
                     polyadenylated RNA-binding protein related to human hnRNPs
                     has a nuclear localization signal sequence that binds to
                     Kap104p required for both poly(A) tail length control and
                     nuclear export of mRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499018.1"
                     /db_xref="GeneID:8204551"
                     /db_xref="InterPro:IPR021083"
                     /db_xref="UniProtKB/TrEMBL:C5E402"
                     /translation="MSSEQYTENLKIIVAEKLGTLENFNEDIKYVAEYIVLLMVNGGT
                     LENVVHELSTLFDSVSTEALTDVVQTAFFALEALQQGETVDSIVGKIRGVLQQPVQQE
                     QQPQPPQQEQQQQQQPPQPPAPMSAFGGIVSTEPPAKLNTTDFQPNFQQRNGAVGKGG
                     RGGRGGRGATRGAGRGASRNGNARFNPLAKALGINGEGAGNLNFVHSKKEGRCKVFPR
                     CPLGKSCPHAHPTKVCNDYPNCPKPPGTCEFLHPSEDEELMREIERTREEFQQRKAAL
                     LAAKAKPVQTGIVICKFGILCSNPLCPFGHPTPANEDAKVLELMWCANNLTCQDPSCT
                     RAHSSLSKIRDVTPLGGPKKPPVVMAPRPVEKSLEQCKFGTHCTNKRCKYRHARSHIM
                     CREGANCTRIDCLFGHPINEDCKFGIDCRNPNCLFRHPTGRNIDANTNSGNGGAANAE
                     NTGVGEGFSTSQRLFAIPEGPHIEQSQAQGGGGLPSIYAPANAQNMDQDTDMN"
     gene            complement(<122203..>122961)
                     /locus_tag="ZYRO0E01672g"
                     /db_xref="GeneID:8204552"
     mRNA            complement(<122203..>122961)
                     /locus_tag="ZYRO0E01672g"
                     /product="40S ribosomal protein S2"
                     /transcript_id="XM_002498974.1"
                     /db_xref="GeneID:8204552"
     CDS             complement(122203..122961)
                     /locus_tag="ZYRO0E01672g"
                     /note="highly similar to uniprot|P25443 Saccharomyces
                     cerevisiae YGL123W RPS2"
                     /codon_start=1
                     /product="40S ribosomal protein S2"
                     /protein_id="XP_002499019.1"
                     /db_xref="GeneID:8204552"
                     /db_xref="GOA:C5E403"
                     /db_xref="InterPro:IPR000851"
                     /db_xref="InterPro:IPR005324"
                     /db_xref="InterPro:IPR005711"
                     /db_xref="InterPro:IPR013810"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018192"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5E403"
                     /translation="MSAAAPEQRRGGFAGRNRGRFQRRGRNVEEKGWVPVTKLGRLVK
                     AGKLTTIEEIFLHSLPVKEFQIIDTLLPGLSDEVMNIKPVQKQTRAGQRTRFKAVVVV
                     GDSNGHVGLGIKTAKEVAGAIRAGIMIAKLSVIPIRRGYWGNNLGEPHSLATKTSGKC
                     GSVTVRLIPAPRGSGIVASPGVKKLLELAGLEDVYTQSTGSTRTLENTLKAAFAAIGN
                     TYGFLTPNLWAEHALPVSPLDIYADEAAVQKKRF"
     gene            <123505..>124060
                     /locus_tag="ZYRO0E01694g"
                     /db_xref="GeneID:8204553"
     mRNA            join(<123505..123512,123613..>124060)
                     /locus_tag="ZYRO0E01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498975.1"
                     /db_xref="GeneID:8204553"
     CDS             join(123505..123512,123613..124060)
                     /locus_tag="ZYRO0E01694g"
                     /note="weakly similar to uniprot|P38325 Saccharomyces
                     cerevisiae YBR230C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499020.1"
                     /db_xref="GeneID:8204553"
                     /db_xref="UniProtKB/TrEMBL:C5E404"
                     /translation="MSENEEKFSQKARAEARKTADQLKKDGEAAKDTVESWTEQLKKC
                     VETASTSVSNGVSQAVSQARSATATAAAKARSIAGRSWEELHNPVVLLNFLLGSGALA
                     GLIAGYAQYDTRYLKGKSDGVILATVSGASAIVAIDALLSAKYYNKYRK"
     gene            <124257..>125786
                     /locus_tag="ZYRO0E01716g"
                     /db_xref="GeneID:8204554"
     mRNA            <124257..>125786
                     /locus_tag="ZYRO0E01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498976.1"
                     /db_xref="GeneID:8204554"
     CDS             124257..125786
                     /locus_tag="ZYRO0E01716g"
                     /note="similar to uniprot|P53129 Saccharomyces cerevisiae
                     YGL124C MON1 Protein required for fusion of cvt-vesicles
                     and autophagosomes with the vacuole associates as a
                     complex with Ccz1p with a perivacuolar compartment
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499021.1"
                     /db_xref="GeneID:8204554"
                     /db_xref="InterPro:IPR004353"
                     /db_xref="UniProtKB/TrEMBL:C5E405"
                     /translation="MDLDESYVDDRRERANEPLYIPPIAAEPTTSINLAQTLFQPSEF
                     DESLEDQLAQSISSCDRRHPLVSTEIPNVFPHRYDKNFLILTSAGKPIYAMKDGDGTI
                     AYMGVIHTIMNYFKLKEDQDLRCIENGDVRFAFLDREPIVLVAYSARGETSNELFSQL
                     DFLHSYLLSSLSERQLSKIFSKRQNFDLRNFLESTDFENLDEICSLLCERLYPDALLG
                     ALRSLSMKKSHRAQLHEAMSQQLTKEKDLPRGTLLYGLIVAPENKLCSVLRPKGHTLH
                     TTDLHLLFCLIFHRFQNLDDSQELWVPICFPKFNANGFLYGYIKFLPKCNSILVLISA
                     QKDAFFNLKSFADHLIKDISSNGLLEEIHKAKGFKISDIPAPLVHHFIYKSKKHVQYV
                     MPELELHSDTEPEQLIELERKFMTYYQQIHNSVVRDDGLAFNKSCLNFIRWDSDAIEP
                     SEEPIAMLGLGWITPKFELYLICNNGVDDKHVIFESAKRIISWCRKHESRLFVNEGAI
                     F"
     gene            complement(<125883..>127247)
                     /locus_tag="ZYRO0E01738g"
                     /db_xref="GeneID:8204555"
     mRNA            complement(<125883..>127247)
                     /locus_tag="ZYRO0E01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498977.1"
                     /db_xref="GeneID:8204555"
     CDS             complement(125883..127247)
                     /locus_tag="ZYRO0E01738g"
                     /note="some similarities with uniprot|P40209 Saccharomyces
                     cerevisiae YMR136W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499022.1"
                     /db_xref="GeneID:8204555"
                     /db_xref="GOA:C5E406"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C5E406"
                     /translation="MRRKFNGMEHYHWIQSISSSIMTTETAETNVACKNLCNDAKGAQ
                     SALTLPTPPPLQPPPPTPTSTRANSTPVPPNSVIFQVVNRDNSSSLTHGFTPRVVPEF
                     NSSTHGAVRNSAIRSTLNRETTRSTPAIVGHVRHASAPSAMMERSVPSRDSVFAPSPP
                     SRKPISDLLKIAKYMDDRGRNDLEDHEKDAALALLVLKECSRQVFDMSKGWSNLDSVP
                     LCDFVVAQRKCQTMLNSIENLKEMKIQARDTNGDVQISNAVEKPSTREKNVKFHEESY
                     KSRSSSVVSIVNVTTPLPEAPSAQREKAIAPRSSSMSSERTLTYSPLSSDRSTPTPVP
                     LEKNNNNNYSPYRPSSSPNTKSDSVFISLSDDDRKHMGKIGKTSKSGKNRNAHMRCLH
                     CSSTETPEWRKGPSGPTTLCNACGLFYKKLIKKFGEEVATSIMKSRQTEDPQNRKIPR
                     FARL"
     gene            <127610..>130372
                     /locus_tag="ZYRO0E01760g"
                     /db_xref="GeneID:8204556"
     mRNA            <127610..>130372
                     /locus_tag="ZYRO0E01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498978.1"
                     /db_xref="GeneID:8204556"
     CDS             127610..130372
                     /locus_tag="ZYRO0E01760g"
                     /note="similar to uniprot|P38138 Saccharomyces cerevisiae
                     YBR229C ROT2 Glucosidase II catalytic subunit required for
                     normal cell wall synthesis mutations in rot2 suppress tor2
                     mutations and are synthetically lethal with rot1
                     mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499023.1"
                     /db_xref="GeneID:8204556"
                     /db_xref="GOA:C5E407"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:C5E407"
                     /translation="MQLSWFLQLLLFWCHLHLVSAFDRSVLKTCSSAGFCKRNRYYGE
                     SIQGNNTSSSYYVIDESSVRYDGDEYSLHANVIKSIPSGIKVELPFTLQLLQDGNVVR
                     FTIDESRPHKDYLPKVLNQRRYNETSKWAFADVPSKVPIAKPRKIGNKIIVGSNSTDC
                     RVEISLDSFLINVYWKNELSMVVNERSFLNYEHLRSEDENSKNLLPEESDFDMFHDSF
                     NYSQSDTIPFGPESVALDFTFNEFENLYGLPEHPASFRIEETCGGEPYRLFAADVPRY
                     DVGTRMPTYGNIPFVIGNNEKSAAGLFWVNAADTWIDFKYPEGKAQSHWMSETGIIDV
                     VMFLGDTPMEIVDKYTNLTGRPALPKEAAVGHHQSRWNYYNESDVMNVDSNMEKGNFP
                     YDIIWLDLDYTDEKKFFTWKPDAFPNPARLLKKLGDLGRGLVVLIDPHLKKDYYYSNT
                     VIKNEVAIKNRTGDTFFGTCWPGVSVWIDTFSDLGSKVWGNFYNNFVNGTENLGIWND
                     MDEPSVFDGIETTAPKNLIHAGGFEHRALHNAYSLTVHQATYNGLSNIFNGTARPFVL
                     TRSHFAGSQRTAGTWTGDNVASWNYLQISIPMVLTSNAAGMPFTGADIAGFLDNPEDE
                     LIVRWYQAGLWYPFFRAHAQNETRRREPFLFKDPIKSYVRNAIQLRYHLLPTFYTAFF
                     NSNLKGSPIMKPMIFEKPKYTNFAAVDDQFYVGDSGILVKPITEKNVSFAYVQVADGV
                     YYDFHDLKPQQTSSKNDSSGIKCIGIEAGLDKIPALLEGGHIITKRDTYRKSSVYYRN
                     DPYTLVIAPDAFGNAQGELYADDGKTWDHKSGQYLHSVFSFQDFKSISGNTSNVPSNG
                     EAAGNTLIDKIVIAIGNNNSSIGDTVKVNRNGELHTVNVNKTSPFEAVISNPMVYANE
                     TWKIEL"
     gene            <130893..>133712
                     /locus_tag="ZYRO0E01782g"
                     /db_xref="GeneID:8204557"
     mRNA            <130893..>133712
                     /locus_tag="ZYRO0E01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498979.1"
                     /db_xref="GeneID:8204557"
     CDS             130893..133712
                     /locus_tag="ZYRO0E01782g"
                     /note="similar to uniprot|P38138 Saccharomyces cerevisiae
                     YBR229C ROT2 Glucosidase II catalytic subunit required for
                     normal cell wall synthesis mutations in rot2 suppress tor2
                     mutations and are synthetically lethal with rot1
                     mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499024.1"
                     /db_xref="GeneID:8204557"
                     /db_xref="GOA:C5E408"
                     /db_xref="InterPro:IPR000322"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR025887"
                     /db_xref="UniProtKB/TrEMBL:C5E408"
                     /translation="MLLHWFLQVLFFWSQLQTVSGFTQYLLKRCDQAGFCTRNRYYAE
                     NIQKTRASYYTIEDSSVHYDESDKTLYATIIKSIPPSEDKDSITKIELPFALQLLQDG
                     SSVRFIIDENRPHKDYLPEALNQRRYNETSKWAFTNLHKKIPYVKKGTTFNKHKIIVE
                     EDPDYVGNLSLELFTDSFLIKVYWKDELAMVVNERSLLNYEHLRAETENEQNLLPEES
                     DFNMFHDNFKYSKADTLPFGPESVALDFAFNGIENLYGLPEHPDSFRLKDTTDGEPYR
                     LYSTDVFRYDIGTKMPMYGNIPFVIGNNPKAAVGLFWVNAADTWVDLKYQKSKTQTHW
                     MSETGVIDVVLFFADTPDQILNKYTNLTGRPMLPKQAAVGYHQCRWNYNDELDVLTVD
                     SNMDKGHFPYDIIWLDIDYTDEKKFFTWKPSAFPNPARMLKKLAKLGRELVVLIDPHL
                     KAGYEISDEIIENDVAIKNQKGKTFYGTCWPGRSVWIDTFSELGRKVWGSFYDAFLNG
                     AKNLNIWNDMNEPSIFDGPETTAPKNLIHDGGFEHRALHNAYSLTVHEATHDGLLEIN
                     NNSVRPFIIARGYFTGSQRTAGTWTGDNVATWDYLRVSLPMILSSNVAGMPFTGADIA
                     GFFENPEDELVVRWYQAGLWYPFFRAHAHIDSNRREPFLFKDPIKSYVRDAIQLRYTL
                     LPTFYTAFFRSSIDGTPIMKPMIFEKPQYPDLAAVDDQFYLGNTGILVKPILEKDVSI
                     TEIKVSEGVFYDYYDLKPHYVNTFREGEDVVQKKRAHVVESISVRAGLDKIPILLEGG
                     HIITKRDNYRRSSKLYRNDPYTLVIAPDSFGDAEGELYADDGETLAHKNGEYLHTVFT
                     LQHHELITGHPKNVPSDHRTAGNTMINKIVIATGNKNRFNIKDTVKINRNGNFHTAKV
                     IRTSPFEAVILHPMVYANETWQIDF"
     gene            complement(<133797..>134696)
                     /locus_tag="ZYRO0E01804g"
                     /db_xref="GeneID:8204558"
     mRNA            complement(<133797..>134696)
                     /locus_tag="ZYRO0E01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498980.1"
                     /db_xref="GeneID:8204558"
     CDS             complement(133797..134696)
                     /locus_tag="ZYRO0E01804g"
                     /note="similar to uniprot|P38324 Saccharomyces cerevisiae
                     YBR228W SLX1 Subunit of a complex with Slx4p that
                     hydrolyzes 5' branches from duplex DNA in response to
                     stalled or converging replication forks function overlaps
                     with that of Sgs1p-Top3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499025.1"
                     /db_xref="GeneID:8204558"
                     /db_xref="GOA:C5E409"
                     /db_xref="InterPro:IPR000305"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR027520"
                     /db_xref="UniProtKB/TrEMBL:C5E409"
                     /translation="MDQQSSKPVPVFYCCYLLQSICKRQSFYIGSTPNPVRRLRQHNG
                     ILTRGGAYRTRREGTRPWEVIMVVYGFPSKITALQFEHAWQHGYKTHYIADDERIVRN
                     KNGGRTIHHKLGTARLLAKNIYFQRMDLVVHFFNADVESIWIQNKYNINDMGLITVEN
                     SPSPTIAPTVENAVDYSESNLKLVEQFLNGFFDRDMGVCQIYRERLTFGEIPCGICQT
                     TFDYTSDNPQLKPFIAFCVHEDCSFVAHLGCLHRYFLDEEQLQDGIRNLIPRYGKCPD
                     CSQIVKWTHLVKYSSMLKSSHGT"
     gene            <134806..>136320
                     /locus_tag="ZYRO0E01826g"
                     /db_xref="GeneID:8204559"
     mRNA            <134806..>136320
                     /locus_tag="ZYRO0E01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498981.1"
                     /db_xref="GeneID:8204559"
     CDS             134806..136320
                     /locus_tag="ZYRO0E01826g"
                     /note="similar to uniprot|P38323 Saccharomyces cerevisiae
                     YBR227C MCX1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499026.1"
                     /db_xref="GeneID:8204559"
                     /db_xref="GOA:C5E410"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004487"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E410"
                     /translation="MIRSSLGSFKRFYSASPSAIASQKLAQGRLPSIPTPRNIKAHLD
                     DYIVGQDKSKKVLSVAVYNHYLRNHDKSRKSELQKARTLIWEETQRREKERQDKLGYE
                     SSESKAGLKNLQQQLLAHPDDDLVLSKSNLMMIGPSGSGKTLMATTLAKMLDVPIAIT
                     DCTQLTQAGYIGDSVEVCIERLLVNADFDVSKAERGIIVLDEVDKLAKPAANIGTKDV
                     SGEGVQQALLKIIEGHNVEVTVKRPVKQGTDNKNNQTAAKKDETFVIDTSNILFMIMG
                     AFVGLDKRIVKRVKGDRGLDESKEEKDSKEEIEKLRFSNTIEQIDLGNGKKETALNLV
                     TPTDLISFGLIPELIGRVPIITALQPLERDDLYHILKEPKNALLEQYRYIFKQFGVQL
                     CITEKALQRVAQFALREGTGARGLRGIMERLLLNVNYECPDSGISYALVTEETVNSLQ
                     EKDYSLSTNVDVKYYSRGERDQFIEDTYKEDPKLGKELDSQFGRISTREKEGKL"
     gene            complement(<136541..>138976)
                     /locus_tag="ZYRO0E01848g"
                     /db_xref="GeneID:8204560"
     mRNA            complement(<136541..>138976)
                     /locus_tag="ZYRO0E01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498982.1"
                     /db_xref="GeneID:8204560"
     CDS             complement(136541..138976)
                     /locus_tag="ZYRO0E01848g"
                     /note="similar to uniprot|P38321 Saccharomyces cerevisiae
                     YBR225W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499027.1"
                     /db_xref="GeneID:8204560"
                     /db_xref="GOA:C5E411"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E411"
                     /translation="MGSDGFKTSRDNVYGSGGSAKNTSIGNSDVGSIGSRTSRESTGS
                     HRDKMRGEISKLQEEIASVKGDDLQDLMSNKDKSVSSSSTISPKPSRRRNMHPTDFND
                     TKSSKLNQVQSMDTIDSDAFDNTESSSDNNTNNNNNDNEDKDFGLTPAFSIHGNTSKV
                     AANLHRRRVVDWNMLPRLGSSVLVKHQSFNVINIPIDGELKQILYTPSYNENFKPMNI
                     FLSFNMDSKSKEAQLYSKKRLNSFGAYIGHYLKSRLYAYQRFPFYQQDAPIDRNYASY
                     DASKDYSEIETVISLWYMQSQRCISQSNSTFFSADVVQHLLQRKANTRHQASQPTAIY
                     VPQTGATLMTSKPSMIETTDDIDILLLRPYQEARLGWQLAYDEPNLKIADYPIDVSPW
                     MMDESDTRAVLGSDNSKSTSSMVNIVNDEAELVEVTNENAGRYLLDCMGRRSGSLYMD
                     EMSSPITKGFGQTPGNEVTPTNSLDSSADRESPSSSAYPEPSRKKVASKLGKKTGLSS
                     LFKRKHQAPTTPSAGSSSAAAAAASAATSSSSSATKKDHPTTDGQGHPVENAWLESYF
                     SRYLSNYKRIDLPTQFLLPKEAQDTPKTTSSSTSNNQDISDSRNALLYSKESLQLRLP
                     FADDSIPAIFCPRVWMGLAFNKWRNLLREMHRVLLPGGYALASVIDIGILNSFASATD
                     ESMQEFPTTQERDRILDAISLAAIEKGVHIHPTQHLAQAFKDVGFTNLRYSVLSLKTG
                     DCATEMGCLYEIYSEITWDLLFRKFLPDPTAPPKGTDPTTLFRRFIKEHMGKVDDTAG
                     SLKVLYLVAQKAR"
     gene            complement(<139487..>141286)
                     /locus_tag="ZYRO0E01870g"
                     /db_xref="GeneID:8204561"
     mRNA            complement(<139487..>141286)
                     /locus_tag="ZYRO0E01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498983.1"
                     /db_xref="GeneID:8204561"
     CDS             complement(139487..141286)
                     /locus_tag="ZYRO0E01870g"
                     /note="highly similar to uniprot|P53128 Saccharomyces
                     cerevisiae YGL125W MET13 Isozyme of
                     methylenetetrahydrofolate reductase catalyzes the
                     reduction of 5 10-methylenetetrahydrofolate to
                     5-methyltetrahydrofolate in the methionine biosynthesis
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499028.1"
                     /db_xref="GeneID:8204561"
                     /db_xref="GOA:C5E412"
                     /db_xref="InterPro:IPR003171"
                     /db_xref="InterPro:IPR004621"
                     /db_xref="InterPro:IPR029041"
                     /db_xref="UniProtKB/TrEMBL:C5E412"
                     /translation="MRISEKLQNHRSKSTKPTFSFEYFVPKTTQGVQNLYDRMDRMYQ
                     STLPQFIDVTWNAGGGVLSQLTTDLVETSQSVLGLETCMHLTCTNMPVSQIDDALESA
                     RLSGCQNILALRGDPPVNSDSWQPVEGGFQYAKDLVRYIRDKYGDYFDIGVAGYPEGH
                     PETAGDDETLLDHLKEKVDAGANFIITQMFYDADLFIKWCQRVRAKGVDVPLIPGIMP
                     ITTYAAFLRRANWCDVHIPQEYFDRLDPIKDDDQLVREVGTDLIVSLCQKLLDSGYVS
                     HLHIYTMNLEKAPQMILDRMELLPSHDEPLDNHLAILPWRKSLNPQRRNEEVRPIFWQ
                     RRPYSYVARTSQWSVDEFPNGRFGDSSSPAFGDLDLCGASLIRQSGKKSLELWSAPNS
                     MEDIAQLVINYLRGELKYLPWSDTSLNHEVDDILPELVTLNQKLIITINSQPQLNGVK
                     SSHPVHGWGPRDGYVYQKMYLEFLLPKEKLSKLHDCLVNDVMLTYFAVDHNGNLTTNH
                     QDGTRANAVTWGIFPGREVLQPTIVEKVSFLAWKQEFYHICEEWKLNFINHRCDQSVK
                     LLQHLIDDYVLVNIVDNDFISPENRIFNLLSSI"
     gene            complement(<141666..>141857)
                     /locus_tag="ZYRO0E01892g"
                     /db_xref="GeneID:8204562"
     mRNA            complement(<141666..>141857)
                     /locus_tag="ZYRO0E01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498984.1"
                     /db_xref="GeneID:8204562"
     CDS             complement(141666..141857)
                     /locus_tag="ZYRO0E01892g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499029.1"
                     /db_xref="GeneID:8204562"
                     /db_xref="UniProtKB/TrEMBL:C5E413"
                     /translation="MSGLSKCVVTLLGQPGVDERDHRTSHPSHTLRFITPKSKLVEAD
                     EIPLKESIFLQTELNCVYR"
     gene            <142718..>144259
                     /locus_tag="ZYRO0E01914g"
                     /db_xref="GeneID:8204563"
     mRNA            <142718..>144259
                     /locus_tag="ZYRO0E01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498985.1"
                     /db_xref="GeneID:8204563"
     CDS             142718..144259
                     /locus_tag="ZYRO0E01914g"
                     /note="similar to uniprot|P38319 Saccharomyces cerevisiae
                     YBR223C TDP1 Tyrosine-DNA Phosphodiesterase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499030.1"
                     /db_xref="GeneID:8204563"
                     /db_xref="GOA:C5E414"
                     /db_xref="InterPro:IPR010347"
                     /db_xref="InterPro:IPR027415"
                     /db_xref="UniProtKB/TrEMBL:C5E414"
                     /translation="MVSDTRKRVAERWSRVDYRSGAIEPAVKKPKSEVIDLTGSDSDN
                     SDNGDQEEQGPPVKPNYPFKLVKSQIFDKNLKNSHHLIDLRDVLHDPSLRKSFLFSFQ
                     YELDFLLEQFHPNVQKIVLVAQEGTVLPPTTPKALSWVGKTHLCEFRMPPFTCHHSKL
                     IINVYQDGSLQLFMPSNNFTYAETNYPQQVCWVSPRLSACASPASSSFQSDLLNYLKS
                     YDLREINRYIIPEVEKFNFEPLEGTEFVYSTPSKDYLSGFQLLAQKLRYKKENGDTSI
                     KHHLSHYLCQSSSVGNSLSRKEPCNLLTHMIIPVLEGIIPKDSKKLPSTSQLLEDYRS
                     HHIVPYLLYPTVQEIVDSPVGWLCSGWFNFNYNKDMAHYNMLRDEFNIFHKQKKSQLS
                     PQRRATPSHSKFYMKSTTRNPNEKPFRELDWCLFTSANLSFSAWGKTSAKPRNYEVGI
                     LLKSPDLRCQSFVDLIYNTKLQNDSENTNGTTVAVPWTPDLEPYEKIDETFCISKDYS
                     QLSSS"
     gene            <144459..>146066
                     /locus_tag="ZYRO0E01936g"
                     /db_xref="GeneID:8204564"
     mRNA            <144459..>146066
                     /locus_tag="ZYRO0E01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498986.1"
                     /db_xref="GeneID:8204564"
     CDS             144459..146066
                     /locus_tag="ZYRO0E01936g"
                     /note="highly similar to uniprot|P38137 Saccharomyces
                     cerevisiae YBR222C PCS60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499031.1"
                     /db_xref="GeneID:8204564"
                     /db_xref="GOA:C5E415"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="InterPro:IPR025110"
                     /db_xref="UniProtKB/TrEMBL:C5E415"
                     /translation="MAPSFNETFAVSDNVAVIVPETGVQVTYRELSHQVGHFQNVFND
                     PESPLYNVIGRQSPVAISLRNGLEFIVSFLGTTMDGKVGAPLNSNYREQEFNFYLEDL
                     KAKAVVVPKGTVKETPTAEIVKSAKKFECFIVEVFFDVKRFRLEYDVYSAKDGYSKVQ
                     YSSLNNAVFFNLDDKKFPGFARSNDVALVLHTSGTTSRPKTVPLLHLNIVRSTENISN
                     TYKLTPQDRSYVIMPLFHVHGLIGALLSTFRTQGSVVVPEKFGAKRFWDDFVKYGCNW
                     FSCVPTISMIMLSMPRPTPFPNIRFIRSCSSALAPTTFQKLEQAFQAPVLEAYAMTEA
                     AHQMTSNNLPPGKRKPGTVGQPQGVEIVILDEKDNKLPQGKIGEVSIRGENVTPGYAN
                     NAKANLENFTRRENYFRTGDQGFFDQEGFLVLTGRIKELINRGGEKISPIELDGAMLS
                     HPAVKEAVSYGVPDEKYGQAVHAAVVLESGKTLTPQDLADHMKQRVSAYKVPVEFNFA
                     DKLPKTATGKIQRRIIAEAFSKKQSKL"
     gene            complement(<146255..>147184)
                     /locus_tag="ZYRO0E01958g"
                     /db_xref="GeneID:8204565"
     mRNA            complement(<146255..>147184)
                     /locus_tag="ZYRO0E01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498987.1"
                     /db_xref="GeneID:8204565"
     CDS             complement(146255..147184)
                     /locus_tag="ZYRO0E01958g"
                     /note="similar to uniprot|Q12289 Saccharomyces cerevisiae
                     YOR100C CRC1 Mitochondrial inner membrane carnitine
                     transporter required for carnitine-dependent transport of
                     acetyl-CoA from peroxisomes to mitochondria during fatty
                     acid beta-oxidation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499032.1"
                     /db_xref="GeneID:8204565"
                     /db_xref="GOA:C5E416"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E416"
                     /translation="MSEPESPVVQEETREETRKEIPAASALMQNAKSLTAGAVGGVFA
                     VLTGHPFDLLKVRCQSGQASSMSHAVKEILQESRGSLVASVRGFYRGVIPPLLGVTPI
                     FAVSFWGYDMGKKIVAYDQPLSQQPLTTSQLATAGFISAIPTTLVMAPTERVKVVLQT
                     TEGYTFGSAAKKLVQDGGVQSLFRGSLATLARDGPGSALYFAAYEVTKKALAKPGEEE
                     FSVTKTSIAGGMAGVAMWTGVFPIDTVKTKLQAGEERSSFKNAVKQIYVTRGGLKGFF
                     PGLGPALLRSFPANAATFVGVELTHSTFKKMNI"
     gene            complement(<147587..>148774)
                     /locus_tag="ZYRO0E01980g"
                     /db_xref="GeneID:8204566"
     mRNA            complement(<147587..>148774)
                     /locus_tag="ZYRO0E01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498988.1"
                     /db_xref="GeneID:8204566"
     CDS             complement(147587..148774)
                     /locus_tag="ZYRO0E01980g"
                     /note="similar to uniprot|P27810 Saccharomyces cerevisiae
                     YOR099W KTR1 Alpha-1 2-mannosyltransferase involved in
                     O-and N-linked protein glycosylation member of the
                     KRE2/MNT1 mannosyltransferase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499033.1"
                     /db_xref="GeneID:8204566"
                     /db_xref="GOA:C5E417"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5E417"
                     /translation="MKPAGDRRRLNRLLGYAAIALITIYVLYKGAQRNGNGFYGSSAA
                     TRQVEKDGNIYRELVSSNNGALDRSGLEKATFVTLVRNSDLYGLIPSIKSVEDRFNHK
                     YGYDWVFLNDEPFTEEFINVTSALVTGETKYGFIEKKDWDFPPWIDQNRAAGTRDRMG
                     KEGIIYGNSISYRFMCRYESGLFYRHPIFNDYEWYWRVEPDVKLHCDVNYDVFKFMRE
                     NNKKYGFTISIKEYSATIETLWDATLSFLEKHPEHVNKNCMLDFISDDGGSSYNLCHF
                     WSNFEIASLDLWRSDAYRDYFDFLDQWGGFFYERWGDAPVHSIAASLFLDRDEIHHFG
                     DFGYFHVPFHQCPVDDETRLSLKCDCNPNEDFTWHSYSCTTKYYTVNQLRKPSNWLDH
                     ATS"
     gene            <148958..>151744
                     /locus_tag="ZYRO0E02002g"
                     /db_xref="GeneID:8204567"
     mRNA            <148958..>151744
                     /locus_tag="ZYRO0E02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498989.1"
                     /db_xref="GeneID:8204567"
     CDS             148958..151744
                     /locus_tag="ZYRO0E02002g"
                     /note="some similarities with uniprot|P14907 Saccharomyces
                     cerevisiae YJL041W NSP1 Essential component of the nuclear
                     pore complex which mediates nuclear import and export"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499034.1"
                     /db_xref="GeneID:8204567"
                     /db_xref="InterPro:IPR011049"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:C5E418"
                     /translation="MSLAASERPKRSISSTIKEFIWGKPSRNQFTAFPERSEQEKPSQ
                     NDVPKNVEPIGLSEPREGFPEFVIVYEGNSQVRPPVLPILPVQRLRLLRQKQEWRKRH
                     DLNLLYLSPSNVASSSPSKLNISNLSYKSSSTPSPTKMNHVVAPPLKRKKTSNNGGKG
                     TKWSAEFEYDLAEYDTVERPGTPPVQNELPFDQVSAHKTVVGPLKTSLLDQDVNSNQL
                     SSIQRKVLLNGPQSILPRRDSDKKENVEKPVKMGEKVILPSVGFDFIKSSDTPSKVKT
                     QQRDEEDEEEEPKRKRKLTEPAQPSFKFGTGPAEKKDEKKQLTGFGAKKDEQSKPSFS
                     FGEKKDEQPKPAFSFGAKKDEQPKPAFSFGAKKDEPPKPAFSFGAKKDEQPKPAFSFG
                     AKKDEPPKPAFSFGEKKDEPAKPSFSFGTKKDELAKPSLSFGDKKDEPAKPSFSFGAK
                     KDESAKPSFSFGAKKDENETSKPTLNFGAKKDDNEPAKPSFSFGAKKDDNEPTKPSFS
                     FGAKDDEKSKPTASFGAGVTTAPSFDLGSKKDEPAEKPKPAFSFGTRPNEKPSFAFGA
                     KDDDPAKKKPAFSFGAKQDESKQDDKADSKPPFSFGAGADGPSKPTFSFGAKKEGTVF
                     DKPTPPLAQDASKQDGKSSGFSFNRLSQGAQPPSLGASAPVAAPSAPTFSFGSGANDK
                     PPASNGPSVFAPTPQAAEKPFPFSRPNSNPSWPSQPGSAASAPGDNPPSMNFKFGSGS
                     GSSMPAAAPPPASTNPLVSNPFVNKPSGFAFGSNSAAPFGASQAPSPSPGAPAPAFGN
                     AASVSPAFGKSASPPVMPNFDPTKRAFTPSNSINLNFGGNAASTDPSRIFSGGSTNSQ
                     PMPGTASTPQQVFGGSQPPAPIFGNGPQPPVGAAGFNGAAPGMPSNPPQPPMSNFQLP
                     PGRRLARMRQSRRA"
     gene            <151924..>152469
                     /locus_tag="ZYRO0E02024g"
                     /db_xref="GeneID:8204568"
     mRNA            <151924..>152469
                     /locus_tag="ZYRO0E02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498990.1"
                     /db_xref="GeneID:8204568"
     CDS             151924..152469
                     /locus_tag="ZYRO0E02024g"
                     /note="some similarities with uniprot|Q12274 Saccharomyces
                     cerevisiae YOR097C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499035.1"
                     /db_xref="GeneID:8204568"
                     /db_xref="UniProtKB/TrEMBL:C5E419"
                     /translation="MEKFKPLIDEWAAKVSAKVRTEPTNVIHLPSFLLGCFVTVTIFS
                     LIPVMKLFLGSLLSTVVTLLKYLVIGGGIIACIMVITTRGGEDTSKSKSLRHDKQELL
                     PKKEQIPKVKPTAVPQPLPQATVYPPHDGSGLVKDDFEGIRHCDISIASSQHQNRRKV
                     PTDERAYNSFINRAAMKNVAG"
     gene            complement(<152683..>153252)
                     /locus_tag="ZYRO0E02046g"
                     /db_xref="GeneID:8204569"
     mRNA            complement(<152683..>153252)
                     /locus_tag="ZYRO0E02046g"
                     /product="40S ribosomal protein S7"
                     /transcript_id="XM_002498991.1"
                     /db_xref="GeneID:8204569"
     CDS             complement(152683..153252)
                     /locus_tag="ZYRO0E02046g"
                     /note="highly similar to uniprot|P26786 Saccharomyces
                     cerevisiae YOR096W"
                     /codon_start=1
                     /product="40S ribosomal protein S7"
                     /protein_id="XP_002499036.1"
                     /db_xref="GeneID:8204569"
                     /db_xref="GOA:C5E420"
                     /db_xref="InterPro:IPR000554"
                     /db_xref="UniProtKB/TrEMBL:C5E420"
                     /translation="MSTHTKILSQAPTELELQVAHAFTELENSSPELKAELRPLQFRS
                     IREIEVAGGKKALAIFVPVPSLNAYHKVQTKLTRELEKKFPDRHVIFLAERRILPKPS
                     RRSRQLQKRPRSRTLTAVHDKILEDMVFPTEIVGKRVRYLVGGNKIQKILLDSKDVQQ
                     VDYKLESFQAVYNKLTGKQIVFEIPGETH"
     gene            <154407..>155312
                     /locus_tag="ZYRO0E02068g"
                     /db_xref="GeneID:8204570"
     mRNA            <154407..>155312
                     /locus_tag="ZYRO0E02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498992.1"
                     /db_xref="GeneID:8204570"
     CDS             154407..155312
                     /locus_tag="ZYRO0E02068g"
                     /note="highly similar to gnl|GLV|CAGL0L03740g Candida
                     glabrata CAGL0L03740g and similar to YOR095C
                     uniprot|Q12189 Saccharomyces cerevisiae YOR095C RKI1
                     Ribose-5-phosphate ketol-isomerase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499037.1"
                     /db_xref="GeneID:8204570"
                     /db_xref="GOA:C5E421"
                     /db_xref="InterPro:IPR004788"
                     /db_xref="UniProtKB/TrEMBL:C5E421"
                     /translation="MIIPSITKGLVFRSLTSISALSCSSKRLMASIKIPKISELPSLG
                     LPLENAKRAAAYRAVDENLDVYQHRVIGIGSGSTVIYVAERIGQYLRDDEYRDYVSKF
                     KCVATGYQSKQLIMDNGLTYAILEQHPHIDIAFDGADEIDCNLDLIKGGGGCLFQEKL
                     ISTSAKIFVVVADTSKKSPRRLGSHWVQGVPIEVVPAAYNRVQDDLLNLLGAKTATLR
                     QGGKVKMGPVVTDNNNFILDTHFGDIDDPKKLHDNIKALVGVVETGLFIGNAAKAYLG
                     SPDGDVLITSRENPAELQNETIMEQ"
     gene            complement(<155560..>156105)
                     /locus_tag="ZYRO0E02090g"
                     /db_xref="GeneID:8204571"
     mRNA            complement(<155560..>156105)
                     /locus_tag="ZYRO0E02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498993.1"
                     /db_xref="GeneID:8204571"
     CDS             complement(155560..156105)
                     /locus_tag="ZYRO0E02090g"
                     /note="highly similar to uniprot|P40994 Saccharomyces
                     cerevisiae YOR094W ARF3 Glucose-repressible
                     ADP-ribosylation factor GTPase of the Ras superfamily
                     involved in development of polarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499038.1"
                     /db_xref="GeneID:8204571"
                     /db_xref="GOA:C5E422"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E422"
                     /translation="MGNSVSRALGKLFGSREMKILMLGLDNAGKTTILYKLKLNKIRT
                     SAPTVGFNVETVSYKNVKFNMWDVGGQERLRPLWRHYFPATTALIFVIDSHDKERLQE
                     AKEELYAIISEKEMENVVLLVWANKQDLKGSLKPQEVSDYLELGQNLKNQLWCVVGSN
                     ALTGQGLVEGLSWISNNTPKK"
     gene            156455..156527
                     /locus_tag="ZYRO0E02112r"
                     /db_xref="GeneID:8204572"
     tRNA            156455..156527
                     /locus_tag="ZYRO0E02112r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8204572"
     gene            <157127..>162079
                     /locus_tag="ZYRO0E02134g"
                     /db_xref="GeneID:8204573"
     mRNA            <157127..>162079
                     /locus_tag="ZYRO0E02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498994.1"
                     /db_xref="GeneID:8204573"
     CDS             157127..162079
                     /locus_tag="ZYRO0E02134g"
                     /note="similar to uniprot|Q12275 Saccharomyces cerevisiae
                     YOR093C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499039.1"
                     /db_xref="GeneID:8204573"
                     /db_xref="GOA:C5E423"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR010506"
                     /db_xref="UniProtKB/TrEMBL:C5E423"
                     /translation="MPDLSVPPNLPIHLRNQISELVRDYKEENLTLKGYEAKRKHLLD
                     QYANGQRFPLAPLRSPTRRPPAFHKRNQSWGSSIWSHGGSFFNDTNSIASSVYQGNPA
                     DHNSDGGSEAPYMFQRGQSGRQSVYRVTTVNSNSGYSTPRARHNESSVHLSIPSNEIS
                     GVPYNPMIPLLPREENPTNSDSLTSVLRGRFENYPGETAMISVNEKGKETYISWDKLY
                     LRAEKVAHILSKEKLYKMDKVLLWYNKNEIIDFTVALLGCFIASMVAVPVSFEIYSLG
                     EITEIIKLTSSKSVLISEDCYEQLENLYSTSNHNRIKVIRSEFFSQISFIKTDDLGQY
                     SKAKKTTPTFDIPNISYIEFTRTPLGRLSGVVMKHKILSNQNNIFTNILNSRAMPHWK
                     KGNVKKAFKKRDSSERYNILNSLDPTRSTGLVLGVFFNIFSGNLLISVDHRLLQKPGA
                     YENLIEKYKADILLNEQLQLKQVVINYLEDPQSTISKKHRIDLSCIKCCLTCCTTIDT
                     DVLDMIVQKWLKNLGCIDASTCYSPILTLPDFGGVFLSVRDQLGKLDNFQIHESKLRL
                     QDELFINKEKLRGNIVEPSITAMINSSSSFKDYLRVTSFGFPIPDAMLCVVNPDDNTL
                     VPDLTVGEILVRSDSLTDEFYQMDRVNNFVFKARLNYPKMYSFLTSEITSPTAGDRLS
                     TIMNICPSTIFFLRTKLMGFVHNGKIYVLSMVEDMFLQNQLIRLPNWAHTSDVRKARK
                     PSSEGDKGSDTMSLASTNLKTGKDEKDIRRVVQTYYLQQVTETLVRTVSTVYEVSAFE
                     LNHNKDEHFLVVVVESSLSKLPTSHSTSVTEAESQKKTTEKKMNELIDQVYRILWIFH
                     KIQPTCVMVVPLESLPRRYCSLEIANSTVEKKFLNGELPATFVKFQFDNVILDFVPHS
                     VFYNESIFSEHLSNMRRTAFLEEYRATHPNFSLDQQYPLPDETPWQSSGIDYRETSID
                     LRTHKSLASFPSILDILEWRIRETGNEFAFSDGVTIGYSSNNENAHKKVSWKAFERII
                     AAFLKKIVESKTPLKRGDKVVIVCENSVEYTAIVIACMYCNLVIIPYPIFREENIEED
                     VSYLVKVIRAYGVKRIFMDLTTHNIFEDNPILTKILKRCKHDIPKITVFSKVKKKNNL
                     TINMFASQLRTKFGPKPGLNHNSHPCVIWIDDEFDIKKDIHVVMNHASLMNSLKILKE
                     TLGLSSENPIFSLCSYTVGMGFMMSCMVGIYVGCTTSLFSLDEVYSNPSGFLIGLQNM
                     NVKDLYLNFETFCILTEKANELVEGNKGKLSSLEKSSKKHTPTPTLLKPDFLRNVQNL
                     MIPFSGRPNTKRIEELLRRNTNITISRAQINYLYRNHLNPHISLRSYLGSPPVDMYLD
                     SIALREGIIKTVNPAEVSPRGYIRVQDSGIVAVCTDVSIVNPETNLPCSNGELGEIWC
                     CSEGNVHDYYICQDANDVTGKPTLTNDPFITNQFKSKLQTDVDNGLTYLRTGDLGFIK
                     RVTCADSAGNSLDLNLLFVLGSINETVEILGLAHFVRDLEKTIRHTHPSIQKCIVSKA
                     GGLLVCLVKCRDNSNAKFANLAALIVSELLKNHGVILDLCAFVSQDPSQVNLPSEWDK
                     NRLTVMESWLDQKLKIEAQFGINYGENISIYLLSEFERNS"
     gene            complement(<162220..>163944)
                     /locus_tag="ZYRO0E02156g"
                     /db_xref="GeneID:8204574"
     mRNA            complement(<162220..>163944)
                     /locus_tag="ZYRO0E02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498995.1"
                     /db_xref="GeneID:8204574"
     CDS             complement(162220..163944)
                     /locus_tag="ZYRO0E02156g"
                     /note="similar to uniprot|Q99252 Saccharomyces cerevisiae
                     YOR092W ECM3 Non-essential protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499040.1"
                     /db_xref="GeneID:8204574"
                     /db_xref="GOA:C5E424"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="UniProtKB/TrEMBL:C5E424"
                     /translation="MSVPLGDIIWTCFKPMIKIYLIIGTGFGLAKINILSVEATRAIS
                     DIVLTLLMPCLAFSKIVGNIQDSDIKNVAIVCLSSLLIFGTGLFGAFVISKTMPVPKQ
                     WRGGILAGGMLPNISDLPIAYIQTLDQGLVFTEEEGNKGVANVIIFLTMFLLCLFNLG
                     GFRLIESDFKYNDEESGSTEADNYEPTQQLSIPDENSSSELSGKEAYGQVQKPPSSAS
                     PLENLSRSPSHNHPPSIASNPTTVASSPNGYNNPERSQPLAYTQNSQTGSLRMRRPSV
                     SESIRTIDRREMPPEDVTHLIREYSNVDQYGHRRRSTTARSTSNDFGELPRTSTRGQS
                     SMERIRSSTLTRMLTSDATVGKEDIEDSGKGSLPKWMRKVRITKYFIFFLKNCLRPCS
                     LAVIVALTIAFIPWVKALFVSGPGIPHINQAPDQQPPLSFIMDYTSYIGAASVPFGLL
                     LLGATLGRLKIKKLYPGFWKSALLLVCLRLCIMPILGVLWCNRLVRAGWLHYDEDKML
                     LFVIVLDWGLPTMTTIIYFTASYTPPDAKETVQMDCVSFFLMIQYPILAISLPFLASF
                     YIKVKLKA"
     gene            complement(<165393..>167327)
                     /locus_tag="ZYRO0E02200g"
                     /db_xref="GeneID:8204575"
     mRNA            complement(<165393..>167327)
                     /locus_tag="ZYRO0E02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498996.1"
                     /db_xref="GeneID:8204575"
     CDS             complement(165393..167327)
                     /locus_tag="ZYRO0E02200g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499041.1"
                     /db_xref="GeneID:8204575"
                     /db_xref="GOA:C5E425"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E425"
                     /translation="MTYEKGPILEQFTHEELANQVTPDSEQLDKEAGKVERGNKLSKL
                     SPEVVAQMGREFAEEFELPNDDDIFARAAMLARNPDGFNDFDFLSDEEKQACWAEEYK
                     PWSSMTRQLIAIICAAAMSAAVQGMDETVINGAMLFYPEVLGLGSGSKRDSWIEGLIN
                     GAPYLCCAGFSCWTTDWLNNRLGRKNVIFVTCGISAVTCFLQGFAPTGVRGWHYLFAF
                     RFLLGLGIGPKSATTNVYLAECATRQIRGCTTIFWQFFTAFGIMWGYVFTLIFYRVKP
                     NGVHGGLNWRLTLGSAMLPALLVMIQIPFCPESPRWLMGKNRYREALENTIKIRPHKI
                     LACRDIFYQHVLLAEEESLQLPFWIRLKQMVTVRRNRNGLLASCICAFMQQFCGINVI
                     AYYSSSIFVESGFSEISALCSSLGFGLINFFFAIPTFFMIDKRGRRYLLLRTFPWLAL
                     FLLIAGFAFWIPGTQARIGVVTMGIYVFSAIYSFSCGPVPFLIAAESANLASRSLNSS
                     IFTVVLWGFNFILSVTWPSMVRAMKPQGAFGFYAFWNAAGFFMVYFCVPETKQYTLEE
                     LDEVFEVPLRTRIKYNFQEIWPNIQYHILRRRKIKRRTPLGPSVGFSDLEEKPEQEHV
                     ERVDTSDSSSDVDPTAGGGL"
     gene            <167692..>168384
                     /locus_tag="ZYRO0E02222g"
                     /db_xref="GeneID:8204576"
     mRNA            <167692..>168384
                     /locus_tag="ZYRO0E02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498997.1"
                     /db_xref="GeneID:8204576"
     CDS             167692..168384
                     /locus_tag="ZYRO0E02222g"
                     /note="similar to uniprot|P38172 Saccharomyces cerevisiae
                     YBL095W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499042.1"
                     /db_xref="GeneID:8204576"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5E426"
                     /translation="MMLKIINRALILPLAGLTLGTASFLKVWPDTINDYDEPMRTDPE
                     LLRRWRRTNLYEELKHLTQWRQSEKIPPAHRSNHVGQGLLSGVGKLENDPVVFHDEVQ
                     NSISVVYQLGKKLGDSNGYVDNGVLSVLLDEALCYCGFPLLPSKRGVTARLDLEFVGK
                     IPVDSTIVLKAKVVEHKGRKCVISGTLESVPGMEKNWWGRLRSVWGAECYARAKCVLV
                     EPKWFKWLPGDA"
     gene            complement(168858..168944)
                     /locus_tag="ZYRO0E02244r"
                     /db_xref="GeneID:8204577"
     tRNA            complement(join(168858..168893,168908..168944))
                     /locus_tag="ZYRO0E02244r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (TTT) cove"
                     /db_xref="GeneID:8204577"
     gene            complement(<169081..>170601)
                     /locus_tag="ZYRO0E02266g"
                     /db_xref="GeneID:8204578"
     mRNA            complement(<169081..>170601)
                     /locus_tag="ZYRO0E02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498998.1"
                     /db_xref="GeneID:8204578"
     CDS             complement(169081..170601)
                     /locus_tag="ZYRO0E02266g"
                     /note="weakly similar to uniprot|P12630 Saccharomyces
                     cerevisiae YIL015W BAR1 Aspartyl protease secreted into
                     the periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499043.1"
                     /db_xref="GeneID:8204578"
                     /db_xref="GOA:C5E427"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5E427"
                     /translation="MKFSSNILKYGIVAAGAAKVALAGGVDGVGKIPFSKRYGKSFDE
                     SRQISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQELTLLLDTGSSDLWIPQKGG
                     YHCQSDSDDATKGKSSGIASQLFSIASAEGGPSPSLTTTLIGSSGGSHPDPLEPTNRN
                     VQPPAAITASALEESCQSSSGNFDPNSSSSFNKNDTVDGFFIEYGDNSYASGYWATDD
                     LTVGDISVKDMTIAVADDTNSSVAVFGISYRGLESSVFGDNLQDPHEYENFPYLLKDQ
                     GIVKRNAYSLYLNSAGASDGNILFGGVDHNKYSGDLYTLPVLKGQEDSDPWERFVVTV
                     QGIGIKGSETQNTLTTTPFIGLLDSGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYV
                     ISCPSDDEKIVFNFGGFNIETSLSNYITDNGNGQCILNISPTSDYMGILGDSFLRDSY
                     VVYDMDNNEISLAQANFDSTEDVEAITGPVPGATKAPGYSSTYSGPQTFQTGGNIF"
     gene            complement(<171852..>173489)
                     /locus_tag="ZYRO0E02288g"
                     /db_xref="GeneID:8204579"
     mRNA            complement(<171852..>173489)
                     /locus_tag="ZYRO0E02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498999.1"
                     /db_xref="GeneID:8204579"
     CDS             complement(171852..173489)
                     /locus_tag="ZYRO0E02288g"
                     /note="similar to gnl|GLV|KLLA0D12606g Kluyveromyces
                     lactis KLLA0D12606g and some similarities with YNR055C
                     uniprot|P53389 Saccharomyces cerevisiae YNR055C HOL1
                     Putative ion transporter similar to the major facilitator
                     superfamily of transporters; mutations in
                     membrane-spanning domains permit nonselective cation
                     uptake"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499044.1"
                     /db_xref="GeneID:8204579"
                     /db_xref="GOA:C5E428"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5E428"
                     /translation="MATNVIDFEVVPGDARLVEGEEREVVLLPKPSKDPEDPLNWSRP
                     RKWLATACVIVVTIGIGIPSAAIYSVLPNIAEERNLSLADLNQGTGYLFLFYGLGCLV
                     FQPLALQYGKRPVYLFSMLATSLICVWPPYTRSNGEWIASKILQGLFGSCVESLPEIS
                     MSDLFFEHERSLGLSLYALTLMGVSYSAPLVAGFISAGQGWQWVMWWCSILAAVCFVI
                     LFFAMEETSYTRRVQDEASLDPEIDGEEVHESNVENGEVENDKAEKAKDDLVKIRSDY
                     SAHSLSEGSISWPQTSYMQKISLTRGFKSKFMLHYYMFMPFRMAQFPVILWAGFLYGS
                     SLVWFNVLNATEAMVLAGKPYNFSSSMCGLAYVSPLVCTFIVFPIAGFCSDKLKVYFA
                     RKRNGFSIPEDRLWLLFVYAILGCAASLLWGIGAYYQIHWFPLVLALGILGGCGVFGP
                     VSSAAYVVDTYRELDAEAMVVVILIRNLMSFACSYGITHWVENLGYKRCFIGVAFCCL
                     ATNSSFLVMIFTGPWWRKKQRHAYWSLVQRCRSLGMH"
     gene            <175207..>176652
                     /locus_tag="ZYRO0E02310g"
                     /db_xref="GeneID:8204580"
     mRNA            <175207..>176652
                     /locus_tag="ZYRO0E02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499000.1"
                     /db_xref="GeneID:8204580"
     CDS             175207..176652
                     /locus_tag="ZYRO0E02310g"
                     /note="similar to uniprot|P38682 Saccharomyces cerevisiae
                     YER122C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499045.1"
                     /db_xref="GeneID:8204580"
                     /db_xref="GOA:C5E429"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:C5E429"
                     /translation="MSAEEGELVASKEVTQQVFQRLASKLENRVCFDCGNKNPTWTSV
                     SFGVMLCIQCSATHRNLGVHITFVKSSSLDKWTVDNLRRFKVGGNHRARDYFMKNNGK
                     HLLSTSNVDARAKYTSAVAKNYKKHLDHKVTKDIEQNPDGIVVDEETGNDSSNSSRTG
                     SKEGSVDDFFANWQKPQASNGSIASRGSSAAPSPKPSTSSSFTNGSADKSKSSILSGS
                     RKKPSVSNTSSQANGAKKHSILASSRKPTRLAANKVDKSEANDLFDQFEKEAEQEKVE
                     KKSKDFGSSRKPRTSYKSSSAFDDDKDYNADQASAFGKQSKKDDFFDDDEFDEPATQT
                     GPVEELQPKFAKLGFGMTMNDADQLAKKQKETRVAAAGPKYTGKIAARYGGQKAISSD
                     QLFGRGSYDEEASREARDKLKTFDNATSISSSSYFGEEQEDEENLMEAQANNGFIDFN
                     LGEDDDMQMLKNAIEQGAQKLGSYLRDFQRR"
     gene            complement(<176775..>177383)
                     /locus_tag="ZYRO0E02332g"
                     /db_xref="GeneID:8204581"
     mRNA            complement(<176775..>177383)
                     /locus_tag="ZYRO0E02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499001.1"
                     /db_xref="GeneID:8204581"
     CDS             complement(176775..177383)
                     /locus_tag="ZYRO0E02332g"
                     /note="similar to uniprot|P25046 Saccharomyces cerevisiae
                     YBL093C ROX3 RNA polymerase II holoenzyme component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499046.1"
                     /db_xref="GeneID:8204581"
                     /db_xref="GOA:C5E430"
                     /db_xref="InterPro:IPR013942"
                     /db_xref="UniProtKB/TrEMBL:C5E430"
                     /translation="MTTVNEQILPPYYYYVDPDTTYQTQRPNPLDDLISVYGLQDLSH
                     QVARTNQDGTRAIKLRKSYKNQIQDLSGKFATIPTRENGKGGEISHILFQNNPDMIPQ
                     VRREPGMTDEQYNAAVADRDRALFESPNMDWDVCKAVLSQFERSYPSEFQGQGFQVDD
                     LAFDLDGTGKINQKKRKVKSNGSSMATPNSDMQEDVKRRRLD"
     gene            <178826..>180592
                     /locus_tag="ZYRO0E02354g"
                     /db_xref="GeneID:8204582"
     mRNA            <178826..>180592
                     /locus_tag="ZYRO0E02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499002.1"
                     /db_xref="GeneID:8204582"
     CDS             178826..180592
                     /locus_tag="ZYRO0E02354g"
                     /note="similar to uniprot|P40077 Saccharomyces cerevisiae
                     YER124C DSE1 Daughter cell-specific protein may
                     participate in pathways regulating cell wall metabolism
                     deletion affects cell separation after division and
                     sensitivity to drugs targeted against the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499047.1"
                     /db_xref="GeneID:8204582"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E431"
                     /translation="MNERPRSINIFYFQCAYIIVQLMETNYYQPVKVFRQPAMIVKTR
                     DASRRKSGEHHAKSWLHDTSRIGSPLLKKVSEEFNDHYTTRKLKSEYWKVNHDNNSTS
                     LPTDLSVVRDTLLVSNMNERDNLKLFNISQDRHGEPTKLYELQSISVPGKPITSACLL
                     SPLEYPAEYVEGHDQLLLTGHQDGIVNLISTSRENGNAKIVRRYNHGKYLSRNMPATL
                     DNWLQSYASLPIRRLKPWAGSGFASIINDSLFIYELNRPKSPQYLQSFPGLESFAIND
                     FRNPYLMALCGSQFGDSGIALLDLRSDRRGGNLYIPDGNKNANSSSSLRTPMHSHVSR
                     DCIWIDEFHVVNCFNDVARIWDIRSTDGENQCEIMPMKGCIESLTYHEPTKTLYTGDD
                     QGYVVSWDLHRLSGIKKCIPSQGFNSILLESVEQETLHEINQCGSIVVNGGQKKFTES
                     TDRVHGSLLMDTLGNGSLATVDSQELGLHKICQVECPLQNVKHDNSSKEYNFGPIYHY
                     EGEKTQGESDSTLMSSEVSSISSSPSSVGLEGSSSFTLSSESEHEPLEYNKQYMLQSH
                     DPNGSNFTLEGPISRVSTSEIL"
     gene            complement(<181177..>182817)
                     /locus_tag="ZYRO0E02376g"
                     /db_xref="GeneID:8204583"
     mRNA            complement(<181177..>182817)
                     /locus_tag="ZYRO0E02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499003.1"
                     /db_xref="GeneID:8204583"
     CDS             complement(181177..182817)
                     /locus_tag="ZYRO0E02376g"
                     /note="some similarities with uniprot|P39962 Saccharomyces
                     cerevisiae YER123W YCK3 plasma membrane-bound casein
                     kinase I homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499048.1"
                     /db_xref="GeneID:8204583"
                     /db_xref="GOA:C5E432"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E432"
                     /translation="MSRSSQHVVGIHYAVGAKIGEGSFGVIFEGENILNSGSSGREDD
                     FGRRPSAPVAIKFEPRRSDAPQLRDEFRAYRILNNCRGIPHAYYFGQEGMHNVLILDL
                     LGPSLEDLFEWCGRKFSIKTTCLVAKQMIDRVRIIHEHDLIYRDIKPDNFLISEFQRT
                     LPDRQIVKDVALSAGGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARYMSI
                     NTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKALNNKLKYEKIGLTKQKLNPDEL
                     LMDFIPAQFGAYLKYARSLRFEEEPDYDYLISLMDDTLHCMGMEDDGHYDWMDLNDGQ
                     GWNIKVNKRANLHGYGNAVPRHDHQQNVNNNNANANANANANVNANENSNLNLAQGNS
                     PYVNNTNGNGNLVGNNNNLQNSNAAMAASLGNTPKSRPHSSHRNSLTYAKQKLKLANS
                     SPIAGVNPTSQPPNRNRTYDSMGSHALKSQTNGMYNDYRGGGGMRVDDPNAMYYHRQM
                     LQRQQRAQQHQQLIQRSQEDEGLYEDAGFCSRVCCGWC"
     gene            <183200..>184300
                     /locus_tag="ZYRO0E02398g"
                     /db_xref="GeneID:8204584"
     mRNA            <183200..>184300
                     /locus_tag="ZYRO0E02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499004.1"
                     /db_xref="GeneID:8204584"
     CDS             183200..184300
                     /locus_tag="ZYRO0E02398g"
                     /note="similar to gnl|GLV|KLLA0E13541g Kluyveromyces
                     lactis KLLA0E13541g and some similarites with YPR023C
                     uniprot|Q12432 Saccharomyces cerevisiae YPR023C EAF3
                     Esa1p-associated factor nonessential component of the NuA4
                     acetyltransferase complex homologous to Drosophila dosage
                     compensation protein MSL3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499049.1"
                     /db_xref="GeneID:8204584"
                     /db_xref="GOA:C5E433"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR008676"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="InterPro:IPR026541"
                     /db_xref="UniProtKB/TrEMBL:C5E433"
                     /translation="MLEVGGKCLAYHGPMLYEAKVLRIWNPTTQSVSVVQDGQEVSVS
                     MKKDKEELSEDTKALGGVPESLAGQECYFVHYQGWKSTWDEWIGLDRIREYNDENLGL
                     KKRLIEEAKEAKKQQQEQKKRKENVLKRGRPSETGTVPRTSSSGRSSSNPGENGNTTT
                     SGNNGTSSTKQGSHGPTTAGTVPLPQGSAPKITLHIPVKLKSLLVDDWEYVTKDKKVC
                     KIPSPVLTVQQLLEEYEASASNELESPAQQSQLSEYCMGLRLYFERSLPLLLLYRLER
                     LQYEELLQKEKYANTSVLHLYGPIHLLRLLSILPDLMATTTMDGQSCQLIVRRTEHLF
                     EWIVTNMERLFNGKEETYVNTSSQYEGVALGL"
     gene            <184575..>187247
                     /locus_tag="ZYRO0E02420g"
                     /db_xref="GeneID:8204585"
     mRNA            <184575..>187247
                     /locus_tag="ZYRO0E02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499005.1"
                     /db_xref="GeneID:8204585"
     CDS             184575..187247
                     /locus_tag="ZYRO0E02420g"
                     /note="similar to uniprot|Q12482 Saccharomyces cerevisiae
                     YPR021C AGC1 Mitochondrial transporter acts both as a
                     glutamate uniporter and as an aspartate-glutamate
                     exchanger involved in nitrogen metabolism ornithine
                     synthesis and the malate-aspartate NADH shuttle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499050.1"
                     /db_xref="GeneID:8204585"
                     /db_xref="GOA:C5E434"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E434"
                     /translation="MEQVNSFSEKKLQQVEIFQKFATDLATEQGKGTSGQLILTYNDF
                     INLISSSKTLYSKFTDHSFNLNQIPPNAFGCIFFALDETNKGYLNINDWFHFNNLLEY
                     DNYHLIILYEFFRKFDVERIRANRRQQLQDAVKQSNVKPGMAADDARVKSINYGSKFL
                     SFDDLLLNLTQFKSTIKLLHSCSKDEFALTNDLFLDWDKFKFLKFYECYPYSFEEGPF
                     LSLNSIVTILQNDLKNEKLYVGFSKLAHMDPIKKCLALNKNQLVYLLKLFYSHRISTD
                     VFESLNLTNTDLIKSNNNAIAFNVFKDLFYLFQNFDLLNQALIRYATVNDFTERDLRE
                     RPITKMDLLQILNTQYNKVNNIIEFSPSQINLLFSIVANSKENNTRKKLQMHHEDSQI
                     DNFIHNEYVHGISGRRKQLETFNDTYQELVEGFHQSAVVHNSLSTKPTSFFDFFIPRS
                     DLASFWYNLTTEDFMKILNPNYLNDVVHQMELRRIQKDSLYTNYYFYPIFDSIYNFSL
                     GSVAGCIGATAVYPIDLVKTRMQAQRSLSQYTNSFDCFSKVLSRDGVKGLYSGLGPQL
                     LGVAPEKAIKLTVNDLMRKTLSDKKGKITLTSEVLAGASAGACQVIFTNPLEVVKIRL
                     QVKSEYALENLAQSEMTAFSIVRKLGFSGLYKGLTACLLRDVPFSAIYFPTYSHVKRD
                     VFNFDPQSNTGRSRLKTWELLFSGALAGMPAAFLTTPCDVVKTRLQIAPRKGEMKYHG
                     IKDAIKTILKEESFKSFFKGGGARVLRSSPQFGFTLAAYEMFKDLVPKPNKTFRSPTH
                     DFDEEIPTVANSFTSFFRKLKSSSQPITVEDSYQTDFFSPTVDPYSSNYLNYYYKSCQ
                     VAKLFIDLDNNFSHFNYDVYTKFQDSLKSIASGK"
     gene            complement(<187334..>188347)
                     /locus_tag="ZYRO0E02442g"
                     /db_xref="GeneID:8204586"
     mRNA            complement(<187334..>188347)
                     /locus_tag="ZYRO0E02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499006.1"
                     /db_xref="GeneID:8204586"
     CDS             complement(187334..188347)
                     /locus_tag="ZYRO0E02442g"
                     /note="similar to uniprot|P46946 Saccharomyces cerevisiae
                     YGL175C SAE2 Protein with a role in accurate meiotic and
                     mitotic double-strand break repair phosphorylated in
                     response to DNA damage and required for normal resistance
                     to DNA-damaging agents"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499051.1"
                     /db_xref="GeneID:8204586"
                     /db_xref="UniProtKB/TrEMBL:C5E435"
                     /translation="MQLQSNLAVLLEFDLNRLLAVQSDVTLLISRRVRELLDRSKELV
                     DEHSTINDKDEDKGDTSIGIVGGDRSNHQVDDGDDSDDFILTQLGEHTGEKIWTHENE
                     DLVTLRAELPKADISSPLKESQSLPDSYNHMKNDSRELDVQVEEDELPSANNNSRKEL
                     SQVTKKLCVRFPDNKPVVPRTNFNINPYTGKPWILEDFKRNEDINSVKKRQQNMKAQK
                     IYAEGFPPPEAGRQSLIDKEISKGVENNFYEFENLRDRSHSPPGFGRLDFPNTQERFD
                     DKQKSQNIIFHKTKWRFRKATCNAVPPYEREFLFKNDKLNEIVDDGTFEWNDAELQIY
                     TRK"
     gene            <188500..>189342
                     /locus_tag="ZYRO0E02464g"
                     /db_xref="GeneID:8204587"
     mRNA            <188500..>189342
                     /locus_tag="ZYRO0E02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499007.1"
                     /db_xref="GeneID:8204587"
     CDS             188500..189342
                     /locus_tag="ZYRO0E02464g"
                     /note="weakly similar to uniprot|P46947 Saccharomyces
                     cerevisiae YGL174W BUD13 Protein involved in bud-site
                     selection diploid mutants display a unipolar budding
                     pattern instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499052.1"
                     /db_xref="GeneID:8204587"
                     /db_xref="InterPro:IPR018609"
                     /db_xref="UniProtKB/TrEMBL:C5E436"
                     /translation="MSLNNYLNDLYGTGSDKSKKKKKSSDKKVKQDSGSQLNITESSQ
                     RRFTKNASTFNATKDKTSKPKTLWKNLDTNEVIDRKSSREDHGDVGQVNNKAKLSSGA
                     HAGLQTAEQMDSQITQKELDQRRQIQKSQKSQETVFRDEKGNKIANYEEILNKEEKEK
                     DLREVVRQRRIRELNMGEVQLFMVQNGLTRIPKERTKEQSESFDDPARTFGISSHNHK
                     EPVSLMGRKLYANVYPENRFGISPGCRWDGVDRSNGFERKWFAKQNELNEKKQQEYAL
                     REDY"
     gene            complement(<189383..>193963)
                     /locus_tag="ZYRO0E02486g"
                     /db_xref="GeneID:8204588"
     mRNA            complement(<189383..>193963)
                     /locus_tag="ZYRO0E02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499008.1"
                     /db_xref="GeneID:8204588"
     CDS             complement(189383..193963)
                     /locus_tag="ZYRO0E02486g"
                     /note="similar to uniprot|P22147 Saccharomyces cerevisiae
                     YGL173C KEM1 5'-3' exonuclease involved in mRNA decay
                     evolutionarily conserved component of cytoplasmic
                     processing (P) bodies plays a role in microtubule-mediated
                     processes filamentous growth and ribosomal RNA maturation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499053.1"
                     /db_xref="GeneID:8204588"
                     /db_xref="GOA:C5E437"
                     /db_xref="InterPro:IPR004859"
                     /db_xref="InterPro:IPR016494"
                     /db_xref="InterPro:IPR027073"
                     /db_xref="UniProtKB/TrEMBL:C5E437"
                     /translation="MGIPKFFKYIAERWPMILQLIEGQHIPEFDNLYLDMNSILHTCT
                     HGNDDDVTKRLTEEEVFGKIFVYIDHLFHTIKPKKVFYMAIDGVAPRAKMNQQRARRF
                     RTAMDAEKALKKAIENGEEIPKGEPFDSNSITPGTEFMAKLTKNLQYFIHDKITNDSS
                     WRDVKIIFSGHEVPGEGEHKIMDFIRNIRGQGDYNPNTRHCIYGLDADLIMLGLSVHA
                     PHFALLREEVVFGKRGKKSTALEHQNFYLLHISLLREYMELEFEEIADELQFEYDFER
                     ILDDFILIMFVIGNDFLPNLPDLHLNKEAFPLLMKTFKEALLHADGYINYNGQINLKT
                     LRLWLHYLSQFELMIFEKNDIDVQWFHQRLENISLEGADQRERSGKKLLVKQQKKIAG
                     YVKPWILDVAAKRYSADIPEEQIPTLKLTDEETKENLDFLKQFAFDLGLFVAHSKSDD
                     RYSLKLDVDAINPQESEEEHEERQRTIRRTLKKYQQAILVEDKEELDKEKETYNARFE
                     DWKDRYYKEKLGFSIHDTEKLTDITENYVEGLQWVLYYYYRGCASWGWYYHYHYAPRI
                     SDLQLGLDQILEFEKGIPFTPFQQLMAVLPERSKNLIPAPFRPLMYDEKSPIIDFYPA
                     EVDTDKNGKTADWEAVVLISFVDEKRLQDAMAPLMSKLTPDEKARNTAGTDLIYSFNP
                     QVDDIYKSPLKGLFSDIEHNHCVEREFNPPKVEESQFRYGLLPNAKTGINLLAGFPTL
                     KTLPFTFELLLNETRIFTSPSKRESMVLHMKDIYSENNLSLDVLAKRYMDKVVYTRWP
                     YLMESKLVSISDGENIFESSNSGSGKNSKFINRPLDEGEKRLFRTMAAKLKNEYQSAK
                     AVDVGDVSVIVKVLPGADLVRDARGAYRKSFQNEPKYYPLQLMVETVANEDERYKEKD
                     PVPIDQEFPQGSQVIFLGDYAYGGETTIDGYSNATRLKLTVKKMSMRSEPAIGKERYK
                     IDTALVKYFPSYIVSKRLQLHPLFLSRITSRFMISDQAGKNVNVGITVKFEARHQKVL
                     GYARRNPKGWEYSNLALDLINEYRKLFPKFFNKLATIQGSNMPSIDQLFPELSSEQCA
                     KLLQDVTAWLKSVTEKFVNVSLESDSLTKVSMQAVEDYIEKYSSYLDQTEKKQLAKVP
                     CEAVLDPKSSYALLRSQRFELGDRVVYIQDSGKVPLFSKGTVVGYTTLGMSLSIQVLF
                     DNEIVAGNNFGGRLRTNRGLGLDASFLLNLTNRQFVYHSKASKQVSKKPVSNAAPKQH
                     VVDIKRKRAHDLLSHIKKNDKETEEKSDPVKAAGEKQGKSPEEQGPNFAFVKGANPTL
                     NPDPASMIYNAVLNQYVPNNANFGASGGPKASGIPYQAQPGYPPPPPFVHMPPPPMGM
                     PMPPPYGGPMPPPHMGGFVPPPIPDVAFQGLKIEEKETDGLKQMLQAGASDKPNNGKS
                     ANAKLHQGGKPHGGKPHNGKPNGDKPFGSKTGSNGKPTGNGKPGGGNWNKDKDGSSKP
                     HFSKGNPNGNRKFSRGGKSKSKPRTPVGEVST"
     gene            <195237..>196880
                     /locus_tag="ZYRO0E02508g"
                     /db_xref="GeneID:8204589"
     mRNA            <195237..>196880
                     /locus_tag="ZYRO0E02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499009.1"
                     /db_xref="GeneID:8204589"
     CDS             195237..196880
                     /locus_tag="ZYRO0E02508g"
                     /note="some similarities with uniprot|Q02199 Saccharomyces
                     cerevisiae YGL172W NUP49 Subunit of the
                     Nsp1p-Nup57p-Nup49p-Nic96p subcomplex of the nuclear pore
                     complex (NPC) required for nuclear export of ribosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499054.1"
                     /db_xref="GeneID:8204589"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:C5E438"
                     /translation="MFNFGKPASAGSSASGGLFGQNNNTGNTGLGGGFSFGQPNNNTA
                     SGGNTGGGFSFGNQNQGSTTGGGLFGAKPADSGTTGTGFSFGKPAQPNTGGGGLLGGS
                     SGANNTGSGGLFGNTNNSGGGLFGNTNTNNTGGGGLFGNTSSNNNTTGGGLFGGANTN
                     NNNNNTNTGGGSLFGNTNNSTNTGGGGLFGNTNNSTNTNTGSGGLFGSTNTNTGGGGL
                     FGNTSNNNSSTGTGGGLFGSKPAGTSLFGNTNNNSSTTGGGLFGSNAGGSAGGGSSLF
                     GNPSNTSNTNTMGGGLFGSKPAGSSLFGNNPSNAGSGGLFGTQQQQQAPPQAAINSIS
                     QLPITTMTRIIDLPPQLRQEIEQLDQYVQRQVQISQHLKADTEEHMELIGSVPRDIAY
                     LLKFESLANQSLAQDLRKLTSIKEITDANLTDTQTFAIILQQLLTPGSKISSMELDKF
                     FHHKLQSYQSKLDEYFRVLSDIESAVNGIDSDVFGSKADGFQGGTSNDSLDVFAVKTG
                     LNALVSTVVEEFQLFMDTAERIAELHQKMKEVTADRLLV"
     gene            <197126..>198796
                     /locus_tag="ZYRO0E02530g"
                     /db_xref="GeneID:8204590"
     mRNA            <197126..>198796
                     /locus_tag="ZYRO0E02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499010.1"
                     /db_xref="GeneID:8204590"
     CDS             197126..198796
                     /locus_tag="ZYRO0E02530g"
                     /note="highly similar to uniprot|P45818 Saccharomyces
                     cerevisiae YGL171W ROK1 ATP-dependent RNA helicase of the
                     DEAD box family required for 18S rRNA synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499055.1"
                     /db_xref="GeneID:8204590"
                     /db_xref="GOA:C5E439"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E439"
                     /translation="MDIFRVLTRGASLRKGQKGSAKSADFSMADDTAKKDKKLDDVHI
                     TKELDFFHNKRIMKNVENAKKEEKPEESGDESNEDEVIDTIQPRITNEEEAKALRKSY
                     KGNISGNDLIFPIGSFEDLISRFSFDKRLLNNLIDNDFTEPTPIQCEGIPLALHGRDL
                     LSCAPTGSGKTLAFLIPLLQQIIDSKDVQGLKGLIISPTKELASQTFVECVKLSRKIF
                     LDKKRPLQVAILSKSLSAKLRNKVVSDKKYDIIISTPLRLIDLVKNEALDLSNVRHLV
                     FDEADKLFDKTFVEQTDDILSACSDPRLRKSMFSATIPSNVEEIAQSIMTDPVRVIIG
                     HKEGANANIDQRLVYCGNEEGKLIAIRRMVQEGEFKPPVIIFLESITRAKALYHELMY
                     DGLNVDVLHAERTQMQRDKIIERFKTGDLWCLICTDVLARGIDFKGINLVVNYDVPQT
                     AQAYVHRIGRTGRNNRQGKAVTYYTRQDSLAIKPIINVMRQSGCEVAEWMDKISKLSK
                     REKESLRKGKSRVDRNPISTVPKVDKLKRKRRQSMIGASKRRKQQSED"
     gene            complement(<198939..>199298)
                     /locus_tag="ZYRO0E02552g"
                     /db_xref="GeneID:8204591"
     mRNA            complement(<198939..>199298)
                     /locus_tag="ZYRO0E02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499011.1"
                     /db_xref="GeneID:8204591"
     CDS             complement(198939..199298)
                     /locus_tag="ZYRO0E02552g"
                     /note="similar to uniprot|Q12233 Saccharomyces cerevisiae
                     YPR020W ATP20 Subunit g of the mitochondrial F1F0 ATP
                     synthase which is a large enzyme complex required for ATP
                     synthesis associated only with the dimeric form of ATP
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499056.1"
                     /db_xref="GeneID:8204591"
                     /db_xref="GOA:C5E440"
                     /db_xref="InterPro:IPR006808"
                     /db_xref="UniProtKB/TrEMBL:C5E440"
                     /translation="MLGRIQSVTTGLLSKSTLLATKTIYYGKVGAELSKQIYLREKLQ
                     PPSIDEFKRAYIGLYQRGFYYASRPKDIVNLVKAFKKDDYIKYTAFFVQLLGFYSVGE
                     IIGRRKLVGYKDYNNHH"
     gene            complement(<199677..>202463)
                     /locus_tag="ZYRO0E02574g"
                     /db_xref="GeneID:8204592"
     mRNA            complement(<199677..>202463)
                     /locus_tag="ZYRO0E02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499012.1"
                     /db_xref="GeneID:8204592"
     CDS             complement(199677..202463)
                     /locus_tag="ZYRO0E02574g"
                     /note="highly similar to uniprot|P30665 Saccharomyces
                     cerevisiae YPR019W CDC54 Essential helicase component of
                     heterohexameric MCM2-7 complexes which bind
                     pre-replication complexes on DNA and melt the DNA prior to
                     replication accumulates in the nucleus in G1 homolog of S.
                     pombe Cdc21p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499057.1"
                     /db_xref="GeneID:8204592"
                     /db_xref="GOA:C5E441"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR004039"
                     /db_xref="InterPro:IPR008047"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5E441"
                     /translation="MSDQPSSPAHHSDQIPPESSSPAPNPASEIGRPSSPAQPSSPAL
                     FYHTSSSAQDTFGQDGSQSQNGRVGAAMGSSPFKYPSSQNQSSDNYPSQARNDPRITS
                     TYSNRSDRLMPASTSSQGSRHGHRAMMRRNDIHASDLSSPRRFIEFDHPSHMSTSSSS
                     SAPPSEAGGEPLRIIWGTNVSIQECANNFRNFLMSFQYKYRKALDGREQFIDDTTDEE
                     SYYVRQLTEMRELGTTNLNLDARNLLAYKPTEELYHQLLNYPQEVISIMDQTIKDCMV
                     SLVVDNNIDYDLDDIETKLYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRCTAVI
                     PDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERVDCNEPNSMSLIHNRCSFADKQVI
                     KLQETPDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEATGTFRSIPMRVNPRQRVLKS
                     LYKTYVDVVHIKKVSDKRLGVDTSTVEQELLQNKMNHSEVEETRRVTDQDIAKIREVA
                     QREDLYEVLARSIAPSIFELDDVKKGILLQLFGGANKTFAKGGRYRGDINVLLCGDPS
                     TSKSQILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVC
                     CIDEFDKMSDSTRSVLHEVMEQQTISVAKAGIITTLNARASILASANPIGSRYNPNLP
                     VTENIDLPPPLLSRFDLVYLVLDKVDENMDRELAKHLTSLYLEDRPQNASNDDVLSIE
                     FLTMYINYAKENINPTITKDAKTELVRAYVGMRKIGDDSRSDEKRITATTRQLESMIR
                     LAEAHAKMRLSNAVEIDDVQEAIRLIRSAIKDYATDPKTGKIDMQLVQTGKSVIQRKL
                     QEDLAREVLRVLGDYSSDSMTFNELSRQINEHSQDRVDSSEISEALSRLQQEDKLIVL
                     GEGVRKSIRLNSRV"
     gene            complement(<202673..>204409)
                     /locus_tag="ZYRO0E02596g"
                     /db_xref="GeneID:8204593"
     mRNA            complement(<202673..>204409)
                     /locus_tag="ZYRO0E02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499013.1"
                     /db_xref="GeneID:8204593"
     CDS             complement(202673..204409)
                     /locus_tag="ZYRO0E02596g"
                     /note="some similarities with uniprot|Q12495 Saccharomyces
                     cerevisiae YPR018W RLF2 Chromatin Assembly Complex subunit
                     1: largest (p90) subunit of three-subunit protein complex
                     (yeast CAF-I) involved in DNA-replication-linked
                     nucleosome assembly. Homol. to p150 subunit human
                     Chromatin Assembly Factor-I (CAF-I) p90 subunit of yeast
                     Chromatin Assembly Factor-I (CAF-I)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499058.1"
                     /db_xref="GeneID:8204593"
                     /db_xref="InterPro:IPR022043"
                     /db_xref="UniProtKB/TrEMBL:C5E442"
                     /translation="MTTPGSVEDSSSNNPAGKQGILSFFQNIKTKEEEEVIEVVDSDD
                     EKRTVAKQEPESKPQSQLEVEKEEQDKDVNVKDEPSNTMKQLKEVVVFPESTTEEKRK
                     QKAEQSQKREDMKRQKDADKQRREELKRQKDADKQRREEEKLKKEDEKKLKKENEKKA
                     KEEERLKKEEEKKLKKESEKKAKEEEKMKKENEKKAKEEAKERSQARIGNFFKKVTDS
                     NKPTNVRSDYEKFFLPFYSKEGVVVSRSGQLSSAEINENRTRIDSLLNQREDDNQVLE
                     WLDSGQNSVKTSLPIAYQAVSLLQQMTSKEKSDQELQSLLSLIPHKYIKFYENVRPPY
                     MGTYSKDIILPVDNPFSTRDTGYNYDYDSDLEWVNEEEEEVEGGVENLESGEEDEDDD
                     EEEASEGEFDGFLDAEDNGDQSGSGKKRFIGPLIPTVCLRKNQDQMEEDDKQYFNMVA
                     VQCLIEEQPFPIEPNQYVKPQVENVKKISTDSQPQDASSPSVSPEKKSKSLISEPKDL
                     LKLFDEIQDSTFSLGTVTEIAQKNLPLYSKQMIKNTVKEYAVKTTWGTSRKWAIKDPQ
                     HWEKLRSACNNN"
     gene            complement(<204601..>205905)
                     /locus_tag="ZYRO0E02618g"
                     /db_xref="GeneID:8204594"
     mRNA            complement(<204601..>205905)
                     /locus_tag="ZYRO0E02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499014.1"
                     /db_xref="GeneID:8204594"
     CDS             complement(204601..205905)
                     /locus_tag="ZYRO0E02618g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499059.1"
                     /db_xref="GeneID:8204594"
                     /db_xref="UniProtKB/TrEMBL:C5E443"
                     /translation="MISAAERKLNTNSTHLHIHTYTQESKRTMQSTRTTLNDDDVKEM
                     EQKLDEVSISDSSRSSSNEEELCKVKNENYHLKLAIGEKNDEILRLHHMLHKEAYLEN
                     LHKVLPSLQNGPLLYPASSSSQGEQQDGEPSIIDSEVATHISASPYKGNRARSTRTES
                     SLATTTISRSKKRSKILEEHLIPFLQRSIQTFHASSIFQKESVELRELWQFFEENNGE
                     DETLLVNVLENLTYLQQQSTTLLNRELHFKKLSQRLEYLFTVFLNPKEYDMAPQEHIE
                     KLKNDLLNILIKLFDRIPANQENNRELSRKEIRAQKIADLEKGIDLCTEAMNNAYGSS
                     KTAAESEKHSDNEEHMPDLSHFSNQEKQRLKKNRTSLEFIPIGYDENMLNTRTPQRPL
                     KHKKQDLDVTPVAQFRKDENDPLQKFFQEQDGYSVRSLSARR"
     gene            complement(205928..206000)
                     /locus_tag="ZYRO0E02640r"
                     /db_xref="GeneID:8204595"
     tRNA            complement(205928..206000)
                     /locus_tag="ZYRO0E02640r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (CAC) cove score=75.70"
                     /db_xref="GeneID:8204595"
     gene            <206336..>207073
                     /locus_tag="ZYRO0E02662g"
                     /db_xref="GeneID:8204596"
     mRNA            <206336..>207073
                     /locus_tag="ZYRO0E02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499015.1"
                     /db_xref="GeneID:8204596"
     CDS             206336..207073
                     /locus_tag="ZYRO0E02662g"
                     /note="highly similar to uniprot|Q12522 Saccharomyces
                     cerevisiae YPR016c TIF6 translation initiation factor 6
                     (eIF6) singleton"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499060.1"
                     /db_xref="GeneID:8204596"
                     /db_xref="GOA:C5E444"
                     /db_xref="InterPro:IPR002769"
                     /db_xref="UniProtKB/TrEMBL:C5E444"
                     /translation="MAARAQFENSNEIGVFSKLTNSYCLVAVGGSENFYSAFEAELGD
                     SIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELIGDVLGVEVFRQTISGNILVGSYCALSNQGGL
                     VHPQTSVQDQDELSSLLQVPLVAGTVNRGSNVVGAGIVVNDYLAVTGLDTTAPELSVI
                     ESIFRLHDAQPESIQGNLRDTLIETYS"
     gene            <208420..>208821
                     /locus_tag="ZYRO0E02684g"
                     /db_xref="GeneID:8204597"
     mRNA            <208420..>208821
                     /locus_tag="ZYRO0E02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499016.1"
                     /db_xref="GeneID:8204597"
     CDS             208420..208821
                     /locus_tag="ZYRO0E02684g"
                     /note="weakly similar to uniprot|Q6Q5F4 Saccharomyces
                     cerevisiae YPR015C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499061.1"
                     /db_xref="GeneID:8204597"
                     /db_xref="GOA:C5E445"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5E445"
                     /translation="MAVKVEMSSSQREIPQQVRLPPISMLVPATYVQEQLYLPPLAAQ
                     QQQQQQKQDVKDGLNPVIRLRKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQ
                     KSFNVKSNMLRHLKSHERRLAKQTSQTNQRF"
     gene            complement(209886..209971)
                     /locus_tag="ZYRO0E02706r"
                     /db_xref="GeneID:8204598"
     tRNA            complement(join(209886..209921,209933..209971))
                     /locus_tag="ZYRO0E02706r"
                     /product="tRNA-Tyr"
                     /note="tRNA-Tyr (GTA) cove"
                     /db_xref="GeneID:8204598"
     gene            <210318..>211271
                     /locus_tag="ZYRO0E02728g"
                     /db_xref="GeneID:8204599"
     mRNA            <210318..>211271
                     /locus_tag="ZYRO0E02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499017.1"
                     /db_xref="GeneID:8204599"
     CDS             210318..211271
                     /locus_tag="ZYRO0E02728g"
                     /note="similar to uniprot|Q12251 Saccharomyces cerevisiae
                     YPR011C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499062.1"
                     /db_xref="GeneID:8204599"
                     /db_xref="GOA:C5E446"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E446"
                     /translation="MADVVVALEQPSRIKKGLQNDASVAFLAGGLAGAVSRTVVSPFE
                     RVKILLQVQSSSESYSGGVSSAVKQLYKEEGVKGLFRGNGLNCIRVFPYSAVQFLVYE
                     GSKNFIFHVDGVNGNGRLTTFQRLFSGALCGGASVMATYPLDLVRTRLAIQTANLRKL
                     QKAKATSMAKPPGVWQLLRNTYLQEGGIKGLYRGVWPTSLGVVPYVALNFCVYEQLRE
                     LVPSQSAYMLAIGALSGGIAQTATYPFDLLRRRFQVLAMGQSELGFHYSGVADALITI
                     GKTEGLRGYYRGLQANLFKVIPSTAVSWLVYELTRDFIKAL"
     gene            <211486..>211787
                     /locus_tag="ZYRO0E02750g"
                     /db_xref="GeneID:8204600"
     mRNA            join(<211486..211518,211605..>211787)
                     /locus_tag="ZYRO0E02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499018.1"
                     /db_xref="GeneID:8204600"
     CDS             join(211486..211518,211605..211787)
                     /locus_tag="ZYRO0E02750g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499063.1"
                     /db_xref="GeneID:8204600"
                     /db_xref="UniProtKB/TrEMBL:C5E447"
                     /translation="MRPTQLLLNQAKKSSSVVPLELTPLFIAMGAAVASASYFTYKKF
                     AHDRSLRITKNPELSEVQKAIDSEKSQ"
     gene            complement(<212005..>213804)
                     /locus_tag="ZYRO0E02772g"
                     /db_xref="GeneID:8204601"
     mRNA            complement(<212005..>213804)
                     /locus_tag="ZYRO0E02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499019.1"
                     /db_xref="GeneID:8204601"
     CDS             complement(212005..213804)
                     /locus_tag="ZYRO0E02772g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499064.1"
                     /db_xref="GeneID:8204601"
                     /db_xref="GOA:C5E448"
                     /db_xref="InterPro:IPR006042"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="UniProtKB/TrEMBL:C5E448"
                     /translation="MSSPRMDSALEEGQKTPSEQIKTTLFWLRWKFTTKEGLLGDYDY
                     KYLFTPTYPFKNFIDRRRGIEPVVYDQPFFGLNEEVPVLLGLILGLQHALAMLAGVIT
                     PPMIIGGIANLDGVHVNYLVSASLITSGILSAVQITRFRIPKTPFHVGSGVLSIVGTS
                     FSVIGIVSKSVPLMYKTGYCPGGANSKEPCPDGYGALLGTAACCALLEILLSFMPPDI
                     LQRIFPKQVTGPVVLTIAVPLIQTGFQDWVGGSGCVGEICPSKGAPQAAPWGSAKFIG
                     LGFLVYVTIILCEKYGPPILKSCAVIVGLLVGCIVAAACGYFQHDMIDQSPAATFLWK
                     HTFKLRVYGPAVLPFLVLFIVLTQETIGDITATSDVSRLEVEGKAFESRIQGAVLSDG
                     LGGILSSLFTVTPMSTFAQNNGVISLTKCASRQVGYWTCFYMLVMGIFAKFGAAIVQI
                     PKPVLGGMTTFLFTTVAVAGIAIISQIPFTRRDRFILTGALLPGFAAILVPNWFDYVF
                     TYEGDNNALKGFLNAIVLIMETSFTICGIVAIILNLLIPQELDEELYDDIEVQQENLS
                     VLEGRKSPTFKPVMSGKEVEAFELTSEQRTSEP"
     gene            214242..214314
                     /locus_tag="ZYRO0E02794r"
                     /db_xref="GeneID:8204602"
     tRNA            214242..214314
                     /locus_tag="ZYRO0E02794r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8204602"
     gene            complement(215111..215183)
                     /locus_tag="ZYRO0E02816r"
                     /db_xref="GeneID:8204603"
     tRNA            complement(215111..215183)
                     /locus_tag="ZYRO0E02816r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8204603"
     gene            <215374..>218964
                     /locus_tag="ZYRO0E02838g"
                     /db_xref="GeneID:8204604"
     mRNA            <215374..>218964
                     /locus_tag="ZYRO0E02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499020.1"
                     /db_xref="GeneID:8204604"
     CDS             215374..218964
                     /locus_tag="ZYRO0E02838g"
                     /note="highly similar to uniprot|P22138 Saccharomyces
                     cerevisiae YPR010C RPA135 RNA polymerase I subunit A135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499065.1"
                     /db_xref="GeneID:8204604"
                     /db_xref="GOA:C5E449"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR009674"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:C5E449"
                     /translation="MGKVIKPPTAARTAHFRTLERESRFQNPPKDKSAYPLLYEAVQP
                     HIGSFNALTEGPEGGLLNQGIKDIGEKVIFDGKRSDSIQLGNRLSVSVEQASITKPMF
                     NDGVASGVERRVFPSEARQRLSSYKGKLVIKLRWEVNNGEETFTEVRDCGAVPIMLQS
                     NRCHLYNMPPSELVKHKEESDEFGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANR
                     GAAYSQFGVQIRSVRPDQTSQTNVLHYLHDGQVTFRFSWRKNEYLIPVVMIIKALCDI
                     SDREIFDGIIGPDLSNSFLTDRLELLLRGFKKRYPQLRNRTQVLQYLGDKFRIVFQAP
                     PDKSDLDVGKEVLHRIVLVHLNGDTNEDKCRLLLFMIRKLYSLVAGACSPDNPDATQH
                     QEVLLGGFLYGMILKEKVDEYMQSIIAQIRTDINRGIPANFKDRKYMTRVLMRVNDNI
                     GSKMQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTT
                     TVRKLLPESWGFLCPVHTPDGAPCGLLNHFAHKCRISTKQSDVSQIPSILYSLGVSPA
                     SQAFAAGPSLCCVQIDGKIVGWTSHEQGRIIADTLRLWKVEGKTPGLPLDLEIGYVPL
                     SSRGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPQELQNNVHTHV
                     EFTPTNILSILANLTPFSDFNQSPRNMYQCQMAKQTMGTPGVALCHRSDNKLYRLQSG
                     QTPVVKANLYDDYGMDNFPNGINAVVAVISYTGYDMDDAMIINKSADERGFAYGTMYK
                     TEKVDLSLNRSRGDPISQHFGFGNDEWPKEWLEKLDEDGLPFIGTYVEEGDPIVAYFD
                     DTLNRTKVKTYHSTEPAYIEEVNLIGDESNKLQELQTVSIKYRIRRTPQIGDKFSSRH
                     GQKGVCSRKWPTVDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGTLHGVAQ
                     DASPWVFDENDTPADYFGDQLLKSGYNYHGNEPMYSGASGEELRADIYVGVVYYQRLR
                     HMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNS
                     SDYTQTNVCRECGSILATQQSVPRIGSISSLRCRRCAINFDEAKKTLAKFEGSDNVFI
                     DDSHIWEDGQGNKFVGGGETTTVAIPFVLKFLDSELAAMGIRLRYNVDPR"
     gene            <219672..>222503
                     /locus_tag="ZYRO0E02860g"
                     /db_xref="GeneID:8204605"
     mRNA            <219672..>222503
                     /locus_tag="ZYRO0E02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499021.1"
                     /db_xref="GeneID:8204605"
     CDS             219672..222503
                     /locus_tag="ZYRO0E02860g"
                     /note="highly similar to uniprot|P13586 Saccharomyces
                     cerevisiae YGL167C PMR1 High affinity Ca2 /Mn2 P-type
                     ATPase required for Ca2 and Mn2 transport into Golgi
                     involved in Ca2 dependent protein sorting and processing
                     mutations in human homolog ATP2C1 cause acantholytic skin
                     condition Hailey-Hailey disease"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499066.1"
                     /db_xref="GeneID:8204605"
                     /db_xref="GOA:C5E450"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006413"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5E450"
                     /translation="MSENPFESRIGAEIDNESEMIFDATNEALSKPNPSLEYCTLTVE
                     ETLDKLRTSAEFGLDSIAETSRRRLEFGVNEVVSEDNESIWRKFVMNFVEDPLILLLI
                     GSAVVSFIMGNIDDAVSITLAIVFVVTVGFVQEYRSEKSLEALNRLVPAECHLVRCGQ
                     ESHVLASGLVPGDLVNFKFGDRIPADIRIVESVGLSIDESNLTGEQEPVHKTSQEVSK
                     ESYNDQPFSIVPISDRTCIAYMGTLVKEGHGKGIVVGTGKNTSFGSVFEMMSTIEKPK
                     TPLQMSMDKLGKDLSLVSFILIGLICLIGVFQGRSWLEMFQISVSLAVAAIPEGLPII
                     VTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSKIWCLDSM
                     ESKSNALVLDKPRSTNYRNYLTEDVKATLTVSNFCNNASFSQEHCKHLGNPTDIALLE
                     NLSKFELQDLRSQTKKVHEIPFNSRKKFMAVQLIDLDGKCSLYVKGAFEKVLEQCSTF
                     LNKKGKPEKLSDSHRELITETANSLASDGLRTLAFAKAELPNGKNKVDEDSISGLTFT
                     GLIAMSDPPRPTVKPAVERLLRGGVHVIMITGDSENTAVNIAREVGIPIINPELSVLS
                     GEKLNEMTEEQLANVIDHVSVFARATPEHKLNIVSALRKRGDIVAMTGDGVNDAPALK
                     LADIGVSMGTMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTSV
                     AALSLVALSTTFKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTDK
                     ILTNEVLKRLSLSAFVIIIGTVYVFIKEMAEDSQVTSRDTTMTFTCFVFFDMFNALAC
                     RHATKSVFETGLFANKMFNYAVGLSLLGQMCAIYVPFFQQVFKTESLSLGDLFFLLII
                     SSTVLIADEVRKLWNKRNALNDPYLYSNV"
     gene            complement(<222715..>223959)
                     /locus_tag="ZYRO0E02882g"
                     /db_xref="GeneID:8204606"
     mRNA            complement(<222715..>223959)
                     /locus_tag="ZYRO0E02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499022.1"
                     /db_xref="GeneID:8204606"
     CDS             complement(222715..223959)
                     /locus_tag="ZYRO0E02882g"
                     /note="similar to uniprot|P32579 Saccharomyces cerevisiae
                     YGL169W SUA5 Protein required for respiratory growth null
                     mutation suppresses the Cyc1p translation defect caused by
                     the presence of an aberrant ATG codon upstream of the
                     correct start"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499067.1"
                     /db_xref="GeneID:8204606"
                     /db_xref="GOA:C5E451"
                     /db_xref="InterPro:IPR005145"
                     /db_xref="InterPro:IPR006070"
                     /db_xref="InterPro:IPR010923"
                     /db_xref="InterPro:IPR017945"
                     /db_xref="UniProtKB/TrEMBL:C5E451"
                     /translation="MIKRFISKMSNVLETKILKVDPASIHFPEDAHLNGSLPTITDPI
                     SEKNLLEAAKIIRGNLEPVAFPTETVYGLGGSSLSDEAVKSIYRAKNRPSDNPLITHV
                     SSIDQLNRKIYQEKHSSLFQNIPNSYHPLISKLWPGPLTILLPVPLKTSALSKLTTAD
                     QPTFAVRIPSNPIARALIALSDTPIAAPSANASTRPSPTMASHVYHDLKGRIPLILDG
                     GPCKVGVESTVVDGLSKPPLLLRPGGFTYEQIVELGGQDWKDCRVERRKVVAEGEQVR
                     TPGMKYKHYAPSAKVILLVPKPQRTDSDRIEELKRLISQELQNEDANTIKKLAILTSL
                     HLGATEIQDLTVGDSKIKPIVVKLGNTGEEIQANLFAALRQVDEIDNVNLIFVEGISE
                     DREGLAIMNRLRKAAGDHCVSF"
     gene            225026..225097
                     /locus_tag="ZYRO0E02904r"
                     /db_xref="GeneID:8204607"
     tRNA            225026..225097
                     /locus_tag="ZYRO0E02904r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT) cove score=75.85"
                     /db_xref="GeneID:8204607"
     gene            complement(<225197..>225643)
                     /locus_tag="ZYRO0E02926g"
                     /db_xref="GeneID:8204608"
     mRNA            complement(<225197..>225643)
                     /locus_tag="ZYRO0E02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499023.1"
                     /db_xref="GeneID:8204608"
     CDS             complement(225197..225643)
                     /locus_tag="ZYRO0E02926g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499068.1"
                     /db_xref="GeneID:8204608"
                     /db_xref="UniProtKB/TrEMBL:C5E452"
                     /translation="MRLTLILILTHLSICMAGANKLPSFVTDFLNGAESNGNWNEDTA
                     QNYVNQLIEKHGAKVQEQINQITEDEKVAYAQSLQEETKDCGKRWHVGDATLTKLDNS
                     VIGSAFNKLRDSLPSWVSWDQTSLQDYGVYFFSVSDTNIFEGLEEG"
     gene            <225906..>226940
                     /locus_tag="ZYRO0E02948g"
                     /db_xref="GeneID:8204609"
     mRNA            <225906..>226940
                     /locus_tag="ZYRO0E02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499024.1"
                     /db_xref="GeneID:8204609"
     CDS             225906..226940
                     /locus_tag="ZYRO0E02948g"
                     /note="similar to uniprot|P47110 Saccharomyces cerevisiae
                     YJR043C POL32 Third subunit of DNA polymerase delta
                     involved in chromosomal DNA replication required for
                     error-prone DNA synthesis in the presence of DNA damage
                     and processivity interacts with Pol31p PCNA (Pol30p) and
                     Pol1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499069.1"
                     /db_xref="GeneID:8204609"
                     /db_xref="GOA:C5E453"
                     /db_xref="InterPro:IPR019038"
                     /db_xref="UniProtKB/TrEMBL:C5E453"
                     /translation="MEEAIEFINEKLFTEEKPVLFTDLIHKFHIGPSRAKKTMYAYYR
                     SNKTLKYNCIIVCCYKDRIKVVHDVNHVDSQESLIDCFIYAFNPMEEFIPVNLAVDQR
                     EYLSILNPHKLVLPELRSKTVEEETTIKAVPKPSARSKTVPQTTKDEKPKPVPPKKQQ
                     QPAKSKDGALKSTALLAKMRADREAKEAQRQKELAQRREKELQEKKSKNDAQMKELNQ
                     MFVDDSDEDDGNDDNQRQESEKPTSTVEPDELEEILDSTAEESLLKQSQSQDEQPKVK
                     QEPQDTSYVDEDGYIVTNRPANNSSTSTPSQSRKRPGNSTPISHQQAKKPAPRKKTQG
                     TLESFFKKSK"
     gene            <227141..>227623
                     /locus_tag="ZYRO0E02970g"
                     /db_xref="GeneID:8204610"
     mRNA            <227141..>227623
                     /locus_tag="ZYRO0E02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499025.1"
                     /db_xref="GeneID:8204610"
     CDS             227141..227623
                     /locus_tag="ZYRO0E02970g"
                     /note="similar to uniprot|P25515 Saccharomyces cerevisiae
                     YEL027W CUP5 Proteolipid subunit of the vacuolar
                     H()-ATPase V0 sector required for vacuolar acidification
                     and important for copper and iron metal ion homeostasis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499070.1"
                     /db_xref="GeneID:8204610"
                     /db_xref="GOA:C5E454"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:C5E454"
                     /translation="MSELCPVYAPFFGAIGCAAAIIFTSFGAAYGTAKSGIGICVTCV
                     LRPDLLFKNIVPVIMAGIIAIYGLIVSVLIVYSLGQKQALFTGFIQLGAGLSVGLSGL
                     AAGFAIGIVGDAGVRGNSQQPRLFVGMLLILIFAEVLGLYGLIVALLLNARATQDVVC
                     "
     gene            complement(<227763..>230000)
                     /locus_tag="ZYRO0E02992g"
                     /db_xref="GeneID:8204611"
     mRNA            complement(<227763..>230000)
                     /locus_tag="ZYRO0E02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499026.1"
                     /db_xref="GeneID:8204611"
     CDS             complement(227763..230000)
                     /locus_tag="ZYRO0E02992g"
                     /note="similar to uniprot|P46673 Saccharomyces cerevisiae
                     YJR042W NUP85 Subunit of the Nup84p subcomplex of the
                     nuclear pore complex (NPC) required for assembly of the
                     subcomplex and also for formation of the nucleocytoplasmic
                     Gsp1p concentration gradient that plays a role in nuclear
                     trafficking"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499071.1"
                     /db_xref="GeneID:8204611"
                     /db_xref="InterPro:IPR011502"
                     /db_xref="UniProtKB/TrEMBL:C5E455"
                     /translation="MTVETTSDSQNLLMDVDTMDFVMEGNTGDTYSDDENETFDYDEV
                     IDRDPKSGAPVMSLSKNNAPLPTNGKGKLKYKLGPLSSQNMAYLDESNQYQLLPVKLA
                     RVDTSEEYVHYVSKLFEIYRDLGYDRVYSVPTMGVINTTATKEHAAAVNLATSALVTE
                     LDFFIDSIKAKKNALTRFSELEECLTILKCLKTIHFTLDTPEDVSVRETFITNLINWI
                     NRSDGEPNEEYIEQVFEPTADGKKVFETSFFWKLLNQLLLRGLFDQALGCLDRSQIME
                     HLNSQCEMSSNALRDLVALLKQYPMDSTDSFREWKSLALELAQTYSGSDTSVSGELRD
                     YIEDTLFLVGGHQSKILHYSTTWYESFCALLLYYIPSLELSEEYLELSLQNHPVDVTS
                     GWEQACVDLIRGRIYSILPVLESLDTCSAAFAAALCEAKGLLERIVDDMETDRDASYE
                     GLEDLFSYRNGMACYMLNNFAFELCSQGDKRLWPIAIGLITLSPVNSTSAKKMAIAEL
                     LPHYPFKTNDDIEWMLSILAKWKLPQVAKAVYVTLGNKLLYESNTIEAMANFSKAGKF
                     EWVKRYSWIMFEAAVMQGTPLDDVVLNAIVADEGDSIVPDEILSSLVTSAMKQTLSPY
                     AVLYRFYQAQTSNNWSEALTLLLALIEFPYLPNCYLVMLMARFMYPIFLENDSRHIDE
                     STILRIMESLENKWDDTDAKSINIYSTMLEEGIIRQNSIPPDLTSFLKLIRQKLNLKL
                     CQEFM"
     gene            <230333..>233779
                     /locus_tag="ZYRO0E03014g"
                     /db_xref="GeneID:8204612"
     mRNA            <230333..>233779
                     /locus_tag="ZYRO0E03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499027.1"
                     /db_xref="GeneID:8204612"
     CDS             230333..233779
                     /locus_tag="ZYRO0E03014g"
                     /note="similar to uniprot|P47108 Saccharomyces cerevisiae
                     YJR041C URB2 Nucleolar protein required for normal
                     metabolism of the rRNA primary transcript proposed to be
                     involved in ribosome biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499072.1"
                     /db_xref="GeneID:8204612"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018849"
                     /db_xref="UniProtKB/TrEMBL:C5E456"
                     /translation="MEIPTSTEALTKLLRSKGTTTSQIVEITSHFDELDLYFPNKEIF
                     ILELIQDRWNDQKLVNFKKDYKIWKLYNDMFSKVTDDTIRKKLLKDLRFVPHLMKTLE
                     VLDSDIPEILIELERMCVLINSMIRVDVSAENAITILGKTLSLIQRTDADHETLVLQV
                     INLTDITNFAQVSAKMSDCYCRELLLPTVKYFVKFGSELTLLSDFLSKFLFEPSVDLV
                     QLLESFVDGNRSQLESQDCILIFEKSMQSLSKQNFSMLEKIFTIITSAKKQLAPSLLK
                     KLSISKKTMSQEFLDNLLSESLRDSKYDQPFWSLILHILDLDVEIGIQNFDQLIKLVV
                     ERKSENIESVEMLWEKLIQCFINAREFVGFLEKIQTYCGDQRESAIFLLQDPLFADKI
                     SSNISTLSVVQLKFLITNLVDQILKGSSDTSDIGGSVLKLILKGLSRLSYISLPELKP
                     AVAKVFEVHADHPSKLWEIWYLAMEVYDDIVPLDSLESIEKQLSLFFSLPIKPKELFY
                     YFFKLREYTTFDLVQLSDALLQFLQESTTETKRVVLKDIFSNWYSLLNSAFSRKALEQ
                     LTNFLVSEECIDLLDEIFEDDNIFEEPNVIFFLVQKLQERSEQQEYVLKLQKIPIQCI
                     NKSTRSDLINSLSSKKVITKKDIELIGHLLSNPTFKSNIERQADSLYSVLSHATEKLT
                     YENVAVEKVWQNHLGQMKEASSIDFIREGGQFISRGMNEDPNEIGYFQMAFLALKVCR
                     SNALDPLKKDFVGKCLKRLSNAEKEDIEIIIWFLRALYYVFKLDNNCISKDESARQTV
                     SNLYRSIKTSDKEMQKKLLTNIFLLYSTTYADKLEYLYAHYMVLRNCDIESEEILPAI
                     EDVLSDSSKTNLVEFNQAFANLTFSLGSCKSNFNEGLLELYRVQIEHLEKDNIIGTHL
                     FAKSLSEFYTNCENFKSARVPVLRLLTTLQSLLVSKPWLFSQYCTEMLFPFCLKLMST
                     FFEGSGANDDLFTAIVKVISNILLAQGVKLTNRHHLMNSFICVCLELIADYKNTGLSS
                     QSAKSLSRLISNFVEPSSSGNNYSNKYSKNNLSSTVGLQKKLLRKYVPVLLIRFIHLS
                     IYRPFESPARKELASGVYAIFDLISQAELNMINSILDHAGRQYFKSLYAEYKKVGKWD
                     AN"
     gene            complement(<233916..>236231)
                     /locus_tag="ZYRO0E03036g"
                     /db_xref="GeneID:8204613"
     mRNA            complement(<233916..>236231)
                     /locus_tag="ZYRO0E03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499028.1"
                     /db_xref="GeneID:8204613"
     CDS             complement(233916..236231)
                     /locus_tag="ZYRO0E03036g"
                     /note="similar to uniprot|P37020 Saccharomyces cerevisiae
                     YJR040W GEF1 Chloride channel localized to late- or
                     post-Golgi vesicles involved in iron metabolism highly
                     homologous to voltage-gated chloride channels in
                     vertebrates"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499073.1"
                     /db_xref="GeneID:8204613"
                     /db_xref="GOA:C5E457"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001807"
                     /db_xref="InterPro:IPR014743"
                     /db_xref="UniProtKB/TrEMBL:C5E457"
                     /translation="MSSSNKGVSNSDRFNDIPETANFNQFLTIDWLNEKNKLVSDGSS
                     KDYRNKDLRNLKYRRFKVAIWSRCQTIITLTAIGVTIGCIAGFLQIFTETLVNWKTGH
                     CTRNWLLNKSFCCSGFANDGEHKDTRSPLSKREEFECVSNGVWTPWSSTPIPFLIFMG
                     LSVTFALFSTLMVNYIAPMATGSGISEIKVWVSGFKYRDDFLNGLTLIVKSIALPLAI
                     SSGLSVGKEGPSVHYATCCGYVITNWLMKDVLTYSKQSEYLTAASGAGVAVAFGSPIG
                     GVLFSLEEIASSVEFSASTLWKSFYVALCATSTLEYINPFRSGKIVLFNVTYDRDWKV
                     QEIPVFIILGIFGGLYGKYVSKWNINYVHFRKVCLSNWPIREVVFLAFITALICYTNE
                     FLKLDMTESMGILFHECQSNDKASSFTHRLCQLDENTHVVSFLRILSSLFIATLVRAF
                     LVVISYGAKIPAGIFVPSMAVGATFGRAISLLVERFISGPGVITGGTYAFLGAAATLC
                     GITQLTLAVVVIMFELTGAFMYIIPTMIVVAVTRMVMASSGVPGGISDQMIKVNGFPL
                     VESEDGDEFMDDTIAEEIMSPNLVTINEKMTLSSLESLIYNSETIAVNGFPVVKEDYD
                     MRTGKKCIGYVLRRDILTKLLMIESDSRGANSTILDFGGSDLSFATELEGTQHMSFRD
                     IVIPFPVSVKMGAPASLLFRMFKQLGCKVIIVENDGMLRGLITRKDIVRLQRTKKREL
                     YGPPYICNTFLDEKILFVMKSIVNKFKRTEN"
     gene            <236699..>237079
                     /locus_tag="ZYRO0E03058g"
                     /db_xref="GeneID:8204614"
     mRNA            <236699..>237079
                     /locus_tag="ZYRO0E03058g"
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /transcript_id="XM_002499029.1"
                     /db_xref="GeneID:8204614"
     CDS             236699..237079
                     /locus_tag="ZYRO0E03058g"
                     /note="highly similar to uniprot|P39990 Saccharomyces
                     cerevisiae YEL026W SNU13 RNA binding protein, part of U3
                     snoRNP involved in rRNA processing, part of U4/U6-U5
                     tri-snRNP involved in mRNA splicing, similar to human
                     15.5K protein"
                     /codon_start=1
                     /product="small nucleolar ribonucleoprotein SNU13"
                     /protein_id="XP_002499074.1"
                     /db_xref="GeneID:8204614"
                     /db_xref="GOA:C5E458"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5E458"
                     /translation="MSAPNPKAFPLADETLTQQILDVVQQSSNLRQLKKGANEATKTL
                     NRGISEFIIMAADCQPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASV
                     TTNDASSIKNQIYAVKDKIETLLI"
     gene            complement(<237145..>240105)
                     /locus_tag="ZYRO0E03080g"
                     /db_xref="GeneID:8204615"
     mRNA            complement(<237145..>240105)
                     /locus_tag="ZYRO0E03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499030.1"
                     /db_xref="GeneID:8204615"
     CDS             complement(237145..240105)
                     /locus_tag="ZYRO0E03080g"
                     /note="weakly similar to uniprot|P39991 Saccharomyces
                     cerevisiae YEL025C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499075.1"
                     /db_xref="GeneID:8204615"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E459"
                     /translation="MDDLKYLSDELKFRKDLELPLREYRLDPYGDFPSGRVIGYQKLN
                     NDNLHLLCFNNGLYVFDLDHLVYHEKASPLSSFVAYLYLENFQGTNGECFPAHVFFKS
                     DGIILFYRINLSTLKFSPVFISERGDFSVLNFQSITASSKNGIYISQAGKTIYKWSYF
                     DPRESLGVFLPVERQPLQYSTFMLNDSIFLCVYKSVFNGDVFVEFSKHCSRTGIFKPL
                     KRATLGNLDFKSVIIEKINDQLVLCVTSNKTWNFTSDLKVFQRKNKGLPNDAQFFSIS
                     WNSMMNSIRLHTSSDVFETTDLDIHLAKPPIRWSSKKIHSISSYSASMVDYSYELREN
                     LYVIIYARGLVVLVNSSTLQSSVLKCDNENRSYFAGQIAANKGSDLNTVLLCGASGDR
                     HGFFEKRFLQYPPCKRVFPFSKRLIHTPVTNLWSTKDGIFYESLGTIYNSDSDSDNGQ
                     DGIWVSKTGEVLKDADDETLFKESVASSWGDEAEEVSGAMSWERNTDYIATICANGVL
                     ELLKYTEESAPQKILQLQLGEWLNEATVVSACYNYRKKILHVAAFVDYRKIFYCDNRN
                     KSFEIPVEHDFQVAGLQIIDNYVNLARGFTDRLVSNVLIVATSFDGRIRIYSMLNEKV
                     ILEIKSPQNSEFQMVKFFNFIIFHNAFEVILLRTCDLVYGNLPLPEIPYKIIHLKNNE
                     ICILDRCWNLQFLEISASVEKQLMIHEPEYQSQFYNFGDYLPLQMSLMPGSDNLVAMA
                     LKNYSNSAGLQLVLFDHINMKTVKSQEWDEVASGVLLVSYFNHLLLSYYKDDHSIVKI
                     FDFHLKLIRRMSFDHRIPSLYFTTPGLESIRSGLRIKDCEEFTSGLPENIIENLCRHF
                     NDPRNSKYRTIYETAKRPQLVTWHHGKEDEYQATDTDILIDFVEDRREPTISRPKNYK
                     LHLTFNNHISIDDFKKLIPYEILSVSPIDEFIYNIQDGIQRTSYIRPLFLITCSHNAI
                     YILSAKYIEPDEWK"
     gene            complement(<240333..>243686)
                     /locus_tag="ZYRO0E03102g"
                     /db_xref="GeneID:8204616"
     mRNA            complement(<240333..>243686)
                     /locus_tag="ZYRO0E03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499031.1"
                     /db_xref="GeneID:8204616"
     CDS             complement(240333..243686)
                     /locus_tag="ZYRO0E03102g"
                     /note="weakly similar to uniprot|P47107 Saccharomyces
                     cerevisiae YJR039W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499076.1"
                     /db_xref="GeneID:8204616"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="UniProtKB/TrEMBL:C5E460"
                     /translation="MEDHVVLGELSKSKCMIDSFILRDGTLLVVEPEQICRAVYSSEL
                     VYEQMETIVTTGYNIGASAYWEPLTGVEYLILLKDCGALELLNSQCERIDLLETGMEQ
                     DDEKKFFAFDERDNQIFINLRKNTIFAIEYQLKNKVMYFVKRDEGPRCIFEDVDTIIG
                     MEISWNIDYMSGRDFPTISILLLNIFSQNYYFQVIRQAPKEVRKGRQPWETFISHSKL
                     EVQFEDNRAVLRAISNVGFFIFGPRQVLFIKLPGGYEQTVKDVEFQQFQSFEGCYMSY
                     DLTEDDKINLDGGIILRRNVNSLEFAAFNSQNRLLKIWLKVIFEDPDELIYHWDALST
                     EIITIEGLTSDRQIITRTILLSNAMAILLCEPENEIIFLDLNQIQVVKRVPYNLSKMF
                     SSDIIGTDFHKLVNCGGSVNNKGFVESKFWGHSNFFSLVESFDSEYQVMQLWNNNKGV
                     WWKDSRGQIFCNGELIDTCMSPIHVTLDGTIVKDTSIITWSNIFNDPSGNYAYVSKVG
                     HIGWSDETETVLLDKLRSSSLVKYILTCTKLENGSKITVLSVDNKLTILQDTHILKKD
                     IDVSTELDSIACMNVISWRGSLRLLITDIDGKLCELDIKNVKICTKHKIGAQRAEICA
                     VTDRGFFLIYTRDDLLLLSSTETGKFELTRIDMKTRISKIAAKDGSAISILDDDSKIH
                     QYTIANEIPQPNVINKRIDSNLYIHTKFISLSCSTRYVLTSSLRSAYSDLLQRVKYYT
                     EIQLHDLETQKTVSQYDLSEKYPQALVSDIVALPFNRESFMSDGMNQNNIYAMQLAFD
                     RVFIVSLNYEMAEDESLDNLLLFSIDDNNGTIELLQGVNTSHPITALLNYHNRTLITA
                     GEVLQAYKIDYLLKENTFKIDLVSNDVRCGGLVNTIVRLPRTYPPGMVPEGKKRKLQE
                     GSFVNERLLILNILRGLREYVLTQKSNSAQENLRITPITTSEKSLFGDHPNANGLITH
                     LSMCRMGETTWLITGDTERSIFLYRTSIDDEPSLIQLKLPGDIVSICSFSKSHESSYL
                     IREESLIQCERKPISILFTISTSKGEYLIGILEDSKLLRKLKTTVGKKMEEQFKFIQL
                     EDEQSDLIFTDTRISTDSSFKKSFEKSML"
     gene            <244074..>246614
                     /locus_tag="ZYRO0E03124g"
                     /db_xref="GeneID:8204617"
     mRNA            <244074..>246614
                     /locus_tag="ZYRO0E03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499032.1"
                     /db_xref="GeneID:8204617"
     CDS             244074..246614
                     /locus_tag="ZYRO0E03124g"
                     /note="similar to uniprot|P40985 Saccharomyces cerevisiae
                     YJR036C HUL4 Protein with similarity to hect domain E3
                     ubiquitin-protein ligases, not essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499077.1"
                     /db_xref="GeneID:8204617"
                     /db_xref="GOA:C5E461"
                     /db_xref="InterPro:IPR000569"
                     /db_xref="InterPro:IPR005735"
                     /db_xref="UniProtKB/TrEMBL:C5E461"
                     /translation="MPQLFRRFSSKKSSDIQIVSHSKGKSQGKRENRQRADSDSSENG
                     LDSFKEIKCPCCGTLLQFPSDVKRLKCAVCQVTTVVPMKGDSRVSSSGKSNITISFSE
                     LQTIVDKCCAKRAKMKAATKEELCAIYDPVAAYLNEGFHDIDILNNSFKTSHRRQLID
                     YYELMNFYQLVMELPTRNPFYRMLCASNDLLKNPPYTGGDVRWILIIWANPSIKRSLV
                     GQKKNGYDAPKILAVAYELTKRCIGYLANIESQAQYGKLMKHLKYISLNEFQSQVELL
                     NIYITFQFSRILYRDLKASVNPHKRTLVDNSPLVQPSPTGSELLSNEDKNDSLNLKHG
                     KPAVVQDFKFKPYEYELDWHIRCAAKLMQTMNKVNDKRYTITKTTNLSSLEFYNVMLD
                     FIDYRQDFENWRTDNKKSSKETPVTLTDFPGMPMRRFTLCSYPFLLSLGVKISIMEHE
                     VRRIMEYEAENAFLTSLDKGKAVSVYFKIRVRRSNITNDSLRSIENHQRDLMKSLRVE
                     FVNEPGVDAGGLRKEWFLLLTRSLFNPLNGLFSYVEESRLSWFAIIPIRSGSQDGCPD
                     HSQLYYLFGIVIGLAIFNSTILDLEFPRAFYKKLCGELLNFDDYMQLYPETGQNLIKM
                     LDYNKEDFTDVFALTFEATYEDRSKELLGHKPCIVSVELCRNGRYRKVTQENKYEFVQ
                     LWQDFFMNKSVEAQFKQFASGFRQVFVLCESIRLFNHEELARLICGNREKNCFEFQML
                     RSVTRYVGGFNDKSRVVVWFWEILQGWDFRLQRKLLQFATGSDRVPPGGMSTLPFKIS
                     RLGSKDSDKLPLAHTCFNEVCLWEYSSKEKLEQKLWWAVTQSEGYGFK"
     gene            <247502..>248152
                     /locus_tag="ZYRO0E03146g"
                     /db_xref="GeneID:8204618"
     mRNA            <247502..>248152
                     /locus_tag="ZYRO0E03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499033.1"
                     /db_xref="GeneID:8204618"
     CDS             247502..248152
                     /locus_tag="ZYRO0E03146g"
                     /note="highly similar to gnl|GLV|DEHA0F12771g Debaryomyces
                     hansenii DEHA0F12771g and similar to YEL024W
                     uniprot|P08067 Saccharomyces cerevisiae YEL024W RIP1
                     oxidizes ubiquinol at center P in the protonmotive Q cycle
                     mechanism transferring one electron to cytochrome c1 and
                     generating a low-potential ubisemiquinone anion which
                     reduces the low-potential cytochrome b-566 heme group
                     Rieske iron-sulfur protein of the mitochondrial cytochrome
                     bc1 complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499078.1"
                     /db_xref="GeneID:8204618"
                     /db_xref="GOA:C5E462"
                     /db_xref="InterPro:IPR004192"
                     /db_xref="InterPro:IPR005805"
                     /db_xref="InterPro:IPR006317"
                     /db_xref="InterPro:IPR014349"
                     /db_xref="InterPro:IPR017941"
                     /db_xref="UniProtKB/TrEMBL:C5E462"
                     /translation="MLSLRSSLRTSLKSLAPSTRMLSGSAVAAKSTYRTPNFGDSIKE
                     NNDPDRSRSYAYFMVGSLGLLSSAGAKSTVDSFISSMSASADVLAMAKVEVSLAAIPE
                     GKNVVVKWQGKPVFIRHRTSAEVQEANEVQMAALKDPQTDADRTKDPQWLIMLGICTH
                     LGCVPIGESGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFEEDGQKVIVG"
     gene            complement(<248494..>250518)
                     /locus_tag="ZYRO0E03168g"
                     /db_xref="GeneID:8204619"
     mRNA            complement(<248494..>250518)
                     /locus_tag="ZYRO0E03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499034.1"
                     /db_xref="GeneID:8204619"
     CDS             complement(248494..250518)
                     /locus_tag="ZYRO0E03168g"
                     /note="similar to uniprot|P39992 Saccharomyces cerevisiae
                     YEL023C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499079.1"
                     /db_xref="GeneID:8204619"
                     /db_xref="InterPro:IPR018712"
                     /db_xref="UniProtKB/TrEMBL:C5E463"
                     /translation="MSTSESHSGQEEGSGKNIVLCFDGTCENFGPNPITNVLKIFQLL
                     ETQDDKIQMCYYQPGVGTEANFDPVVDMRRNFSTASIMNKIDALFASSIDHHIVSGYL
                     FLMNYYEKGDKVYMFGFSRGAYVARALAGMLERVGLLNRGLDDMVSMAWKIYESWEFA
                     EQPSESSYNTTLAEEFKRTFSRPYEIRVFFQGLFDSVNSVGILRDRLFPCTQRSGIVD
                     HIRHAVSLDERKGKFKQQTFAINLDAPKLFSLNYNSYLVETASEVSEEQTLDDTNPNL
                     SHSLIELMLNKGSGSVKQASDSSESNSSAKAENLTQKINKQLQKLRSSNLQNTKNVNE
                     NVEGFFEYEPFSNSVRTVNSLMTSDLVEKWFPGDHSDVGGGYHSDCETREVLSGLSLR
                     WMIAEAVKHGLIFKKHSIHKLASKQTSLGSLFSTIHDKLSFNQVRHPDLDEPYEQIED
                     NNTDSREQLLSELESANWLQTTWNNFKEMRINEILTEREAAREKYTFDCTSASKFQIA
                     LWWLLELIPIGLRMESGSGKWRSVYIPNLGQPRYVPDYGNIHWSVYWRIRYDNSYRPK
                     NLPNYCRKLLKGYADINMEPSKGRSAHAIASPIKSYPTDLDHRSNNNLPSDNNNSTST
                     NGREMNKMIVNDIAEVQCFETGVKFSEWAAHHWREIPDDLEPWLLKFPDL"
     gene            complement(<250709..>253867)
                     /locus_tag="ZYRO0E03190g"
                     /db_xref="GeneID:8204620"
     mRNA            complement(<250709..>253867)
                     /locus_tag="ZYRO0E03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499035.1"
                     /db_xref="GeneID:8204620"
     CDS             complement(250709..253867)
                     /locus_tag="ZYRO0E03190g"
                     /note="similar to uniprot|P40352 Saccharomyces cerevisiae
                     YJR035W RAD26 Protein involved in transcription-coupled
                     repair nucleotide excision repair of UV-induced DNA
                     lesions homolog of human CSB protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499080.1"
                     /db_xref="GeneID:8204620"
                     /db_xref="GOA:C5E464"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E464"
                     /translation="MDGSEKQLQDLGLVNVLSQSTLEQRIQNDATSLINQQLLEQEQG
                     RLERAQNAVEKCNDKIGLLTRRWNNASRISARQKLQEQIDEIKNNELPPILSDIKDIR
                     KRLRDLKKSQKSDATRDSSQDEGKKPGESERDYLVRTGQVTAFGSKRGFEVANDSEEG
                     EEENQEQEENDVAKKSPPSNDDDDDYKDEDMDDEENDLDVSQGEDVKEENDIVLQPGA
                     VKDDGDEYFYQKRLRQWCNRRAQGRKTDNNPDWPEWRKKHQEFPDAKLDDEFRIPGEI
                     YSLLFNYQRTCVQWLYELYQQKCGGIIGDEMGLGKTIQVIAFLAALHHSNQLDGPVLI
                     VCPATVMKQWCTEFHHWWPPFRTVILHSIGAGMASKKKMSEDELEDMIMSGDPNQFSY
                     GDLENSSKTKAQVESDNLLQTLIDKVAKDGHVLITTYVGLRIHADKLLKINWAYGILD
                     EGHKIRNPDSDISLTCKKLKTPNRLILSGTPIQNNLTELWSLFDFIFPGKLGTLPIFQ
                     QQFVQPINMGGYANATNIQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPEKKEMVL
                     FCKLTQVQRRKYLEFLHSRELEDIKGGKRRVLYGIDILRKICNHPDLLDRDERSKEAS
                     YGDPKRSGKMQVVKQLLLLWRKEGHKALLFTQSRQMLDILQEFIAFKDQELTGLKFLR
                     MDGTTTISIRQSLVDEFNRGDYNVFLLTTRVGGIGVNLTGANRIIIFDPDWNPSTDMQ
                     ARERAWRIGQKREVSIYRLMVTGSIEEKIYHRQIFKQFLTNKILSDPKQKRFFKMNEL
                     HDLFTLGGENGHATEELESEVQQRTEGLKNSKSDESDDFEKVVNLIGVSKLESFYTGK
                     ESQENSKKDDDRLIEGLLGESGLAGAATHESMMSSHSNGSSDIITREASKLADAAVNA
                     LRKSRRARKKFDVGTPTWTGKFGQAGKIRKKRDKDVPGSSAILANIRNAQKQAENIPS
                     QESTSEEVEEKQVILRQIENYLHKCPDYFATSSDVINNIKVNLSTKEDVIKIRALLKV
                     IATFDKTRKGWKLNEEFINSEY"
     gene            complement(254321..254392)
                     /locus_tag="ZYRO0E03212r"
                     /db_xref="GeneID:8204621"
     tRNA            complement(254321..254392)
                     /locus_tag="ZYRO0E03212r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove score=66.07"
                     /db_xref="GeneID:8204621"
     gene            complement(254683..254754)
                     /locus_tag="ZYRO0E03234r"
                     /db_xref="GeneID:8204622"
     tRNA            complement(254683..254754)
                     /locus_tag="ZYRO0E03234r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove score=66.07"
                     /db_xref="GeneID:8204622"
     gene            complement(<254862..>255188)
                     /locus_tag="ZYRO0E03256g"
                     /db_xref="GeneID:8204623"
     mRNA            complement(<254862..>255188)
                     /locus_tag="ZYRO0E03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499036.1"
                     /db_xref="GeneID:8204623"
     CDS             complement(254862..255188)
                     /locus_tag="ZYRO0E03256g"
                     /note="similar to uniprot|Q02772 Saccharomyces cerevisiae
                     YJR034W PET191 Protein required for assembly of cytochrome
                     c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499081.1"
                     /db_xref="GeneID:8204623"
                     /db_xref="InterPro:IPR018793"
                     /db_xref="UniProtKB/TrEMBL:C5E465"
                     /translation="MGASCKDQHKAVAVCLQRSPCVMIERHTPQECFEDPELKKELPL
                     LCISQMKAFLDCKRGMVDMTKRIRGNGPLSTGRYDQQYDKLCSGDFDPREELKKLELL
                     DNNKKD"
     gene            <255578..>259558
                     /locus_tag="ZYRO0E03278g"
                     /db_xref="GeneID:8204624"
     mRNA            <255578..>259558
                     /locus_tag="ZYRO0E03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499037.1"
                     /db_xref="GeneID:8204624"
     CDS             255578..259558
                     /locus_tag="ZYRO0E03278g"
                     /note="similar to uniprot|P47104 Saccharomyces cerevisiae
                     YJR033C RAV1 Subunit of the RAVE complex (Rav1p Rav2p
                     Skp1p) which promotes assembly of the V-ATPase holoenzyme
                     required for transport between the early and late
                     endosome/PVC and for localization of TGN membrane proteins
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499082.1"
                     /db_xref="GeneID:8204624"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR022033"
                     /db_xref="UniProtKB/TrEMBL:C5E466"
                     /translation="MSLTYLPGRPNDTQQSTCQSSWQGRIVFAYCSGNNLIILSNGFQ
                     RLQTIYLESDSVAVDINPRNGFIAIGYGNKVGIYKPKHQVMKAPSWVFCCEIVHDDSK
                     VNSLSWGNFNDLTVGSNYLSFWKINDEFGVYKPVLQWNKKQPKPVYLCITSQCSQMIA
                     SFGKYDTSVKLWKRISISGDQVLFNLTLLPHPAPICTMRWRKSGRCEPSENPNGLQAI
                     YTLCADQKLRVWLCYELDSLHNVQHWATLQLEDAQRYCFTIDNWLLKDQRDLVLIADR
                     EGNLVIYSLSHLSSDPPRPIAKEKLSTKSFSYSSFVTKPDFLYFAELQPCDDNTDDLS
                     LIIHDLRGVIRQSRITVSQLLERNHSQIGTLEHKFTGHNKSVQKLIRSSDGEAMLTIS
                     RFLECCVWCPQRLSDESSLKLRGVIITEAPVKHAIIHEKGKLVICLLENSKLQAWECA
                     GIEGKCDLKRSHLKFEQQLEASTAEHGEPLLMLNTPESVHNHDRHFVALIYKDGAIRA
                     FEISSDQGIQEIYSESLEIPDNQIHHIATIDPVHQNFFSDRPLISLMSKNATAITYKA
                     VVDCEKKLIHWHKSCEFKTGMKDVVALRGSSTGKLCTVHCKGKKMSLWDLNKRVLEYE
                     ESFDDEIKDVDWTSTEYGQSIVSIGFSGYALLYTQLRYDYTNHNPSYLPIEKIDITSH
                     TAHQIGDSIWLKDGMFVVASGNQFYIKDKFLDLNDPFTRRSIGSRKILSNDILHLSSV
                     LNGPLPVYHPQFLIQAVYANKLQLVKELLLRLFLELRKLTFENENYSKLTSDLKTNYN
                     KFLTAQDNQFERDQFPDPYPEFNRTVALALCEQLTKITLPYLTRHQQITLSTVVEAVE
                     EILRNESVVDYNGIRFLLGVKLYASHKNVQKTILMRDVNWALHSDNKELLLSILDSHI
                     TSWAAACEYRISFWAKEDDLITKFEQIAKFEFSKDDKRDPSRCGIFYLALKKKKILFS
                     LWKISIGHPEQQKMIKFLSNDFSEARWRKAALKNAFVLLSKHRYMDAACFFLLAECLK
                     DCVNVLFKQVKDLDLAIGVCRVFEGDNGPVLGEFLTQQILPNAILQNDRWISSFVYWK
                     LRRHDKAIRTLVMDPFDLEKDTGLVDMDGGVSKSFLAEDPALLMLYSHLRKRNIKYFL
                     GSLKVEGELEYSLIGRVADILRRMGCDYLALSLVRNWEFIGVHEKLISSKNEQKSSEL
                     FSNVTNSHPTNKMKPGMFEKFENDSPDVTSRRKTKNLLDDFFTDLPSESSASPAPTQE
                     THDDLPASADETKPSTTASRSLLDDFGSQEPSVPRDTSATSSTTIEPVKRTPPSQPRN
                     LLDDFM"
     gene            complement(<259634..>260827)
                     /locus_tag="ZYRO0E03300g"
                     /db_xref="GeneID:8204625"
     mRNA            complement(<259634..>260827)
                     /locus_tag="ZYRO0E03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499038.1"
                     /db_xref="GeneID:8204625"
     CDS             complement(259634..260827)
                     /locus_tag="ZYRO0E03300g"
                     /note="similar to uniprot|P47103 Saccharomyces cerevisiae
                     YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin) catalyzes the cis-trans isomerization of
                     peptide bonds N-terminal to proline residues binds to
                     Hsp82p and contributes to chaperone activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499083.1"
                     /db_xref="GeneID:8204625"
                     /db_xref="GOA:C5E467"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5E467"
                     /translation="MSLNPKTFFDISIGDSPIGRIVFELYEKEAPKTVDNFVILCTAA
                     DSYLEDTPLKFRNNYFHRVVKNFAIQAGDVFHCSDKYEKNDNTGKGGCSIYASTEDLI
                     KRDAESLCFGDFEDENLKNFDKPFLLAMANKGEPNTNSSQFFITTSPAPHLNGKHTLF
                     GRVVHGKSVVRTIERCSVDSDGFPESCIRIVSSGKWSEGDPLPLHNASNDTIGGDIYE
                     EYPDDNENFDEDNFTLAFKVANTIKESGTLLYKKKDFQNAYYKYIKSLRYVNEFIPEE
                     SVDKANRINFINLKSKLYLNLSLVLYYLQNYDESIKYATYLLEMENIPDADQAKALYR
                     RGNSYSAKRKWEEALKDYKSCQEKNDQDKVVVEKIEGVEKELEKKKEKAKQTMSKFFT
                     ESTEE"
     gene            <260990..>265570
                     /locus_tag="ZYRO0E03322g"
                     /db_xref="GeneID:8204626"
     mRNA            <260990..>265570
                     /locus_tag="ZYRO0E03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499039.1"
                     /db_xref="GeneID:8204626"
     CDS             260990..265570
                     /locus_tag="ZYRO0E03322g"
                     /note="similar to uniprot|P39993 Saccharomyces cerevisiae
                     YEL022W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499084.1"
                     /db_xref="GeneID:8204626"
                     /db_xref="GOA:C5E468"
                     /db_xref="InterPro:IPR000904"
                     /db_xref="InterPro:IPR023394"
                     /db_xref="UniProtKB/TrEMBL:C5E468"
                     /translation="MNKKCYSVESCYEPIEGKQDQVGFWISGSLLFQFSVSHLLKMNS
                     DYVVAVDPVTIVIKECINLSTAMRKYSKFRSQSGVAALLSSSEIFTNQDDSLAVTFNN
                     LSSNKHNDPLLSGFVQLRLMLNNLQNLEEIDSLTLLQPFLLTISTSSISGYITSLALD
                     SLQKFLTMNIINETSKNHVAAIREAVNALTHCRFERSEQLSDDAVLLKVVILLQGVTH
                     SRYGELISDSIMYDVLQTVLSLACNKKRSEVLRRAAETTMVSITASLFYKLKNIEPTD
                     LTQKYINDEGYANSILQEDLIGTPDGSQEEDYTRDEPTTLSGGEEVATNTSQLLEQSQ
                     EEKDEKDSTHVMESQRSESKDSKSSEVLEDNHGIPVIRHYLNLLLSLIVPENQAKHTN
                     SVRIFGLQLINTAIEVSGNTFPQHPRLFSLVSDPIFKHVLFIIQNGSKLSLVQAALQL
                     FTTLVIILGDHLKVQIELTLNRIFDILLNNANEITSEGRPRPAAVKELLIEQISLLWT
                     RSPSFFTSTFIEFDCNLDRADVSINFLSALTKLALPESALTSTESVPPICLEGLISLI
                     DDIYSRLQRVDREKFLQDKGNVSRLKQKERKTEFIKCAKIFNEKPKKGVPLLIEKKFI
                     TSDSEEDIAQFLFENNGRLNKRTIGLFLCDPSHTSLLKQFIDLFDFKDLRVDEAIRIL
                     LTKFRLPGESQQIERIIEAFSARYVDSQKYDPSKANNNNDDEDLSTIQPDADSVFILS
                     YSVIMLNTDLHNPQVKEHMSFDDYCSNLKGCYNQQNFPHWYLDRIYCSIRDKEIVMPE
                     EHHGNDRWFEDAWNNLISSTMVMTEIQEQCERDYDNLGLQEISQFDGAIFQHVGRSIV
                     DTFFKIFEVASDDHISSRMLSSVDKCAFIASFLEIDNLFNEILYKIAVMTTLSDGTNR
                     DPNENDEIPLVEITVEDSNSKILVSSDACRLGRSFKAQLCVVIFFRVFRTNNFFTKLT
                     PELWNKIVKILLLLFEDLMISPDIFPDLQQRLKLGNLPRPAPEVSLKKAKESRGILSA
                     FASYLKGDEEPTEDEIDASAKAIDCVRSSNIPSSIFGNEKNITEELIRMLLNSIKLKK
                     TPENSRFFEPEMLFIVELCVALFLFCKDKKTLGSHILHKISEISKVSGLSKRCIRRLM
                     AYNLLLISVVDEQQDMLHKLINDELLKKNEVFTQKYFASEHGCEVLRRLLALTDIDNY
                     RNTILQDEGFWKLLRLLASMKEHTATIYNYLERSLYATNNILANENFMWILGLLDEIS
                     SLGAVGSQWEREYQRLLKTGHKVDDKNPHQPLIDLSLKSIKLTSQIVEKKLASIHLSK
                     NETIALIQALAHQCLNPCSQIRSFSLECLENVLIKLDLPSAEISNLEELIEGGLLPLL
                     DTMNSKEGSTVPVSEILAVISKIYLYRLKQGITTDETFLKILNIYNRYVEVPEVEKQL
                     QHLITDKKAIEKPTSSAAHEDESSNNDSHQAPAEVPQSAVPESESSKDDPQQAPAETP
                     SSATPPATALVAETSQISNGESAKEQITEQVN"
     gene            complement(<265644..>266966)
                     /locus_tag="ZYRO0E03344g"
                     /db_xref="GeneID:8204627"
     mRNA            complement(<265644..>266966)
                     /locus_tag="ZYRO0E03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499040.1"
                     /db_xref="GeneID:8204627"
     CDS             complement(265644..266966)
                     /locus_tag="ZYRO0E03344g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499085.1"
                     /db_xref="GeneID:8204627"
                     /db_xref="GOA:C5E469"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E469"
                     /translation="MTTGYDSIDGGESNATPSTAHRTSVIGALTAGGRSVVYQLTSFY
                     LRTPLKLFRPARFDYLHYLRVVLTGEERKPLHEVEKQQKLKRFRILNPKYMYYLENSS
                     LGILTKALNKYGWKVIPDRILPPLVVNSAAGVILYTTYLSTLTHFAKLRAEKSQLNKP
                     WDIWRSGLLAGAAQALVSSPIDAIYTRSSTSELLSSAQKYDNLWLYGRDKLKEIGLIG
                     CFGGYGITLFKESLGFAVYFTTFELIKGQLCQSLINTIKHYDQLKYTIRNTKLTDILL
                     RRSPQPHEFEKAPMKSMSPQEEKWFQRTFTFGGGVTAAFLLQVVQFPFSKIQKVHLSR
                     LEAFDIYNRTLFKNAEAAPVTTTPPSMKIRVRSPNSRRLHIYYNSYMDTFEHILFIHK
                     NTNSLLKWLYKGFMRNTLAIIPGTTAGLLLLDYMRSSVEETLIQTPLT"
     gene            <267206..>268003
                     /locus_tag="ZYRO0E03366g"
                     /db_xref="GeneID:8204628"
     mRNA            <267206..>268003
                     /locus_tag="ZYRO0E03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499041.1"
                     /db_xref="GeneID:8204628"
     CDS             267206..268003
                     /locus_tag="ZYRO0E03366g"
                     /note="highly similar to uniprot|P03962 Saccharomyces
                     cerevisiae YEL021W URA3 orotidine-5'-phosphate
                     decarboxylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499086.1"
                     /db_xref="GeneID:8204628"
                     /db_xref="GOA:C5E470"
                     /db_xref="InterPro:IPR001754"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR014732"
                     /db_xref="InterPro:IPR018089"
                     /db_xref="UniProtKB/TrEMBL:C5E470"
                     /translation="MSHLTYQERAARHPSPVATRLLNLMHEKQTNLCASLDVNTTAEL
                     LHLLDVLGPHICLVKTHVDILSDFSIEGTVKPLKELAAKHNFLIFEDRKFADIGNTVK
                     LQYKSGVYQIAQWADITNAHGVTGPGIVQGLKQAAQETTQEPRGLLMLAELSSKGSLA
                     HGEYTTGTVDIAKSDKEFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDSLGQQYR
                     TVDDVVSTGSDIIIVGRGLFAKGRDPSVEGERYRKAGWQAYLKRCNK"
     gene            <268186..>268449
                     /locus_tag="ZYRO0E03388g"
                     /db_xref="GeneID:8204629"
     mRNA            <268186..>268449
                     /locus_tag="ZYRO0E03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499042.1"
                     /db_xref="GeneID:8204629"
     CDS             268186..268449
                     /locus_tag="ZYRO0E03388g"
                     /note="highly similar to uniprot|O74700 Saccharomyces
                     cerevisiae YEL020W-A TIM9 Mitochondrial intermembrane
                     space protein mediating import and insertion of polytopic
                     inner membrane proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499087.1"
                     /db_xref="GeneID:8204629"
                     /db_xref="GOA:C5E471"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:C5E471"
                     /translation="MDSLNPREQQEFTRLIEQKQMKDFMRLYSNLVERCFSDCVNDFT
                     SNKLTSREQTCITRCSEKFLKHSERVGLRFQEQNAAMGQGLGR"
     gene            complement(<268553..>270388)
                     /locus_tag="ZYRO0E03410g"
                     /db_xref="GeneID:8204630"
     mRNA            complement(<268553..>270388)
                     /locus_tag="ZYRO0E03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499043.1"
                     /db_xref="GeneID:8204630"
     CDS             complement(268553..270388)
                     /locus_tag="ZYRO0E03410g"
                     /note="similar to uniprot|P25351 Saccharomyces cerevisiae
                     YCR023C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499088.1"
                     /db_xref="GeneID:8204630"
                     /db_xref="GOA:C5E472"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E472"
                     /translation="MAPKLTFREQMDGFPWTQLLVVSLVRFSEPIAFTSLFPYVYFMV
                     RDFHIAPNDAEVSKYSGYLSSCFALCQVVSAYHWGHFSDIYGRKCALSLGLIGTCTSL
                     MVLGFSKNFYMALLARCMMGLLNGNVGVLRTMIGEIATERKHQALAFSTMPLLFQFGS
                     VVGPMVGGFLVFKQSHGENIPNFFPHWLRGLVHRYPYLLPNIVVSIFLMVGLFNAILF
                     LEETHPDLKYRRDYGVELGDFIKLHIFGIQPVSRPWNHLQLDTHNDDNPIIGDDSSVI
                     HSDQDTTTEAVDHDTAPLIPSSGDSSDSEESIRSFGPILTRRQSVGLIREYSLHEPTD
                     IPDADLELAFDGCKEDSIYHHVFHTSVFYPISVNFIMSLHLIVYNEFLPVFLAYDLAQ
                     DDKGNLLSKFPWKISGGIGYSPDQTGALLSSTGIFGCFVVIFIFPVVDRSFDCLTIFR
                     TLVKLYPIMYLMVPYVIFLQQDHIPRWCTIVYLYLITGTKTLCGALTSPQIMLLIHNC
                     SPLSCRAVINGATISISALARFVGPLAWGYIMSWSQEFDVAWLSWWSLGLISLIALFQ
                     SYKIDPIDEEDEEPGAASIEEARPHSRPSLSSFSNHRRPSELNNS"
     gene            complement(270433..270775)
                     /gene="RPR1"
                     /locus_tag="ZYRO0E03432r"
                     /db_xref="GeneID:8204631"
     ncRNA           complement(270433..270775)
                     /ncRNA_class="RNase_P_RNA"
                     /gene="RPR1"
                     /locus_tag="ZYRO0E03432r"
                     /product="RNase P RNA"
                     /note="RPR1 (RNase P RNA)"
                     /transcript_id="XR_002648407.1"
                     /db_xref="GeneID:8204631"
     gene            complement(<270926..>272575)
                     /locus_tag="ZYRO0E03454g"
                     /db_xref="GeneID:8204945"
     mRNA            complement(<270926..>272575)
                     /locus_tag="ZYRO0E03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499044.1"
                     /db_xref="GeneID:8204945"
     CDS             complement(270926..272575)
                     /locus_tag="ZYRO0E03454g"
                     /note="similar to uniprot|P39994 Saccharomyces cerevisiae
                     YEL020C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499089.1"
                     /db_xref="GeneID:8204945"
                     /db_xref="GOA:C5E473"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5E473"
                     /translation="MQFQDYFTRVLQNYGVDTVFGIVGIPIVELADTMIEHGIKFIAC
                     RNEQSASYAASAYGYLTGKPGVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAGSSEAQ
                     HRGGFQELDQVSLLKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIG
                     STVKKDSLPPVKNIYVPKSSPDPSAVQEVTDLIRKNPENVLVVVGKGAVHASQEIRQF
                     VDRFQLPFLPTPMGKGVVPDSHPLNVSSARSRALQEAKVVLVLGARLNWILHFASAPK
                     WNPDALFIQVDSDTTTLGHNNFKSQHLSLWGDIGLTVRLITASLGDYHSQGLSPSLQS
                     NIARNAAKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPT
                     DYPLQRLDAGTNATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGL
                     ALIVIVMNNGGIYHGQNPTSSPSSSPSPLPSTALTEECRYDLVAKGLGAHGYLVQTLN
                     DLRESFVKAQEHAKKGQSTLLNVVLEPGEQKKISFGWQVRL"
     gene            complement(<272677..>274068)
                     /locus_tag="ZYRO0E03476g"
                     /db_xref="GeneID:8204632"
     mRNA            complement(<272677..>274068)
                     /locus_tag="ZYRO0E03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499045.1"
                     /db_xref="GeneID:8204632"
     CDS             complement(272677..274068)
                     /locus_tag="ZYRO0E03476g"
                     /note="similar to uniprot|P25345 Saccharomyces cerevisiae
                     YCR024C SLM5 Mitochondrial asparaginyl-tRNA synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499090.1"
                     /db_xref="GeneID:8204632"
                     /db_xref="GOA:C5E474"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5E474"
                     /translation="MFRGYHTIRALYDSGPQKFVDVNGWIQSIRQLKRIAFIDLRDGT
                     STKSLKIAVPLCDQSLIESVKNLKTGQCVSISQAQWVPTPQREQPFELKVGDALKDIQ
                     ILGNVTSQYPLQKKSHSLSFLRTLPHLKHRSNYLGSLLRFRSHVENTFIQFFAQNEFT
                     KVTPPLITSSDCEGGGELFKVDGSNDYFGRSAYLTVSAQLHLEALSLALNRCYTLSPS
                     FRAEKSDTNRHLCEFWMLEAEWCFVRDVNELTHFTQNLLKSVIKSCYDNRNELIPQII
                     PQESDQVSTIIQRWENLLKNDNWPSITYTEAIKILREQHSNVKPFPNYEPQWGLALQS
                     EHEKWLAGEYFQSPVFVTDYPKDCKAFYMKHNDDGQTVACFDLLVPGMGEIVGGSVRE
                     DDYIKLVTEMDRRQMNHNGDLDWYAALRQEGSAPHGGFGLGVERLVSYLYGNHNIRDA
                     IPFHRAATGTIEL"
     gene            complement(<274104..>274835)
                     /locus_tag="ZYRO0E03498g"
                     /db_xref="GeneID:8204633"
     mRNA            complement(<274104..>274835)
                     /locus_tag="ZYRO0E03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499046.1"
                     /db_xref="GeneID:8204633"
     CDS             complement(274104..274835)
                     /locus_tag="ZYRO0E03498g"
                     /note="similar to uniprot|P38632 Saccharomyces cerevisiae
                     YEL019C MMS21 Protein involved in DNA repair mutants are
                     sensitive to the alkylating agent methyl methanesulfonate
                     and show increased spontaneous mutation and mitotic
                     recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499091.1"
                     /db_xref="GeneID:8204633"
                     /db_xref="GOA:C5E475"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR026846"
                     /db_xref="UniProtKB/TrEMBL:C5E475"
                     /translation="MISSAPLHLRCKEFHSLKVVEIDGFLQNSKKQLIRSLEQVVRDS
                     DPNELDSLIKDICQNYEELRTNEESSIKLQRQVSEAKQQYKQSSESLAPLTIETWDQY
                     SQEPAPSLKDFISQDVEVQLPLTQEDRILRALPHIWQDPQCLLPDDTDGDDLQIRGGR
                     IELICPITCKPFENPMISKKCGHVFDNSGLNNYFESYPSRDCPQGACLQKLTLRDFKV
                     DELMKLRCLLHLKKVRQEETNLDVL"
     gene            <274837..>275502
                     /locus_tag="ZYRO0E03520g"
                     /db_xref="GeneID:8204634"
     mRNA            <274837..>275502
                     /locus_tag="ZYRO0E03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499047.1"
                     /db_xref="GeneID:8204634"
     CDS             274837..275502
                     /locus_tag="ZYRO0E03520g"
                     /note="similar to uniprot|P39995 Saccharomyces cerevisiae
                     YEL018W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499092.1"
                     /db_xref="GeneID:8204634"
                     /db_xref="InterPro:IPR026226"
                     /db_xref="UniProtKB/TrEMBL:C5E476"
                     /translation="MIPQVSELVVLQTIYLLLQNGESVRVSLVKLTNEIRNSVLVRQL
                     STGEPPLDINDILSIVKRVLPNQRISLVDGQLSFPHLQLNELKQEIQSRRQSLQSSQL
                     QVIKQLEEQILHPRKVDPKREKLLQLYRDTVLNKLNKSHTLDQLYTQVPQDTNVTKLH
                     IALDNIKNDTPASVHELQLTLQLAICNAKACTRTGSKQWQLCTQAQIDLDETVQFMRR
                     ALE"
     gene            complement(<275553..>275912)
                     /locus_tag="ZYRO0E03542g"
                     /db_xref="GeneID:8204635"
     mRNA            complement(<275553..>275912)
                     /locus_tag="ZYRO0E03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499048.1"
                     /db_xref="GeneID:8204635"
     CDS             complement(275553..275912)
                     /locus_tag="ZYRO0E03542g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499093.1"
                     /db_xref="GeneID:8204635"
                     /db_xref="UniProtKB/TrEMBL:C5E477"
                     /translation="MAKCLVRGPPDSCKYKEVCIDPQYCAVAATIQPRYTCDTHDYNT
                     VQYGTMPFFSKLRSNKPEEKKYISVEEFHKRNKEYEEAHEKRKNSVSEGYKDWSRDTP
                     TSSSATNGSGGWNTPWL"
     gene            complement(<276372..>277916)
                     /locus_tag="ZYRO0E03564g"
                     /db_xref="GeneID:8204636"
     mRNA            complement(<276372..>277916)
                     /locus_tag="ZYRO0E03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499049.1"
                     /db_xref="GeneID:8204636"
     CDS             complement(276372..277916)
                     /locus_tag="ZYRO0E03564g"
                     /note="some similarities with uniprot|P25353 Saccharomyces
                     cerevisiae YCR026C NPP1 Hypothetical ORF and to YEL016C
                     uniprot|P39997 Saccharomyces cerevisiae YEL016C NPP2
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499094.1"
                     /db_xref="GeneID:8204636"
                     /db_xref="GOA:C5E478"
                     /db_xref="InterPro:IPR002591"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR024873"
                     /db_xref="UniProtKB/TrEMBL:C5E478"
                     /translation="MFLLPLSLVLSILLVVILTGLRDSYNNRYKPHGFDPSAKYSNGT
                     HEFYPITLVLSLDGFHPSLISKEATPFLHELYTLQQPNTSVAPFIVPSFPSQTFPNHW
                     SIVTGKYPSENGIVANWFWDHSLEKQFGPGNIDPELWETASEPIWSTLENAFFADTFK
                     SAAHMWPGCEVQGRTPHFFTAFNDSETLEEKSESIFRNYVDGKRDASERPQLILAYAP
                     QPDAYGHEYGYPAPHTPSFRELLNKIDSYVSRVFAALDQRHMRHFTNVVILSDHGMAT
                     VPSHNVLLEKEILPDDLRTQHVSHSYLEGPALAIYTPNASHVERQLIKRLERLKIGKN
                     FHVTRNLQQEFGYKLSGERTADIWVLPDVHYAVAHQRRLLGTHGYNNSSPEMRALFIA
                     NGPAFTEGYVEPFENVAIHGLLLELAGWKSEPHVGRPSHKIATADTKPQGLLVPLRSP
                     PQDDLALLSRIFGNGSSYNAVFHNETTKLDAVVPEKQQQDFSSLLGEIVGELQAELAE
                     WGSNDK"
     gene            <278440..>279492
                     /locus_tag="ZYRO0E03586g"
                     /db_xref="GeneID:8204637"
     mRNA            <278440..>279492
                     /locus_tag="ZYRO0E03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499050.1"
                     /db_xref="GeneID:8204637"
     CDS             278440..279492
                     /locus_tag="ZYRO0E03586g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499095.1"
                     /db_xref="GeneID:8204637"
                     /db_xref="GOA:C5E479"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5E479"
                     /translation="MTRQSRQGSIIEGPHAVGAPNPAVVNAALAEELEAETRVGPDGI
                     VRSATPDTPSIPLVKDIVPTYRLDGHVTIVTGGSGGLAHTLSQALVAQGSQVALVDLA
                     VEKLARVERELQEFIKVNKLTPVNISTWECDISDPQEVEELINSIPRDHDGLIPDKLV
                     HTAGYCQNVPAHEYNARKAEHLVKVNLLGSLYICQAMTRQLIERSKRRRSIAALRGSV
                     GEAVPQFPNASFVLIGSMSGIIVNTPQPQVAYNMAKAGVIHMVKSLACEWARYGIRVN
                     AISPGYIATPLTKQVIGASPEGLALQEQWTSRIPMERMAEPKEFVGAMLYLLSRTASS
                     YTTGENLVVDGGYTNF"
     gene            complement(<279670..>280272)
                     /locus_tag="ZYRO0E03608g"
                     /db_xref="GeneID:8204638"
     mRNA            complement(<279670..>280272)
                     /locus_tag="ZYRO0E03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499051.1"
                     /db_xref="GeneID:8204638"
     CDS             complement(279670..280272)
                     /locus_tag="ZYRO0E03608g"
                     /note="similar to uniprot|P25378 Saccharomyces cerevisiae
                     YCR027C RHB1 Putative Rheb-related GTPase involved in
                     regulating canavanine resistance and arginine uptake
                     member of the Ras superfamily of G-proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499096.1"
                     /db_xref="GeneID:8204638"
                     /db_xref="GOA:C5E480"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E480"
                     /translation="MSYNQPSFQRKIAVLGARNVGKTTLTVRFVEEHFVESYYPTIEN
                     DFTKIVQFKGNNYTLEILDTAGQDEFSLLNAKSLIGVKGIVLCYSVSNRPSFELIPVV
                     WDKLVDQLGRDDLPCVVVANKIDVRDSASSTEFISSQEGRELAKTIGSTDGKHKAGFV
                     ECSAKQDVNVEGAYRAVLEKMRQQELGTGDSNGDSKCLMM"
     gene            <280468..>281946
                     /locus_tag="ZYRO0E03630g"
                     /db_xref="GeneID:8204639"
     mRNA            <280468..>281946
                     /locus_tag="ZYRO0E03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499052.1"
                     /db_xref="GeneID:8204639"
     CDS             280468..281946
                     /locus_tag="ZYRO0E03630g"
                     /note="similar to uniprot|P39998 Saccharomyces cerevisiae
                     YEL015W EDC3 Non-essential conserved protein of unknown
                     function plays a role in mRNA decapping by specifically
                     affecting the function of the decapping enzyme Dcp1p
                     localizes to cytoplasmic mRNA processing bodies"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499097.1"
                     /db_xref="GeneID:8204639"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="InterPro:IPR025762"
                     /db_xref="UniProtKB/TrEMBL:C5E481"
                     /translation="MSQFVGFGVQVELKDGKRIQGRIAKATAKGLTLNDVVFGDGGTS
                     QAFKVRASRLKDLKVLSVARKTHHTPKVSPPASQGQDWQNDDVNKLKQQDDFDFQGNL
                     KMFNKKDVFAQLKQQDDVQPQQRLVSHNKKPENIANDQSVIPNAKEDAWDVDDEKYYD
                     AQLLPVTKSINITHLLHNKGGDDQEADEEEEEEEESEEEKVIAKIKQALRSDRPALLR
                     AKEINLQVLMANPVQLLEMERVSAEQYGIHAPIVVENFGNNASFVLKQKLGGRIRLRL
                     DNMNPGPLVVIMASDSYRSGARALSLGRHLCQTGHVRVVVVFISQDLQDNHVLQQMDL
                     FRRSGGKIVNGITQLESLVDKLNTPVECVIDAIQGFDCNLSDLYYNEALSPLENRVRS
                     LIQWCNSLHNVQIWSLDIPAGFDSTTGTQNFDDAVRATGVLSSGWPLAALHAVKDQLK
                     DQLTEVVAIDVGTPQGVYAQTSLRKFQSYDVFVTEGSLSLDI"
     gene            <282429..>284129
                     /locus_tag="ZYRO0E03652g"
                     /db_xref="GeneID:8204640"
     mRNA            <282429..>284129
                     /locus_tag="ZYRO0E03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499053.1"
                     /db_xref="GeneID:8204640"
     CDS             282429..284129
                     /locus_tag="ZYRO0E03652g"
                     /note="highly similar to uniprot|P39968 Saccharomyces
                     cerevisiae YEL013W VAC8 Phosphorylated vacuolar membrane
                     protein that interacts with Atg13p required for the
                     cytoplasm-to-vacuole targeting (Cvt) pathway interacts
                     with Nvj1p to form nucleus-vacuole junctions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499098.1"
                     /db_xref="GeneID:8204640"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E482"
                     /translation="MGGCCSCLRDSSDEASVLPIADNEREAVTLLLGYLEDKDRFDFY
                     SGKPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVSRDVLEPILILLQSQDPQIQ
                     VAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGNNVEVQCNAVGCITNLATQDDNK
                     HKIATSGALVPLTRLAKSQHIRVQRNATGALLNMTHSEENRRELVNAGSVPVLVSLLS
                     SADPDVQYYCTTALSNIAVDESNRKKLAQTEPRLVSKLVALMDSPSSRVKCQATLALR
                     NLASDTSYQLEIVRAGGLPHLVKLIQSDSMPLVLASVACIRNISIHPLNEGLIVDAGF
                     LKPLVRLLDFKESEEIQCHAVSTLRNLAASSERNRKEFFESGAVEKCKELALDSPVSV
                     QSEISACFAILALADISKLDLLDANILDALVPMTYSNNQEVSGNAAAALANLCSRINN
                     YTRIIEAWGIPNGGIRGFLARFLHSDYATFEHIALWTILQLLESHNDKVAELVKNDKE
                     IINGVKRMADITFERLQRSGSDGKNNDHDLADSKSSEAAEDASVELYNITQQILQFLN
                     "
     gene            complement(284600..284671)
                     /locus_tag="ZYRO0E03674r"
                     /db_xref="GeneID:8204641"
     tRNA            complement(284600..284671)
                     /locus_tag="ZYRO0E03674r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=73.86"
                     /db_xref="GeneID:8204641"
     gene            complement(285238..285309)
                     /locus_tag="ZYRO0E03696r"
                     /db_xref="GeneID:8204642"
     tRNA            complement(285238..285309)
                     /locus_tag="ZYRO0E03696r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT) cove score=75.85"
                     /db_xref="GeneID:8204642"
     gene            <285779..>286882
                     /locus_tag="ZYRO0E03718g"
                     /db_xref="GeneID:8204643"
     mRNA            <285779..>286882
                     /locus_tag="ZYRO0E03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499054.1"
                     /db_xref="GeneID:8204643"
     CDS             285779..286882
                     /locus_tag="ZYRO0E03718g"
                     /note="similar to uniprot|P23060 Saccharomyces cerevisiae
                     YCR019W MAK32 Protein necessary for structural stability
                     of L-A double-stranded RNA-containing particles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499099.1"
                     /db_xref="GeneID:8204643"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5E483"
                     /translation="MRELQHLQETPMEPTSNELGPLVTTNGMFIIDEIHEQDGKVHTD
                     IPGGGGMFAMLGACIVTSSAQVSENLKWIIDRGHDFPPSLTSVIESWGTGVHFRDDNS
                     RYTTRGGNFYRNEDLREFEYLTPKKQITVQDWIDSWGLEVLSQLKCIHLLCSAERCLQ
                     ILDQLAEKQLGPKTFVWEPIPDLCNQEHAPQIMRVLQRPETVIFSPNAEEGARLLGDE
                     EPLQLDQVLEYIWKFDNLISPHHSCVLRCGKMGSVALSSRDIHTRKRQVIHYPAYHSA
                     SPEKVVDPTGGGNSYLGAFCLGYSLTQDLHVASICGNLAAGCVIEQVGIPHFDHSTRQ
                     WNGLTLPQRIHHYLQTYHISQYTSLDMYQQLSP"
     gene            complement(<286885..>287529)
                     /locus_tag="ZYRO0E03740g"
                     /db_xref="GeneID:8204644"
     mRNA            complement(<286885..>287529)
                     /locus_tag="ZYRO0E03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499055.1"
                     /db_xref="GeneID:8204644"
     CDS             complement(286885..287529)
                     /locus_tag="ZYRO0E03740g"
                     /note="similar to uniprot|P25362 Saccharomyces cerevisiae
                     YCR020C PET18 Protein required for respiratory growth and
                     stability of the mitochondrial genome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499100.1"
                     /db_xref="GeneID:8204644"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="InterPro:IPR016084"
                     /db_xref="InterPro:IPR026285"
                     /db_xref="UniProtKB/TrEMBL:C5E484"
                     /translation="MTTTTESLLAKYGDLFEKATTHSLTKELCLGTLEDRKLFIYLAQ
                     DLQFFEEGLRLMCKIASLAPAPESLITLAQKIGFFANDENTYFRDALKLLEPSVDESS
                     THWMNNRLPQVETYVGQLIAMTRENNWQYPQLITYLWCAEIVYWQWAHNLPRSSNLHW
                     KHQTWIDLHDGKHFQEWCDFLRDEVNQYPLKEVESTFEKILKFEYGFFDSCYNA"
     gene            complement(<287663..>287959)
                     /locus_tag="ZYRO0E03762g"
                     /db_xref="GeneID:8204645"
     mRNA            complement(<287663..>287959)
                     /locus_tag="ZYRO0E03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499056.1"
                     /db_xref="GeneID:8204645"
     CDS             complement(287663..287959)
                     /locus_tag="ZYRO0E03762g"
                     /note="similar to uniprot|P23059 Saccharomyces cerevisiae
                     YCR020C-A MAK31 Non-catalytic subunit of N-terminal
                     acetyltransferase of the NatC type required for
                     replication of dsRNA virus member of the Sm protein
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499101.1"
                     /db_xref="GeneID:8204645"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5E485"
                     /translation="MSKDLSQVSMEGLKLPDFVGCTLYVNLHNNRILKGSLMALDAQL
                     NLLLDHVQERAGDGNRRTLGLVSVPRKTIQAIKVPQAELNQLVQFKRNLLKNVV"
     gene            <288092..>288316
                     /locus_tag="ZYRO0E03784g"
                     /db_xref="GeneID:8204646"
     mRNA            <288092..>288316
                     /locus_tag="ZYRO0E03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499057.1"
                     /db_xref="GeneID:8204646"
     CDS             288092..288316
                     /locus_tag="ZYRO0E03784g"
                     /note="similar to uniprot|Q9URQ5 Saccharomyces cerevisiae
                     YCR020W-B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499102.1"
                     /db_xref="GeneID:8204646"
                     /db_xref="UniProtKB/TrEMBL:C5E486"
                     /translation="MSSASNSQRKYNNITLKTLTAYQLMSQRERMCELFQLLDDSERH
                     EHIVNPLKQENICNSMKENLRDIKNELGTN"
     gene            <288494..>289187
                     /locus_tag="ZYRO0E03806g"
                     /db_xref="GeneID:8204647"
     mRNA            join(<288494..288498,288563..>289187)
                     /locus_tag="ZYRO0E03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499058.1"
                     /db_xref="GeneID:8204647"
     CDS             join(288494..288498,288563..289187)
                     /locus_tag="ZYRO0E03806g"
                     /note="highly similar to uniprot|P28263 Saccharomyces
                     cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme that
                     negatively regulates gluconeogenesis by mediating the
                     glucose-induced ubiquitination of fructose-1
                     6-bisphosphatase (FBPase) cytoplasmic enzyme that
                     catalyzes the ubiquitination of histones in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499103.1"
                     /db_xref="GeneID:8204647"
                     /db_xref="GOA:C5E487"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5E487"
                     /translation="MSGGNSKRRIETDVMKLLMSDHEVELVNDNMQEFHVKFHGPKDT
                     PYETGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLK
                     NIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIKEYIDKYACAEKYEQLFGT
                     DDEDDDEDDDEDDEQENDEDDDEDVDGNGDEEVDGGSEELSDIEVSDEE"
     gene            <289636..>291756
                     /locus_tag="ZYRO0E03828g"
                     /db_xref="GeneID:8204648"
     mRNA            <289636..>291756
                     /locus_tag="ZYRO0E03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499059.1"
                     /db_xref="GeneID:8204648"
     CDS             289636..291756
                     /locus_tag="ZYRO0E03828g"
                     /note="highly similar to uniprot|P32775 Saccharomyces
                     cerevisiae YEL011W GLC3 Glycogen branching enzyme involved
                     in glycogen accumulation green fluorescent protein
                     (GFP)-fusion protein localizes to the cytoplasm in a
                     punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499104.1"
                     /db_xref="GeneID:8204648"
                     /db_xref="GOA:C5E488"
                     /db_xref="InterPro:IPR004193"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006048"
                     /db_xref="InterPro:IPR006407"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5E488"
                     /translation="MGADSEIPENVRGVVEFDSWLKPFVHVLSERRYLGDKWHYDITH
                     ATPDGSYQSLSKFARDSYRSYGLHADWETGEIRYREWAPNAQKAFLIGEFNNWNESSH
                     ELKSKDEFGVFHITIPPNADGSFAIPHDSKIKVMFVKPDGSKIYRLPAWITRATQPDR
                     ETAKAYGPGYEARFWNPEKPYEFKNKRPHFNQKVDSLRIYEAHVGISSPEPKVASYKE
                     FTQNVLPRIKHLGYDAIQLMAIMEHAYYASFGYQVTNFFAASSRYGTPEELKELIDTA
                     HGMGILVLLDVVHSHASKNAEDGLNEFDGSDHQYFHSIDSGRGSHPDWDSRLFNYGSF
                     EVQRFLLANLAFYIDVYQFDGFRFDGVTSMLYLHHGVGPSGAFSGNYNEYLSKEKSGV
                     DHEAVAYLMLANDLVHELLPQSAITIAEDVSGYPTLCLPRAMGGIGFDYRLAMALPDM
                     WIKLLKEQKDEDWEMGDIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMY
                     TDMSVLKPATLVIDRGMSLHKMIRLLTHSLGGEAFLAFEGNEFGHPEWLDFPNVNNGD
                     SFHYARRQFNLADDNLLRYRMLYEFDAAMQNCERKHQWLNTPQAYVSLKHEGDKVIAF
                     ERNGHLFMFNFHPTKSYTDYRFGVDVAGTYKIVLNSDRKEYGGYDRVDESARFFTTDL
                     AWNGRKNFIQVYIPSRVALVCALE"
     gene            complement(292308..292380)
                     /locus_tag="ZYRO0E03850r"
                     /db_xref="GeneID:8204649"
     tRNA            complement(292308..292380)
                     /locus_tag="ZYRO0E03850r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8204649"
     gene            <292938..>295847
                     /locus_tag="ZYRO0E03872g"
                     /db_xref="GeneID:8204650"
     mRNA            <292938..>295847
                     /locus_tag="ZYRO0E03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499060.1"
                     /db_xref="GeneID:8204650"
     CDS             292938..295847
                     /locus_tag="ZYRO0E03872g"
                     /note="similar to uniprot|P25618 Saccharomyces cerevisiae
                     YCR017C CWH43 Putative sensor/transporter protein involved
                     in cell wall biogenesis contains 14-16 transmembrane
                     segments and several putative glycosylation and
                     phosphorylation sites null mutation is synthetically
                     lethal with pkc1 deletion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499105.1"
                     /db_xref="GeneID:8204650"
                     /db_xref="GOA:C5E489"
                     /db_xref="InterPro:IPR005135"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="InterPro:IPR027317"
                     /db_xref="UniProtKB/TrEMBL:C5E489"
                     /translation="MVKINGKVVPLAHTVCASSAFLASLLAGCILHYDKIVRNSFFEY
                     PDEWFPSVSATIGSFYPERSIFQALIALAAIPRFLLILGHYYLSGSITTLIIGLVRTL
                     SCGGWVYITSTDDQDVHDLFMILYIALTLPWNVYVTKSSEKSKKWRKLISIGFFGTMV
                     PLVQHFVKHKVHMVPGAYSIYALLGWSLVALDIAFDAFSIKDFTSIEINLGLEPLQQG
                     TWLFKREETSSKPVNGVKDEKLVSNGKESKLATNSERDAPGLYPSTLPQVESYTYILT
                     NTYNSFIFWTAVTSITCSIWYFPLWNMGLSGYEAVMVYDLLPILLYIPYVPQIIHQHA
                     VLLGGLLVVGSHFVGLPESRLLVTGAGDALVVSAFVLNLKSIKRPEVNAAFTVTWLLG
                     LVISVILKFACHGNNPLWPITKAENGGYHNIGLIFTTIFGILAPYVNSLHFAPKDSSK
                     ADGKTTESIKSNKYKFFVGLGFGSIIFSLHRFFTDASALIYWSWEGWNQETQGPLAWP
                     WSGLTCLVMLLASLTSVRFSKNTWVPGILLLESTWVLCNRNITEWDNYLYGGLPYILG
                     VIWTIPSYFAALSELQSVGVIILGFVTYAFISFATVWTVAYAFVPLGWLLRERIEVVI
                     WFSTALIVIGLFVIKVPADTVNSISSKPLGNAFFKRILILTSVIAAMIGGFTFENRPT
                     GVPQPYHPESQMITAGIWTVHFGFDNNMWASEESMAFLLKSMELDVVGLLETDTQQIP
                     MGNRDITSKLAHDLNMYADYGPGPNKHTWGCVLLSKFPIVNSTHHLLPSPVGELAPAI
                     HATLKTYNDTLVDVFVFHGGQEEDELDRKLQSEVMAKLMGSTQRPTILLSYLVTDPHE
                     GNYNTYVSETSGMRDIDPSDYERWCEYILYKDLKKLGYARVSRGTVTDTELQVGKFQV
                     IPETQVKKLGEKLYDTVTLDTAEEDAHLFPEEFFDEGERGHYYHVFNRPRYFSLN"
     gene            complement(<295966..>296331)
                     /locus_tag="ZYRO0E03894g"
                     /db_xref="GeneID:8204651"
     mRNA            complement(<295966..>296331)
                     /locus_tag="ZYRO0E03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499061.1"
                     /db_xref="GeneID:8204651"
     CDS             complement(295966..296331)
                     /locus_tag="ZYRO0E03894g"
                     /note="similar to uniprot|P40342 Saccharomyces cerevisiae
                     YNR004W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499106.1"
                     /db_xref="GeneID:8204651"
                     /db_xref="GOA:C5E490"
                     /translation="MDLKFVIDNLQDLGVLPPDQSLTLGSQYQLIARDEQLSQKAIDK
                     CEKVFLQWSLNRGVNIEVLKRFQNLWSVIKGKDFPLVGFPYSNLTIQQVDVNQYISNQ
                     SEKLMKNLTVEEVEITDYV"
     gene            complement(<296502..>298217)
                     /locus_tag="ZYRO0E03916g"
                     /db_xref="GeneID:8204652"
     mRNA            complement(<296502..>298217)
                     /locus_tag="ZYRO0E03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499062.1"
                     /db_xref="GeneID:8204652"
     CDS             complement(296502..298217)
                     /locus_tag="ZYRO0E03916g"
                     /note="weakly similar to uniprot|Q12300 Saccharomyces
                     cerevisiae YDL138W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499107.1"
                     /db_xref="GeneID:8204652"
                     /db_xref="GOA:C5E491"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E491"
                     /translation="MKIDKKQIGCALMGKRINYRVTIYDKFPKIYNIFVIGFTSCISG
                     LMFGFDVSSMSSMIGTDGYKEYFGTPGPTEQGGITACMPAGSFVASLIAPYFSDNFGR
                     RVSLHLCAIFWMIGAVLQCASQDLAMLCVGRVVSGLGIGFGSSVAPVYCSEIAPPKIR
                     GAIGGLFQFSVTLGIMILFFIGYGAHFINGAGSFRLTWGIELVPGACLLIAVFFLPES
                     PRWLALHDYWEEAEDIVIRVAAKGNRENEQVMIQLEEIREQVEIDKEAEAFQLKDLFR
                     PKTRVKTMVGMMAQMWQQMCGMNVMMYYIVYIFTMAGFKGGAVLVSGSIQYVLNVVMT
                     IPALFLMDKCGRRPVLLIGGLLMCAWLFAVGGLLATYSDPYPHGFEGDETVRIAIPQS
                     NKPAANGVIACSYLFVCSYAPTWGVCIWIYCAEIFNNTERAKGSGLCTAVNWIFNFAL
                     ALFVPSAFKNLTWKTYIMFGVFCVALTINTFLLFPETKGKTLEEIDQMWEAHIPAWKT
                     HSWVPTIPSASKFDQEMHKTDLEHVEDTGDSDRISPKDDSEKGSVTGLEEVAKSNPNS
                     TSLSE"
     gene            complement(<299150..>300019)
                     /locus_tag="ZYRO0E03938g"
                     /db_xref="GeneID:8204653"
     mRNA            complement(<299150..>300019)
                     /locus_tag="ZYRO0E03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499063.1"
                     /db_xref="GeneID:8204653"
     CDS             complement(299150..300019)
                     /locus_tag="ZYRO0E03938g"
                     /note="similar to uniprot|P25617 Saccharomyces cerevisiae
                     YCR016W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499108.1"
                     /db_xref="GeneID:8204653"
                     /db_xref="InterPro:IPR019327"
                     /db_xref="UniProtKB/TrEMBL:C5E492"
                     /translation="MSEHVPAWKRITIKKNQQRDSTNANEEEDDPLNITTHLATGSLT
                     KKQKQKIIRGEDREDTDLPSNKKTKSDKKKEKLPREERDARKQNVLKDQLRYLIEFYL
                     NKVNPKNLPDSLSSLTNVRNNYSEKFNNDDQDDDDNSSESEVIDIWKFSKQKQNWLIK
                     HFFNAEEIPVEYDELLLSYFKELKSPAIKDRVTAVCKANVSQWNEYIDQQDEKMRRIV
                     EGEEEQEVTKEDDAKEHDTKEDDMKEKEEKKKEEDELTPPDKRVVKRSQELLKLWQVE
                     PLIELKRFNDDAF"
     gene            complement(300551..300634)
                     /locus_tag="ZYRO0E03960r"
                     /db_xref="GeneID:8204654"
     tRNA            complement(300551..300634)
                     /locus_tag="ZYRO0E03960r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAA) cove score=70.82"
                     /db_xref="GeneID:8204654"
     gene            complement(301350..301433)
                     /locus_tag="ZYRO0E03982r"
                     /db_xref="GeneID:8204655"
     tRNA            complement(301350..301433)
                     /locus_tag="ZYRO0E03982r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAA) cove score=70.82"
                     /db_xref="GeneID:8204655"
     gene            <301742..>302785
                     /locus_tag="ZYRO0E04004g"
                     /db_xref="GeneID:8204656"
     mRNA            <301742..>302785
                     /locus_tag="ZYRO0E04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499064.1"
                     /db_xref="GeneID:8204656"
     CDS             301742..302785
                     /locus_tag="ZYRO0E04004g"
                     /note="similar to uniprot|P25616 Saccharomyces cerevisiae
                     YCR015C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499109.1"
                     /db_xref="GeneID:8204656"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5E493"
                     /translation="MLKGNFSNFSSFVLRGIDIEVCKHLSSTCQCISTLKRIYTTMNN
                     VIIADFDETVTNRDTTCIVGQLPYTLDPKLKPAWSHFVDVYYEHYKKFQSNINSRVLP
                     LLPLGKETVITDTNFTQLFHAEVDFQTSKRLLELSSTTEIESRNVFKGVKHEQVRSFV
                     ENNLQGADSLLRPGFSNFISLVPKDNFHVVSVNWSPEFIRHVIGDEKIHPHHIACNNL
                     ISDGDEYTGQFTNDLLTGSDKIKVIQQILSYYDSKESDHCLWYVGDSDTDLLSVLFPN
                     INGVLLIDPIKESKKFQKLTVQLLGLPQKEMDEFAHDSSLGWYTCCTKQGGKTVYIVK
                     SWNDLQRLIFGEN"
     gene            complement(<302794..>304305)
                     /locus_tag="ZYRO0E04026g"
                     /db_xref="GeneID:8204657"
     mRNA            complement(<302794..>304305)
                     /locus_tag="ZYRO0E04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499065.1"
                     /db_xref="GeneID:8204657"
     CDS             complement(302794..304305)
                     /locus_tag="ZYRO0E04026g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499110.1"
                     /db_xref="GeneID:8204657"
                     /db_xref="UniProtKB/TrEMBL:C5E494"
                     /translation="MKISRNSSHRQNRQNSICRPSTVANAANADQIFWNTSTPVLTTD
                     VFEELELPTRRTHSNTNSFSFDQSCFTELPFNEAPEVLQSPDDCCLPQFEEVLELDKN
                     LEQMPAHKLKQFLFLHSVVNSSSDDSQFTDSGTESEEYWIDNPPSAGGGFYRFDVVEV
                     PIPLEGQGQQVQVDPEEDVKKMLTEPQVIFYSVPLSIKHLLCTHDNLMGLCENITLER
                     IVRRRTLSKIIPMSSEGVRRFFPLEVDFSSSKEGCNDVVNVCAFIQTLSNNFQRKLGS
                     FFNTTFQFSYKFNCGKFYIKYGIFDDNFDFTFGSNLIDLHAFSRYLPETDERLDDKGL
                     NSRRKKRCHKTSRAWKTFVTMAEVFTIIDYMLKGKFSWVQNNRKLLDYISKGGSIKVA
                     SKQYDTTVRKNQQRILSNVRKYIRNKELMPLKEAKERNIMNDSQLEFHNGLYDQIIGF
                     YENIGRELPQSRVKMYVIELNDLEAVIAQILDKYVYEQYEVTADHDNASNYKT"
     gene            <304608..>306266
                     /locus_tag="ZYRO0E04048g"
                     /db_xref="GeneID:8204658"
     mRNA            <304608..>306266
                     /locus_tag="ZYRO0E04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499066.1"
                     /db_xref="GeneID:8204658"
     CDS             304608..306266
                     /locus_tag="ZYRO0E04048g"
                     /note="similar to uniprot|P25615 Saccharomyces cerevisiae
                     YCR014C POL4 Probable homolog of mammalian DNA polymerase
                     beta may function in double-stranded DNA break repair DNA
                     polymerase IV"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499111.1"
                     /db_xref="GeneID:8204658"
                     /db_xref="GOA:C5E495"
                     /db_xref="InterPro:IPR002008"
                     /db_xref="InterPro:IPR002054"
                     /db_xref="InterPro:IPR010996"
                     /db_xref="InterPro:IPR022312"
                     /db_xref="InterPro:IPR027421"
                     /db_xref="InterPro:IPR028207"
                     /db_xref="InterPro:IPR029398"
                     /db_xref="UniProtKB/TrEMBL:C5E495"
                     /translation="MAILKDHTFLFLPNVSSSTLDFLAGLIAKEGGKVIEDVNQLDPE
                     TVVLINDSFVGEGENIIHEDILRRESDLDIDYIYDYITENSVKCVRASKVSRWLKDGQ
                     LVISKPELVQLIPTEEEKSAYENVSSDSESATDVEGTDGGERSPSKDQHEGQETPKGS
                     DGEDSRSLETNWSKNELVIKFLDILAHRYKVKGDNFRSRGYNLAKIGIQRLPHEIESG
                     VQAQKEVSNVGSSIAKKIQTILDTGTLPGAYESPQFEESLQYLSKCHNVGTYTARRWT
                     NLGLKSFAEVSQKFPHELKTDWPILFGWSFYEDWSIPIPRQECSQIERIVNQELKSVD
                     PACQVEIQGSYLRGADYCGDLDMLFHKKNCNDTTELSSIMEEVAIRLYDKGYIKCFLQ
                     LTPRICELFAPKILDRFKKCNLQAKTITPSNERIKKFYFGFQIPGSTAKNGNPKSLLL
                     SDDQFMSLNTKVGNPCRRVDFFSCKWSELGASRLQWTGPKEFNRWLRMIAIEKGMKLT
                     QHGLFDKNDVLIESFIDTKIFQALDQPYIGPEERNHVFKKRRSK"
     gene            complement(<306419..>307669)
                     /locus_tag="ZYRO0E04070g"
                     /db_xref="GeneID:8204659"
     mRNA            complement(<306419..>307669)
                     /locus_tag="ZYRO0E04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499067.1"
                     /db_xref="GeneID:8204659"
     CDS             complement(306419..307669)
                     /locus_tag="ZYRO0E04070g"
                     /note="highly similar to uniprot|P00560 Saccharomyces
                     cerevisiae YCR012W PGK1 3-phosphoglycerate kinase
                     catalyzes transfer of high-energy phosphoryl groups from
                     the acyl phosphate of 1 3-bisphosphoglycerate to ADP to
                     produce ATP key enzyme in glycolysis and gluconeogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499112.1"
                     /db_xref="GeneID:8204659"
                     /db_xref="GOA:C5E496"
                     /db_xref="InterPro:IPR001576"
                     /db_xref="InterPro:IPR015824"
                     /db_xref="InterPro:IPR015901"
                     /db_xref="InterPro:IPR015911"
                     /db_xref="UniProtKB/TrEMBL:C5E496"
                     /translation="MSLSSKLSVDNLNVQGKRVFIRVDFNVPLDGKTITSNQRIVAAL
                     PTIKHVLSQNPRYVVLASHLGRPNGERVEKYSMEPVAGELQKLLDQPVTFVNDCVGPQ
                     VTKAVEESKPGSVLLLENLRFHIEEEGSKKVDGQKVKASPESIEAFRKELSSLADVYI
                     NDAFGTAHRAHSSMVGFDLPQRAGGYLLNKELTFFGKALENPERPFLAILGGAKVADK
                     IQLIDNLLDKVNILIIGGGMSFTFKKVLDNTQIGDSIFDQAGSELVPKLVEKAKKNNV
                     EIVLPVDWVVGDKFGPDANTKVVSEKEGIPAGWQGLDSGPESRKLFAAAVAKAKTIVW
                     NGPPGVFEFEKFAEGTKALLDEVVKASSAGVTVIIGGGDTATVAKKYGAADKISHVST
                     GGGASLELLEGKTLPGVAFLSNKN"
     gene            <308495..>311683
                     /locus_tag="ZYRO0E04092g"
                     /db_xref="GeneID:8204660"
     mRNA            <308495..>311683
                     /locus_tag="ZYRO0E04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499068.1"
                     /db_xref="GeneID:8204660"
     CDS             308495..311683
                     /locus_tag="ZYRO0E04092g"
                     /note="similar to uniprot|P25371 Saccharomyces cerevisiae
                     YCR011C ADP1 Shows homology to ATP-dependent permeases
                     Active transport ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499113.1"
                     /db_xref="GeneID:8204660"
                     /db_xref="GOA:C5E497"
                     /db_xref="InterPro:IPR000742"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR013032"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E497"
                     /translation="MLKVQLHVLLLLFSVQWTRVMGIGFDQVEFRTRTTLSRPDRDSA
                     GGDAAAGGNGDGDKCPPCFNCMLPIFECKQYSECNSNTGRCECIPGFAGDDCSIPVCG
                     GLDEPNGRRPQRDNGSDTCQCKAGWGGINCNICEEDFACDAFMPGPELKGTCYKNGMI
                     VNKSYQGCNVTNEKILQTLKGRIPQVTFSCDNHTKDCNFQFWIDRIESFYCGLDRCQF
                     EYDLKSNSSHYNCESARCKCVPNTTLCGAKGSIDISDFLTQTVKGPGDFVCDLQTKKC
                     RFSEPSMNDLISTIFGDPYIMLECRGGECLHYSEIPGYMPPDKDISMSWQANLILALT
                     SVLVLLLVTFVTFCISKSPLFKNDPLALEGDDFLSGGGGGGATSAQEPSDANFLKTDV
                     EAVLTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKK
                     KAGKVSGQIKVNGKSISKKDYTKLIGFVDQDDYLLQTLTVFETVLNSALLRLPRALPF
                     EAKRSRVYKVLEELRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLILFLDEP
                     TSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSGE
                     AIRVNEFLRNNGYQCPTEYNIADYLIDITFETQLQSKKRARAASSRSGMQVTPDVLQN
                     PTSGIDANKNAIHPALEEGSGSVPSVTQREWEHLAGHRDEIRTLLKDSVSQEHETVGS
                     MNTRLLHNRFKDGPYYAQLSHDIATILTNYATAQMELPSSMNSASFPQQLSILCSRTF
                     KNIYRNPKLLLANYLMTLLLGGFLGTLYYDVSNDISGFQNRLGLFFFIMTYFGFVTLT
                     GLSSFAVERIIFIKERSNNYYSPLAYYFSKILSDVLPLRVIPPVILGLVVYPLVGLNM
                     DNHAFFKFIGILVLFNLGISLEILSIGIIFEDLSNSIIFSVLVLLGSLLFSGLFINTK
                     EITSVAFKYLKNFSLFYYAYESLLINEVKSLMLREKKYGLDIEVPGATILSTFGFSVQ
                     NLGLDIKILGVFSTVFLIIGYVALKLIVVEQK"
     gene            <311897..>312835
                     /locus_tag="ZYRO0E04114g"
                     /db_xref="GeneID:8204661"
     mRNA            <311897..>312835
                     /locus_tag="ZYRO0E04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499069.1"
                     /db_xref="GeneID:8204661"
     CDS             311897..312835
                     /locus_tag="ZYRO0E04114g"
                     /note="highly similar to uniprot|P32910 Saccharomyces
                     cerevisiae YNR003C RPC34 RNA polymerase III subunit C34
                     interacts with TFIIIB70 and is a key determinant in pol
                     III recruitment by the preinitiation complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499114.1"
                     /db_xref="GeneID:8204661"
                     /db_xref="GOA:C5E498"
                     /db_xref="InterPro:IPR007832"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016049"
                     /db_xref="UniProtKB/TrEMBL:C5E498"
                     /translation="MGNLLENALQLSDQAKDLHTKMLDKGPSVLFTQPELQETSGIAS
                     LNDLMPIVQELLDKNLIKLVKQNNELKFQAVDIFEAQKKSAMSAEESLVYSYIEASGR
                     EGIWTKTIKAKTNLHQHVVLKCLKSLESQRYVKSVKSVKYPTRKIYMLYNLQPSIDVT
                     GGPWFTDSELDVEFINSLLTIVWRFASDRTFPNGFKNFSGNDKKELLYAPNVKNYSTI
                     QDILDFIVASQVVNVELTPANIRSLCDVLVYDDKMEKISHDCYRVTLESVRQMTQYGG
                     LISNDDDGEFSIFDYFNLIAPSQNDKEAVYFDEWIL"
     gene            <313002..>313727
                     /locus_tag="ZYRO0E04136g"
                     /db_xref="GeneID:8204662"
     mRNA            <313002..>313727
                     /locus_tag="ZYRO0E04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499070.1"
                     /db_xref="GeneID:8204662"
     CDS             313002..313727
                     /locus_tag="ZYRO0E04136g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499115.1"
                     /db_xref="GeneID:8204662"
                     /db_xref="UniProtKB/TrEMBL:C5E499"
                     /translation="MGRRSIKQDTKGTVTTNTTDFSKRSKFASSLREYVHKIKEFCYP
                     VECTTTQYFHHFRRWKNAKQSYTFVESIPRIGKEVVITPEKKEEKEKEYENDLQRMLS
                     LRKIKHQDPEQYRMGCMMLKWYFESKSRRNNHERINGDATGKLFNENEEQQKNASRHN
                     HPTFKPASEIANTQAFTNNLKLSINKHGRIPRQTKFRPLDRCGRHSQEPFELEVENDK
                     GTANERILDDLVHMIDDYLGDTN"
     gene            <314271..>315056
                     /locus_tag="ZYRO0E04158g"
                     /db_xref="GeneID:8204663"
     mRNA            <314271..>315056
                     /locus_tag="ZYRO0E04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499071.1"
                     /db_xref="GeneID:8204663"
     CDS             314271..315056
                     /locus_tag="ZYRO0E04158g"
                     /note="similar to uniprot|P25613 Saccharomyces cerevisiae
                     YCR010C ADY2 Accumulation of DYads member of the TC 9.B.33
                     YaaH family of putative transporters Protein involved in
                     Accumulation of DYads"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499116.1"
                     /db_xref="GeneID:8204663"
                     /db_xref="GOA:C5E4A0"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:C5E4A0"
                     /translation="MMQAQSDAVGRIATEGDNNEYIRFGHQKYLKSDLYEAFGGTLQP
                     GLAPASEHRFANPAPLGLSAFAATTFMLSLINAKAQNVTIPNAIVGPAIFYGGIVQII
                     AGIWEIALENAFGGTALCSYGGFWMSYAAIYIPWFGITKAYEGEESELSNAVGFFLLA
                     MTIFTLGITICTMKSTLMFFLLFFLLDITFLLLAISEFTGKFGVKRAGGILGVIVALL
                     AWYNAFAGLATRQNSYLTGHPVPLPTNEYTLTNITGRNRRRVN"
     gene            <315499..>316374
                     /locus_tag="ZYRO0E04180g"
                     /db_xref="GeneID:8204664"
     mRNA            <315499..>316374
                     /locus_tag="ZYRO0E04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499072.1"
                     /db_xref="GeneID:8204664"
     CDS             315499..316374
                     /locus_tag="ZYRO0E04180g"
                     /note="similar to uniprot|P32907 Saccharomyces cerevisiae
                     YNR002C FUN34 Putative transmembrane protein involved in
                     ammonia production member of the TC 9.B.33 YaaH family
                     homolog of Ady2p and Y. lipolytica Gpr1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499117.1"
                     /db_xref="GeneID:8204664"
                     /db_xref="GOA:C5E4A1"
                     /db_xref="InterPro:IPR000791"
                     /db_xref="UniProtKB/TrEMBL:C5E4A1"
                     /translation="MSFSDVEKRQSTDSDAAYEQPTGFSTGAYNVGDDNSSANEHGVH
                     RVFTAGDNDEYVVIGRRKFLKDDLFQAFGGTLNPGLAPPSEHKFANPAPLGLSGFALT
                     TFVLSMIKAKAQGLTIPNVVVGPAMFYGGIVQVIAGVWELALENTFGGTALCSYGGFW
                     MSFSALYIPWFGIVDAYKDDQDQLGNAVGIYLLGWAIFTYGLSVCTMKSTLMFFALYF
                     LLGTTFLLLAIGSITDNFGVNRAGGVLGIIVAFIAWYNAFAGLANKRNSYVQCKAIPL
                     PNNDWHFGRMVHHRR"
     gene            <316577..>317380
                     /locus_tag="ZYRO0E04202g"
                     /db_xref="GeneID:8204665"
     mRNA            <316577..>317380
                     /locus_tag="ZYRO0E04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499073.1"
                     /db_xref="GeneID:8204665"
     CDS             316577..317380
                     /locus_tag="ZYRO0E04202g"
                     /note="highly similar to uniprot|P25343 Saccharomyces
                     cerevisiae YCR009C RVS161 BAR adaptor protein subunit of a
                     complex (Rvs161p Rvs167p) that regulates actin endocytosis
                     and viability following starvation or osmotic stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499118.1"
                     /db_xref="GeneID:8204665"
                     /db_xref="GOA:C5E4A2"
                     /db_xref="InterPro:IPR004148"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:C5E4A2"
                     /translation="MSWEGFKKAINRAGNSVMIKNVDKTIDKDFDIEERRYRVLQKAG
                     DALQKEAKGYLDSLRAVTASQVTVAEVISNLYDDSKFINSSTGGYNVGNYYLQCVQDF
                     DTETVKQLDGPFRETVLDPVTKFSGYFKEINEAMKKREHKKQDYDAAKAKTRRLVDKP
                     AKDATKLPRAEKELNLAKDVYENLNESLKQELPQLVALRVPYYDPSFEALVKIQLRFC
                     TDGYTRLAQIQQYLDQQSRDDYANGLLDDRIDSLLQQMQSLDICALGIK"
     gene            <317895..>321641
                     /locus_tag="ZYRO0E04224g"
                     /db_xref="GeneID:8204666"
     mRNA            <317895..>321641
                     /locus_tag="ZYRO0E04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499074.1"
                     /db_xref="GeneID:8204666"
     CDS             317895..321641
                     /locus_tag="ZYRO0E04224g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499119.1"
                     /db_xref="GeneID:8204666"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E4A3"
                     /translation="MRYMANETGRRGYYGNKSSAFLSLRKFKTFCSTVIRHPKINIVL
                     PLLIAVILSSKLFSIAISARQIWRELNGNQYISKVEILDDHNAGRIRENSHLVLLQVW
                     MRCVGENFDNILGKRTLLESLALQNKLLNNVSTAMMVKSPFQLWNHSLKNLRSDPAPL
                     QTINSNLLSLPQYSFFGTWKINGLVSSAAGITISILVNSTDSQKLLDSLNYNVVHLNG
                     MSNITNFHIFPPLNVNSAENESLRLYMIKLGSHYKTIFSLLHLAVFVYFVFSMKRLKK
                     TVKSVVGIILAMVAQLLFTIGSAITLTNFFYKSSNDNIPFRALSCAVIFFTMNEQIRL
                     LDDTSGSTFESKALEDSEGFALTQAYDPGDVTADRSFPSCAALSQIKSTKSAFLLSIV
                     ITFLIPFSRKATFFLLLSLWFGHFLGCTFFTAVLSLDHRRLEENDLISIDSNVLLDEE
                     ISSVSNYASLEQQLFRYLKSSCRNRYSVILTVLYLVIFNINFTVARSSSSLIFKVFRG
                     GINKVFKFGRPIPNVIFDQKFIADAAFNLIKNDENQGTSSLLANLTVKDPFLVLKYQE
                     ELNLNELGSQLSSIFDASAFTASYKLDFYYVFEFLLSVVLLLSCTLLVLQKLMEKLDH
                     INSFQFTNGDSLENSMTHAEAKRSKAGKNNYLQNLPHISEDTGSKLQSPNHFHAKELY
                     RGGHSLDIVGISTSKCPFVVSVGLDYRVLVWSPLLKPIPNPTSIPLSRKFWPLSKVVL
                     SNDGYYIAFFGKNGSITCWSRRQMKFVWELQLKRDRQTKDPSIIAPPLEAFFRKITAP
                     AFRRRRLPPAAALRPDVNSRRSSVNSIDYAARLAEGGLDVAYEKVVFSQANPDEKDEL
                     VFVTPSGYLYSIQTDGELHVEKLTSSKHSLKSCKLLSSPRVSDRLVACDDVGDLYVST
                     VVNNKWRPRTLTVNYNRMLEPSTHFSKMEEDRSATPSVDEAQIMSKTDYTIELVSFVG
                     LILRVIGKEAELIDAMTGCVIRTFAIGLLKPNSLRVFHDNPTHCRFCGSASVASFSIA
                     YTSFDNERVALHTFKLESKTKNSICLRVERDPREIRCLGMESAFETVHYFYDAEDWCV
                     TNNNMLIGIRRVPQNIKVKTGTTSVDTRTGTADNESSGLIRRKYDKSERESKVNDSSD
                     FRIHNIWEGWTMTASGKISLQKIPIGVNGLLVNRLGPLTRYGAKAVIVGFSNIMNMFY
                     VGHEELIFNPEKEDANKEELSLRFVNKRRDRLSNKKLPLNYSSL"
     gene            complement(<322215..>324035)
                     /locus_tag="ZYRO0E04246g"
                     /db_xref="GeneID:8204667"
     mRNA            complement(<322215..>324035)
                     /locus_tag="ZYRO0E04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499075.1"
                     /db_xref="GeneID:8204667"
     CDS             complement(322215..324035)
                     /locus_tag="ZYRO0E04246g"
                     /note="similar to uniprot|P25333 Saccharomyces cerevisiae
                     YCR008W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499120.1"
                     /db_xref="GeneID:8204667"
                     /db_xref="GOA:C5E4A4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E4A4"
                     /translation="MISNSDHCMAPMAAVHAPASSTTGGVSRKNTLSKMAKLFGAGNS
                     TKNLQHQQQQNHHHLHQENSNGKVRTDAAKSEYYQSTPALMPNGKSPLSPASSTSSIA
                     SSVSAVSITSNSPSAATTPGATGAAPSLGSSKIRDHNNVNDPTISHTSSLSNISSAYS
                     GSATNLASFQGPSGRFVVHEDGTHEHHLKNTKRQEKLTRMIKSMAVSQKVRGQAKSAV
                     PEIMIENKGNQQNQQNQQNQQGQQQRLDPPTLFAGLIKQMGSVNESERENTPFSGASY
                     GPDKRLYTPSLVGAAATPGATTTNNSTAAIAKRDSLCLAEKYGRCQEVLGKGSFGVVR
                     VCHKKTMNSAGNGKGEVLYAVKEFKKKPSEPAEKYAKRLTSEFCISSSLRHINIIMTL
                     DLFQDVKGDYCEVMEYCAGGDLFTLVITAGKLEYLEADCFFKQLIRGVVYMHDMGVCH
                     RDLKPENLLLTSDGTLKIIDFGNSECFQMAWEKDIHLSGGVCGSSPYIAPEEYTQEEF
                     DPRPVDIWACGVIYMAMRTGRQLWKVAQKEDPFFAKYLRKRKEKGGFEPIENLKRARC
                     RNVIYSMLDPVASRRINGKQILNSEWGREIKCCNDGHSLD"
     gene            complement(325279..325352)
                     /locus_tag="ZYRO0E04268r"
                     /db_xref="GeneID:8204668"
     tRNA            complement(325279..325352)
                     /locus_tag="ZYRO0E04268r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=73.16"
                     /db_xref="GeneID:8204668"
     gene            <326162..>327577
                     /locus_tag="ZYRO0E04290g"
                     /db_xref="GeneID:8204669"
     mRNA            <326162..>327577
                     /locus_tag="ZYRO0E04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499076.1"
                     /db_xref="GeneID:8204669"
     CDS             326162..327577
                     /locus_tag="ZYRO0E04290g"
                     /note="highly similar to uniprot|P00890 Saccharomyces
                     cerevisiae YNR001C CIT1 Citrate synthase catalyzes the
                     condensation of acetyl coenzyme A and oxaloacetate to form
                     citrate the rate-limiting enzyme of the TCA cycle nuclear
                     encoded mitochondrial protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499121.1"
                     /db_xref="GeneID:8204669"
                     /db_xref="GOA:C5E4A5"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR010109"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:C5E4A5"
                     /translation="MSVLSQSTRTTLARHALKSARFQFIAQRYYSNAEKTLKERFAEI
                     FPAKAEEIKKLKKEHGQTVIDQVKLEQAFGGMRGIKGLVWEGSVLDPEEGIRFRGRTI
                     PEIQKQLPKAAGGDEPLPEALFWLLLTGEVPSESQVKAFSADLASRSELPKHVVELLD
                     NLPKDLHPMAQFSIGITALESESKFAKAYAQGVAKKDYWNYAFEDSLDLLGKLPVIAA
                     KIYRNVFKDGKLAAIDPNADYGSNLASLLGFENGQFVELMRLYLTVHSDHEGGNVSAH
                     TTHLVGSALSSPYLSLAAGLNGLAGPLHGRANQEVLEWLFKLREEVKGDYSPEVIEKY
                     LWDTLNSGRVVPGYGHAVLRKTDPRYTAQREFALKHFPDYELFRLVSTIYQVAPDVLT
                     KHGKTKNPWPNVDSHSGVLLQYYGLSEASFYTVLFGVARAFGVLPQLIIDRAIGAPIE
                     RPKSLSTEKFINLVKSIENKN"
     gene            <328509..>329432
                     /locus_tag="ZYRO0E04312g"
                     /db_xref="GeneID:8204670"
     mRNA            <328509..>329432
                     /locus_tag="ZYRO0E04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499077.1"
                     /db_xref="GeneID:8204670"
     CDS             328509..329432
                     /locus_tag="ZYRO0E04312g"
                     /note="highly similar to gnl|GLV|DEHA0F18447g Debaryomyces
                     hansenii DEHA0F18447g and similar to YCR004C
                     uniprot|P25349 Saccharomyces cerevisiae YCR004C YCP4
                     Protein of unknown function, has sequence and structural
                     similarity to flavodoxins; green fluorescent protein
                     (GFP)- fusion protein localizes to the cytoplasm in a
                     punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499122.1"
                     /db_xref="GeneID:8204670"
                     /db_xref="GOA:C5E4A6"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C5E4A6"
                     /translation="MGKVAIITYSMYGHIDTLAKAVQKGVEAAGGQADLYRVEETLPE
                     EALEKMNAPEKNPDVPVATPETLLEYDAFLLGIPTRFGSLPAQWSAFWDHTGSLWAQG
                     ALAGKIAGAFVSTASPGGGQETTLRSALSYLTHHGIIYVPLGYRDVFAELGNVEELHG
                     GSPWGAGTLAGADGSRTPSALELRIAEIQGKSFYETSLRFETTSSHGSGAAAATESGA
                     AGATTDSGAAGAATDSGASAATGAAATGKKASSPKGKSPSSNGAAAGSSDGAAKSGGK
                     PSGSANGAQGTPDRPIPVQKDGKKKKKCIIM"
     gene            <330667..>331098
                     /locus_tag="ZYRO0E04334g"
                     /db_xref="GeneID:8204671"
     mRNA            <330667..>331098
                     /locus_tag="ZYRO0E04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499078.1"
                     /db_xref="GeneID:8204671"
     CDS             330667..331098
                     /locus_tag="ZYRO0E04334g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499123.1"
                     /db_xref="GeneID:8204671"
                     /db_xref="UniProtKB/TrEMBL:C5E4A7"
                     /translation="MCEIWYFKLKTTNNWIKRQYCKGSRIGDSNRGIYDKEMEHKYNE
                     LEKKDEELQKTRAKIILLQNEVESFLKESCLMKDTSIVVEEDLYFHMVNVILERKLQA
                     EGKNGHRQTESADTWKGLEKMQENIEQLKMKNNESLSKDSQ"
     gene            complement(<332059..>332619)
                     /locus_tag="ZYRO0E04356g"
                     /db_xref="GeneID:8204672"
     mRNA            complement(<332059..>332619)
                     /locus_tag="ZYRO0E04356g"
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /transcript_id="XM_002499079.1"
                     /db_xref="GeneID:8204672"
     CDS             complement(332059..332619)
                     /locus_tag="ZYRO0E04356g"
                     /note="similar to uniprot|P25348 Saccharomyces cerevisiae
                     YCR003W MRPL32 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL32"
                     /protein_id="XP_002499124.1"
                     /db_xref="GeneID:8204672"
                     /db_xref="GOA:C5E4A8"
                     /db_xref="InterPro:IPR002677"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:C5E4A8"
                     /translation="MSSIGFSMSRFYLSATTLLPWVKPLGGPMIGELPKQLPESLRKW
                     IDQRTKKNEEGSIVEEDFFSNNGRLLAVPKKKVTHQKKRQRLYAPGKKQLKFIHELNK
                     CPSCGHYKRANCLCMHCVQHVRHIWKTQTVKERQEPSQEQELSDLDKRILYPGKKETE
                     YNKKLKDKDSYLERRMRTLPVEEKDK"
     gene            <332944..>333924
                     /locus_tag="ZYRO0E04378g"
                     /db_xref="GeneID:8204673"
     mRNA            <332944..>333924
                     /locus_tag="ZYRO0E04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499080.1"
                     /db_xref="GeneID:8204673"
     CDS             332944..333924
                     /locus_tag="ZYRO0E04378g"
                     /note="highly similar to uniprot|P25342 Saccharomyces
                     cerevisiae YCR002C CDC10 Component of the septin ring of
                     the mother-bud neck that is required for cytokinesis
                     septins recruit proteins to the neck and can act as a
                     barrier to diffusion at the membrane and they comprise the
                     10nm filaments seen with EM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499125.1"
                     /db_xref="GeneID:8204673"
                     /db_xref="GOA:C5E4A9"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4A9"
                     /translation="MSAPPALAGIQPTSYVGFDTITSQIEHRLLKRGFQFNVMVVGHS
                     GLGKSTLINTLFASHLIDSATGTDITQVPVTKTTEMKVSSHTLLEDRVRLNINVIDTP
                     GFGDQINNNKVWEPIVKYIKEQYSQYLRKELTAQRDRYIRDSRVHAVLYFLQPNGKGL
                     SALDIAALKKLTEIANVIPVIAKADTLTLEERAHFREIIQQEFKKHKFRIYPYDTDEL
                     TEEELELNESIRSIVPFAVVGSEREIEVNGETFRGRKTRWGAVNVEDINQCEFVYLRE
                     FLIRTHLEDLIETTSYIHYEGFRARQLIALKENASSRTSAGPSNGGAYQR"
     misc_feature    complement(334844..335012)
                     /note="Centromere Zyro0E"
     gene            complement(<335131..>336309)
                     /locus_tag="ZYRO0E04422g"
                     /db_xref="GeneID:8204674"
     mRNA            complement(<335131..>336309)
                     /locus_tag="ZYRO0E04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499081.1"
                     /db_xref="GeneID:8204674"
     CDS             complement(335131..336309)
                     /locus_tag="ZYRO0E04422g"
                     /note="uniprot|Q96WU4 Zygosaccharomyces rouxii el001w
                     Hypothetical protein el001w similar to YNL001W
                     uniprot|P33309 Saccharomyces cerevisiae YNL001W DOM34
                     Probable RNA- binding protein functions in protein
                     translation to promote G1 progression and differentiation
                     required for meiotic cell division"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499126.1"
                     /db_xref="GeneID:8204674"
                     /db_xref="GOA:C5E4B0"
                     /db_xref="InterPro:IPR004405"
                     /db_xref="InterPro:IPR005140"
                     /db_xref="InterPro:IPR005141"
                     /db_xref="InterPro:IPR005142"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5E4B0"
                     /translation="MKLIKEVRPSNNSDEAHITLIPQEKEDLFTIHQLVGKGDELIFK
                     RKVTSSVKEDANKKKQQELKRLRIVVESEEFDMKEESLRYKGKTVRDNDVPDKDDYPV
                     GVFFSTNIDYTYPITIIKYDFNAYHKKLLKEATQPASRADTAAVVLQEGLAHVCVLTA
                     SSTILKQKVEYTLPKKKRATDVAKFDEKTQKFYKAIYESIKRNFDFEKLKMIILCSPG
                     FYAKTLYDKIIQYAQEEQNKVLINNKGKFLVAHSSTGYIQGITEVLKNPSYASKLQDT
                     KFSQEVLIIDQFLQHLNDDDFKAWYGEAEVTKAVDLGAVNTLLITDTLMRSDDIDQRK
                     KSLDLAQQVERLGGKVAVFSALHNSGEELNRLTGIACILNYPIPDLDEDLEEDEEEDD
                     "
     gene            complement(<336625..>337185)
                     /locus_tag="ZYRO0E04444g"
                     /db_xref="GeneID:8204675"
     mRNA            complement(<336625..>337185)
                     /locus_tag="ZYRO0E04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499082.1"
                     /db_xref="GeneID:8204675"
     CDS             complement(336625..337185)
                     /locus_tag="ZYRO0E04444g"
                     /note="similar to uniprot|P25560 Saccharomyces cerevisiae
                     YCL001W RER1 Protein involved in retention of membrane
                     proteins including Sec12p in the ER localized to Golgi
                     functions as a retrieval receptor in returning membrane
                     proteins to the ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499127.1"
                     /db_xref="GeneID:8204675"
                     /db_xref="GOA:C5E4B1"
                     /db_xref="InterPro:IPR004932"
                     /db_xref="UniProtKB/TrEMBL:C5E4B1"
                     /translation="MELEEGDRSQLNTLSPISVRYHRALTIYRYYLDKSVPLIKERWG
                     ALILLLFLFELRVVLTHKWYLSCYTHGIFLLNQFLAFLTPKFDLSLQQDEENKELEAG
                     ERSEEFRPFIRRLPEFKFWHYSARATLVALVSTLFNITDVPVFWPILLVYFIIIFVLT
                     MKRQIQHMLKYRYIPLDIGKKKYGSK"
     gene            <337432..>338300
                     /locus_tag="ZYRO0E04466g"
                     /db_xref="GeneID:8204676"
     mRNA            join(<337432..337467,337557..>338300)
                     /locus_tag="ZYRO0E04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499083.1"
                     /db_xref="GeneID:8204676"
     CDS             join(337432..337467,337557..338300)
                     /locus_tag="ZYRO0E04466g"
                     /note="similar to uniprot|P25565 Saccharomyces cerevisiae
                     YCL002C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499128.1"
                     /db_xref="GeneID:8204676"
                     /db_xref="UniProtKB/TrEMBL:C5E4B2"
                     /translation="MIFLQCISGFLSSIAILYQKRYNKLHHSVYGLSYDLYLLEIVGQ
                     FLTIYCTINYRWSPLVRLQLSRRFPLFYPLDGSNIPISNPLLIKDVILTICGLLVLRQ
                     LMLYQSTKHIYQGFSTTCMSIIGIFASFSMFTYFCACHNLPERDSGKFGVFYIDHVNY
                     LWVIGNTIRAFKFLPQITLNWMGFCTRGISSKYIIVNSLACLLILVGSLVSSPNKEFH
                     QNAFNNCPWVVTLVQFLSLCAILYQAQCLYVKKKPYLPRGE"
     gene            complement(<338396..>339943)
                     /locus_tag="ZYRO0E04488g"
                     /db_xref="GeneID:8204677"
     mRNA            complement(<338396..>339943)
                     /locus_tag="ZYRO0E04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499084.1"
                     /db_xref="GeneID:8204677"
     CDS             complement(338396..339943)
                     /locus_tag="ZYRO0E04488g"
                     /note="similar to uniprot|P25578 Saccharomyces cerevisiae
                     YCL004W PGS1 Phosphatidylglycerolphosphate synthase
                     catalyzes the synthesis of phosphatidylglycerolphosphate
                     from CDP-diacylglycerol and sn-glycerol 3-phosphate in the
                     first committed and rate-limiting step of cardiolipin
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499129.1"
                     /db_xref="GeneID:8204677"
                     /db_xref="GOA:C5E4B3"
                     /db_xref="InterPro:IPR001736"
                     /db_xref="InterPro:IPR016270"
                     /db_xref="InterPro:IPR025202"
                     /db_xref="UniProtKB/TrEMBL:C5E4B3"
                     /translation="MRSSHRILLSCAVWRHTCSSKSIRFSSRTMSTHSYLDLVKEKLS
                     VLSTKFYFRRNEIDVLYSPSDFYETLKSKISKAERRIFLASLYLGKTEDELVDCIGKA
                     LENNPNLKVYFLIDGLRGTREAPSKCSATLLARLLEKYDNRVDIRLYKTPAVIGWKES
                     VVPKRFNEGLGLQHMKIYGFDDELLLSGANLSSDYFTNRQDRYYLFRSKPFADYYFQL
                     HQLISKLSYKVKSTDTLQKFQLCWPQSNLAQEPKICKKTFIRHAADELQKFLKRVNSH
                     QDAKEAEVSQGGEFPTVVYPISQFTPLFTGLHDYSTEKPTLLDVLSTIKDPSINWTFT
                     AGYFNMFPAIMNQLISTPSEHATVITASPYANGFFESKGVSGNLPGAYLHLSKKFLQN
                     VKRSGKESNIILKEWKRGVVNKPGGWSYHAKGIWISGMTEKDDRPLVTCIGSSNYTRR
                     AYSSDLESNALIVTRDEELRDKMRNELENLLKYTKSINLDDFKNDPGRKVGTGVKIAT
                     SILGSKL"
     gene            341022..341093
                     /locus_tag="ZYRO0E04510r"
                     /db_xref="GeneID:8204678"
     tRNA            341022..341093
                     /locus_tag="ZYRO0E04510r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (TCT) cove score=66.58"
                     /db_xref="GeneID:8204678"
     gene            complement(<341193..>342152)
                     /locus_tag="ZYRO0E04532g"
                     /db_xref="GeneID:8204679"
     mRNA            complement(<341193..>342152)
                     /locus_tag="ZYRO0E04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499085.1"
                     /db_xref="GeneID:8204679"
     CDS             complement(341193..342152)
                     /locus_tag="ZYRO0E04532g"
                     /note="some similarities with uniprot|P25587 Saccharomyces
                     cerevisiae YCL005W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499130.1"
                     /db_xref="GeneID:8204679"
                     /db_xref="UniProtKB/TrEMBL:C5E4B4"
                     /translation="MKSIEKVIALGKDFGLFLAYSCAYCISVFFEYTISWIPPLYGIL
                     KRIITFFRALFFAPLRIIIKVVLQLFLLPVNVPLRLLLGTSLQQILLHTTSWTDGYVI
                     VTILQYWLALTILGVLIGAICGTSLSVVHSIWGIPDIYIEIPIRFWKLIPSLSVWLKN
                     HLPLYNNVETQLNGKGPEFKGAPPSPLSTPSSPPPQTPIMVDSELSKMPATPKHQSNS
                     KKCSRPPSISKGSILKVASKLPSDFFQQVQSEGKFDEEIQRYMSPGESSQDTTQDSSA
                     EFTDLWDKVEESPTTLKTEDGLATLSRRRNFLDSDGNRKLDVK"
     gene            <343429..>344725
                     /locus_tag="ZYRO0E04554g"
                     /db_xref="GeneID:8204680"
     mRNA            join(<343429..343509,343577..>344725)
                     /locus_tag="ZYRO0E04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499086.1"
                     /db_xref="GeneID:8204680"
     CDS             join(343429..343509,343577..344725)
                     /locus_tag="ZYRO0E04554g"
                     /note="similar to uniprot|P25604 Saccharomyces cerevisiae
                     YCL008C STP22 Component of the ESCRT-I complex which is
                     involved in ubiquitin-dependent sorting of proteins into
                     the endosome homologous to the mouse and human Tsg101
                     tumor susceptibility gene mutants exhibit a Class E Vps
                     phenotype"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499131.1"
                     /db_xref="GeneID:8204680"
                     /db_xref="GOA:C5E4B5"
                     /db_xref="InterPro:IPR008883"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR017916"
                     /db_xref="UniProtKB/TrEMBL:C5E4B5"
                     /translation="MPPASNDESFVSIPQPVINWLFGVIQPIYHDKKTTFHDSVVVLS
                     YYKQLRPRTRVYTDSNGISELLLCIYGKPEIGSPVPLLIWIPKSYPLEHPIVYIDLES
                     LKDAKVSPGEHVDPNGLITLPIFGKWNADTCNLLHVVQECIKICRYDHVIDPVAPGDS
                     NTYLTLPPKLPPNPVEEIPKPPLPKKTGFLHSTSNDNILPSNIPSKATPEPRLAEVPP
                     VLPKKPQPAHSLDLLDSVATENADNTHKAVLGDLQHALNQMSEADLAYINENLQNRKL
                     SIASAQRQFESMYRYETDSLKNIRESIELTKASLQGEISLIKRHFDKIELYEKENGEE
                     IDPSSLVTAQNPALNQLYESVARDYALSDTMHVLARLLNRDAVNLDVFVKKTRQLGRE
                     QFFTRMHIQNIIERLRQ"
     gene            <344989..>346485
                     /locus_tag="ZYRO0E04576g"
                     /db_xref="GeneID:8204681"
     mRNA            <344989..>346485
                     /locus_tag="ZYRO0E04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499087.1"
                     /db_xref="GeneID:8204681"
     CDS             344989..346485
                     /locus_tag="ZYRO0E04576g"
                     /note="similar to uniprot|P33322 Saccharomyces cerevisiae
                     YLR175W CBF5 Component of box H/ACA small nucleolar
                     ribonucleoprotein particles (snoRNPs) probable rRNA
                     pseudouridine synthase binds to snoRNP Nop10p and also
                     interacts with ribosomal biogenesis protein Nop53p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499132.1"
                     /db_xref="GeneID:8204681"
                     /db_xref="GOA:C5E4B6"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR004521"
                     /db_xref="InterPro:IPR004802"
                     /db_xref="InterPro:IPR012960"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5E4B6"
                     /translation="MSKDFVIKPDTSGPTPDTAEWPLLLKDYDKLLMRSGHYTPIPAG
                     SSPGKRDIKSYVNSGVINLDKPSNPSSHEVVAWIKRILRCEKTGHSGTLDPKVTGCLI
                     VCVDRATRLVKSQQGAGKEYVCIVRLHDALKDEKDLGRSLESLTGALFQRPPLISAVK
                     RQLRVRTIYDSNLIEFDNKRNLGVFWASCEAGTYMRTLCVHLGMLLGVGGHMQELRRV
                     RSGALSENDNLVTLHDILDAQWVYDNTRDESYLRRVIQPLETLLVGYKRIVVKDSAVN
                     AVCYGAKLMIPGLLRYEDGIELYDEVVLITTKGEAIAVAIAQMSTVDLATCDHGVVAK
                     VKRCIMERDLYPRRWGLGPVAQKKKQMKVDGKLDKYGRVNESTPEDWKKSYVPLDNAE
                     APAARESAPKESAPLVQEVDKKDEEEKKEEKKEEKKEEKEEKKEEAEESDDEEKSDKK
                     SKKEKKDKKEKKDKKEKKEKKEKKEKKEKKRKADDDEDGESKKKKSKK"
     gene            complement(<346758..>347831)
                     /locus_tag="ZYRO0E04598g"
                     /db_xref="GeneID:8204682"
     mRNA            complement(<346758..>347831)
                     /locus_tag="ZYRO0E04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499088.1"
                     /db_xref="GeneID:8204682"
     CDS             complement(346758..347831)
                     /locus_tag="ZYRO0E04598g"
                     /note="some similarities with uniprot|P25294 Saccharomyces
                     cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
                     suppressor dnaJ homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499133.1"
                     /db_xref="GeneID:8204682"
                     /db_xref="GOA:C5E4B7"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5E4B7"
                     /translation="MVKETKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTEK
                     FKEISEAYEILSDSSKREIYDQYGLEAARNGGPAFGGASPGAGGFPAGGAGGFSSHAF
                     SNEDAFNIFSQFFGGSSPFGASSGMDDGFGFSGFPGGGSTRFASSNGFGGGGGMPGGM
                     PGGMPGGMPGGFRSGSASPPSAEEEIVPVNLPVSLEDLFAGRKKSFKIGRKNRGGSFE
                     KTQIDIQLKPGWKAGTKITYKNEGDYNPQTGGRKTLQFVLQEKSHPLYKRDGDNLIYS
                     LPLSFKESLLGFSKTIQTIDGRTLPISKIQPVQPTEVSSYPGQGMPVSKRPGQRGDLV
                     VKYKIDYPLSLTEDQKRAIAENF"
     gene            <348647..>349558
                     /locus_tag="ZYRO0E04620g"
                     /db_xref="GeneID:8204683"
     mRNA            <348647..>349558
                     /locus_tag="ZYRO0E04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499089.1"
                     /db_xref="GeneID:8204683"
     CDS             348647..349558
                     /locus_tag="ZYRO0E04620g"
                     /note="highly similar to uniprot|P41318 Saccharomyces
                     cerevisiae YNL006W LST8 Protein required for the transport
                     of amino acid permease Gap1p from the Golgi to the cell
                     surface component of the TOR signaling pathway associates
                     with both Tor1p and Tor2p contains a WD-repeat"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499134.1"
                     /db_xref="GeneID:8204683"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5E4B8"
                     /translation="MSVILVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDK
                     KLLAAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVW
                     DVRAPSIPRNYKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDT
                     PLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSD
                     VKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRL
                     WDLSTREIVRQYGGHHKGAVCVALNDV"
     gene            complement(<349593..>352016)
                     /locus_tag="ZYRO0E04642g"
                     /db_xref="GeneID:8204684"
     mRNA            complement(<349593..>352016)
                     /locus_tag="ZYRO0E04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499090.1"
                     /db_xref="GeneID:8204684"
     CDS             complement(349593..352016)
                     /locus_tag="ZYRO0E04642g"
                     /note="some similarities with uniprot|P48743 Saccharomyces
                     cerevisiae YLR176C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499135.1"
                     /db_xref="GeneID:8204684"
                     /db_xref="GOA:C5E4B9"
                     /db_xref="InterPro:IPR003150"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5E4B9"
                     /translation="MQQHQRPTAAAPSVPIVSTNTVVPGQVPGTALHGQESAPSHNGN
                     NYAPQTQSQQGTNATPAHNSQLSSVYRLLHTPDSAAQLQLWRYQLPSPQLTQSAYSYH
                     DSAQKAAVDRAGRFAQGPLPWRNGISPPDSSSGATAAAAAAAAAAAAAVNSANANKNV
                     NVGGVPTSSTSPVAAPTSFSHVPESNSNSNGVTPAVAPASGSISSSAASSNDTGFHNF
                     PSETRRNTQEAVARGIAERHRDRPIAEYAAIVKQAEIAVLNMDPQTHSKTLVQTAEQN
                     RERERQVYALLWLMKSCQAQPDSYVPRGRIFAQYAASCAQNGLKPLSQASLGKLIRAV
                     FPDLTTRRLGMRGQSRYHYCGLKLVGPAQNSSETDTPSSMTNKVGLSATAPHSPMPMH
                     LFPQQPSQVSTSASISASSPLLSLQQQQQQQYYQQQQHYQQHYQQQQQQQLYQQQQHQ
                     QHGLPHNVNSQISLPSNDYYHPYTHTKSNPIGLEPLTTDRAFNDYESVFMENMYDHIF
                     SNEVPIPSDYALKFPKIPRSQLPAGTDEDIVSALESLYHVHCNTIFEHIRFMRFDQLP
                     NCLVLFGSGSISPQMYNLFTHESLHYWVYECDLITHVSLIKCLSRMVLDFDKVPASSI
                     VKLEEFAKAYDEIISESTIDLPVVMVAHKTEIVKNFSRLVRKLIQLIKYLRETSKILP
                     NFQHMSKDWLSYDNLDDVLYVINRNGYEKIVPMIRQFMSVDVTRFVDELASGVVRLDV
                     FVRRFCEIISSVRDVPAYKIMECIMMFSKVFMADTNIEMQQKGYPWYVLDMLFNLLIG
                     YCYELNRFI"
     gene            complement(353061..353133)
                     /locus_tag="ZYRO0E04664r"
                     /db_xref="GeneID:8204685"
     tRNA            complement(353061..353133)
                     /locus_tag="ZYRO0E04664r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (CAC) cove score=75.70"
                     /db_xref="GeneID:8204685"
     gene            <353639..>354439
                     /locus_tag="ZYRO0E04686g"
                     /db_xref="GeneID:8204686"
     mRNA            <353639..>354439
                     /locus_tag="ZYRO0E04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499091.1"
                     /db_xref="GeneID:8204686"
     CDS             353639..354439
                     /locus_tag="ZYRO0E04686g"
                     /note="similar to uniprot|P40693 Saccharomyces cerevisiae
                     YNL002C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499136.1"
                     /db_xref="GeneID:8204686"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="InterPro:IPR018038"
                     /db_xref="UniProtKB/TrEMBL:C5E4C0"
                     /translation="MNMENPEILLKRRRNADETRLAKQQLAGQRKHREKKNRFVRAES
                     IVAKTLATQREKERVKRINKSVKNHHGDNEKILDETKDGAKITYDGKPQLLFVVRVKG
                     PHAVNIPQRVFKVLQILRLEQVNTGVFFRLNPTTFQLLKIIAPYIVVGKPSLSTVRSL
                     IQRRSRVNWKGSQINLNDNNIVEEALGEQGIICMEDIVHEISTMGETFKQCCYFLLPF
                     QLARQVSGFSALKKLKKLEQRQKERHLSNAGNAPLVEIDIDQLLSEMN"
     gene            complement(<354494..>356329)
                     /locus_tag="ZYRO0E04708g"
                     /db_xref="GeneID:8204687"
     mRNA            complement(<354494..>356329)
                     /locus_tag="ZYRO0E04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499092.1"
                     /db_xref="GeneID:8204687"
     CDS             complement(354494..356329)
                     /locus_tag="ZYRO0E04708g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499137.1"
                     /db_xref="GeneID:8204687"
                     /db_xref="UniProtKB/TrEMBL:C5E4C1"
                     /translation="MSVSVDFGTRPSSVEELPTTRNESGGKLVEEAFDYFTCMEIGKS
                     IEQKAAKTKKIDEETLSNEIIGQFSKLQAPKGNVKFGDKEIVIFNEDERIGHSMKANS
                     SVDNVILPLPILKISQKGASDIKYMEPDNKMATQQERLFEVFRRCYTLCNLPMSQFDE
                     NNPFKSLKKLCEGIKKSFKAKDECYKYIRYEENRRLSQEIRKLKDTIQELKDDRHNSL
                     VLLQINKLQKHNNEYRNEIKDLTAQVTSTNYENSELRSNISELQTTKNQLMEKLGTAL
                     ARSVELENNQEEKIELTKQNTKLNNDHGKLNDEHERLTKKYESLEEEYTKVTHSNESL
                     TAKVDALTTTVQGWTHDHSELKSAHDILKSINKDLNSKLSKESTNVGELEAENSKLQR
                     DSQDSKIAFKTKLQELIDENIDLKSQVEKWRVEFEQVQTKYDKLNLEQREIVKQREKF
                     RRDSDQTFKKTVELQLQLDQHVKYREQAIKFNAEREACLITLKKLDFEYCHLQKSFEQ
                     ACVHNRELLEFQQAAERVVQDMNSKIVNLEKSKKTDAFKIDTLTRQVLKQTDKLDELQ
                     LQLTSWKQRQRLNGRKASGKRDILRSLANTKTLLEDPMTLSKNVC"
     gene            357303..357421
                     /locus_tag="ZYRO0E04730r"
                     /db_xref="GeneID:8204688"
     tRNA            join(357303..357340,357378..357421)
                     /locus_tag="ZYRO0E04730r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8204688"
     gene            complement(<357586..>358830)
                     /locus_tag="ZYRO0E04752g"
                     /db_xref="GeneID:8204689"
     mRNA            complement(<357586..>358830)
                     /locus_tag="ZYRO0E04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499093.1"
                     /db_xref="GeneID:8204689"
     CDS             complement(357586..358830)
                     /locus_tag="ZYRO0E04752g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499138.1"
                     /db_xref="GeneID:8204689"
                     /db_xref="UniProtKB/TrEMBL:C5E4C2"
                     /translation="MKFFKNNNNRGFFCTARKRKSEIVLDLNAASPSHNLESPLFEST
                     SKQESAEATEINFKEVKINSDSSDTCGNSDDGKISKHLSLCKHDKAPRERTSGMKESS
                     KMKFYGQLDLENSSVESSGEDHSDRSIPPINKNIDHGGSGTNREGICFNYNLDNFLGK
                     RKSSPKIVTNISKAGCKVSATTKSAMLKIFPGFTSPRSTRHQYGTVWTTASASKVHRL
                     DVGGNEPPTFESLSSSAHEKTKKLILSPGRRLTCKGTNSKFGTNVGSEPTIKTKVKRV
                     KHKHQKKTVRQRKERQENVADQISKSTELVHMQPKSSSQKHLKRSTREGETSLQENKT
                     KVKDENIKDANLEKTIITLWTLQNCVQHQTHCQSPIYQQLLQLNNQSSSKSTCRKSSK
                     LKPRAWGFKSIELDGTFSVFLY"
     gene            complement(<359351..>361777)
                     /locus_tag="ZYRO0E04774g"
                     /db_xref="GeneID:8204690"
     mRNA            complement(<359351..>361777)
                     /locus_tag="ZYRO0E04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499094.1"
                     /db_xref="GeneID:8204690"
     CDS             complement(359351..361777)
                     /locus_tag="ZYRO0E04774g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499139.1"
                     /db_xref="GeneID:8204690"
                     /db_xref="UniProtKB/TrEMBL:C5E4C3"
                     /translation="MDEDLVLISHSVCKKRTAAEAQLSPISPNGEFVTTYYTPTTKTK
                     TSKRQKFRSKLLKCFSKSEDSASAFGDTDWTIQLNNNVGNSQMPESLLGSRVHNGSGI
                     TMTSNHNSGEENLACSLDKPHDSSNPFYIASISSSKHEAYSSGLAPVFGAQEAYVPRS
                     VNKIPMTSNTSAGRGDQESPKKHRFRIWLNENCPRSSDRKVTMALKDIFAAIAEEAAK
                     FASIRGKSKAAVEAGAVTTAAYARVNAATFRPSFNNGDAAKIIKEACQDVLTVSLVPK
                     WKNIDYVKLFSIYQYELNLREAQANESLRRSSLKSGIDGLTIENSIGETFSEKELEPG
                     RRVQFVNLEEGFEKESNSSALNSECDSPSEAFVEDFESNFLDEGDYALSTRTKKWMNL
                     LMSRIDFFGKTTDIVRTFGDGIDNRSIGTNGMNNQKNLPFELECPNADELDDGFNPCM
                     LDNSLIDALLPHIESGLSPSHRISDEISAAMTTEISTTNPGFCVYFGNASEGSSATLE
                     SNFEVKTKKAAEDIGVRTDERNTLESLAFREVATPRDTSFSSCDNHSVDFSKAYLRIE
                     ILNSHFDQISSQVEKIVSGAVRDDISNELPLKNYQSPFIAADGSCDAPVPFKNNYSAL
                     NTSADVVGSSDRKYSIEDLSPTATADPKMQVKELLSQIDSMLNTTKMGQYQANRENSS
                     TSRENRLHLDIDTEQTIPQIDELLSLIDVAMVPATSENSKIDTQCIPNLNVRDTIIGK
                     APLDSLIPRVDCRLFDTDCVDSPATKIEDPIDSLSCEYGKQDSTNSGPQVNALLAQID
                     SVITNFDSND"
     gene            <362881..>363969
                     /locus_tag="ZYRO0E04796g"
                     /db_xref="GeneID:8204691"
     mRNA            <362881..>363969
                     /locus_tag="ZYRO0E04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499095.1"
                     /db_xref="GeneID:8204691"
     CDS             362881..363969
                     /locus_tag="ZYRO0E04796g"
                     /note="uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2
                     3-isopropylmalate dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499140.1"
                     /db_xref="GeneID:8204691"
                     /db_xref="GOA:Q96WI0"
                     /db_xref="InterPro:IPR001804"
                     /db_xref="InterPro:IPR004429"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /translation="MSKNIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLI
                     GGAAIDATGSPLPDDALAAAKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYA
                     NLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKY
                     TKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLKLN
                     HQLIDSAAMILVKSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTN
                     EAFGLYEPCHGSAPDLPKGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQVLDSG
                     VRTGDLGGSNSTSEVGDAIAKAVKEILA"
     gene            complement(<364119..>365612)
                     /locus_tag="ZYRO0E04818g"
                     /db_xref="GeneID:8204692"
     mRNA            complement(<364119..>365612)
                     /locus_tag="ZYRO0E04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499096.1"
                     /db_xref="GeneID:8204692"
     CDS             complement(364119..365612)
                     /locus_tag="ZYRO0E04818g"
                     /note="highly similar to uniprot|P25374 Saccharomyces
                     cerevisiae YCL017C NFS1 Cysteine desulfurase involved in
                     iron-sulfur cluster (Fe/S)biogenesis required for the
                     post-transcriptional thio-modification of mitochondrial
                     and cytoplasmic tRNAs essential protein located
                     predominantly in mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499141.1"
                     /db_xref="GeneID:8204692"
                     /db_xref="GOA:C5E4C5"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="UniProtKB/TrEMBL:C5E4C5"
                     /translation="MLRQGITGLTRVSRLLRVGANSRPALSGGIRLYSKAASNAALKF
                     ADDAALETHTDTEAAAREQTVTRAAATSSPSEVIGSSTSALQNAYAENTGFGTRPIYL
                     DMQATTPTDPRVLDTMLKFYTGLYGNPHSNTHAYGWETNKEVENARKNVANVINADPK
                     EIIFTSGATESNNMVLKGVPRFYKRSKKHIITTRTEHKCVLEAARAMVNEGFDVTFLN
                     VDNEGLVNLKELEEAIRPDTCLVSVMAVNNEIGVMQPLKEIGSICKKHKVYFHTDAAQ
                     AYGKVPIDVNEMNIDLLSVSSHKIYGPKGAGAVFVRRRPRVRLDPIFSGGGQERGLRS
                     GTLPPPLVAGFGEAARLVVQENDADIAHIKRLSEKLTKGLLSIPDTSLNGSAEHRYPG
                     CVNVSFAYVEGESLLMAMRDIALSSGSACTSASLEPSYVLHAIGKDDALAHSSIRFGI
                     GRFTTEEEVEYVVDAISKRVKFLRELSPLWEMVQEGIDLNSIEWSGH"
     gene            <365995..>366834
                     /locus_tag="ZYRO0E04840g"
                     /db_xref="GeneID:8204693"
     mRNA            <365995..>366834
                     /locus_tag="ZYRO0E04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499097.1"
                     /db_xref="GeneID:8204693"
     CDS             365995..366834
                     /locus_tag="ZYRO0E04840g"
                     /note="similar to uniprot|P38921 Saccharomyces cerevisiae
                     YNL003C PET8 S-adenosylmethionine transporter of the
                     mitochondrial inner membrane member of the mitochondrial
                     carrier family required for biotin biosynthesis and
                     respiratory growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499142.1"
                     /db_xref="GeneID:8204693"
                     /db_xref="GOA:C5E4C6"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E4C6"
                     /translation="MDSNGFFVSLLSGAAAGTSTDLVFFPIDTLKTRLQAKGGFFANG
                     GYRGIYKGLGSAVVASAPGASLFFVAYDSMKSFLKPKFQQLMPKANEPLIDVVTQMAS
                     SSIGEISACMVRVPSEVIKQRTQTHISNSSLQTFKNLLKNENGEGLRRNFYRGWSTTI
                     MREIPFTCIQFPFYEFLKKSWAQWENAKEIPPWKGAICGSIAGGVAAASTTPLDVLKT
                     RLMLSNKSMPVWQLASTLYKEEGPKVFFSGVGPRTMWISAGGAIFLGVYELAHSMLTR
                     PTL"
     gene            complement(<366864..>367988)
                     /locus_tag="ZYRO0E04862g"
                     /db_xref="GeneID:8204694"
     mRNA            complement(<366864..>367988)
                     /locus_tag="ZYRO0E04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499098.1"
                     /db_xref="GeneID:8204694"
     CDS             complement(366864..367988)
                     /locus_tag="ZYRO0E04862g"
                     /note="similar to uniprot|P25559 Saccharomyces cerevisiae
                     YCL016C DCC1 Subunit of a complex with Ctf8p and Ctf18p
                     that shares some components with Replication Factor C
                     required for sister chromatid cohesion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499143.1"
                     /db_xref="GeneID:8204694"
                     /db_xref="InterPro:IPR019128"
                     /db_xref="UniProtKB/TrEMBL:C5E4C7"
                     /translation="MSLNLHERLSTDGSFRLLHLTPELLEVLKDSNSKLQFKAAGNDE
                     DDGDVVLCSRDKTWLLRQKNHSNTVMLMHEFTPEQETSLETTFGLPNPTSDFAGFART
                     TFEYETKKVSGIINLDSVPVHNGSLDFPPADGQDLPVKSMDDLLASSACSEKECLSQW
                     NQLGGCTVKGYPCILSSDFLSKALHVTLMSAMAESLDFSRLKLDETFDAVNKDMDQDS
                     NPYTREVIKTTLEKYGKRVKDDDDCWQLDQKKVAEWYGIRALRKYASQSSIPPAEFLI
                     KWKSTFPPYAPFDIEIEMLRGWFFRPTGSNLQYLSKNTLPSDIKERFKMLFKLQSQWD
                     MDDIAPFVEELNTKGLKIDVFIMKYARKRRVGKKFIISSR"
     gene            <368266..>373518
                     /locus_tag="ZYRO0E04884g"
                     /db_xref="GeneID:8204695"
     mRNA            <368266..>373518
                     /locus_tag="ZYRO0E04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499099.1"
                     /db_xref="GeneID:8204695"
     CDS             368266..373518
                     /locus_tag="ZYRO0E04884g"
                     /note="weakly similar to uniprot|P25558 Saccharomyces
                     cerevisiae YCL014W BUD3 Protein involved in bud-site
                     selection and required for axial budding pattern localizes
                     with septins to bud neck in mitosis and may constitute an
                     axial landmark for next round of budding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499144.1"
                     /db_xref="GeneID:8204695"
                     /db_xref="GOA:C5E4C8"
                     /db_xref="InterPro:IPR000219"
                     /db_xref="InterPro:IPR021895"
                     /db_xref="UniProtKB/TrEMBL:C5E4C8"
                     /translation="MYDDVSSSLDSVATDNGHADPPKKDIIQLFNNILRAQLGNNPSL
                     QRLGTPAEWVDIIFKKSNVFYGCDELMWGAFIACIYRDPQDSQLSCILIDKVGVSHFS
                     PIDVTGESQYYPAIENLVPAHKNSESRQCIAVTFLQRFAQLSDKDVRRVHPDTFKFDY
                     DPTHAGDLASACIQMEGENKLVNIGRKLLSLGFFQDRLVSSTLLDVVYEYNEAVSEPN
                     NKLVFYLGKQLEQLFNPLTEYSPEQTEHTYKAPSDETPTEEDDALVKAISRELLELQT
                     NFTLNLVEFLQKFVIVLRIRVLNGEIEGLSTVKLNRLFPPTIDEVTRINCIFLDSLKS
                     ATPFGSLEVLKACSVTIPYFYKAYTRHEAATKNFNKDIKLFLKSFYNQIPLSDVFTEM
                     KIDSLIKGPQEKLMKIKLIIDRLYASKKWDPKNEGEAKKCYDNVIEIIDSFGRLEGPL
                     NSYNSRVFTPSGKILTELAKGWPAELQYKWLKRRVVGVFDMIDPKDPTNEKLLVIFSD
                     YLMFLDVVEDRTNYGSAQFKKPSISDILMNSLVNEVPLPPKMPQLRVDGHCYIDEVFV
                     TLFGNNCIRFDAFRDKNPFAVTLKVQRKPFSAYTVADLVTKAKILEKDTAFHLFKATH
                     DDITVYSTAHEMEAYSNETIKSKFALFLNMNPTEKVIMQHKLHVAMFAKFVPGVLDTE
                     LVQLDILTSDGGFRSIRTAIEELIPSVLRQLSFEIPVCFSSIYSPLLPGILAANESII
                     KGLECFDSANAVTSRPVSKTRGEKEPRPMSSSVTKGPESHSRHRPAKSYATITTFRSN
                     ISDTKTAGNRQSEDRFDFEEMDQPQKAQVESHEPQEKKDRMKLFPQAPAPSLAARQES
                     QPASKKAGRHQKRRSISNIFKSIFSKKKENDSSISTIKDKTKKKSNEGRPNESQKHYF
                     TSNNKSRSDNGSQRKRSSVLQNNYPKPVNDARNSLNGRSPNESLAPVEPPNTRNKAVE
                     EKRHQSIQLGQFDTDNTVGTNDKRFSTVSDFAGPARNTSTTNNRDSALYRKSQISEMM
                     NEEIGQPERSDSRELKELPKEPPIDASKDGKENHGSPPQPSVNEVREHNQTMASQANN
                     LSDSKLAGVQENIVAEDLEGKPSRESQVFNDDLFGDVIPDPKKGPSTINETGTMQSNK
                     RNSAVQNNSQAVNGSSVPGPFDNKKVENFDAEIKPQENVQQNENEPEATHIEATQPTD
                     NFQDNFSQKKSVNPRIQNLKASKIDFEKSSSFVELFQGMRLVLDESDAKYNWKSLPSE
                     YSLRDTSPVNFVEEPTPQPQHQHAFKSIAFAGINIPPKPRAESAVRRPPQAKPESINS
                     FSPGARQSKLVSGTNQNVAQESGKKVFNASQQNRESGINQNATQGQKAGFINQRIPRE
                     RSIPEIRYGGMNRQSRTGVNSNAFVSPGNPTLSADGTGNTLEEEQEENQRDVANKLFE
                     NTLRKDSDLAPPPKLSQQSSPERPARKKIPTFKVINNSPTRIIQRISPDRAASPYNIP
                     SDISISSDLDEHTNKRLFELKFSSKDDINDSGSSPVESAAKPSMPDATTQDVGNASET
                     SAPSVHNNDDSNTTPEDSLPEGKPLQGEDGGLLDDLDFSSFNVTFDTFNRDRDVSQRS
                     ITRGPSVIIKDQEPLSTTVENPRSEEPLIYRLPKSNENSTRKSYLNRPSNTRQVHNDD
                     DPIWISPSKLDYYDINKFTGPAFKDAKEMIRTATNENMHKIIAENPTSMNELSYAYLA
                     SIIDDDDDQPLNSNDRPIRLTFKE"
     gene            complement(<373554..>374017)
                     /locus_tag="ZYRO0E04906g"
                     /db_xref="GeneID:8204696"
     mRNA            complement(join(<373554..373925,373973..>374017))
                     /locus_tag="ZYRO0E04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499100.1"
                     /db_xref="GeneID:8204696"
     CDS             complement(join(373554..373925,373973..374017))
                     /locus_tag="ZYRO0E04906g"
                     /note="similar to uniprot|Q8J0M4 Saccharomyces cerevisiae
                     YCL012C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499145.1"
                     /db_xref="GeneID:8204696"
                     /db_xref="InterPro:IPR018559"
                     /db_xref="UniProtKB/TrEMBL:C5E4C9"
                     /translation="MLELLHAKFIIGILVYVILVDELNVNSFVTNKCFPAYRFKERYI
                     RLRRGLGHRIGLNDDFADDLESGLSSRHFDIISRNASDERHGLDPAAKEEIRNIMERE
                     NMGFDKARLLYTERVFGQNNIAPDGTPLDPKAITFQ"
     gene            complement(<374326..>375727)
                     /locus_tag="ZYRO0E04928g"
                     /db_xref="GeneID:8204697"
     mRNA            complement(join(<374326..375537,375710..>375727))
                     /locus_tag="ZYRO0E04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499101.1"
                     /db_xref="GeneID:8204697"
     CDS             complement(join(374326..375537,375710..375727))
                     /locus_tag="ZYRO0E04928g"
                     /note="similar to uniprot|P38922 Saccharomyces cerevisiae
                     YNL004W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499146.1"
                     /db_xref="GeneID:8204697"
                     /db_xref="GOA:C5E4D0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E4D0"
                     /translation="MSQLERHRSRSPARVRDERDYGRSGYGPRPRGGGGRHSRYDRRG
                     RGSYAGGAGGAGGAGGASGAGGAGGRYSRFRKNKGDYGPVLARELDSTYDEKVNRNYA
                     NSVFVGNLTYDCAPEDLKDYFSQIGNVVRADIITSRGHHRGMGTVEFTNTEDVDEAIR
                     RFDGAYFMDRQIFVRQDNPPPESNSHERVQERRKERTFAGASSGSNNGTNAGGNSNGP
                     IYEVFVANLPYSINWQALKDMFKECGNVIRADVELARNGYSRGFGTVIYGTPEEMQDA
                     IARFHGYELEGRILEVREGRKSAVDPPPQEPIDDSSNFNSEFTEGVTDGGERNNLIYC
                     ANLPFSTATSDLYDLFETIGKLNNAELRFDSKGAPTGVAIVEYENVEDADVCIDRLNN
                     YNYGGCDLEISYGKRET"
     gene            complement(<375954..>376940)
                     /locus_tag="ZYRO0E04950g"
                     /db_xref="GeneID:8204698"
     mRNA            complement(<375954..>376940)
                     /locus_tag="ZYRO0E04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499102.1"
                     /db_xref="GeneID:8204698"
     CDS             complement(375954..376940)
                     /locus_tag="ZYRO0E04950g"
                     /note="similar to uniprot|P25554 Saccharomyces cerevisiae
                     YCL010C SGF29 SaGa associated Factor 29kDa Probable 29kKDa
                     Subunit of SAGA histone acetyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499147.1"
                     /db_xref="GeneID:8204698"
                     /db_xref="InterPro:IPR010750"
                     /db_xref="UniProtKB/TrEMBL:C5E4D1"
                     /translation="MDEQWDLVISSLQDIYNANAVMAYDDDVQLKEIELNTLSDEKLR
                     EHLDHYSSHLHNIRRAQRLIDSVGENVKLVLEHAQERERMASKVPPPASPSAAKIESN
                     TGEDTTNATVTENEPPKAPAEATAEAPAEAPIEAPTEAPSETSVEAPTEAPTREALDT
                     QAHPQPQFQQTARPLGRSGWISQYNPNGPISIGSEVAFKPKKGGEGEWFQCVVVKVSA
                     DGLRFEVRDPEPDELGNPGKTFKCNWRDIIFIPPEGTDPKSQTPNYPPGTKVLARYPE
                     TTTFYPAVVIGSKRDGTCRLRFDGEEEVDKETEVLRRLVLPCPTISSIMAKK"
     gene            <377214..>378326
                     /locus_tag="ZYRO0E04972g"
                     /db_xref="GeneID:8204699"
     mRNA            <377214..>378326
                     /locus_tag="ZYRO0E04972g"
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /transcript_id="XM_002499103.1"
                     /db_xref="GeneID:8204699"
     CDS             377214..378326
                     /locus_tag="ZYRO0E04972g"
                     /note="similar to uniprot|P12687 Saccharomyces cerevisiae
                     YNL005C MRP7 Mitochondrial ribosomal protein of the large
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL2"
                     /protein_id="XP_002499148.1"
                     /db_xref="GeneID:8204699"
                     /db_xref="GOA:C5E4D2"
                     /db_xref="InterPro:IPR001684"
                     /db_xref="InterPro:IPR018261"
                     /db_xref="UniProtKB/TrEMBL:C5E4D2"
                     /translation="MDILANCSGGFVPKYACNVLTQVRNATKRAAGSRTSMKDSAGRR
                     LGPKKYEGQSVKVGEIIMRQRGTKLYPGENTGIGKDHTIFAKEPGVVRYYVDPFHPKR
                     KFVGVSLKRELKLPLPHFAPRVRRFGREILTHPRLKAEEESFLPRKQLEAKDSILKAL
                     QERESRRLQLSEDFQVFFEKQLPELQLKDVEMANAYLIRLRSCLKNGYELEDAQYNAQ
                     HYLELEYRLQAQRENWNDNLESHLQILQETVGTLNKSVSFDNKLHLMKYIDPQTKESL
                     KSQLVKTLHEKAENIETKQQRDEIQSLFQDACQFLTLSEEVHLRRQFLKPVKPETPPT
                     LAPQPTKKTVTIKRFNHERNRLETIPRTKSAFLSKL"
     gene            complement(<378428..>379360)
                     /locus_tag="ZYRO0E04994g"
                     /db_xref="GeneID:8204700"
     mRNA            complement(<378428..>379360)
                     /locus_tag="ZYRO0E04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499104.1"
                     /db_xref="GeneID:8204700"
     CDS             complement(378428..379360)
                     /locus_tag="ZYRO0E04994g"
                     /note="highly similar to uniprot|P25605 Saccharomyces
                     cerevisiae YCL009C ILV6 Regulatory subunit of acetolactate
                     synthase which catalyzes the first step of branched-chain
                     amino acid biosynthesis enhances activity of the Ilv2p
                     catalytic subunit localizes to mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499149.1"
                     /db_xref="GeneID:8204700"
                     /db_xref="GOA:C5E4D3"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR004789"
                     /db_xref="InterPro:IPR019455"
                     /db_xref="UniProtKB/TrEMBL:C5E4D3"
                     /translation="MNRLVLQGSARRFVSLRYSLNAIRCSSSSTSALAYKQLHRNATR
                     PPLPTLETPSWSADSAVSSILYETPTPSAQPCKQHVLNCLVQNEPGVLSRISGTLAAR
                     GFNIDSLVVCNTEVKDLSRMTIVLQGQDGVIEQARRQIEDLVPVYAVLDYSNASIIKR
                     ELVLARVSLLGAEYFEDLLVHHHRSTSGIEDTGDLVKEIRNKKYHPSNLPLSEVLRMK
                     HEHLGAISNLSNNFGGKVVDISDSSCIIELSAKPSRISAFLKLLEPFGVLECARSGMM
                     ALPRIPIKNRPDDSDEAVTEKINDMVDISQLPPG"
     gene            complement(<379654..>380889)
                     /locus_tag="ZYRO0E05016g"
                     /db_xref="GeneID:8204701"
     mRNA            complement(<379654..>380889)
                     /locus_tag="ZYRO0E05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499105.1"
                     /db_xref="GeneID:8204701"
     CDS             complement(379654..380889)
                     /locus_tag="ZYRO0E05016g"
                     /note="highly similar to uniprot|P41939 Saccharomyces
                     cerevisiae YLR174W IDP2 Cytosolic NADP-specific isocitrate
                     dehydrogenase catalyzes oxidation of isocitrate to
                     alpha-ketoglutarate levels are elevated during growth on
                     non-fermentable carbon sources and reduced during growth
                     on glucose"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499150.1"
                     /db_xref="GeneID:8204701"
                     /db_xref="GOA:C5E4D4"
                     /db_xref="InterPro:IPR004790"
                     /db_xref="InterPro:IPR019818"
                     /db_xref="InterPro:IPR024084"
                     /db_xref="UniProtKB/TrEMBL:C5E4D4"
                     /translation="MMPKIQVKNPIVEMDGDEQTRIIWKLIKDLLILPFIDVDLLYYD
                     LSITNRDATDDRVTVESAEATLKYGVAVKCATITPDEARVEEFHLKKMWRSPNGTIRN
                     ILGGIVFREPIVIPRIPRMVSQWEKPITIGRHAFGDQYKATDTVIPDEGELKLVFKSK
                     DGKHDQDLQVFEFPKGGGVAMAMYNTTESIEGFAKASFELALERKQPLYSTTKNTILK
                     KYDGKFKDIFEAMYEKEYRSQFEKLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGD
                     VQSDIVAQGFGSLGLMTSVLVTPDGKTFESEAAHGTVTRHFRLHQQGKETSTNSIASI
                     FAWTRGIIQRGKLDNTPEVVKFGQLLEKATVEVVDFENIMTKDLALILGKTDRSAYVT
                     TEEFIHAVSKRLKGEVAKF"
     gene            381323..381395
                     /locus_tag="ZYRO0E05038r"
                     /db_xref="GeneID:8204702"
     tRNA            381323..381395
                     /locus_tag="ZYRO0E05038r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (TGC) cove score=80.16"
                     /db_xref="GeneID:8204702"
     gene            complement(<381556..>382278)
                     /locus_tag="ZYRO0E05060g"
                     /db_xref="GeneID:8204703"
     mRNA            complement(<381556..>382278)
                     /locus_tag="ZYRO0E05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499106.1"
                     /db_xref="GeneID:8204703"
     CDS             complement(381556..382278)
                     /locus_tag="ZYRO0E05060g"
                     /note="highly similar to uniprot|P53981 Saccharomyces
                     cerevisiae YNL010W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499151.1"
                     /db_xref="GeneID:8204703"
                     /db_xref="GOA:C5E4D5"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR006384"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5E4D5"
                     /translation="MVKAVIFTDFDGTVTLEDSNDYLTDTLGFGKPKRLDAFEGVLAG
                     TKSFRDAFWEMLTSIHTPFPECLDILGKKIALDPGFKDTLHWSLENNVPIVVVSSGMK
                     PIIKHLLTLLVGEEAVSKVDIVSNAVEVQPDGQWKIVYIDDSPFGHDKSKTIDHYKEK
                     FESESKDSEKPVYFYCGDGVSDLSAAKECDLLFARRGKDLVRYCRRENVPFHEFDSFQ
                     DILANMKQVLAGEKTVKELMEN"
     gene            <382498..>383838
                     /locus_tag="ZYRO0E05082g"
                     /db_xref="GeneID:8204704"
     mRNA            <382498..>383838
                     /locus_tag="ZYRO0E05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499107.1"
                     /db_xref="GeneID:8204704"
     CDS             382498..383838
                     /locus_tag="ZYRO0E05082g"
                     /note="similar to uniprot|P53980 Saccharomyces cerevisiae
                     YNL011C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499152.1"
                     /db_xref="GeneID:8204704"
                     /db_xref="InterPro:IPR002882"
                     /db_xref="UniProtKB/TrEMBL:C5E4D6"
                     /translation="MNVVVLSGGTATNSLTSCFSQISVSENRELTYILPISDNGGSTS
                     EILRVVGGPAIGDIRARVAQLVGDPQVGQLLSYRLPNDSVRAKEEWNSIVEGQHSVWK
                     DIPTPVKEMCRAFIIHMQSELLKKTKSANAFRFEKASVGNFFLTGARLFLGSLDATVE
                     LLMRIGRCDPHASVIPCISTNHTHHIAALLSNGEVIRGQSQISHPSKPKASQSVLPPS
                     IMGGTTSRPTTAAKSDGLDLHSEEEQEEEYANPIYILPELKNSQLHFDKLEKEETFSA
                     PIERLLYINPYGEEIKPQGNPRAVSKIKRADMVVYSIGSLVTSLLPIVILGNIADIIA
                     ESKSTRKVLLINNSYDRESFWLDGVRYVQLVIESMSRAVQTHRQSKGSKDPTPVLLDW
                     THFVTDVVYPIGGEIPIAQEKLESMGIKCHGIDSNKMENESLKQILVQIGSSKP"
     gene            complement(<383976..>384680)
                     /locus_tag="ZYRO0E05104g"
                     /db_xref="GeneID:8204705"
     mRNA            complement(<383976..>384680)
                     /locus_tag="ZYRO0E05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499108.1"
                     /db_xref="GeneID:8204705"
     CDS             complement(383976..384680)
                     /locus_tag="ZYRO0E05104g"
                     /note="similar to uniprot|P39931 Saccharomyces cerevisiae
                     YLR250W SSP120 Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499153.1"
                     /db_xref="GeneID:8204705"
                     /db_xref="GOA:C5E4D7"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="UniProtKB/TrEMBL:C5E4D7"
                     /translation="MKFTPSLVLGLFAGIGIANLNAPIDPKVNVEVEQVPQGLSWEKW
                     HMQHEHKLDDYTPEHFFDLHDEGGKGYLNRGDILALYGMNRGEVIGSGDGMGHHDDSE
                     HLDQELGDRVAQFIMKLLDVDDDSKITKQEYLNFARKGGVFPDLGVGVGHHADFELEY
                     EIHHWNEFHKDKDPDVDVIHKEDIEHELLHHEHEVEHEESVQRGASRSTVITDDELES
                     RINPDVIPKKYTNSLF"
     gene            complement(<384898..>386550)
                     /locus_tag="ZYRO0E05126g"
                     /db_xref="GeneID:8204706"
     mRNA            complement(<384898..>386550)
                     /locus_tag="ZYRO0E05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499109.1"
                     /db_xref="GeneID:8204706"
     CDS             complement(384898..386550)
                     /locus_tag="ZYRO0E05126g"
                     /note="similar to uniprot|P53541 Saccharomyces cerevisiae
                     YNL012W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499154.1"
                     /db_xref="GeneID:8204706"
                     /db_xref="GOA:C5E4D8"
                     /db_xref="InterPro:IPR002642"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:C5E4D8"
                     /translation="MGLAISGGGYRSMLTASGFIKEMDNYGIFDCLSYISGLSGGSWV
                     LMDLLSQNFNVSSLLSNWKLNDGLLKGVPDFDIRHHDIVSGMEEYEDALVKRTVSDEG
                     ALRQFFYNFEESLQLAAFLFQEDDEQKRVTKRGVGPLAKIMDFFLQRNDKQEEEDLDD
                     NENSLFGSIQSLHQVIQFYIDLHLGIRPKKMQGFTISFTDYLGKALKKKLSNTKGQSS
                     SFSQLMMNSTKFQDFKAPIPLFIANCRNEHLKNVIFEFNPFEFGSWESNLGLFVKMPY
                     LGSTIEAGNPSRCINGFDDIGFITATSSSIFNNVLIYIWQLTAQSSRETMRAVKNIMS
                     IFGLGNGKLDEKSFRPTSLNNLDTDYAVYQPNPFYHYPGINNELTQNDYLYLVDGGED
                     GENIPLRPLTIPQRNLDIIFVIDSSSDEFNYPRGKKLKNVLHQLQNEEIDSHSYSIPD
                     FDKVNQYPIALGCYQPHLPIILYHPNAPHSYNSNTSTFKITYNESEVNGMLQNGRVIF
                     SLSSNPEHMDCIGCLIAKRRIEQVDKSRMPKICRQCFEDYCH"
     gene            complement(<387268..>390405)
                     /locus_tag="ZYRO0E05148g"
                     /db_xref="GeneID:8204707"
     mRNA            complement(<387268..>390405)
                     /locus_tag="ZYRO0E05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499110.1"
                     /db_xref="GeneID:8204707"
     CDS             complement(387268..390405)
                     /locus_tag="ZYRO0E05148g"
                     /note="highly similar to uniprot|P16521 Saccharomyces
                     cerevisiae YLR249W YEF3 stimulates the binding of
                     aminoacyl-tRNA (AA-tRNA) to ribosomes by releasing EF-1
                     alpha from the ribosomal complex contains two ABC
                     cassettes and binds and hydrolyses ATP EF-3 (translational
                     elongation factor 3)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499155.1"
                     /db_xref="GeneID:8204707"
                     /db_xref="GOA:C5E4D9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR015688"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4D9"
                     /translation="MSDSQQSVEVLNQLLARLSVATPDNRDEVATEVSSFVNGNIIEH
                     DAPEHFFNGLAKAIKDKKSAVNALAAVSHVASTSGLAPSVEPYVVALVPAILEQTGSK
                     DKDVQSAANAALHAVVTAVNPVAVKAVLPHLTKSLSETNKWQEKVAVLSAISALVDQA
                     KSQISLRMTELIPVLSEAMWDTKKEVKNAATATMTKATETVENKDIERFIPKLIECIA
                     NPSEVPETVHLLGATTFVAEVTPATLSIMTPLLSRGLAERETPIKRKSAVIIDNMCKL
                     VEDPQIVAPFLNKLLPGLKNNFSVIADPEAREVTLRGLKTLRRVGAVGEGDVLPEISH
                     AGDPATTLGVLDSLLKTENIAKKFRPAVEYISCIGGDLIDERIIDQQTWFTHVLPYMT
                     IFLHQNQAKEILDEFRKRAVDNIPEPPKFDDEEEEGEDLCNCEFSLAYGAKILLNRTQ
                     LRLKRGRRYGLCGPNGSGKSTLMRAIANGQVDGFPSQEECRTVYVEHDIDGTHAETSV
                     LDFVFQGDVGTKEAISAKLKEFGFDDEMIVMPIAALSGGWKMKLALARAVLKNADILL
                     LDEPTNHLDTVNVAWLTNYLITCGITSIVVSHDSGFLDNICQYIIHYEGLKLRKYKGN
                     LSALVERVPSAKSYYELGASDLEFRFPEPGYLEGVKTKQKAIVKVSNMTFQYPGTSKP
                     QISDVSFQCSLSSRIAVIGPNGAGKSTLINVLTGELLPTTGEVYTHENIRIAYIKQHA
                     FAHIESHLDKTPSEYIQWRFQTGEDRETMDRANRQINEDDAQAMNKIFKIDGTPRRIA
                     GIHSRRKFKNSYEYECSFLLGENIGMKSERWVPMMSVDNAWLPRGEVIESHGKMVAEV
                     DMKEALASGQFRPLTRKEIEEHCAMLGLDAELVSHSRIRGLSGGQKVKLVLAAGTWQR
                     PHLIVLDEPTNYLDRDSLGALSKALKEFEGGVIIITHSAEFTKDLTEEVWAVRDGLMT
                     PSGHNWVSGQGSGPRLEKKEDEEDKFDAMGNKISSGTKKTKLSSAELRKKKKERMKKK
                     KELGDAYVSDDDADF"
     gene            complement(<390866..>392593)
                     /locus_tag="ZYRO0E05170g"
                     /db_xref="GeneID:8204708"
     mRNA            complement(<390866..>392593)
                     /locus_tag="ZYRO0E05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499111.1"
                     /db_xref="GeneID:8204708"
     CDS             complement(390866..392593)
                     /locus_tag="ZYRO0E05170g"
                     /note="some similarities with uniprot|P38623 Saccharomyces
                     cerevisiae YLR248W RCK2 Protein kinase involved in the
                     response to oxidative stress identified as suppressor of
                     S. pombe cell cycle checkpoint mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499156.1"
                     /db_xref="GeneID:8204708"
                     /db_xref="GOA:C5E4E0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5E4E0"
                     /translation="MNKLKNFFKQKKTQEEEEQLDQKQKQQYSLQQGQAQGNSLSTTR
                     PYETRVSIEEDTLSSTTKVNSERSTMETQPANIHHNNSTNHQCQSMFVEDVGSSRTSS
                     SDESCGMSDEDEDGDEDDIPEDIFPEQVELDGYTLVNKIGEGAFSTVFRGIICKGSGK
                     EFLANNFKNLAIKVIRKQDIPDSNATKKDAGKTSTRAQVLKEVTIHKLAASGCPEIVQ
                     FVDFQETDNYYFIIQEFLSGGEIFGEIVKFTYFSEDLSRHIIRQLALAVKHLHNVGVV
                     HRDIKPENLLFEPIDFVPSKKIKLRKSDDPSTKKDEGIFRPGFGGGGIGSVKLADFGL
                     SKQIYQAKTKTPCGTVGYTAPEVVKDEKYSTKVDMWGIGCVLYTILCGFPPFYDEKID
                     TLTEKISRGEYVFLRPWWDEISDGAKTAVKRLLEVDPVKRYDIDEFLNDPWLNTFDCL
                     EEQKEEEERIRSHKRKSKLQFKRKMAIDSTLLYSPAAVAMKDAFDVSNAVQRDEEDKR
                     EIMSNSLGALAEDEESDDPSSALASATNANYDNNQDLSQDMFHLSLDSSTIIKRRKNG
                     AVPIAAVVE"
     gene            <393899..>398461
                     /locus_tag="ZYRO0E05192g"
                     /db_xref="GeneID:8204709"
     mRNA            <393899..>398461
                     /locus_tag="ZYRO0E05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499112.1"
                     /db_xref="GeneID:8204709"
     CDS             393899..398461
                     /locus_tag="ZYRO0E05192g"
                     /note="similar to uniprot|Q06554 Saccharomyces cerevisiae
                     YLR247C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499157.1"
                     /db_xref="GeneID:8204709"
                     /db_xref="GOA:C5E4E1"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4E1"
                     /translation="MSSVATLDVAADQDFIGDGSKSRDSGTRCFVADGLSDYVCSSQI
                     TQPEKEGGIKETIKDGNKKSKLSKCQVEIARLRMYASGEVGGSTDLAAERRVLVQFLE
                     MVDQDVLMVSGESGEKLLKVQRGIKDDRWRQILRVAHNKCLEWEVNNSKQNMEAFTTD
                     TSRKSRKRGNRSTARNAVVMAKRLVSKMYKDLSCEVTIGLDSANRWILCIRVWLSYLP
                     QSLNKFSTETKSFLDTWFSQRAAPSSPSSLDPLPPSPFIQGKFVSQTVAHTRQRLSRW
                     YSDPVRDVPGLNLHLLPFQSSTVEWMLSKEVGEFLPRYLGKTKQELLQFLNGCVSYGY
                     ESISQDLFWNKFTNFVLTGEEVEQIYSGMWAKREEFNQRARGILCEEMGLGKTIEILS
                     LILLNQRNLSDIPRTFIAEDGKTILRTSTTLIICPNAILQQWINEVESHTNDMSIFHY
                     KGFLPVKKFFKTDNIWEIVDQLSHYDIVITSYNVVSTEVHYAEYNASSRPRRSTCPIK
                     YDYSSPLSLMQFFRIILDEVQMLHSDSTKAAKCTSLLHRVHTWGVSGTPIQLVKDFQT
                     VLSYLKISPFHELPEIISSVNNNVIQRQKEQLVQGVKFTLSELLNIPIEQDLTVRHSR
                     EDVISQIHIPRQHNYIVPLEFAPVEWDNYLDVWNSFVTVSGYGPNGTDSPRLNTIQLN
                     QWLTRLRYLCCHAVFPDSHTNSKGQSHSSNASLHNIDDILKLMTTDAIEKLDSLYRDN
                     YQLQIRSAQAKSELQNNPDGAIDLLHSVQEKLSEDLKEKCLVDDPFDTDGIPVEERSG
                     TPATKDSPEGVSSIRTRAYLDLLHQCFFLMATAYYNKGSSRLEYVDDENEKLALKQSD
                     EKPKTYTDVYNVEEMKDIEKNQRLEQEYYGYAERLRKRILFGRVQKVDIFVKETQDYF
                     ENDSSSRPQSLQYIEFSSSNNFANSMLVSRCFQLLSLLINSLNEQALQFNQLFGELAQ
                     LVYEPIIRDYDETNEDEKAQEYSNSIENQDKMFAILACMEQLLENRNSILTSDETIKL
                     SKKTFKPQAGQKISDYHSELLSNLKLISGTPFKPIFDDLKNAKVVRNVSTSKSSHKST
                     SPQEFEDYLLRYEEEIPRMVREDKCIRDSLKKLNIVYNAKLEYYSHLQRISDSLVPLL
                     QLENVTRNAIVKSIRDDTQYRRNLEKISSAESRVKYLNGLNKLKESIKHNQSFSCAIC
                     LGTIHTGSIIKCGHFFCRKCIHSWLKNNQSCPLCKTRATLLEVYNFKFKEEPEEESPP
                     SSSSSSEKKNDSQNTNGNDNKQFKREHLDPVLKQKYEFFPQFEEVHKMVIKESFGAKI
                     DFVIKLILFLKLKSESESDQEDPPQILMYSQSFEFLKVISKVLNIYEIKHLSCWANVT
                     NVGEAISKFKRNTSITCLLLNVKSLGAGLNLLNARHVFLLDPIINRGDELQAMSRNNR
                     IGQTKETYVWNFMIKNSVEENIFKYKCVLEGRRRLLGEKLKVKQENLDTMTVEEEERE
                     ELEMNESTGEQVCGKHLKNCFFPCTS"
     gene            <398897..>399247
                     /locus_tag="ZYRO0E05214g"
                     /db_xref="GeneID:8204710"
     mRNA            <398897..>399247
                     /locus_tag="ZYRO0E05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499113.1"
                     /db_xref="GeneID:8204710"
     CDS             398897..399247
                     /locus_tag="ZYRO0E05214g"
                     /note="similar to gnl|GLV|KLLA0F22792g Kluyveromyces
                     lactis KLLA0F22792g and some similarites with YMR252C
                     uniprot|Q04814 Saccharomyces cerevisiae YMR252C
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499158.1"
                     /db_xref="GeneID:8204710"
                     /db_xref="UniProtKB/TrEMBL:C5E4E2"
                     /translation="MLKSLIKPQYFSHLQPRYFSTTVRLGQFKDWKSLSKKDKQEFIT
                     NYVELFQKKHPCSKGNVMNKNLSEGMHEYDDTPYVFGIIYNEIRSIALGEPNDNEDGE
                     GVLSDREFSSLLYK"
     gene            complement(<399318..>399788)
                     /locus_tag="ZYRO0E05236g"
                     /db_xref="GeneID:8204711"
     mRNA            complement(<399318..>399788)
                     /locus_tag="ZYRO0E05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499114.1"
                     /db_xref="GeneID:8204711"
     CDS             complement(399318..399788)
                     /locus_tag="ZYRO0E05236g"
                     /note="highly similar to uniprot|P35181 Saccharomyces
                     cerevisiae YLR170C APS1 Small subunit of the
                     clathrin-associated adaptor complex AP-1 which is involved
                     in protein sorting at the trans-Golgi network homolog of
                     the sigma subunit of the mammalian clathrin AP-1 complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499159.1"
                     /db_xref="GeneID:8204711"
                     /db_xref="GOA:C5E4E3"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:C5E4E3"
                     /translation="MTQIKYMILASRQGKVRLVKWYTPYTPKEKTKISKELPPLILSR
                     KPKMCNIVEYSDHKVVYRRYASLYFICGITPEADNELLTLEIIHRYVETMDTYFGNVC
                     ELDIIFNFGKAYAILDEMLMCDGAITESSKRDVLSHIHSMDTMEGSDQLERITS"
     gene            complement(<400002..>400904)
                     /locus_tag="ZYRO0E05258g"
                     /db_xref="GeneID:8204712"
     mRNA            complement(<400002..>400904)
                     /locus_tag="ZYRO0E05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499115.1"
                     /db_xref="GeneID:8204712"
     CDS             complement(400002..400904)
                     /locus_tag="ZYRO0E05258g"
                     /note="highly similar to uniprot|P32469 Saccharomyces
                     cerevisiae YLR172C DPH5 Methyltransferase required for
                     synthesis of diphthamide which is a modified histidine
                     residue of translation elongation factor 2 (Eft1p or
                     Eft2p) not essential for viability GFP-Dph5p fusion
                     protein localizes to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499160.1"
                     /db_xref="GeneID:8204712"
                     /db_xref="GOA:C5E4E4"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR004551"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="UniProtKB/TrEMBL:C5E4E4"
                     /translation="MLYLVGLGLSYKSDITLRGLEAVRKCSRVYLEHYTSILMAASQE
                     ELESFYGKPIILADRELVESGSDKILANADKEDVAFLVVGDPLGATTHTDLVLRAKRQ
                     NIAVDIVHNASIMNAVGSCGLQLYQFGQTISMVFFTDNWRPDSWYDKIMENRRIGLHT
                     LVLLDIKVKEQSIENMARGRLIFEPPRYMSISQCCEQLLEIEEKRGTKAYTPNTPVVA
                     VSRLGSASQQFKAGTIEELSQYDAGEPLHSLVILGRQCHELELEYLLEFADDKEKLRA
                     DVLADQEYFKPAPWVPPAEEEDSE"
     gene            <401122..>402849
                     /locus_tag="ZYRO0E05280g"
                     /db_xref="GeneID:8204713"
     mRNA            <401122..>402849
                     /locus_tag="ZYRO0E05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499116.1"
                     /db_xref="GeneID:8204713"
     CDS             401122..402849
                     /locus_tag="ZYRO0E05280g"
                     /note="similar to gnl|GLV|KLLA0F22858g Kluyveromyces
                     lactis KLLA0F22858g and weakly similar to YLR173W
                     uniprot|Q06247 Saccharomyces cerevisiae YLR173W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499161.1"
                     /db_xref="GeneID:8204713"
                     /db_xref="UniProtKB/TrEMBL:C5E4E5"
                     /translation="MVDSAGMEADIETQPLLGSSPSRQVLHRGRKSRRRYYTFGITSI
                     LVLLTLGAFVWRPILSSQVVVGNAVQVSNVEISKVHLDGWNSEGNQLQLTTNLNFWVD
                     YEDWIAGNQSQLSPWQKGLSRFASEKLVRTACFTLNNITNYDQNGTVAYVTVKEPICI
                     DLRQGQITPLQLTVLVEPRISNIFKVIKKLVLHQYDDLQISSKVDVTIGKRVAMLHIP
                     LGRLKNLNIKWNQMQSYLRGASEVLNRLLSMVNDVSIQDFTMKDSESGFSFDVSADPL
                     SIPTGFDWFGWPIDSQIPQINWQVKLPDCADECTIELPSLTCLSDAVKVEDPLKLSAF
                     IDVKGPLPESFLTQVCWSDDENAVTPITNFLNRLLNASQMVHIEAQGYPITNSHDNDN
                     NFLIPPETLKILLEEMSFIPLAANMTLDSRDSLRRVTIDGLRIKWTAGGHRLVVAGKM
                     VALVGLPFYKTNGQHMAVDHIKGVIKLFHDDIQFLAVPMRVWTPSTSKILHDEKKQTV
                     IELLLDIRDDEVQVTNSMELTRVLNEIIVRGHAEVQVSARLDLLVSTPLGELALLGLK
                     EQGNAIVRS"
     gene            complement(<404251..>405771)
                     /locus_tag="ZYRO0E05302g"
                     /db_xref="GeneID:8204714"
     mRNA            complement(<404251..>405771)
                     /locus_tag="ZYRO0E05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499117.1"
                     /db_xref="GeneID:8204714"
     CDS             complement(404251..405771)
                     /locus_tag="ZYRO0E05302g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499162.1"
                     /db_xref="GeneID:8204714"
                     /db_xref="UniProtKB/TrEMBL:C5E4E6"
                     /translation="MFVDYSGLQRFSSINRCFAHRFIQLLEYEDLDTLEERLKFLKSL
                     EKDEVCIQRLEITDFADHSDVMDYLFKLSLSVKQMQEVSEVIRRCPTTYSVEIFNANE
                     ISVDIGDVVAWAGMFLRNTYDSIRKALYDDIKQIIVDLKPELNNSSFQDWHLLQRYLF
                     YGWCEEVPKFMEPRTNIIIIPMNFPEIFVNNVNKNGFMSATSDITFYTFEVENGDYNS
                     LANFNIDSLVRRPIKDKISTIWKDGDEKDYIGTVWEPTKENNIHSNNISENATTQPNF
                     LTLFHECDSGLEPNTIVDGADNSFYMVQHDKERRHHRKYERDSSSPASDGGSAESESN
                     SHSDKDGSLYDIFSPLSSNELPTALTPPNNASDSSPVQGKNYNYMANLEREEKSKDYA
                     LLPPPPSFLPCYSDFENSSLYNQKQGFRYKLRQLFSSSSSSLHSRSKRQSSGDKSLTG
                     FDTIGSWADFQSSNWDDLSTKKFFRYKMRKWKKNYQYYKEVAKQCIEDFHDNTSYN"
     gene            <406954..>408648
                     /locus_tag="ZYRO0E05346g"
                     /db_xref="GeneID:8204715"
     mRNA            <406954..>408648
                     /locus_tag="ZYRO0E05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499118.1"
                     /db_xref="GeneID:8204715"
     CDS             406954..408648
                     /locus_tag="ZYRO0E05346g"
                     /note="similar to uniprot|Q06567 Saccharomyces cerevisiae
                     YLR253W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499163.1"
                     /db_xref="GeneID:8204715"
                     /db_xref="GOA:C5E4E7"
                     /db_xref="InterPro:IPR004147"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E4E7"
                     /translation="MMLFKRALKPLPLRRFATNSVQGKPVSKANKFKLTKTRITLGTV
                     LLCGTVYYNTSDTGHELLRHVFLTSKRIGIVTVATARCFYNYKKVLRGVYDSEEERNE
                     ALSKCHKKCALVTLNALQINGGVFIKLGQHIGAMTYLLPAEWTETMVPLQDQCPESTM
                     EEIKELFHQDLKTSIDEKFVEFDPKPIGVASLAQVHIARLRENGQKVAVKCQHPSLKE
                     FVPVDVMMTQTVFNLMDIVFPEYPLTWLGDELQSSIFVELDFTKEARNSIDTQTYFSQ
                     YRKETALRIPDVVSAKKRILIMEYVAGHRLDDLKYLDDNHISRAEVSACLSHIFNNMI
                     FTPNVGLHCDPHGGNLAIRALPSRSYLSANPHNFEIILFDHGLYRFPTTETRRYYAKF
                     WLALLDHDQEKVKMYAKRFANITDEQFPLFAAAITGRSIEAALNYDISKPRSNQEIKE
                     MASGMVKGTLFSDLMNILSRIPRIVLLILKTNDLTRNLDECLQNPLGPERSFLIMTQY
                     CARTVYNEACEAINNQYKRWSLCWMWQELKAWLEYESRKNQLLLYDIALWWKHKLI"
     gene            complement(<408747..>409241)
                     /locus_tag="ZYRO0E05368g"
                     /db_xref="GeneID:8204716"
     mRNA            complement(<408747..>409241)
                     /locus_tag="ZYRO0E05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499119.1"
                     /db_xref="GeneID:8204716"
     CDS             complement(408747..409241)
                     /locus_tag="ZYRO0E05368g"
                     /note="similar to uniprot|Q06568 Saccharomyces cerevisiae
                     YLR254C NDL1 homolog of nuclear distribution factor NudE
                     NUDEL"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499164.1"
                     /db_xref="GeneID:8204716"
                     /db_xref="UniProtKB/TrEMBL:C5E4E8"
                     /translation="MDLSTALNVISTLESQLKELETMSKDYESEMEQVIDKLRRDYVE
                     KCDQWESQRTHVTELEIRVDELESENAFLSNKINFLEEENDRHLERNVLLEHELYDAK
                     ERLENVDHIDRKKKLKRDSESLQVSTSGSSLLVMPRSHSTSNSNAKLNTSQVISTTSQ
                     RAKP"
     gene            complement(<409482..>410519)
                     /locus_tag="ZYRO0E05390g"
                     /db_xref="GeneID:8204717"
     mRNA            complement(<409482..>410519)
                     /locus_tag="ZYRO0E05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499120.1"
                     /db_xref="GeneID:8204717"
     CDS             complement(409482..410519)
                     /locus_tag="ZYRO0E05390g"
                     /note="similar to uniprot|P53110 Saccharomyces cerevisiae
                     YGL159W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499165.1"
                     /db_xref="GeneID:8204717"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023401"
                     /db_xref="UniProtKB/TrEMBL:C5E4E9"
                     /translation="MNEVVITDKEVSEFFLAADRGTHLAFLQELEFALQRYSANPSII
                     PPRIKAHTPSGSTVHLYMPVIDDVYSGVKTLGYNVNSNMGFVGSINVTDADSGALFGT
                     LEAKQVTGIRTALASCIGLYHQLTKFENTPRINCTVFGAGLQAFWHIFIVIQLFKGHC
                     DAFKVNILYRENPMDLEPLLKAVYSQEDAGEVVMEQFPLSDRANVQNCVSNSHVIFGC
                     IPSETPNLLFKDLAVPGTEVEHTYISLIGSYQPYMHECDAETIGRFQGRGTPIIVDSK
                     EHTPLESGELCDSGVYREQLVEIGELAGTTVPTLKCPNSRRSITLCKIVGLAIMDISL
                     SKKLLEISTSL"
     gene            <410945..>414679
                     /locus_tag="ZYRO0E05412g"
                     /db_xref="GeneID:8204718"
     mRNA            <410945..>414679
                     /locus_tag="ZYRO0E05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499121.1"
                     /db_xref="GeneID:8204718"
     CDS             410945..414679
                     /locus_tag="ZYRO0E05412g"
                     /note="similar to uniprot|P12351 Saccharomyces cerevisiae
                     YLR256W HAP1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499166.1"
                     /db_xref="GeneID:8204718"
                     /db_xref="GOA:C5E4F0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E4F0"
                     /translation="MSADVTVFNNGTSAATDPAAANKMKRKRNRIPLSCTICRKRKVK
                     CDKTRPNCEQCSKTGVAHLCHYMEQTWAEEAEKEISKESELKKLKNRVKALEEALVKA
                     QASSYSQTPDSDTPILEDTSPLRGEPTLSGGGKHDNDELDLTRQFDMLHLRNNGIIHL
                     GATHWLAIMKGDPYLKLLWGHIFTMKEKLAEWYGQKKRNPQAQMGKCPVMAPSVRSDC
                     PVDHRSLRKSESSVMPGKCPVDLTSLQKCPIDRSTMPRAPTESSSASKCPIDHSASTS
                     RSSVDHSSVSKCPVKHEETPLGSPVTKPQTSLPSFQNLTSKCPVIHDALPGIQEAISR
                     NEPAERNAPVDQKLDYSQTMARLCELLPPKRIICMFIEKFFKQIYPVIPILDESTFKN
                     HMNYMLSLGVNTETDNVKHIRMNKLADFCNLGILVIILRLTWWSLPVNGCKIDLGSHN
                     PSFFMPHATTASVTQAKEEAMLANYATPAEALTLVRENLIKFDQISSVSNSNVNLTTV
                     QFSIFYKLYLMCWSNDSGGNGKAANSNNGDNQDNESHQVLFSSIAQMAFSCGLHRDPD
                     NFPQLNSVPYAQTDGSNPMSNNNGVNATGSARPHKDAVASTEKFKHTWRKTWYYIVSL
                     DVQQSLSLGTPRLLRNLNDFSDTKLPTASKLDYVSDIKELVIVKNTTLFFQIDLCIIA
                     VLNHVLNVSVARNVKKSQLDFLISSLGDLTNNKRNICEVLNGLINNGMLHSSEGTVDN
                     DMENIYGLPSLEELLSQQTAPSSENDVDKRLELAHESTTKALFFSKHLTIRMLLYLLN
                     YVLFTHYEPLGVEDSDNASIAKSYAQETLNYAMDGYRNCLFFFTNVGHPGSSGSMFNY
                     IEVVLAPQCLDIGHRALQFIVCLILRAKCGPLTGMGESAIIGNNNGSAGNSEEEDDRS
                     NWRKKEGSVDSVDDRDDEISLDTGERLADILLSKMILFHKMTKQLCVKYQYAQRTMKS
                     TGFFIALLREPSQKSKRGDGQSGDKKHPKLNKMTGLFRNLPSLILCGDGEQLKRCPVY
                     QDAIGFVTPRTDPGINRQGMFGLDSARSGVQLPPLKAYKPITYVSSSVRTERGGEEAK
                     RRRLNGGPPLSSTDIPLGSMPAVPPITSPRSVPGAPASLPPIDKIAGDLTPGHQPNAA
                     QFGPMDEIDGRGASTFTTPVSEGSLSNFTPTFEDFLMENANFNGIMLNPSSIVEAVGF
                     HNFDGVNMPLGGEPADFLPLDSIGIDGLAEPNGVQFPNMG"
     gene            <414824..>416638
                     /locus_tag="ZYRO0E05434g"
                     /db_xref="GeneID:8204719"
     mRNA            <414824..>416638
                     /locus_tag="ZYRO0E05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499122.1"
                     /db_xref="GeneID:8204719"
     CDS             414824..416638
                     /locus_tag="ZYRO0E05434g"
                     /note="weakly similar to uniprot|Q05902 Saccharomyces
                     cerevisiae YLR299W ECM38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499167.1"
                     /db_xref="GeneID:8204719"
                     /db_xref="GOA:C5E4F1"
                     /db_xref="InterPro:IPR000101"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5E4F1"
                     /translation="MQLALLTTQNFQLLQRSPMSYNSSRRSTVHSTKGIVASTQPLAS
                     AAGAKVLELGGNSVDACVAVAACLCVLEPPSTGIGGDCFMLHYDNNSKKVIGLNGTGR
                     SPANLSRTDIIAENESLGRPDAKRMSMGSVHSVTVPGAVAGWVDAVEKCGSGKVTLSQ
                     ILQPAIDLCEKGHPISKISSILTLNCWKKLNAVNSPELLECFAPVSQPLAPPKDGELV
                     VNKPLGRILRSVAENGKDAFYDGDVARGIIGEVQHRGGLLTLDDLKNHASTLVEPIHM
                     DFLGGRIWEIPPNSQGLVVLLALGIIKELQKSGTIDLYAMKHNSAEYLHLLIEALKLA
                     FYDVDEYVGDPEFGGDGNLISLWLSEYYLKKRAAMFDSHRVIDGSKTTHGVPDPNVNQ
                     SDTVYFTASDPEGNATSFINSVYTGFGSAIIPRTLGGFCLHNRGANFNLLEGSRNCLE
                     GSKRPYHTIIPALITDPETNELIYTLGNMGGFMQPTGHVQHFLNLMLFKLSPQESLDS
                     PRICLSPHPDHTHLDRGRGAGGPVSSPVTLVEVEEDMDPTVVEQLRHLGHAVKVVRAH
                     DRSVFGRGQIIKKTSAGDGFIYSAGTDKRGDGIPIPLI"
     gene            complement(<416737..>418317)
                     /locus_tag="ZYRO0E05456g"
                     /db_xref="GeneID:8204720"
     mRNA            complement(<416737..>418317)
                     /locus_tag="ZYRO0E05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499123.1"
                     /db_xref="GeneID:8204720"
     CDS             complement(416737..418317)
                     /locus_tag="ZYRO0E05456g"
                     /note="similar to uniprot|P53109 Saccharomyces cerevisiae
                     YGL160W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499168.1"
                     /db_xref="GeneID:8204720"
                     /db_xref="GOA:C5E4F2"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /translation="MSSELVKRHGHTHYANIPYGYYVLIVSFFYLVFLGVLRIILKPR
                     AAGFNSSKRSRLAQKLYLVNPVVHLPILLVAVLLPFYRHYSISEHATVYIKRLGRLSY
                     ALLPLNLLLNLRPNWLLRNNYTYTDLIPLHKWLSRCIIIIAVVHGILFLINWALGESG
                     TLAKKIANPYNLAGVLLFAPLISMIFFSIGPMRRFSYNAFYVIHNLTGISFIFVVAFH
                     ARPSVTIPYLLINIAILLWQGFAKFYYAKRTDILSKNTDYQNTNLVNVQLPRMALPDQ
                     FEPACHIRISPYSRLHPLYWLYPSHPFTVASLPSDTVVDLIISESHHPKSFKLELGAP
                     YSVINNFDPAVPRSCLEQAKRVAIVCGGSGISFGLPLYRYFKEIHPVEYIQFIWLVKD
                     AYQLKILDKLDTIGLLDGSNDCHAFITRSVDDPNSNQETAPDLEFELESMTQDVVDEN
                     GAFVSERDGSPTSKFKFASINLGRRIDWATDLSQFVEPALVDNTWLLTCGPSDLIESG
                     RQYAADNSINFASEIYAL"
     gene            418686..418756
                     /locus_tag="ZYRO0E05478r"
                     /db_xref="GeneID:8204721"
     tRNA            418686..418756
                     /locus_tag="ZYRO0E05478r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.56"
                     /db_xref="GeneID:8204721"
     gene            <419461..>420420
                     /locus_tag="ZYRO0E05500g"
                     /db_xref="GeneID:8204722"
     mRNA            <419461..>420420
                     /locus_tag="ZYRO0E05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499124.1"
                     /db_xref="GeneID:8204722"
     CDS             419461..420420
                     /locus_tag="ZYRO0E05500g"
                     /note="weakly similar to uniprot|Q06146 Saccharomyces
                     cerevisiae YLR257W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499169.1"
                     /db_xref="GeneID:8204722"
                     /db_xref="UniProtKB/TrEMBL:C5E4F3"
                     /translation="MRQDNPMVAPSLVGDSVRNVDDAHSSESRDEPIDHATSSSMVLN
                     KIQPQSGSVDGSYTTVDELNREGALLTDEMDMDQVVNATDKVHEDPDEHRKWLKSLKK
                     KQLEQSRDHSNNNNNKSNGSLTASPVHSSESKSLLGSVDLGDDQITFSPQSKSRSAIR
                     NSYGEFIRDESHRPHLAKGESYQSAGGTGETLPIDEKEERLGRRTARSLDTGSREYLR
                     SLSRSLSRDPAAHRRNQQVSTAEAGESLENARLYSTNNYSISQADLEHAPHIIQTLKE
                     EPEESEESHNHHKHVQTPKRSNASPSSKDTISEEHATHEARHL"
     gene            <420518..>423310
                     /locus_tag="ZYRO0E05522g"
                     /db_xref="GeneID:8204723"
     mRNA            <420518..>423310
                     /locus_tag="ZYRO0E05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499125.1"
                     /db_xref="GeneID:8204723"
     CDS             420518..423310
                     /locus_tag="ZYRO0E05522g"
                     /note="weakly similar to uniprot|P43597 Saccharomyces
                     cerevisiae YFR016C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499170.1"
                     /db_xref="GeneID:8204723"
                     /db_xref="GOA:C5E4F4"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5E4F4"
                     /translation="MKDQDAVSEAAAKRSSGRRSQVLDLDSIMVGIEEYLNNDDSDHE
                     QKTDKHVDKAATDVPVNIVDGEQNEKGKNVIDLTGKDEDEDEDKGDGENRNDEKSFDD
                     NDTLPTTQESLTQNKDHLNQFSAPSSNLSGETPISTQDHVHETTKDKDSQIPASIQGI
                     EKGSDAPAEKSISGDDFTQKDLHERVASAEKSITNDDNKQKDQPAQAAPAEKSMLNDD
                     HMQKDQHEQVASAEKSISSDDRTQKDQPAQAASAEKSIPSDEHIKKDQHAQAAPAEKS
                     IPSDDRKQKDQHSQAAPAEKSIPSNDHMQKDLHGKAASVEKSIPSDGSKQNDQPAQAA
                     SAEKSIPSDDRTQKDQHEQVAPAEKSIPIDDRTQKGQHEHDDRMQNDLHAQAAPAEKS
                     ISSDDRMQNDQHVQDALTTKVEKPVKEQLASGKTEQTAGSMEEKCARKEVTKDEPIEN
                     IDEPTKVVEEEIKQHQKVRENSAEDSSYLKSTNNTEERTENREGSAKKNAEGDYMRKP
                     AGSPKDLPETHARPFGNSGMSHTKETLEKSAVQYAPQNDIGPAEEKEPAEQSNKSISK
                     RLQGEKDESNQSPSGPLDHQGPLTTHTNNSSRSNLTVSVGPKTDGNSDKYNDKSEQDV
                     ESDMSGQNNADTRLKTEEQERPEGASIVSNAHASNASNTEGSAECAVVGGDKDSKSAS
                     HIEGNEGGTVRPHVAREISTNEEDGSDAGNLSAATDANTTDDSDLHSERHSTSLTSGS
                     TENAEKSAGKREAEYDNGIKDSNRNKDKLKDCQDNYEETNTIKTTEQKQHQKPPQITP
                     PLQQEEEKQQAVSKIDAETEAILKGLDNPQELLKELEAERRKEPVFILTSLAGGGFHI
                     IPRTNRLATILQANRIEFSYKDLGTDPQARNLWKAHAQGKQLPGLVRGSDVIGNWQDV
                     EDANEEYRLEEILYSL"
     gene            <424445..>426691
                     /locus_tag="ZYRO0E05544g"
                     /db_xref="GeneID:8204724"
     mRNA            <424445..>426691
                     /locus_tag="ZYRO0E05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499126.1"
                     /db_xref="GeneID:8204724"
     CDS             424445..426691
                     /locus_tag="ZYRO0E05544g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499171.1"
                     /db_xref="GeneID:8204724"
                     /db_xref="GOA:C5E4F5"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:C5E4F5"
                     /translation="MSIKEIALDLTVFTLTSVNDAISFKPQLCFEVPKQDYQQLKEDY
                     INFTGTSIRKNRSKLFFLPTNVSDELQKLNASVPESAKRVPNDGRVYYKNRLITELDY
                     ENVKRVETACAFIAYTALNSFVHFETDVKGNASGNGDHESVPMVSTVSAGTNTGSSGS
                     SVDIDGTSSNTVGNGGDDDDENEEVSSSESVTRALKKGNILGFRELGHLVGITPWHFH
                     RVFKVITGLTIREYGQLCVEFIKKNKELINACRVRVVRFKLTEHYSCLDDTHFLRDGG
                     LQYPATENVVLLPDYFIDPNKSKEFKKRKSSTKPVQEEVNYGVTQRSQIRKRRSSVVY
                     GRIQRASQNTITSNSLNDCLTSPTTTRRSVSFPRSDEENINYNYDYGYNYKNDGNDNV
                     NGNNIIDSNFGNQIENDTFNNYHYSNTTTNNNFDNDTDESTSASSDWERPIQNVFPPL
                     SMATPRPTSPAITSRKNSIISIGSAGAAASASNNKVSKKGGNLMEAHRRNRSDGLGLN
                     LDSLRDGSIDHKLSMATTSAGTAVGGDNGNANTSTIEFNNNIFQNDDAEDVDFTNLDY
                     NSSNNIFQKQFKLDPKYPYPSNSSDTNVDSKANSVSRSSGSAAAAAIAAFSGVNGNGN
                     NNDSNGNSGMEGVPSMTDISLFNNSLLEQTTTPAASLLLDTDPTSASTGIQEELDVDT
                     LLNNSSSLLDELVPFSSHPHHHHNHQPQRKDGIAAGELFSMPEENELFDTLNGDLLAG
                     DALLSFEH"
     gene            <427628..>429745
                     /locus_tag="ZYRO0E05566g"
                     /db_xref="GeneID:8204725"
     mRNA            <427628..>429745
                     /locus_tag="ZYRO0E05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499127.1"
                     /db_xref="GeneID:8204725"
     CDS             427628..429745
                     /locus_tag="ZYRO0E05566g"
                     /note="highly similar to uniprot|P23337 Saccharomyces
                     cerevisiae or YLR258W uniprot|P27472 Saccharomyces
                     cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499172.1"
                     /db_xref="GeneID:8204725"
                     /db_xref="GOA:C5E4F6"
                     /db_xref="InterPro:IPR008631"
                     /db_xref="UniProtKB/TrEMBL:C5E4F6"
                     /translation="MGRDLQNSLVFEVATEVANRVGGIYSVLKSKAPVTVAQYGDNYT
                     LMGPLNNGTWQSEVEELDWTANETFTEELRPLQSVLKSMHSRGVRFVFGRWLIDGSPR
                     VILFKLDSVRGFLNEWKGDLWSLVGIPSPEHDPETDDAIILGYMVAWFLGELAHLDHK
                     HTIVTHCHEWLASVALPLCRKRRIDVVTIFTTHATLLGRYLCAAGNIDFYNNLAHFDV
                     DHEAGKRGIYHRYCIERAAAHTADVFTTVSQITALEAEYLLKRKPDGILPNGLNVVKF
                     QAVHEFQNLHAIQKEKINEFVRGHFHGCFDFDLDNTLYFFTAGRYEYKNKGADMFIEA
                     LARLNYRLKVSGSKKTVVAFIIMPAKNKSFTVEALKSQAAVKALENSVAEVTRSIGKR
                     MFEYAMRYPHMGVHSEIPQDLDELLRPSDKILLKKRVFGLRRAEGELPPVVTHNMVDD
                     ANDPILNQIRHVALFNHSSDPVKIIFHPEFLNQNNPILGLDYDEFVRGCHLGVFPSYY
                     EPWGYTPAECTVMGVPSITTNLSGFGAYMEDLIEVDQAKDYGIYIVDRRFKAPEESVE
                     QLVDYMEDFCKKNRRQRINQRNRTERLSDLLDWRRMGLEYVKAKQLALRRAYPESFRQ
                     LVGEELNDLNMETLAGDKKIKIARPLSVPGSPRDRANSVSSAVYMTPGDLGTLQDANN
                     ADDYFSLAVDDKEDEEDRVYYDE"
     gene            <430271..>431686
                     /locus_tag="ZYRO0E05588g"
                     /db_xref="GeneID:8204726"
     mRNA            <430271..>431686
                     /locus_tag="ZYRO0E05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499128.1"
                     /db_xref="GeneID:8204726"
     CDS             430271..431686
                     /locus_tag="ZYRO0E05588g"
                     /note="similar to uniprot|P22517 Saccharomyces cerevisiae
                     YOL016C CMK2 Calmodulin-dependent protein kinase and to
                     YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
                     CMK1 Calmodulin-dependent protein kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499173.1"
                     /db_xref="GeneID:8204726"
                     /db_xref="GOA:C5E4F7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5E4F7"
                     /translation="MDSSTKDNSHHNSHSEEANHSDTQDGELVAPNHVGGNKVSKLLY
                     KLSGQPESYINKRDYVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKALKGNDVQL
                     QMLYDELSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDA
                     VKIVVQMLNAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELI
                     FKAAGSLGYVAPEVLTTNGHGKPCDIWSLGVITYTLLCGYSPFVAESVEGFLEEVAKD
                     RYPVKFHEQYWSKISTEARRFILRALEINPQYRPTASELLCDPWITSKSNYTHDLLPH
                     VKKQFDARKKFRDVVEIVKLNNRIDKLRNMYCEGSEEEEDLQGNDLSPHKSLLDSLKD
                     LSLQQPDRAASTPGTSSSQSHDELKSSLTQSAFAQLVKAATTNTDKVLNYKDPLAAKS
                     EEAEAEAEKREAAKAKSDLKK"
     gene            complement(<431805..>434438)
                     /locus_tag="ZYRO0E05610g"
                     /db_xref="GeneID:8204727"
     mRNA            complement(<431805..>434438)
                     /locus_tag="ZYRO0E05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499129.1"
                     /db_xref="GeneID:8204727"
     CDS             complement(431805..434438)
                     /locus_tag="ZYRO0E05610g"
                     /note="similar to uniprot|P43596 Saccharomyces cerevisiae
                     YFR013W IOC3 Member of a complex (Isw1a) with Isw1p that
                     has nucleosome-stimulated ATPase activity and represses
                     transcription initiation by specific positioning of a
                     promoter proximal dinucleosome has homology to Esc8p which
                     is involved in silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499174.1"
                     /db_xref="GeneID:8204727"
                     /db_xref="InterPro:IPR028942"
                     /db_xref="UniProtKB/TrEMBL:C5E4F8"
                     /translation="MSESQDLSVRPEEPLSADTQENGSANVTGNASDDQPPNEKKLGQ
                     LTFDDFENIKRVENAPNMSSHSMGLRRSKRVPQQKSKQDVADIMEQEAEAEAARKRKA
                     QSTAKAKARARERERERYRAKVAAMKKNEASGNTTSKKPANGPTTSSAAPENQEPPLT
                     NDNWSPNMPLLSSDFKTHHSVISRLKNPNMKPVLYAGDVMKVMGFVNKFYQFFDTDVL
                     NLSFQNFEVGLDLYPGGPVGEVIGIYDETKQRTLLYQDYLPIKDVVSSQDKMNLLFLT
                     LLKLTFSQSKAGELQKSHQPLTNLDQMKAQKKPFTMLVRQLRNSARTWGYPKEWRMND
                     IDKEEFFQPKSKLFENDEIEESVDPKMSEILTPNIYQWHHHEPVPLEEDPLQSSELEK
                     DGILALNPRDRIILLRAMVDWCGSQSPRIRNEIYHLSHTKRDPAFGVQTQHAPRYLVE
                     GSAVTYAQFRKLCSIVQSRYEIRSKKKHVKKQLSNGKKEDLSIKLKILEEIKQTLKDM
                     PKEEKDQTMINLYEKWEKLFEGELPDNPLSNPFEDEVYKLRQQEFFIGRVPHIGDFYL
                     PRLHTYPDEGIISTYMNVRNLKSMHDKYANGEIDSLALFEKNGQIMSTQFKVLYHDTI
                     SLIRDTAQGQPTLGKTYWYEMCHDTKTLKEFLEFLDCKIVVGENQGKDSQPGELSENG
                     LPSEEVKDESKDEAKDGSKDEAQDDPKDEAKDESKDEAKDESKDESRDEKGKSGTNSI
                     LNKNPLPKESRFNPARNKLRFLKDYLSEMYDILKVFEDLREQYGDTKPSQRLLRRSQR
                     RNVSYGFDSDAEEADVDMGEEYVDEEKNVEYDDDDDAALDYEDDYQDADEEESRGTRK
                     RGRPGRPPKQTRSVRRNTRRR"
     gene            complement(<434758..>437055)
                     /locus_tag="ZYRO0E05632g"
                     /db_xref="GeneID:8204728"
     mRNA            complement(<434758..>437055)
                     /locus_tag="ZYRO0E05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499130.1"
                     /db_xref="GeneID:8204728"
     CDS             complement(434758..437055)
                     /locus_tag="ZYRO0E05632g"
                     /note="similar to uniprot|P36096 Saccharomyces cerevisiae
                     YKL034W TUL1 Transmembrane Ubiquitin Ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499175.1"
                     /db_xref="GeneID:8204728"
                     /db_xref="GOA:C5E4F9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5E4F9"
                     /translation="MEIDGNTLLIIIIILFLFFSTPGGDGVSSQYEFNQLQSFKSQLN
                     TEYESFEQMSYNSGFRNITGFKLSFNDVKDDPQRNATYPIPSKDYDRWFQNQDYLILP
                     EDVTTRVKNEVWSPNMNKPEENVFPPNITSSLLGRIQLISNNKHPRIPMPVPRFYESP
                     TEFSDVTPPEGETYFKDWPAHSELHNVTFDTGELTIQLTHVDKVPSQLGSQKKKFFNS
                     QTDRWKFLNLRISLSDKSEHERHSLYTNAIYDVRRGRILAMTESAKFHSLFAFPHYMN
                     LQNDNDNDDEDTFDSLKKAVKEYWDKSNFVKTLTMGDLQSWYDESILKCEYMVFLQLS
                     PWNQYTRDQIKMIDDELNWPLGRPANLSHLPPVTVSKGILYSPDCGVELEFHDAKGER
                     YGLKIRSIRTHLLFGIGLFIAQIYLLLCQMHHTNTPSSVNKISVYCFSMINLVDGSLA
                     TIYFFSASILPELYLPLVTSAFACFILASVFETRYLISVYASQLNERNVGISTLLRGG
                     HSTNEDTDTATAVVPDESSISGSLYARFFFMLVSFTLLSMSARWWPRKVRMMFEYSAI
                     IVLNSYWLPQIFRNAIKGTLPRRNRLRNQRMNEAMGVRRQNKMPLLWKFVLGTTFIRT
                     LPVVYVFTYSSNVFRHHRNVRFVVVLCLWLLFQIAVLYSQDILGSRWFLPKLSIPEGY
                     SYHKAMPAQDLLEHGSTAGYTIDCAICMSEVPIRVEEVPETHKVDEQTYMVTPCAHIF
                     HTQCLENWMSYKLQCPVCRSPLPPL"
     gene            complement(<437437..>438939)
                     /locus_tag="ZYRO0E05654g"
                     /db_xref="GeneID:8204729"
     mRNA            complement(<437437..>438939)
                     /locus_tag="ZYRO0E05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499131.1"
                     /db_xref="GeneID:8204729"
     CDS             complement(437437..438939)
                     /locus_tag="ZYRO0E05654g"
                     /note="highly similar to uniprot|P32861 Saccharomyces
                     cerevisiae YKL035W UGP1 UDP-glucose pyrophosphorylase or
                     UTP-glucose-1-phosphate uridylyltransferase EC:2.7.7.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499176.1"
                     /db_xref="GeneID:8204729"
                     /db_xref="GOA:C5E4G0"
                     /db_xref="InterPro:IPR002618"
                     /db_xref="InterPro:IPR016267"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5E4G0"
                     /translation="MSYQKKHIKTHSTYAFENNTNAVAASQMRNALNKLADSVRDDEN
                     LRNRFENELDSFFSVFRRYLVEKSSGNTLLWEKIKSPTQEEVIDYGSLKPTHDDISNL
                     SKLAVLKLNGGLGTSMGCVGPKSVIEVRDGNTFLDLSVRQIEYLNRQYDSDVPLLLMN
                     SFNTDKDTEHLIKKYSANRIRIRPFNQSRFPRVFKDSLLPVPSHYDDELDSWYPPGHG
                     DLFESLHASGELDALLAQGREILFVSNGDNLGATVDFKILNHMIETGAEYIMELTDKT
                     RADVKGGTLISYDGQVRLLEVAQVPKEHIDEFKNIRKFKNFNTNNLWINLKAVKRLVE
                     SSSLSMEIIPNQKTIKRGGQEINVLQLETACGAAIRYFEGAHGVVVPRTRFLPVKTCS
                     DLLLVKSDLFFLEHGSLKLDPSRFGPNPLIKLGSHYKKVSDFNGRIPHIPKIVELDHL
                     TITGNVNLGKNVTLKGTVIIVCSDGQSIDIPNGSVLENVVITGNLQILEH"
     gene            complement(<439616..>442816)
                     /locus_tag="ZYRO0E05676g"
                     /db_xref="GeneID:8204730"
     mRNA            complement(<439616..>442816)
                     /locus_tag="ZYRO0E05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499132.1"
                     /db_xref="GeneID:8204730"
     CDS             complement(439616..442816)
                     /locus_tag="ZYRO0E05676g"
                     /note="some similarities with uniprot|P32862 Saccharomyces
                     cerevisiae YKL038W RGT1 Glucose-responsive transcription
                     factor that regulates expression of several glucose
                     transporter (HXT) genes in response to glucose binds to
                     promoters and acts both as a transcriptional activator and
                     repressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499177.1"
                     /db_xref="GeneID:8204730"
                     /db_xref="GOA:C5E4G1"
                     /db_xref="InterPro:IPR001138"
                     /translation="MTPMSENNGSENTRDVSAAMMKSRSNSSEYAGGDGSFHASEVES
                     QSSQGASGGNTSASKRRTKASRACDQCRKRKIRCDYDDDKGVCTSCRKNGESCAFERI
                     QLKRGPSKGAVRGHSVSRSISGENNNTAATAVGSGGEFSSPSSRQGSVLLPPLGQYLP
                     QPAPVPSNLNATQQQQFWKVPYHDFQGQRRGSIDSLSSDMSAKSVNIPQEHLLYASPS
                     AGHPPLHSPVTFGPNNSSTDSGYWPFRNSGGEESDELRRKSGSNPPSLKNVSQPPPPP
                     LQQQQQQQYSYSKFNNSFAQYGANGFPSRHGSIASEGMSPSASVPYQSVPMNQSNSNG
                     LSQQQQQPIQWPKVQPKNLPPPQVQVQAADKEETLGNSFQKTIKKRRTVSASSGENKA
                     EPGEYPLARFSSSGNDSLLGGNLVSPAGFVYGQIPEIQLIDIYYEFIHMVFPIIPLNK
                     ETVTNEILLVNTQPISPIHEINNYVILWFRNSLELLIRITLKRRSGHFYDSLTHSKER
                     ELSNEIRGNSNGGGSNDSKDDNLEMQGVFVTALNECLQKIVDIHPSFRENKDKISPKV
                     KIIYLSTFVLLNYILAVVGYDNSFVLGMSTTIFKDFKVYELLLYDDEDDDATKSGSND
                     NDNTNNDNNSNNANNDNNDSRFYDENNAMNWDQAGYSITFKRLYVLLIIFDSLQCCSY
                     GGPKLLNVPIEGASERFFQTKPHSNSKWVVDQSPTRMKFILQSVKFGELLAECSMKRR
                     SICDLSRTQLTWEIPPYFLKGVTDEDDELFSLAQLLAAFILIRKEFVDCLLNLQDLET
                     GELPTVDMELCGELIKLLCQLTSIILQALTVMMRTNPKNHIDYNYRPMKPMEHDDSGN
                     SASRKFTTSQAESGKNSGNDFYHKLLGLQDNAEACLTNLLRGSISPYCISMLREIRNV
                     MELVKKMPASLIGVVMACAGTHHNTANNNNNDPLAITFQSQELVVKLSNCMNDMMQIT
                     SLLNMIKPVNLSDQDSDNTSATATITTTETISKSLNRDHSIMRRLYYSKAAKRDKKHI
                     YPSSSSSPQLQETITTLKSFVLIGWKLLDDFELGWS"
     gene            <444081..>444947
                     /locus_tag="ZYRO0E05698g"
                     /db_xref="GeneID:8204731"
     mRNA            <444081..>444947
                     /locus_tag="ZYRO0E05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499133.1"
                     /db_xref="GeneID:8204731"
     CDS             444081..444947
                     /locus_tag="ZYRO0E05698g"
                     /note="similar to uniprot|P38747 Saccharomyces cerevisiae
                     YHL013C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499178.1"
                     /db_xref="GeneID:8204731"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:C5E4G2"
                     /translation="MDEILSRHRKESKDLQNRITGMKKQATKSTRKQVMAKCNDLEQE
                     MKQRHELEIKEFNGEMKNEDEEVTPEKLLEQLSIDNDTQKTTESTSAPTPAPTSEPKK
                     RRNRQKERLAKRDAEIVKMKQEAEEEASKQPDLKKIEQDSLDQLCNLNHLMPHDIKPD
                     GHCLFASILDQLTVRHGIKDLDIYKLRQLACNYIRSHSDDFIPYLFDENTMQLQNINE
                     YTDEMEKTAKWGGEIEILALSKVFDCPISILMSGRATHIINEAGEKPELKLIYYKHSY
                     ALGEHYNSLHNA"
     gene            <445100..>446314
                     /locus_tag="ZYRO0E05720g"
                     /db_xref="GeneID:8204732"
     mRNA            <445100..>446314
                     /locus_tag="ZYRO0E05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499134.1"
                     /db_xref="GeneID:8204732"
     CDS             445100..446314
                     /locus_tag="ZYRO0E05720g"
                     /note="highly similar to uniprot|P38746 Saccharomyces
                     cerevisiae YHL014C YLF2 Protein of unknown function, has
                     weak similarity to E. coli GTP-binding protein gtp1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499179.1"
                     /db_xref="GeneID:8204732"
                     /db_xref="GOA:C5E4G3"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4G3"
                     /translation="MSIARKVLLGRPSNNLTTGIVGLANVGKSTFFQAVTDSKLGNPA
                     NYPFATIKPEEAKVQIPSNRLSHLAKLYQSAKCVPATLTMYDIAGLIRGASSGEGLGS
                     AFLNDIRHVDGIYQVVRGFVKEEITHIEGSVDPVRDLSVVQDELILKDVEFLEGIREK
                     IGRKMGRTAKTSMEYRDLSVELELMNSLEEHLYEGRKIIHFKDDWTPQEVSILNRHNF
                     LTAKPSLVLLNVSAKDYILGQNQFVKPVKDWLNAYSPGDELVLFSAEFESAYNELGSN
                     AQDLLKHAETTWGLSQRQLPNSALPQILLKMRELLHLISFFTCGPAESRQWTIREGTT
                     APEAAGVIHTDLQKTFINASVIKYEDLAQLEPPLQESILKSQAKIKRAGKQYEVEDGD
                     VVLFKAAGGKAR"
     gene            complement(446357..446466)
                     /gene="SNR69"
                     /locus_tag="ZYRO0E05742r"
                     /db_xref="GeneID:8204733"
     ncRNA           complement(446357..446466)
                     /ncRNA_class="snoRNA"
                     /gene="SNR69"
                     /locus_tag="ZYRO0E05742r"
                     /product="snR69"
                     /note="C/D snoRNA monocistronic SNR69"
                     /transcript_id="XR_002648408.1"
                     /db_xref="GeneID:8204733"
     gene            complement(<446910..>447269)
                     /locus_tag="ZYRO0E05764g"
                     /db_xref="GeneID:8204946"
     mRNA            complement(<446910..>447269)
                     /locus_tag="ZYRO0E05764g"
                     /product="40S ribosomal protein S20"
                     /transcript_id="XM_002499135.1"
                     /db_xref="GeneID:8204946"
     CDS             complement(446910..447269)
                     /locus_tag="ZYRO0E05764g"
                     /note="highly similar to uniprot|P38701 Saccharomyces
                     cerevisiae YHL015W RPS20"
                     /codon_start=1
                     /product="40S ribosomal protein S20"
                     /protein_id="XP_002499180.1"
                     /db_xref="GeneID:8204946"
                     /db_xref="GOA:C5E4G4"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR005729"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:C5E4G4"
                     /translation="MSEFEKGKVQEQEQPQIIKIRITLTSTKVKQLENVSANIVRNAE
                     QYKLTKKGPVRLPTKVLKICTRKAPNGEGSKTWDTYEMRIHKRYIDLEAPISVVKKIT
                     QITIEPGVDVEVEVAKN"
     gene            <447852..>449156
                     /locus_tag="ZYRO0E05786g"
                     /db_xref="GeneID:8204734"
     mRNA            <447852..>449156
                     /locus_tag="ZYRO0E05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499136.1"
                     /db_xref="GeneID:8204734"
     CDS             447852..449156
                     /locus_tag="ZYRO0E05786g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499181.1"
                     /db_xref="GeneID:8204734"
                     /db_xref="InterPro:IPR012469"
                     /db_xref="UniProtKB/TrEMBL:C5E4G5"
                     /translation="MTVPKPAEFFKTIRSVRDTTGPVYQLIKNQGEGNYYKLDESKMD
                     QVTEYLCKIIARDYGDNYNSIPPHGRWQHLNAGGHLRVEQLIDQWRAAKTDEVEISRR
                     LIDLLVVSVLVDAGAGNLWKYIVGESESYSRSEGLAVASYYLFVDGEFSSDSNTKFQV
                     NGQKLKDFTMDQFVKGFQVSDANPLNGAEGRLQLIQKLGDSLLTHPEIFGSDARPGGI
                     VDFLKKEASTGNCIDLNDIWNALMDGFVTIWPQGRATIQGQPLGDSWSLDTKSKTEKK
                     WDDEFLDSLVTFHKLTQWLCYSLLVPLEKFGHKFQVSNKELQTGLPEYRNGGLFYDFG
                     VIALKPEHLKRGLALSDKLGVKEPIPTFTAEDGAIVEWRCLTIGLLDELHALVNKRLN
                     TNLALPQVIEAGSWKAGREIAAEKRPLTKGPPIELQSDGTVF"
     gene            complement(<449379..>450941)
                     /locus_tag="ZYRO0E05808g"
                     /db_xref="GeneID:8204735"
     mRNA            complement(<449379..>450941)
                     /locus_tag="ZYRO0E05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499137.1"
                     /db_xref="GeneID:8204735"
     CDS             complement(449379..450941)
                     /locus_tag="ZYRO0E05808g"
                     /note="similar to uniprot|P32857 Saccharomyces cerevisiae
                     YKL039W PTM1 Putative membrane protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499182.1"
                     /db_xref="GeneID:8204735"
                     /db_xref="GOA:C5E4G6"
                     /db_xref="InterPro:IPR009637"
                     /db_xref="UniProtKB/TrEMBL:C5E4G6"
                     /translation="MKDFAGFRMSVAKILLTFGFLLNLCVANKMTMDQDDIQVCSGMY
                     SKQDHGGKTDPFISFNMKKLTNGDPGVVVAIFDFQDYEHLGVEVSEGVHHYICDDYAI
                     SKGYCKEDKKDQFIVQDVAYDPYTGANKTLANKVMSFSQNAAGLHDKKYPVTKTGYYC
                     VLGFSKSDSTKYQAVVNFRNAYGHLAASEINKLPLYGLLAIGYVVAMALYSFAFWRHK
                     HELLPLQKYLLAFFVFLTAEAIFVWAYYNIQNEKGDTAGIKVYMVFLSILTAAKVTFS
                     FFLLLLIALGYGIVYPKLNKTLMRRCQLFAVLNFALSVAFLIQSYLEDPESTSLMILI
                     TLVPVSITMFAFYFMILKSMTNTVRYLRDQRQVVKLGMYKKLMTIIYASLLIILAGLV
                     ISSFVFLGMNTIEMIEQHWRTRFFFTDFWPTLVYFGVFVIFAFIWRPTDTSYMLACSQ
                     QLPTDPENVADFDLDDLQSMGELDNEFDDTIRDEDINFTDEEEHQPQHEEVHHDDDTH
                     NKDGNINPPKSA"
     gene            <451608..>452372
                     /locus_tag="ZYRO0E05830g"
                     /db_xref="GeneID:8204736"
     mRNA            <451608..>452372
                     /locus_tag="ZYRO0E05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499138.1"
                     /db_xref="GeneID:8204736"
     CDS             451608..452372
                     /locus_tag="ZYRO0E05830g"
                     /note="similar to uniprot|P32860 Saccharomyces cerevisiae
                     YKL040C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499183.1"
                     /db_xref="GeneID:8204736"
                     /db_xref="GOA:C5E4G7"
                     /db_xref="InterPro:IPR001075"
                     /db_xref="InterPro:IPR014824"
                     /db_xref="InterPro:IPR017065"
                     /db_xref="UniProtKB/TrEMBL:C5E4G7"
                     /translation="MFRFAGFNVSKCLRPNMVSMPRRFIAIKTMTTPNENALKFISTD
                     GEMLQDKGSSSLEIKNSDESLIEHSNLAQRIFLQCPGVESLMIGDDFLTVNKDSMVHW
                     NQIKPGVIELLTSQLASGEDVVSDEFHTIRDSDAGYEVTAPKFELSEEDEEVSDMIDE
                     LIQTRIRPAIQDDGGDIQYRAYDPKTGTVYLKLQGACKSCSSSEDTLKAGIEGMLKHY
                     VDEVTNVVQMLDPEEEIALREFDKMEQRIQQKNAEQ"
     gene            complement(<452408..>452737)
                     /locus_tag="ZYRO0E05852g"
                     /db_xref="GeneID:8204737"
     mRNA            complement(<452408..>452737)
                     /locus_tag="ZYRO0E05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499139.1"
                     /db_xref="GeneID:8204737"
     CDS             complement(452408..452737)
                     /locus_tag="ZYRO0E05852g"
                     /note="similar to uniprot|P38744 Saccharomyces cerevisiae
                     YHL018W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499184.1"
                     /db_xref="GeneID:8204737"
                     /db_xref="GOA:C5E4G8"
                     /db_xref="InterPro:IPR001533"
                     /db_xref="UniProtKB/TrEMBL:C5E4G8"
                     /translation="MYNKIVRTAPIVVEGANLVEKLVLLPRWKVLQNQLVREVQFKDY
                     ETTWAFLTHVSMRSHLWGHHPTITTNYNYVKLQLCTHELEEKVSDIDLKLAKRFEQYI
                     ETYKQEE"
     gene            <452910..>454559
                     /locus_tag="ZYRO0E05874g"
                     /db_xref="GeneID:8204738"
     mRNA            <452910..>454559
                     /locus_tag="ZYRO0E05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499140.1"
                     /db_xref="GeneID:8204738"
     CDS             452910..454559
                     /locus_tag="ZYRO0E05874g"
                     /note="similar to uniprot|P38700 Saccharomyces cerevisiae
                     YHL019C APM2 homologous to the medium chain of mammalian
                     clathrin-associated protein complex Similar to clathrin
                     coat proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499185.1"
                     /db_xref="GeneID:8204738"
                     /db_xref="GOA:C5E4G9"
                     /db_xref="InterPro:IPR001392"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR018240"
                     /db_xref="InterPro:IPR027200"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5E4G9"
                     /translation="MSSCLYILDENLEPLISKNIKSIPNLNTLVEVFQEVYSSNAPPI
                     VFNRNWYFIHTKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGVAQLDRNL
                     VLDNVLLVLELLEESSEFGVPQMTEPSVMKDYIRIKVNKSETPIENSDRDDDDKEGDT
                     TDSDDDTVQQGLEREAQEKKKPKLPKSKSLYDFFQKTSKTAFSKKDKDGIQEGEDSEE
                     EPDLYINSYLVKTTTMPVSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHG
                     KIYCKSYLSGMPKLKIALNKLLQRDAQFMSHSKFHQCVALETLNEKELEFIPPDGEFI
                     LCEYELKRHVNDTPILKITSFEIKPQLKKFKLRILLTIETHFKTRNSTSILNVKIPLA
                     KLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGETQFSMVAEFSLFN
                     KEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQSQLVGMDFEIP
                     YTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYAYLT"
     gene            complement(<454640..>456052)
                     /locus_tag="ZYRO0E05896g"
                     /db_xref="GeneID:8204739"
     mRNA            complement(<454640..>456052)
                     /locus_tag="ZYRO0E05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499141.1"
                     /db_xref="GeneID:8204739"
     CDS             complement(454640..456052)
                     /locus_tag="ZYRO0E05896g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499186.1"
                     /db_xref="GeneID:8204739"
                     /db_xref="UniProtKB/TrEMBL:C5E4H0"
                     /translation="MWPQLVFRRFGSQWVRLSQCYQKLPPKLSLVLQGYNSKKIRCGL
                     VLPSNNGGLQGGSAFLSALLADVYSPDQTWFHVWRQRYLQYNSPSTVLVKYGNVFDKQ
                     SGKLGGADVTTFSVPSPFLQKHDVEFLEVQSTNLLDDDGCHFYINLQQNVTNTSALYD
                     WPTVNLKLNPNIRELPLPIENQLDPQWALGATCNFINDKKTVDGYLDAMQRSNFASVK
                     KQLESKLQDVDGIFRDLQASVLENIARRENLHDQHRKLVNDKREISMKIQRWSESAHA
                     ELQSSVLPKLQEFVKNQLSIWKVYGYSESKLQLKLINMITGPLHNLQMVNSLNRLKGE
                     LQIDDMDSKNLVDTGEINHRATSLHKDINKIVYQNFLLLQLPLILVATLGVVSGECSS
                     FSMGALASFGIVLGFSRVLAIWQSLLDSYVKRIRETLSSNIENEKVGLINEYQTSFAT
                     KEKDFETKYEIFRSLASFTD"
     gene            <456481..>457740
                     /locus_tag="ZYRO0E05918g"
                     /db_xref="GeneID:8204740"
     mRNA            <456481..>457740
                     /locus_tag="ZYRO0E05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499142.1"
                     /db_xref="GeneID:8204740"
     CDS             456481..457740
                     /locus_tag="ZYRO0E05918g"
                     /note="weakly similar to uniprot|P21957 Saccharomyces
                     cerevisiae YHL020C OPI1 Transcriptional regulator of a
                     variety of genes phosphorylation by protein kinase A
                     stimulates Opi1p function in negative regulation of
                     phospholipid biosynthetic genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499187.1"
                     /db_xref="GeneID:8204740"
                     /db_xref="InterPro:IPR013927"
                     /db_xref="UniProtKB/TrEMBL:C5E4H1"
                     /translation="MVMSLTEHAGLSEEDVRAAEVLDVLRNSHGSPPSQSFELRDQEI
                     QDHQEHQQVKQDLQVPTLLDRVRRNSIINNVVSLYEMNTRKRSAPPNANVAGGLGSLA
                     PAVGSSGNSLEDSNALEDEAENSNDDDDDDYYGYEDDEDIQAVSKRQKISEAIAKSRG
                     NLKEYQLNMSIGSKKRLIACLHLLKLANKQLTQKVAYLQEQVESEKSNEVSVDDGLGE
                     RAQEEEEDDDDDDDDEEYFDASESIDDDKSTVIKMEVVGTVKKVYSLISKFAGNSLPE
                     PARTQVRQTLLNLPTNWSLSANNSSSSSRRAKSQRKPLTTNGKVLILAEESLSVVRNV
                     MNVVDSSLGKAEEWVKQKQELKEILKERFIQQQWKKQVRNQLTKEKEEEERSGATNAS
                     NAQIEADDENYEQDENKVKDELKVNES"
     gene            complement(<457871..>458569)
                     /locus_tag="ZYRO0E05940g"
                     /db_xref="GeneID:8204741"
     mRNA            complement(<457871..>458569)
                     /locus_tag="ZYRO0E05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499143.1"
                     /db_xref="GeneID:8204741"
     CDS             complement(457871..458569)
                     /locus_tag="ZYRO0E05940g"
                     /note="highly similar to uniprot|P36095 Saccharomyces
                     cerevisiae YKL041W VPS24 involved in secretion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499188.1"
                     /db_xref="GeneID:8204741"
                     /db_xref="GOA:C5E4H2"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5E4H2"
                     /translation="MDYVRKAIWGPDPKEQNRKIKMTLRRNGRSIDKSLRDLSILQTK
                     TQQLIKKSAKKNDVKTVKLYARELYQINKQYDRMYTSKAQLDSVGMKIEEAFRMRILS
                     NQMADSAGLMREVNSLVKLPQLQSTMVELEKELMKAGIISEMVDDTTEVVQQEGDGEM
                     DEEIDEEVNKIVEQYTSNKFDKVDNAPQTELPTTTDSTKQEEQEREIPENQIDEEADN
                     MLNDMKERLRALQN"
     gene            458785..458856
                     /locus_tag="ZYRO0E05962r"
                     /db_xref="GeneID:8204742"
     tRNA            458785..458856
                     /locus_tag="ZYRO0E05962r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=60.23"
                     /db_xref="GeneID:8204742"
     gene            <459338..>463159
                     /locus_tag="ZYRO0E05984g"
                     /db_xref="GeneID:8204743"
     mRNA            <459338..>463159
                     /locus_tag="ZYRO0E05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499144.1"
                     /db_xref="GeneID:8204743"
     CDS             459338..463159
                     /locus_tag="ZYRO0E05984g"
                     /note="similar to uniprot|Q03690 Saccharomyces cerevisiae
                     YMR012W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499189.1"
                     /db_xref="GeneID:8204743"
                     /db_xref="GOA:C5E4H3"
                     /db_xref="InterPro:IPR023231"
                     /db_xref="InterPro:IPR025697"
                     /db_xref="InterPro:IPR028275"
                     /db_xref="UniProtKB/TrEMBL:C5E4H3"
                     /translation="MSADEKGATNATNSEIKLLIKLPFKSGPTAHSKKTQVNQENELQ
                     LLFTREGKIQNVIDVLGVVYTTKFLTNIDLEANGRVLSPLENLSDVVGNDEAETFKLK
                     LLYKPYNAREVLKHLLATREYLGFTPETTDGLSDFAVSVGSKFPEIPFKEIKQRTESE
                     HKDEKNEGKKENVEPEISAEEKQEFVKLVHEIFEEFNSEPNKNSYFTGNSIITPCLRS
                     LYLSHYNPVPAFYRARGHLMYLKAVTLEGEVFHITAVPSGFYLNKSSETKFDPFPREA
                     ENDDHYVKPSLHQLIGMHSKKFFSHIENFEKKISKLDSAAYLKPTTTFLHKPWLISSL
                     PVETGDYLRLQENSYNFDTERNFNDEFQAVRELASDSLHERVEAERLLIRISHEFSAA
                     ASKTAMSILHGDLVAMNPESPLEEQIFLKDNIFYSFVTDVSGNFTGKGGDAAAFAAAN
                     QDLRTTNLLNRLNLRDVRYLLATIVDFAGKRILAQTPVPGLLNTMGTRIVEDPETGKE
                     VIEDLPNEVVVNYGYDEAEGKVVSNEEFDESVRKEFSRTFHLKTHEVDGAQVSFSSQS
                     KGIIGFDKRKYILDLANTYPLDINFVRANFDSVEESKRYPHRQTLLRPELIEKWWQEK
                     LTKAGVEYKEAYERNMFSYNPDAYQIPGIEDPVIDEISDYLEKTVLQSVVEDYASTNA
                     MAPYDGAHVVDNLHINGINVRYLGKLIELAKNTLSQQTADYENNLVKIQEGNKDHQEW
                     EKGYLIKIEKMLKERQEKINKYIEANKEVPKELTGELKLNDEEIRKPTKETPAIIAKD
                     YLLPLISAAESEIVARSLKHVLRSYSKPLPVALLPSFVAYVFNLFFGVEYNDKPVPEE
                     VDEFYPVKNYEFSKLTRASLLEAIEEQAYLRFRYELPGNWFEAHTKVPFALIRSVCYG
                     FGIQLINKEYFFNKEQFSAYQNSLDKKMRNKVVAPKYTFSSSDLLVIPRVKTTNYGSS
                     VGDELWAEGAAVLDKDQGLALTFLSQAIAVKEDVSTALDRSVAEKYLALSTIYSSVGL
                     VPEAVAFARKASVIYERVTGLDSFELLRSLSNLALMEYSNRSPYNAALVYKRIMEIVK
                     PFDLTSKHHPVIISALNYLEEFAVTLKDSRLAIEILNKLCTLVAKLDGENSLASGYLE
                     SRIGNLYATLDDMPHALDHIARTNGIFIKELGLNHEVTAQARQWTEGLTNLIKNNQFK
                     QKVLEQKARANNGATPQNRKNVDEKQVQPNPGLANKSVDELLNFIEGSEGADTKQSKN
                     KKKSKGKGGKK"
     gene            complement(<463341..>464882)
                     /locus_tag="ZYRO0E06006g"
                     /db_xref="GeneID:8204744"
     mRNA            complement(<463341..>464882)
                     /locus_tag="ZYRO0E06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499145.1"
                     /db_xref="GeneID:8204744"
     CDS             complement(463341..464882)
                     /locus_tag="ZYRO0E06006g"
                     /note="similar to uniprot|P20048 Saccharomyces cerevisiae
                     YMR013C SEC59 Membrane protein that catalyzes the
                     CTP-mediated phosphorylation of dolichol the terminal step
                     in dolichyl monophosphate (Dol-P) biosynthesis required
                     for viability normal rates of lipid intermediate synthesis
                     and protein N-glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499190.1"
                     /db_xref="GeneID:8204744"
                     /db_xref="UniProtKB/TrEMBL:C5E4H4"
                     /translation="MSRLGASTASSNSAAGEQVTQRQNKDSTITENKKDEGEYSFIDA
                     TLKPERILQIGILGLITHLSYDKYYNMDFEHMEIMQMGLIAAAAVFVGIYSSFKSSKG
                     NSSVLPEFNTIYLIFIPFMMSLLFDQQNAAANIALVTNCLQMSPFYGIPMQMIFIAFH
                     TVDTTIEEKYGYLGAVPINYFIYRTLAKVSCLKSLDKIDCNLFSILLTNVLYLNTSQS
                     LYFLVLKKTLTAFVIVVMVNSAISFLTRDMSNGVIRSMILFSVFLVGFPLGVEKLLVI
                     DDNDPLGWLINYIAVSKLRQTILFTWLGSLLFLIPNILTFKSSFTLNTSRKVWHFLIL
                     VLISHPFRLDPEFVKISLSGTIVLFLCVEYLRYLKLEPFGEFLDSRLRSFADFRDDKG
                     PLIISYIYLIIGIATPLLISDSPVGLIGLGVGDSLASIVGGKWGKTSWPGTGKTIEGT
                     GAFIAGTSFVSLIFKQYLGYFKGISSLNLILICGLSGVLEGNSFLNDNILIPAFMLVA
                     EQVLS"
     gene            465700..465778
                     /gene="SNR78"
                     /locus_tag="ZYRO0E06028r"
                     /db_xref="GeneID:8204745"
     ncRNA           465700..465778
                     /ncRNA_class="snoRNA"
                     /gene="SNR78"
                     /locus_tag="ZYRO0E06028r"
                     /product="snR78"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR78"
                     /transcript_id="XR_002648409.1"
                     /db_xref="GeneID:8204745"
     gene            465866..465950
                     /gene="SNR77"
                     /locus_tag="ZYRO0E06050r"
                     /db_xref="GeneID:8204953"
     ncRNA           465866..465950
                     /ncRNA_class="snoRNA"
                     /gene="SNR77"
                     /locus_tag="ZYRO0E06050r"
                     /product="snR77"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR77"
                     /transcript_id="XR_002648410.1"
                     /db_xref="GeneID:8204953"
     gene            466027..466126
                     /gene="SNR76"
                     /locus_tag="ZYRO0E06072r"
                     /db_xref="GeneID:8204952"
     ncRNA           466027..466126
                     /ncRNA_class="snoRNA"
                     /gene="SNR76"
                     /locus_tag="ZYRO0E06072r"
                     /product="snR76"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR76"
                     /transcript_id="XR_002648411.1"
                     /db_xref="GeneID:8204952"
     gene            466209..466300
                     /gene="SNR75"
                     /locus_tag="ZYRO0E06094r"
                     /db_xref="GeneID:8204951"
     ncRNA           466209..466300
                     /ncRNA_class="snoRNA"
                     /gene="SNR75"
                     /locus_tag="ZYRO0E06094r"
                     /product="snR75"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR75"
                     /transcript_id="XR_002648412.1"
                     /db_xref="GeneID:8204951"
     gene            466361..466450
                     /gene="SNR74"
                     /locus_tag="ZYRO0E06116r"
                     /db_xref="GeneID:8204950"
     ncRNA           466361..466450
                     /ncRNA_class="snoRNA"
                     /gene="SNR74"
                     /locus_tag="ZYRO0E06116r"
                     /product="snR74"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR74"
                     /transcript_id="XR_002648413.1"
                     /db_xref="GeneID:8204950"
     gene            466515..466615
                     /gene="SNR73"
                     /locus_tag="ZYRO0E06138r"
                     /db_xref="GeneID:8204949"
     ncRNA           466515..466615
                     /ncRNA_class="snoRNA"
                     /gene="SNR73"
                     /locus_tag="ZYRO0E06138r"
                     /product="snR73"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR73"
                     /transcript_id="XR_002648414.1"
                     /db_xref="GeneID:8204949"
     gene            466716..466804
                     /gene="SNR72"
                     /locus_tag="ZYRO0E06160r"
                     /db_xref="GeneID:8204948"
     ncRNA           466716..466804
                     /ncRNA_class="snoRNA"
                     /gene="SNR72"
                     /locus_tag="ZYRO0E06160r"
                     /product="snR72"
                     /note="C/D snoRNA polycistronic Cluster 1 SNR72"
                     /transcript_id="XR_002648415.1"
                     /db_xref="GeneID:8204948"
     gene            <466974..>468458
                     /locus_tag="ZYRO0E06182g"
                     /db_xref="GeneID:8204947"
     mRNA            <466974..>468458
                     /locus_tag="ZYRO0E06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499146.1"
                     /db_xref="GeneID:8204947"
     CDS             466974..468458
                     /locus_tag="ZYRO0E06182g"
                     /note="weakly similar to uniprot|Q04347 Saccharomyces
                     cerevisiae YMR014W BUD22 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499191.1"
                     /db_xref="GeneID:8204947"
                     /db_xref="InterPro:IPR015158"
                     /db_xref="UniProtKB/TrEMBL:C5E4H5"
                     /translation="MPKDNLIFKLDNLEYQYNYLNGTLENFQPRLNGTSKAYNAKGKK
                     SSKRISKLLEEIKIGEVEKQLNELCTDIFQKKTFHLDGKLRQFIEKQLSQYKPSKKSK
                     NDFTPVIKDIREKYGLEKFSELISKSKVIKLSLSKINPTREPPKWFTEHEFWKIHNDK
                     NNEYNPSKIWNEVVMKTEGCNQLLSSLMNNNKCKELIAGFNSGMDVFLNINKGKKDKS
                     KEDKVSQSEKETQKTQKEGDNQESPDEKEEQDDDGDESDESSESQLQDEGENGELDEE
                     VLKQYDDMLAASDEEDNEGLQLDPNINYNEVTDEEPSDDEKESEDEDEDENEDEDEDD
                     GEPETKKPKYQLPELMGGYYSGGDSSDDDLKNDRIAQEQMSNKGQRKNRRGQRARRKI
                     WEQKFGEKANHVVKERNVYFEKKRKKQQEFEEREAKRAAKAAKASEFEKKASQEYEKG
                     AARKTESKPKNETPAAEHPSWIAKREAEAKLKNAKFEGKKVVFD"
     gene            complement(<468599..>470212)
                     /locus_tag="ZYRO0E06204g"
                     /db_xref="GeneID:8204746"
     mRNA            complement(<468599..>470212)
                     /locus_tag="ZYRO0E06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499147.1"
                     /db_xref="GeneID:8204746"
     CDS             complement(468599..470212)
                     /locus_tag="ZYRO0E06204g"
                     /note="highly similar to uniprot|P54781 Saccharomyces
                     cerevisiae YMR015C ERG5 C-22 sterol desaturase a
                     cytochrome P450 enzyme that catalyzes the formation of the
                     C-22(23) double bond in the sterol side chain in
                     ergosterol biosynthesis may be a target of azole
                     antifungal drugs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499192.1"
                     /db_xref="GeneID:8204746"
                     /db_xref="GOA:C5E4H6"
                     /db_xref="InterPro:IPR001128"
                     /db_xref="InterPro:IPR002403"
                     /db_xref="InterPro:IPR017972"
                     /db_xref="UniProtKB/TrEMBL:C5E4H6"
                     /translation="MAEVTVDKAMDTVAGFQNSTVQPLLANNGHTVASILEVVKSLSY
                     WKIFVTFLCVLIVWDQISYQTKKGSCAGPKWKWYPIIGPFLESLDPKFEEYKAKWYSG
                     ELSCVSIFHKFVVIASTRDLARKIMQSPKYVKPCVVDVAVKILRPNNWVFLDGKAHVD
                     YRKSLNGLFTKQALEQYLPGLEVLIDKYIGKFVQLSKDNNNKPQVFFHEMREILCALS
                     LSAFCGEYITEDQVRKIADDYYLVTAALELVNFPIILPYTKTWYGKRTADAAMKIFEE
                     CAQMAKDHIAAGGKPICVMDAWAKLMHDAKNKNDSDSKLYHREFTNKEMSEAVFTFLF
                     ASQDASSSLACWLFQIVADRPDVLAKVREEQLAVRNGDVNMKVTLPLIEKMDYTTMVI
                     KETLRYRPPVLMVPYVVKQNFQVRENYTAPKGTMLIPTLYPALHDPEVYENPDEFVPE
                     RWVEGSKASEAKKNWLVFGCGPHVCLGQTYVMMTFCALLGKFALFTDFEHSVTPLSEK
                     IKVFATIFPKDDLLMTFKKRDPLTGKIYE"
     gene            complement(<470767..>471888)
                     /locus_tag="ZYRO0E06226g"
                     /db_xref="GeneID:8204747"
     mRNA            complement(<470767..>471888)
                     /locus_tag="ZYRO0E06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499148.1"
                     /db_xref="GeneID:8204747"
     CDS             complement(470767..471888)
                     /locus_tag="ZYRO0E06226g"
                     /note="similar to uniprot|Q75DH2 Ashbya gossypii ABR054C
                     ABR054Cp and weakly similar to YKL042W uniprot|P36094
                     Saccharomyces cerevisiae YKL042W SPC42 Central plaque
                     component of spindle pole body (SPB) involved in SPB
                     duplication may facilitate attachment of the SPB to the
                     nuclear membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499193.1"
                     /db_xref="GeneID:8204747"
                     /db_xref="GOA:C5E4H7"
                     /db_xref="InterPro:IPR021611"
                     /translation="MNISPTPRRYNSRNGGIDFNDENYLAFSDPVNRDANGNGIGRER
                     IVPEEYKLNSRMINRLIRQNKELMNKLDGKQEEIDRLNVLVGSLRGKLIKYTELNKKL
                     EDRQNVSRSSSGGSNGMETDSNYIQLPKRRNNKDLDKDTDPRLSKDDRISVLSEKLDM
                     LTKIMMESRNSSLASPPPQQQQTANIPTPASAPTAATSSTSPLPPNTSTSVWQRPSEE
                     DIMCRESMELKQLEDQIESLKRKLLIKRENELRKISLSQELLELMGKLSMEQAQVQQG
                     AAGSTATTVPPRTSTAVPSAEQHVSSSSPEFCMECHHTKTHPLHQHHDHNHILRNDLN
                     SRRPTVPAINPLETPTPFAKRASLAASTGDLTDTINRVW"
     gene            complement(<472430..>474043)
                     /locus_tag="ZYRO0E06248g"
                     /db_xref="GeneID:8204748"
     mRNA            complement(<472430..>474043)
                     /locus_tag="ZYRO0E06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499149.1"
                     /db_xref="GeneID:8204748"
     CDS             complement(472430..474043)
                     /locus_tag="ZYRO0E06248g"
                     /note="some similarities with uniprot|P53438 Saccharomyces
                     cerevisiae YMR016C SOK2 Protein that can when
                     overexpressed suppress mutants of cAMP-dependent protein
                     kinase displays homologies to several transcription
                     factors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499194.1"
                     /db_xref="GeneID:8204748"
                     /db_xref="GOA:C5E4H8"
                     /db_xref="InterPro:IPR003163"
                     /db_xref="UniProtKB/TrEMBL:C5E4H8"
                     /translation="MSMNPPPYPFVVGQQPQYQPQYQQQQEPQEQQPQQPMQQPLSYH
                     QLPQLAIPAPPPGLQFQPYQTFAPQAPMLTSPSSTVHTLPHPYHYPGFQYQQQAQQIP
                     QSISPLPPQSTSPKSLSQLPLRQFTSTPIVPLQQHHDDRSSKTPSTSGSSAILSPYNV
                     SSAGSMAQIAKKPIERPIEKPKFSTTTTTTPSAPATTSEPLVHSYDVANIRGGSIISY
                     DSNGHVTKPRVTTTMWEDEKTLCYQVEANGVSVVRRADNDMINGTKLLNVAKITRGRR
                     DGILKAERIRHVVKIGSMHLKGVWIPFERAQVMAEREKIADYLYPLFVKDIQSVLKET
                     SNHEDERMSRINSPPNDPMSSLNPPSQGPMSLHPPNTYDPWYSTRNIPQPTPTTTTIL
                     PQPAQFGLPTQSRTTPPFAIQYTPAHTTIRPHPNTPNFDYSTNSSTPNPNSRLIFNQN
                     LAPPLTSVTPTPSDTSTTTAPSLTSIRPLSVTPTASDARQQQNVMGFVPAPQPQQLHQ
                     SSSQLLRSTSGKSDTTDRSTSDSDGSKND"
     gene            <475960..>478698
                     /locus_tag="ZYRO0E06270g"
                     /db_xref="GeneID:8204749"
     mRNA            <475960..>478698
                     /locus_tag="ZYRO0E06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499150.1"
                     /db_xref="GeneID:8204749"
     CDS             475960..478698
                     /locus_tag="ZYRO0E06270g"
                     /note="weakly similar to uniprot|P50104 Saccharomyces
                     cerevisiae YMR019W STB4 Protein that binds Sin3p in a
                     two-hybrid assay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499195.1"
                     /db_xref="GeneID:8204749"
                     /db_xref="GOA:C5E4H9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E4H9"
                     /translation="MVQEEIRRNRLRVRKACEICKRRKVKCDGSQPCANCVKHGQECK
                     YISGTVRRRYRRDIGNSSGASILIPSRLTPSSSTALNFNGSVNGGGSEILGNNNGVGD
                     SDRMASLLLQLGGNGTAGIWPPVSLDSERINANTSAIRHLIKTTNSVGYNNRRSPWQS
                     FSLDKYRFHRRYQNLLPFYLGASLMSEIPQHAVESHRLKQPRIQNYGWNMSGGHYLRH
                     DKSSKARARARARAEGANLDPEGFFDFENPVHLSVVNKLLKFYFKEINPPMSIVHESM
                     FWQQFNNRFLPHTNFKDSSSKLFRSMLYLILAITLRFREGFMENTEGSNEFLFTWEEL
                     SFFQRQHREEAMFKYAYSVITQLTFEWESFELIQSWLLITFYFRTCYRQTACWNALGQ
                     AINMCNGMSLYLNRFPRTHSKYDESRAWHCFWACFIMDKLISFQMGRFYQLSMPVSHM
                     TTPGHWCDNKVDVDRNGNSNAEDDDNSIWSDASETTNDESDDSSNVEDVQEVDHNDRQ
                     ENGEHPQGEDVEKSNTPQYEDDGKEDDWFHHETTQLFELAVIVQTCQKRDGEELDLEE
                     SIALRRKLDEWFEKHIQSTRIDKTWQHLYQIQPLLSYLDVRLTFETRRLFLLINQPLD
                     TGEMIFPIDTLGLVKHCQLSVKVLSQINQKQLYFIPWWLNLSQLFTASVISIALIHSG
                     LQTSRSLDILRRCMDIWNNLMTSHPKNPPGMLPECLWCIKMLNHMCCLRLLSSATHLE
                     NLVGTNPGDSTPNDNKFSQFGKVGEMGKAINSDDESGSLSNLPPIQSQIPSASPSIPQ
                     SQPIRVKSEPSTHIPISTTAVKSLAENQFKITPQSQPHPQPQPQPQPGLSEPILGQGS
                     GTMNTPQASEDFTCPRMGNIPSSSITDSSGTGNKENSEAIDEGLFSYLQWFDQNFM"
     gene            complement(<478738..>480333)
                     /locus_tag="ZYRO0E06292g"
                     /db_xref="GeneID:8204750"
     mRNA            complement(<478738..>480333)
                     /locus_tag="ZYRO0E06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499151.1"
                     /db_xref="GeneID:8204750"
     CDS             complement(478738..480333)
                     /locus_tag="ZYRO0E06292g"
                     /note="highly similar to uniprot|P20457 Saccharomyces
                     cerevisiae YKL045W PRI2 Subunit of DNA primase which is
                     required for DNA synthesis and double-strand break repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499196.1"
                     /db_xref="GeneID:8204750"
                     /db_xref="GOA:C5E4I0"
                     /db_xref="InterPro:IPR007238"
                     /db_xref="InterPro:IPR016558"
                     /db_xref="UniProtKB/TrEMBL:C5E4I0"
                     /translation="MCRIISTLGELHQSLNLINHSSRQIKMFRQNKKRISSRRHFSDD
                     NSGSQFIMGQPGSEAERRLYDKIYESKLSFYELPPQGEITLDQFEIWAIDRLKVLLEL
                     ESCVARNKTAKETETIVKPLLQKLLPFNTDSLEDKKKDYYSHFILRLCFCRTKDLRDK
                     FLRAETLLFKLRFNMLTSQYQAKFVQSLDLPMLQFISEDEKMELSQELYQTISPQLQF
                     QLNLTDEMQRRQYFQNERFIKLPFESVIDLVGSRQVFLKKGFAYLPQFQQLNLLSREF
                     AQRLEEELLRTFQHLPHLNEDDRLIPILTHLSTGYTISDYQQYSHEFGSDAQEGEINS
                     QNVYSKEISSNFPLCAKNLFSGLQQHHHLRYNGRQQLSFFLKGIGLNADDALKFWSEA
                     FTARGGNMTQDKFNKEYRYNFRHNYGLEGSRISYRVWDCRTILSKPRPARGEFHGCPY
                     RDWNVDKLTSELSSMKLTSTQVSSVLESCQKNEFTIACTKVFESTHGQTGMEVDDQTH
                     IAHPNLYFERSRQWQKKHSNETE"
     gene            <480856..>482349
                     /locus_tag="ZYRO0E06314g"
                     /db_xref="GeneID:8204751"
     mRNA            <480856..>482349
                     /locus_tag="ZYRO0E06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499152.1"
                     /db_xref="GeneID:8204751"
     CDS             480856..482349
                     /locus_tag="ZYRO0E06314g"
                     /note="similar to uniprot|P50264 Saccharomyces cerevisiae
                     YMR020W FMS1 Polyamine oxidase converts spermine to
                     spermidine which is required for the essential
                     hypusination modification of translation factor eIF-5A
                     also involved in pantothenic acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499197.1"
                     /db_xref="GeneID:8204751"
                     /db_xref="GOA:C5E4I1"
                     /db_xref="InterPro:IPR002937"
                     /db_xref="UniProtKB/TrEMBL:C5E4I1"
                     /translation="MAIKDKTVVIIGAGISGLKAASKLYEEGVKNCVVLEARDRIGGR
                     LHTIQGYQGRKYDLGGSWHHDTLINRLFAEEAKLALQEGKPRFVFDDDSPIYIDGERG
                     HLESDGYLRLEVILDEFIKFVYLIFNQNLGVPDCSYKEMVHRYIYEKREFLTDGQIRY
                     LPQLARFMELWHGVDWEMLSGRDSVYDSQGRNAFVLHYESVINRIAQSFPQDWLQVST
                     PVKSIKRSKGVIVTTDEDEYHCDYTIVTIPQSVLELSLHDEDQPGKISFQPPLNPRIQ
                     EGFTKSHFGSLGKVVFEFEKCTWSDATTRVVVLSHSSDHIAQQVRSADDWATFWKAAD
                     HHEESIKPWDHPLFFLNLPRSTGVPSLVVLMQAPLTQYIESLPNKQLVFEFFEPILNK
                     FMAAMGCSQPVINAIDKTDVKSPNADSPVLQGIIVTNWSSDPYSRGAYTVCFPGDDAI
                     DMVTAMMGGQDSRIRFAGEHTILDGAGCAYGAWESGIREAEYIRERL"
     gene            complement(<482415..>483557)
                     /locus_tag="ZYRO0E06336g"
                     /db_xref="GeneID:8204752"
     mRNA            complement(<482415..>483557)
                     /locus_tag="ZYRO0E06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499153.1"
                     /db_xref="GeneID:8204752"
     CDS             complement(482415..483557)
                     /locus_tag="ZYRO0E06336g"
                     /note="similar to uniprot|P35192 Saccharomyces cerevisiae
                     YMR021C MAC1 Copper-sensing transcription factor involved
                     in regulation of genes required for high affinity copper
                     transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499198.1"
                     /db_xref="GeneID:8204752"
                     /db_xref="GOA:C5E4I2"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:C5E4I2"
                     /translation="MIIFDSEKYACASCIRGHRSSTCRHTDRMLVKVRSRGRHASMDI
                     RKVIIVETDSQVTPDESSPSCDKCYSDSKNECEKMNRQPILFLRTRKTQRAILADGNL
                     QIIVENDAKPQDGSDKPHPPFKYISEKDFLRMHLVNEREPSSCGCGKNNKKSKEDITK
                     VEPALETPLPPTAPLVPSADSAFPMENVPQNDFNSKDPFALNADPKQMVELLTHKGLF
                     LSTQCSCEEGHCVCANCLLHRNEEELSSYIQRSGVPLTNMGEAQLSNPMMVGTGSCNC
                     PPEDCECESCPDHPCENMSFNKLLLTGLLNAPLRRKTNIVYKGKLIPSQYWWDFLKLH
                     IPLMGDSQLESLDIIGWFERIVSIYEHQLADANANVASVPQSLFAL"
     gene            <484003..>484500
                     /locus_tag="ZYRO0E06358g"
                     /db_xref="GeneID:8204753"
     mRNA            <484003..>484500
                     /locus_tag="ZYRO0E06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499154.1"
                     /db_xref="GeneID:8204753"
     CDS             484003..484500
                     /locus_tag="ZYRO0E06358g"
                     /note="highly similar to uniprot|Q02159 Saccharomyces
                     cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
                     involved in the ER-associated protein degradation pathway
                     requires Cue1p for recruitment to the ER membrane proposed
                     to be involved in chromatin assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499199.1"
                     /db_xref="GeneID:8204753"
                     /db_xref="GOA:C5E4I3"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5E4I3"
                     /translation="MSKTAQKRLLKELQQLMKDSSTGIVAGPRSENDLFVWDCLIQGP
                     PDTPYEGGIFNAKLEFPKDYPLSPPKLTFTPSILHPNIYHNGEVCISILHSPGDDPNM
                     YELAEERWSPVQSVEKILLSVMSMLSEPNVESGANVDACILWRDNRPEFELQVKRSIL
                     QSLGF"
     gene            <484736..>486097
                     /locus_tag="ZYRO0E06380g"
                     /db_xref="GeneID:8204754"
     mRNA            <484736..>486097
                     /locus_tag="ZYRO0E06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499155.1"
                     /db_xref="GeneID:8204754"
     CDS             484736..486097
                     /locus_tag="ZYRO0E06380g"
                     /note="similar to uniprot|P36091 Saccharomyces cerevisiae
                     YKL046C DCW1 Mannosidase GPI-anchored membrane protein
                     required for cell wall biosynthesis homologous to Dfg5p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499200.1"
                     /db_xref="GeneID:8204754"
                     /db_xref="GOA:C5E4I4"
                     /db_xref="InterPro:IPR005198"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012341"
                     /db_xref="InterPro:IPR014480"
                     /db_xref="UniProtKB/TrEMBL:C5E4I4"
                     /translation="MLLCKLWVFGFLASWFPSASALDIDLNDFKTLQNASALVAKGLM
                     DYYTGDQYGQTIGMFSWPYYWWEAGGAWNTLIDYWFYMKNDTYNDKVTEALLYQSGDN
                     HDYVPLNQSTVEGNDDQAFWGIAVLNAAERKFPNPPDDQPQWLYLGQAVFNTMALRWD
                     TATCGGGLRWQIFTWNTGYDYKNTVSNGALFHIAARLAYFTGNSSYVDWAERVYDWMH
                     DVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYNHGLVLSGCAYLYKETGDKIWY
                     NRSKAFLETAAKLFYNDSILYEYSCQQSKTCNVDQRSFKSYYSTFLAATAQLIPDFRE
                     QIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWDGQYGLGEQMAALEALVVTQAMN
                     KPAPYNSTNGGNSTGDGAAGTQTAPTNLKPLHITAGSRAGAGIITCVVGFSIIASFLW
                     LVM"
     gene            complement(<486200..>487783)
                     /locus_tag="ZYRO0E06402g"
                     /db_xref="GeneID:8204755"
     mRNA            complement(<486200..>487783)
                     /locus_tag="ZYRO0E06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499156.1"
                     /db_xref="GeneID:8204755"
     CDS             complement(486200..487783)
                     /locus_tag="ZYRO0E06402g"
                     /note="similar to uniprot|P36090 Saccharomyces cerevisiae
                     YKL047W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499201.1"
                     /db_xref="GeneID:8204755"
                     /db_xref="InterPro:IPR018626"
                     /db_xref="InterPro:IPR028115"
                     /db_xref="UniProtKB/TrEMBL:C5E4I5"
                     /translation="MASKSFSSERSNSPLERAQSSLRSAHRVPISCMFLCNFEVKKGN
                     VLVWARHSDGFEKKVNLEDIEFKSMPSGVHEVIDDVINFVIPKGEKEGEDGHYNGVAY
                     FKQNGQELSKGVGQIDRSRVKMYALGVVVDFDSTQYARNQDWKADEFSSANEYVDDLE
                     QLLCQWFNRGTLENFDIFDQFFETYNSGKTVDSLSPVLDRLAAAAYTGQELLSSDAPQ
                     AKPHMLEYLLYWLRKLGPLIFPLWRSCLLNERILILNPPSGSFEKCNALCYCLSVISL
                     FPQTSKFNKSEGHYVTPLYTLGVCDIDRMSKEVSRANSENRKPNGYIACTSDEILLSK
                     PELYDKVMKIPGEVEESYFVDIPKLYDNQEQLIRATPHDLHSVQVLYKELFGEELSVT
                     ERQNFLKMIEPLSWSQYIIDGFYWWVTAGYLKPSYHEETNSIPAGPIGESELALILGA
                     LEYFHGRTMALFQKLKEIFESKEVCGSDEVVQLPSAELVAMDLDSFSAQDHKFIEEIA
                     HKWFHRTLEVTGDLYGAAC"
     gene            <487921..>488277
                     /locus_tag="ZYRO0E06424g"
                     /db_xref="GeneID:8204756"
     mRNA            <487921..>488277
                     /locus_tag="ZYRO0E06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499157.1"
                     /db_xref="GeneID:8204756"
     CDS             487921..488277
                     /locus_tag="ZYRO0E06424g"
                     /note="similar to uniprot|P35727 Saccharomyces cerevisiae
                     YKL061W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499202.1"
                     /db_xref="GeneID:8204756"
                     /db_xref="GOA:C5E4I6"
                     /db_xref="InterPro:IPR020491"
                     /translation="MRDQERTLNQDVERCINVLQDFLDTGSAKAISVFSNKTSENEDW
                     LEEIRVKYRIKDNDELQAIKMLKQKRLDQLEALESKVDYYEKLCDELEEFQDEMEVKA
                     KLEQNRRSRFDSMTRK"
     gene            complement(<488300..>489820)
                     /locus_tag="ZYRO0E06446g"
                     /db_xref="GeneID:8204757"
     mRNA            complement(<488300..>489820)
                     /locus_tag="ZYRO0E06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499158.1"
                     /db_xref="GeneID:8204757"
     CDS             complement(488300..489820)
                     /locus_tag="ZYRO0E06446g"
                     /note="similar to uniprot|P32559 Saccharomyces cerevisiae
                     YMR023C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499203.1"
                     /db_xref="GeneID:8204757"
                     /db_xref="GOA:C5E4I7"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR004520"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR018948"
                     /db_xref="InterPro:IPR025867"
                     /db_xref="InterPro:IPR027266"
                     /db_xref="InterPro:IPR027368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4I7"
                     /translation="MLWKLSPFLAKSQLRYQSQLATAYLPTIYALSTAPGTKSAIAVV
                     RISGTHSKYVYHQLNNSEKKLIHRRTLLRNLYGPGKNLLDKALTLFFDSPKSYTGEDL
                     LELHIHGGKAVTGSVLNAIGSLNDRNSGIEIRYALPGEFTQRAFQNGKIDLIEVEGIR
                     ELIDAETETQRRCALSSFNGMNKNLFMLWRDKIVNNIAQLTAIIDFGEDTEIEDTNNL
                     LQLVKHNMVQLKQEINQFIQKIEKTSILQSGVKVVLLGPPNAGKSSLINSISNDDVSI
                     ISHTPGTTRDTVEASIDVNGYKVTISDTAGIRSHSSDEIELLGIERAIKKSEQCDLCL
                     LIVDPLNKPLINEDLTQMIQSMYKEGKEFVIIVNKQDLLTDENQSKSVMDALREKFGD
                     KFPIITVSCKTQEGIEPLVKQLTQIFQRLSETSDESDPIIASRRVKEILHSDVLYGID
                     SFFVTTDSEIGGDSYDVVMASEHLSHAADGIGKITGDAVGIEEVLGVVFANFCVGK"
     gene            complement(489994..490066)
                     /locus_tag="ZYRO0E06468r"
                     /db_xref="GeneID:8204758"
     tRNA            complement(489994..490066)
                     /locus_tag="ZYRO0E06468r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.19"
                     /db_xref="GeneID:8204758"
     gene            <491055..>492197
                     /locus_tag="ZYRO0E06490g"
                     /db_xref="GeneID:8204759"
     mRNA            <491055..>492197
                     /locus_tag="ZYRO0E06490g"
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /transcript_id="XM_002499159.1"
                     /db_xref="GeneID:8204759"
     CDS             491055..492197
                     /locus_tag="ZYRO0E06490g"
                     /note="highly similar to uniprot|P36516 Saccharomyces
                     cerevisiae YMR024W MRPL3 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL3"
                     /protein_id="XP_002499204.1"
                     /db_xref="GeneID:8204759"
                     /db_xref="GOA:C5E4I8"
                     /db_xref="InterPro:IPR000999"
                     /db_xref="InterPro:IPR011907"
                     /db_xref="InterPro:IPR014720"
                     /db_xref="UniProtKB/TrEMBL:C5E4I8"
                     /translation="MSQLSSLTRHVAASRCMVTRLAVNGRSRSLPLGRRFNSTVSDRI
                     SSSSSSSSLKSNAVELSKYKNYYKELKQIIENVPEDIASKSPELVTLHKRLQLPKEFQ
                     LSVLSRCLTCRSSHLPNEISNPKLGSAFSSTVPTNNLFDNHGLNIFGKNLLTYHVTRK
                     LMTKYPRLPTVILNAAVDAYICEDVLAGVGKSWGVETEKTPVLERYLKEEPIQITLGK
                     LRFYNNSLNQEDGIESISSLNFSEKSAYSLAIRSIIGALWACTQETNPQYAFQFIDDH
                     ILSRKLDISKMFQFEQPTRELAALCRREGLQKPVSRLLAESGRHSKAPVFIVGVFSGD
                     EKLGEGFGSSLKEGKARAATDALMKWYCYEPLEDQHPVVDHGAVIV"
     gene            <492396..>493178
                     /locus_tag="ZYRO0E06512g"
                     /db_xref="GeneID:8204760"
     mRNA            <492396..>493178
                     /locus_tag="ZYRO0E06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499160.1"
                     /db_xref="GeneID:8204760"
     CDS             492396..493178
                     /locus_tag="ZYRO0E06512g"
                     /note="weakly similar to uniprot|Q04368 Saccharomyces
                     cerevisiae YMR025W CSI1 Subunit of the Cop9 signalosome
                     which is required for deneddylation or removal of the
                     ubiquitin-like protein Rub1p from Cdc53p (cullin) involved
                     in adaptation to pheromone signaling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499205.1"
                     /db_xref="GeneID:8204760"
                     /db_xref="UniProtKB/TrEMBL:C5E4I9"
                     /translation="MDSVKLHELLLLEVNYQYESRSVGDTTRPPLCLLLLGLPLDDHE
                     KFEIQRSIAIPLRLQVINDQDGQFVYDLDQVTRRIKLARETNPQLQLCGIMVVNDQIY
                     DYEKPIESLMQHFEGQIEYLFTYKPDSNAEMGRKLNGFSLLPQRQRIGYRLIHGKVNI
                     ETQKIDASINSSLPEISDRQRMDQELSFVQKLTQEIDKMIRYLDLAQPSDAVLRKISM
                     LVSQLKRGPTTDIEEMIMNKEGEINALRTICEQWEMGVELGD"
     gene            complement(<493175..>494323)
                     /locus_tag="ZYRO0E06534g"
                     /db_xref="GeneID:8204761"
     mRNA            complement(<493175..>494323)
                     /locus_tag="ZYRO0E06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499161.1"
                     /db_xref="GeneID:8204761"
     CDS             complement(493175..494323)
                     /locus_tag="ZYRO0E06534g"
                     /note="similar to uniprot|Q04370 Saccharomyces cerevisiae
                     YMR026C PEX12 RING-finger peroxisomal membrane peroxin
                     that plays an essential role in peroxisome biogenesis and
                     peroxisomal matrix protein import forms translocation
                     subcomplex with Pex2p and Pex10p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499206.1"
                     /db_xref="GeneID:8204761"
                     /db_xref="GOA:C5E4J0"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR006845"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017375"
                     /db_xref="UniProtKB/TrEMBL:C5E4J0"
                     /translation="MSFYSNLPTSEVSSSLYPTIFEIVSSQEIDALLPASVRYILTNY
                     WIARHPNKITLAINNYFQEWFQVLLKGIVEWHHIKEYNSTFVDRFYGLQRFNCSNEVL
                     VRKQAKNNNTKVWPPGLQFTKGQKRVVFIQKVIVPYLKDRLDELESKWVAQSTFQEQR
                     NDKRNLIRRFVTHVYPVFKKSWYLLDLFTKLLFLAGRIGSVSFLEYLFKIEYTRAVLP
                     LSGGDARPKSVSQANRPQRQNLYALVSRFQRILANVGNTSAYLGSQFFPAFIFMLRVY
                     QWWTTQDLGAKLQRKLNDIDKDIPRTNNKTDGKGKSTGTDCPICHQRIQNACVLETGY
                     AACYPCALDHLTNNEGKCPVTGKKLLGCTYDKELQKWKVVTGVRKLLI"
     gene            complement(<494514..>495599)
                     /locus_tag="ZYRO0E06556g"
                     /db_xref="GeneID:8204762"
     mRNA            complement(<494514..>495599)
                     /locus_tag="ZYRO0E06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499162.1"
                     /db_xref="GeneID:8204762"
     CDS             complement(494514..495599)
                     /locus_tag="ZYRO0E06556g"
                     /note="highly similar to uniprot|P14540 Saccharomyces
                     cerevisiae YKL060C FBA1 Fructose 1 6-bisphosphate aldolase
                     required for glycolysis and gluconeogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499207.1"
                     /db_xref="GeneID:8204762"
                     /db_xref="GOA:C5E4J1"
                     /db_xref="InterPro:IPR000771"
                     /db_xref="InterPro:IPR006411"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5E4J1"
                     /translation="MGVESILKRKAGVIVGDDVRHLFDYAKEHKFAIPAINVTSSSTV
                     VSSLEAARDNKSPIILQTSNGGAAYFAGKGVSNEGQNASIKGAVAAAQYIRSIAPAYG
                     IPVVLHSDHCAKKLLPWFDGMLEADEAYFKEHGEPLFSSHMLDLSEETDNENIETCAK
                     YFKRMAAMGQWLEMEIGITGGEEDGVNNEHVDKESLYTQPPTVYAVHEALSKISPNFS
                     IAAAFGNVHGVYKPGNVVLSPQILGDHQKYAAEKDGKAAGSKPLYLVFHGGSGSSDKE
                     FQTGIDNGVVKVNLDTDCQYAYLTGIRDYVLKNKDYLMSTVGNPEGPDKPNKKFFDPR
                     VWVREGEKTMSARITTALKVFRAVNSV"
     gene            <496299..>497669
                     /locus_tag="ZYRO0E06578g"
                     /db_xref="GeneID:8204763"
     mRNA            <496299..>497669
                     /locus_tag="ZYRO0E06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499163.1"
                     /db_xref="GeneID:8204763"
     CDS             496299..497669
                     /locus_tag="ZYRO0E06578g"
                     /note="similar to uniprot|Q04371 Saccharomyces cerevisiae
                     YMR027W High level expression reduced Ty3 Transposition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499208.1"
                     /db_xref="GeneID:8204763"
                     /db_xref="InterPro:IPR002791"
                     /db_xref="UniProtKB/TrEMBL:C5E4J2"
                     /translation="MIAERFRTSDKNTFGEYTAHSRWPILVQNAVDDIGEELKNHSGE
                     SKKQGEIIEAQLKELLEEVKNNSKLRPFTQQETAIAGVPASFNEHLTDTRNEGVTWFD
                     AEWLFAEIYMYRRINVLFRSQPLWAKFDIFDRVKQATFHSSFHGVVELALRYKTLSAQ
                     LRQNGGDSEALQILFKEFIDISLWGNATDLSLLTNATLEDIKSIQGAQARKNAESKII
                     VDDTTKAWQVLQKSGPDARVDFVLDNSGFELYADLVLAAFLINSKLAKQCVFHGKDIP
                     YMVSDALYKDLLALLDNMKDTKFFPAEDSASREALNGFAQDIEKFLANGQLQFRANPF
                     WTTELDYWNIDPSETKYGGAEVHKDLSESDLVIFKGDLNYRKLTGDRKWPRTTAWSEA
                     IGPLANNGITLLSLRTCKADVQVGLSQGLDEKLSQEWEKDHPGKGSWWTSSGKWAVIS
                     FNSSSH"
     gene            complement(<497754..>499112)
                     /locus_tag="ZYRO0E06600g"
                     /db_xref="GeneID:8204764"
     mRNA            complement(<497754..>499112)
                     /locus_tag="ZYRO0E06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499164.1"
                     /db_xref="GeneID:8204764"
     CDS             complement(497754..499112)
                     /locus_tag="ZYRO0E06600g"
                     /note="similar to uniprot|P35728 Saccharomyces cerevisiae
                     YKL059C MPE1 Essential conserved subunit of CPF (cleavage
                     and polyadenylation factor) plays a role in 3' end
                     formation of mRNA via the specific cleavage and
                     polyadenylation of pre-mRNA contains a putative
                     RNA-binding zinc knuckle motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499209.1"
                     /db_xref="GeneID:8204764"
                     /db_xref="GOA:C5E4J3"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR014891"
                     /db_xref="UniProtKB/TrEMBL:C5E4J3"
                     /translation="MSSTIFYKFRSQKDIDRILFDGTGLTVFDLKREIIQENKLGDGT
                     DFQLRLYNPDTNEEYEDDSQVIPRSSSVIARRSPAVKAFSVHSMHRGGATAALGNATR
                     YVTGRPRVYQKKPVSNGGSSTSAAGAVSGVTEEERIANMFANQENQWEQTQQEMSAAT
                     PVFYKSHNPNAAENEGPPPPGYMCYRCGARDHWIKNCPTNNDPNFEGKRIRRTTGIPK
                     KFLKSVEIDSENMSPEEMAQRKIMVTDDGKFVVQVADQQSWEDYQRKQQNRLINGTDN
                     PWQKGHFKDLPADLKCPLTEGLLRGPVRTSKCCNTVFSKTALEDSLLESDFVCPNCHA
                     EGVLLDSLVEDEEKAKQVQEFLKERDDGKGGHLGANKRDGEQEDSPNKRLKVDGKSDG
                     EGANGNVSGGGNGDSQVKPPAPPLPMPPVPFGMPPFPMFPPPMPFMAPPPPRSTPSPD
                     KK"
     gene            <499317..>499685
                     /locus_tag="ZYRO0E06622g"
                     /db_xref="GeneID:8204765"
     mRNA            <499317..>499685
                     /locus_tag="ZYRO0E06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499165.1"
                     /db_xref="GeneID:8204765"
     CDS             499317..499685
                     /locus_tag="ZYRO0E06622g"
                     /note="highly similar to uniprot|P32774 Saccharomyces
                     cerevisiae YKL058W TOA2 Transcription factor IIA small
                     chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499210.1"
                     /db_xref="GeneID:8204765"
                     /db_xref="GOA:C5E4J4"
                     /db_xref="InterPro:IPR003194"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR015871"
                     /db_xref="InterPro:IPR015872"
                     /db_xref="UniProtKB/TrEMBL:C5E4J4"
                     /translation="MAVPGYYELYRRSTVGNSLVDALDTMISDGRIEASLAMRVLETF
                     DRVVAETLRDNTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEGSHEGSGHMGGSDG
                     QSTIAVDKLRIVACNSKRSE"
     gene            <499973..>501082
                     /locus_tag="ZYRO0E06644g"
                     /db_xref="GeneID:8204766"
     mRNA            <499973..>501082
                     /locus_tag="ZYRO0E06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499166.1"
                     /db_xref="GeneID:8204766"
     CDS             499973..501082
                     /locus_tag="ZYRO0E06644g"
                     /note="similar to uniprot|Q04372 Saccharomyces cerevisiae
                     YMR028W TAP42 Protein that physically associates with the
                     protein phosphatase 2A and the SIT4 protein phosphatase
                     catalytic subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499211.1"
                     /db_xref="GeneID:8204766"
                     /db_xref="GOA:C5E4J5"
                     /db_xref="InterPro:IPR007304"
                     /db_xref="UniProtKB/TrEMBL:C5E4J5"
                     /translation="MSLSQEYESLLRTYRDKIEHSSLRQDTTEYQSLVTKTIEKLLSL
                     KNSIYGDLALFSSNETVDDISTKSLKLLSIDFYLALLFSRKQMVQLNDPLARQKMKLK
                     FLEKTVQLFMQFLTTLQDYEILDPFLSKKIDSLEDTYNPSLQELYQQPAHGEDLSGAQ
                     KRRQQKIEMFRQSKTINEKLEFIESKYKSNEISSDDDEQMRKLYIKRLQSHSYQAFNE
                     MEQILYELELLRNFTKSGGDPTAQQLEPPSERNSDSGKDSSGYTEKLELLNKPLLSKQ
                     GKVLRNFTLVDKRTQLQNKVRGYGQYGPTMSVEELLQKEFEENRVLQGGEEATNENVN
                     EDDLNWQDQETYKARQWDEFKESVARGSGNTMNRG"
     gene            complement(<501139..>504231)
                     /locus_tag="ZYRO0E06666g"
                     /db_xref="GeneID:8204767"
     mRNA            complement(<501139..>504231)
                     /locus_tag="ZYRO0E06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499167.1"
                     /db_xref="GeneID:8204767"
     CDS             complement(501139..504231)
                     /locus_tag="ZYRO0E06666g"
                     /note="similar to uniprot|P35729 Saccharomyces cerevisiae
                     YKL057C NUP120 Subunit of the Nup84p subcomplex of the
                     nuclear pore complex (NPC) required for even distribution
                     of NPCs around the nuclear envelope involved in
                     establishment of a normal nucleocytoplasmic concentration
                     gradient of the GTPase Gsp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499212.1"
                     /db_xref="GeneID:8204767"
                     /db_xref="InterPro:IPR021717"
                     /db_xref="UniProtKB/TrEMBL:C5E4J6"
                     /translation="MLLLSKVDADLLQLKDSAVDENVINLYLGNSENGISHGVKNSDD
                     DIRSSFASTVELSNSNHISYHLSMANTVITLYPVEKNLFNKTINLFLPEPTMNQHHTL
                     TIQEFNGCLLINTILQNGIYLLIELPLKYIFSPNERLDHDWFKAFNPYDFTVRVPHLL
                     FSVSPQFLVAFLDDGGLLGLKQLNDTDVEPILFNDNSYLQSITSLFSGRNSHRSEKAV
                     SCILYEQRYLVILTQHCHLRIWDITTFSLVQDYDFSKEHHFENVDISSYENPGRFMSL
                     FSNYLMVYLPFGNGIFEIGTLTPGGRGRINFTSKGVFAANLSSSSIWSLVDMTLLKPL
                     DLNLTYSYANLVVLWKSGTVSKLQILNILDQDLQAHEWIEATNRSLSDIESEQDLNVN
                     SDAEKGLFNLKSRYESRLFERAQKILNENNIIMLPGESELMDYLANLETVLKDLKSKS
                     DEVSSLTIYRDEIILVNSLQKYNHSVYKTNTPLENIYYNIHSELNDDELTRYLKTLHG
                     FSSTISKDVLKDVSERFIGIVSGAVAGNLSPNEKFTDIFKTCLENKFELSNLKLLFNE
                     LSSFDIIPTLNEFIENNLEPSVVNPSEFVDSITMDSLATVVTLEGLRQQVTIQRHFVL
                     QILLTFAFLDFDFTAFEKQITSLLDYHFKQSLFLELFNIDKSLLAKELLTRTTDHGCG
                     INLLSYTELHNYLKYALSEFYESPISMSPYFLGFYKSFILESGVSNKQNLLSPKFLLQ
                     NVGWPFHVRGNKVQEFLIATILFSCEQYGQAFDYFHLHDYPDTIADSLPDCLKELQDN
                     DSSSIWAPLIFSFTVPYKHSSFEYELSLLFADIGNYEYALKSIKRSIEYSMKDISIDE
                     PHDFKQAQIVQYLDLLFYFDMFAEALDVLRLSPVLSREVKTNYYRSILESTQQSGPFF
                     ATLLKLCHSNDKGPLYLPPDDYQIIDKIILSHSRENNWTNLKKLYSFRVVNKHERSAV
                     EALYEYVQKAGYDPETKRKCFLLIINTLSTFDDEQDQWLLNGCNIVTLGELKAELRRL
                     "
     gene            complement(<504600..>506294)
                     /locus_tag="ZYRO0E06688g"
                     /db_xref="GeneID:8204768"
     mRNA            complement(<504600..>506294)
                     /locus_tag="ZYRO0E06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499168.1"
                     /db_xref="GeneID:8204768"
     CDS             complement(504600..506294)
                     /locus_tag="ZYRO0E06688g"
                     /note="similar to uniprot|Q05040 Saccharomyces cerevisiae
                     YMR029C FAR8 Protein involved in G1 cell cycle arrest in
                     response to pheromone in a pathway different from the
                     Far1p-dependent pathway interacts with Far3p Far7p Far9p
                     Far10p and Far11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499213.1"
                     /db_xref="GeneID:8204768"
                     /db_xref="InterPro:IPR013258"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E4J7"
                     /translation="MNSQFPMHPTYTLPGIMHYLQTEFTKNERDRISWELERSEMKAR
                     IAHLEGENKDLRYRLMKLDPNPEPEILRTLDKSDTSPLIKSKAAVQENVKEIIYLFKS
                     PNLGSQMETLNEKKDPVHELEKMGFNQSRDNQSQPLVDNDNAEHQRIDLHQVDSLQEV
                     TQHEDLGGAEIDERSDAGTVVVGSENEQQEAEESSDFTKRHRSSSLFTSEKVQPLDAK
                     EEQPQEERVSLVQGSTDRSAIVRLKVHGNKVIAYSKSGELSQRFVNKSLDWENDQYHK
                     YEGLSSELLDIFWVDNEKFLTLDNEGIKLRKTTVEDHPIAALKLFGENLQFNQVNAWD
                     FKNSWLLLALKGRIYLKEISISPDSSKISIGKSYYFNTNKKVWDAKFGMTEKSLIVLN
                     RNPDELVIYSFQGKQLQKIDIRKHLSKNIASDSDAMLYLNKKSSKLLILIQELLLIYS
                     FDQKKIILKQSLRSQPTSVIFNSPKDYVALAYDDGYIELRNIKDFNSVIKRYNHVNDE
                     VELDENTQSLMDSGLRPMDRNPIVLQDTEIDNHKVIISADNSGRMKLNEIQELGEN"
     gene            complement(<506648..>507151)
                     /locus_tag="ZYRO0E06710g"
                     /db_xref="GeneID:8204769"
     mRNA            complement(<506648..>507151)
                     /locus_tag="ZYRO0E06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499169.1"
                     /db_xref="GeneID:8204769"
     CDS             complement(506648..507151)
                     /locus_tag="ZYRO0E06710g"
                     /note="highly similar to uniprot|P35691 Saccharomyces
                     cerevisiae YKL056C RBF18 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499214.1"
                     /db_xref="GeneID:8204769"
                     /db_xref="InterPro:IPR011057"
                     /db_xref="InterPro:IPR011323"
                     /db_xref="InterPro:IPR018103"
                     /db_xref="InterPro:IPR018105"
                     /db_xref="UniProtKB/TrEMBL:C5E4J8"
                     /translation="MIIYKDIFSGDELLSDAYDVSEVEGAVYEADCSMVKVGGENIDI
                     GANPSSEGGEEGVEDSAEVVNNVVHSFRLQQTGFDKKSFVSYIKGYMKAVKAKLQETN
                     PDAIPVFEKGAQAYVKKILGSFNDWEFFTGESMDPDAMVVMLNYREDGVTPFVAIWKH
                     GVSEEKI"
     gene            complement(<507383..>508192)
                     /locus_tag="ZYRO0E06732g"
                     /db_xref="GeneID:8204770"
     mRNA            complement(<507383..>508192)
                     /locus_tag="ZYRO0E06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499170.1"
                     /db_xref="GeneID:8204770"
     CDS             complement(507383..508192)
                     /locus_tag="ZYRO0E06732g"
                     /note="similar to uniprot|P35731 Saccharomyces cerevisiae
                     YKL055C OAR1 Mitochondrial
                     3-oxoacyl-[acyl-carrier-protein] reductase may comprise a
                     type II mitochondrial fatty acid synthase along with
                     Mct1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499215.1"
                     /db_xref="GeneID:8204770"
                     /db_xref="GOA:C5E4J9"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5E4J9"
                     /translation="MVHLEPVAIVTGATRGIGKAIVQKLSSQGISCICIGSSRESIAG
                     IKLGDHLQSVKENQRHRSLAIDLSQWPQWVAQKSHFGIEYYPQRLESMFPLMGFNSWN
                     SPHQRYCLSLVVNCAGTTQSSISLRTSTEEMQRIMNINFLSTVSMCDLATRSMIRQRS
                     HSGALPLQIVNISSVLGETELAVKGTSIYSASKAAISHYSKVLSQEVSNWGIRVNTIA
                     PGLVNGTDMIKGLDDTAQTALMNLMATSNRRSTPQEIASSVWSIYSDGNYK"
     gene            complement(<508456..>510729)
                     /locus_tag="ZYRO0E06754g"
                     /db_xref="GeneID:8204771"
     mRNA            complement(<508456..>510729)
                     /locus_tag="ZYRO0E06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499171.1"
                     /db_xref="GeneID:8204771"
     CDS             complement(508456..510729)
                     /locus_tag="ZYRO0E06754g"
                     /note="some similarities with uniprot|P35732 Saccharomyces
                     cerevisiae YKL054C DEF1 RNAPII degradation factor forms a
                     complex with Rad26p in chromatin enables ubiquitination
                     and proteolysis of RNAPII"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499216.1"
                     /db_xref="GeneID:8204771"
                     /db_xref="GOA:C5E4K0"
                     /db_xref="InterPro:IPR003892"
                     /translation="MSAQSRKSNSHNGKNSRVNPEIKFKLETLTELFPDWTNDDLIDL
                     VHEYDDLETIIDKITSGAVTRWDEVKKPSKKERLEKRLEQQQQLQKEQQQHQLQQQHY
                     HAQDLDGHHGGSSSHHHTKAGQGSGSRYSRDNNGTHSSSGGSNAKSKKQQQQQQQQQN
                     GKPSLPSDNARAAISRGKPASGGGSWAAVASSDSKKHQQEEEEEEDQQQQRPESSPEE
                     PSATTVQASETKTDGVEASASATSTAQSSTHATATASTGNAAHNEKPKKMSWAAIAAP
                     KPKVVQKKQSSLNNVGGLKKEINEVAKETETPAAGQAQREPVSETNDKATNNQGKKAD
                     AQHEDTASKLSEQQQQQQEQLQAQQQEQQQTQQQDQSPIEFQSQGTNQEDTAQHNRPE
                     EQKDTREITSNQVQIDEQEVAATSEPQEPSQTAQAVATEVNDGSKVKQQQQQPTVGVE
                     AGKPQQQQQQEAYYQQQQQQQQQQQQQYFAQQQQYAQSQTPQHAPQQLSGQQAAVGQP
                     NANANASANANAAAAATAAQQQYYMYQNQFPGYTYPGMFDSPSYAYGQQQAYQQPSQP
                     SAQAGFGTGTASQYSIPQGYAAAPAADMTTASTATASPVAGHAQPQQQQPYGGSFLPY
                     YAHFYQQSFPYAQPQYGMAGQYPYQVPKAGYNYYQPQRQTQGRNVQQGQQSPGHSPSQ
                     QGEDVQQQSQPTQQNQLQNGQQPLNPQQLQFQQYYQFQQQQQAAAAAAAAAAAQQGLP
                     YGYTGYDYTSQASRGFY"
     gene            complement(<511612..>511869)
                     /locus_tag="ZYRO0E06776g"
                     /db_xref="GeneID:8204772"
     mRNA            complement(<511612..>511869)
                     /locus_tag="ZYRO0E06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499172.1"
                     /db_xref="GeneID:8204772"
     CDS             complement(511612..511869)
                     /locus_tag="ZYRO0E06776g"
                     /note="highly similar to uniprot|O60200 Saccharomyces
                     cerevisiae YKL053C-A MDM35 Mitochondrial Distribution and
                     Morphology Similar to human sequence predicted by GENSCAN"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499217.1"
                     /db_xref="GeneID:8204772"
                     /db_xref="InterPro:IPR007918"
                     /db_xref="UniProtKB/TrEMBL:C5E4K1"
                     /translation="MGNVMSASFAPECTELKKKYDDCFNEWYSEKFLKGKSVENECSE
                     QWYSYTACVDAHLIKQGIKPALDEARKEAPFEEGGAIKDED"
     gene            <513129..>514325
                     /locus_tag="ZYRO0E06798g"
                     /db_xref="GeneID:8204773"
     mRNA            <513129..>514325
                     /locus_tag="ZYRO0E06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499173.1"
                     /db_xref="GeneID:8204773"
     CDS             513129..514325
                     /locus_tag="ZYRO0E06798g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499218.1"
                     /db_xref="GeneID:8204773"
                     /db_xref="GOA:C5E4K2"
                     /db_xref="InterPro:IPR005804"
                     /db_xref="InterPro:IPR013866"
                     /db_xref="UniProtKB/TrEMBL:C5E4K2"
                     /translation="MTTITHRGLEIRTDEMEVPEATAPLDVLHNYYWVSTKEPHAIRR
                     KAILKAHPEVKKLMGHEPLTKYLATIVVLTQLGIAYYLRSGHSWLKTVFLAYVIGATL
                     TNNMYLAVHEITHNLAFKKPLYNKMFAIFVNTPVPLPYAADFGPYHQLHHKFLGDELY
                     DTDIPTEFEAKFLKGRVGKFFFVLFQALFFALRPMFVVAISLTNFHIANITYQIVVDI
                     LWIRYFGIQSFLYLGFSSLLAGSFHPLSGHFIAEHFLFDIDEALKGGKETFKYTNGEE
                     QQYSEAQKNELESIRPEVEFKREYALETYSYYGILNLFVWNAGLHNEHHDFPFIPWSR
                     LWALHNMAPEFYKPLPRHESWCKAIFDFVFRADLNFYSRVKRANPQITKEKELKKQKE
                     MQKSKF"
     gene            complement(<514778..>515011)
                     /locus_tag="ZYRO0E06820g"
                     /db_xref="GeneID:8204774"
     mRNA            complement(<514778..>515011)
                     /locus_tag="ZYRO0E06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499174.1"
                     /db_xref="GeneID:8204774"
     CDS             complement(514778..515011)
                     /locus_tag="ZYRO0E06820g"
                     /note="similar to uniprot|Q3E790 Saccharomyces cerevisiae
                     YBR058C-A TSC3 Protein that stimulates the activity of
                     serine palmitoyltransferase (Lcb1p Lcb2p) several-fold
                     involved in sphingolipid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499219.1"
                     /db_xref="GeneID:8204774"
                     /db_xref="UniProtKB/TrEMBL:C5E4K3"
                     /translation="MPASHTMEYVETNAQRNKRLNERVNLWSKILHKTFFNYYIHLPF
                     YVITQGDAFLLHTFCLTIVSLGLFGIVKYCLLL"
     gene            complement(<515664..>515897)
                     /locus_tag="ZYRO0E06842g"
                     /db_xref="GeneID:8204775"
     mRNA            complement(<515664..>515897)
                     /locus_tag="ZYRO0E06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499175.1"
                     /db_xref="GeneID:8204775"
     CDS             complement(515664..515897)
                     /locus_tag="ZYRO0E06842g"
                     /note="similar to uniprot|Q3E790 Saccharomyces cerevisiae
                     YBR058C-A TSC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499220.1"
                     /db_xref="GeneID:8204775"
                     /db_xref="UniProtKB/TrEMBL:C5E4K4"
                     /translation="MTSRSTMYYVETSAQRSQRLNIYPNPVAQFLRRTYWAYYVHLPF
                     YGLTKLDAFWLHTFFLTLMSLGVFGVVKYCILF"
     gene            complement(<516731..>520078)
                     /locus_tag="ZYRO0E06864g"
                     /db_xref="GeneID:8204776"
     mRNA            complement(<516731..>520078)
                     /locus_tag="ZYRO0E06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499176.1"
                     /db_xref="GeneID:8204776"
     CDS             complement(516731..520078)
                     /locus_tag="ZYRO0E06864g"
                     /note="some similarities with uniprot|P38080 Saccharomyces
                     cerevisiae YBR059C AKL1 Serine-threonine protein kinase
                     member (with Ark1p and Prk1p) of the Ark kinase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499221.1"
                     /db_xref="GeneID:8204776"
                     /db_xref="GOA:C5E4K5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E4K5"
                     /translation="MPATSDAAKTASSVTKPVVDGYAPGTVVAVGNQQVEIISFIAEG
                     GFAQIYSVKYIKFLGEFNNGSKAPLQPGDIACLKRVLVPDENGLSEMRNEVEVMKQLR
                     GAKAIIQYYDSNASRRTSGQVGYEVLLLMELCPNNSLLDYMNQRLATRLTEKEILKVM
                     YDTTLAISQMHYLPIPLIHRDIKIENVLVDAQNNFKLCDFGSTSTCFPLVTTHQDIAI
                     LTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFFITPFEMTGQFSI
                     LHSKYEFPANKYSSKLINLIIIMLAENPYVRPNIYQVMHHICSVIGCEVPIEDKYGLG
                     PYNFEKYTEFQTKLQNVQYQMYLLQQKKLENNGRLNAVEEKLLNDLLITSFEVSSKIP
                     AEVGLHQQQLQQQQQQQPMKSKESVSSSDEFSDHRKSVFSSTKPSRNPSSASRKNLPS
                     NEFENESDANLDAEPKQFASVSMTDRDSHFSPPNQRSMSSYSSGKSLSGGPPIQDVKY
                     SDILAVEQTARSEQSPGIIKQHKSNNPFPMMAQGFGQGQPGPLSSSGTPMGAAPVAPA
                     APVPQAPGPMPIPGNAGALPGGAGGVNVAPRGTPISIQPELGSRPEYFVDAHSPADDS
                     QFTISQPQPQLPQVGPVPQAQPKMNFNQNMFYQHVDSPVSVQGQAQPIPLKKISDVPQ
                     PQSHMRFNYQVPPQQPQSGTSPYYPSPSVGPNASLSAQNPMSQIALQQQPQQQVPRPL
                     PSQQQAKQGFVPAPQHHHQQQQQQQPPVEQVRQLPQHATTVDSSDLVQPPENPPPKPP
                     HPKTWQDYQSHDGLDLKQSLHKRGGSDHRPKTDSPQLERTPSKNLDLSYDEFDLNSND
                     PPKPISHIKRDTFDSASTVSSTASSESIQIDLDDARRERDRTQQPPASNEKLTQPPEK
                     PIRQTIDSSTGSLRRSLDLKYQEVHFSSPETQRPPTKEATRRQDVADPPRRPHGDIRR
                     HSNNNANSNNDNNNNNSNNNNSNSNNNNNTTNNGTSAGSGSANAGGTSSNAGTNASSG
                     SPPSLQNNDLDRYKNAHKNSSNTSVNASGPASGSGGGEVRRSFAKARQSLDLEKIRKE
                     AVKGEAALSAKRRSIFSVFRGPDKKKE"
     gene            complement(<520584..>522395)
                     /locus_tag="ZYRO0E06886g"
                     /db_xref="GeneID:8204777"
     mRNA            complement(<520584..>522395)
                     /locus_tag="ZYRO0E06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499177.1"
                     /db_xref="GeneID:8204777"
     CDS             complement(520584..522395)
                     /locus_tag="ZYRO0E06886g"
                     /note="similar to uniprot|P32833 YBR060C Saccharomyces
                     cerevisiae ORC2 Subunit of the origin recognition complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499222.1"
                     /db_xref="GeneID:8204777"
                     /db_xref="GOA:C5E4K6"
                     /db_xref="InterPro:IPR007220"
                     /db_xref="UniProtKB/TrEMBL:C5E4K6"
                     /translation="MSDDGIVKHVDILSSPSKARGKVTCRVVSKRRSTPVPDGLDRKR
                     SPKKNLLERIERSPTPGGIWQESSDLSSSESPIGKRKRSESRRTKSQNDDKEEEEDNN
                     DDGGDAYVSNGDEEDKLDRENKRHRRLPSRSETPIPVLASPVKTTESENEVSITTTPQ
                     KKTPKKTLSTEHDFTSPLKKVILSNLDEYKNTASSENLKLSRNFVPTPLPTAKEKYVP
                     TTTDKSMSSFFDTFEGYFDQRKQLRGSQKSKNTMSMATDVTREEFALISNTFHGKLHR
                     AARDGLYEIQTRLFPQYWFELTQGFSLLFYGVGSKREFLERYVFEYLAPNLVSDESSV
                     GVPCVVVNGYNPTCNYRDVFKDISRALLPQELSRNETKYWGNHVILQIQKMIELYKNE
                     PPDIKLVIVIHNLDGPSLRKDNFQTMLCYLALIRQVALVASTDHIYAPILWDNFKAQN
                     YNFVFHDVSNYEPLAVESSFKDVMKMNRNNSASGAEGAKFVLESLTHNTKRMYKVLLE
                     TQISNMNSHASNARGQVPPTKRGSPTVGVELKQLLHLCSAEFVASNEISLRSMLTEFV
                     EHKMAAISKNPAGTEHVWIPYNYSEINKLLSTVMQSI"
     gene            <523402..>525186
                     /locus_tag="ZYRO0E06908g"
                     /db_xref="GeneID:8204778"
     mRNA            <523402..>525186
                     /locus_tag="ZYRO0E06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499178.1"
                     /db_xref="GeneID:8204778"
     CDS             523402..525186
                     /locus_tag="ZYRO0E06908g"
                     /note="highly similar to uniprot|P15180 Saccharomyces
                     cerevisiae YDR037W KRS1 Lysyl-tRNA synthetase also
                     identified as a negative regulator of general control of
                     amino acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499223.1"
                     /db_xref="GeneID:8204778"
                     /db_xref="GOA:C5E4K7"
                     /db_xref="InterPro:IPR002313"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018149"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5E4K7"
                     /translation="MSQEQANAAAEAVANLHLDDATGEMVSKSELKKRQKQRQVEAKR
                     AAKKATAQPPAPSKKKKDEALADLSPSQYFEMRSRQILELRKSHQPNPYPHKFFTTTS
                     LADFLSKYAYLQRGETLKEEKVAIAGRIHAKRESGSKLKFYVLHGDGAEVQLMAQLQD
                     YHDPEAYEKDHDLLKRGDIVGVEGYVGRTQPKKGGEGEVSVFVSRIQLLTPCLHMLPA
                     DHFGFKDQETRYRKRYLDLIMNKGSRDRFITRSKIISFIRRFLDSKNFIEVETPMMNV
                     IAGGATAKPFVTHHNDLDMDMYMRIAPELFLKELVVGGMERVYEIGRQFRNEGIDMTH
                     NPEFTTCEFYQAFADVYDLMDMTELLFSEMVKEITGSYEIKYHPDPHNPEKEMSLNFA
                     RPWKRIHMIEALEERFNTKFPAGDQLHTKETGEFLKNLLAANKMDCPPPLTNARMLDK
                     LVGELEDTCINPTFIFGHPQMMSPLAKYSRDMPGLCERFEVFVATKEICNAYTELNDP
                     FDQRARFEEQARQKDQGDDEAQLVDETFCNALEYGLPPTGGWGCGIDRLAMFLTDSNT
                     IREVLLFPTLKPDVLREEVKKEEVKPSA"
     gene            complement(<525320..>528466)
                     /locus_tag="ZYRO0E06930g"
                     /db_xref="GeneID:8204779"
     mRNA            complement(<525320..>528466)
                     /locus_tag="ZYRO0E06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499179.1"
                     /db_xref="GeneID:8204779"
     CDS             complement(525320..528466)
                     /locus_tag="ZYRO0E06930g"
                     /note="uniprot|P78981 Zygosaccharomyces rouxii Z Na -
                     ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499224.1"
                     /db_xref="GeneID:8204779"
                     /db_xref="GOA:C5E4K8"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006414"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5E4K8"
                     /translation="MNLNEVKENDLFHTLDIAQTAQVVGTDTEHGLNANEAHARLKHG
                     GPNNLGEDTGIDYKSLVIHQVCNAMVMVLFISMVISFAIRDWITGGVIAFVVGVNVSI
                     GVFQEFKASKTMNSLKSLTSPTATVIREGKHVSVESATVVVGDICEVRVGDSVPADLR
                     LMEASNFETDEALLTGESLPVAKDYQAVYDSDKDTPVGDRLNLAYSSSSVVKGRARGI
                     VIRTGLDTEIGKVADSLRSKQTIVSRDPAKSWVVNAYRTVHNTAGVFLGTTIGTPLHR
                     KLSKLAILLFFIAVLFAIVVMASQKFNVDRGVAIYAVCVALSMIPSSLVVVLTITMSV
                     GAAVMVTRNVLVRSLDSLEALGAVTDICSDKTGTLTQGLMVPRQIWVPGFGTVLVESV
                     GKDSCIKIIPRLSPHEFAHNNDEDVGILQDFVNLYNDNKLPEDMQRSYFTQWLDTAAL
                     ANVAKVRWDDEKENWVGQGDPTEVAIQTFVAEMGGREERSQEFQNVKEFPFDSTIKRM
                     SAVFESNQDKSRCVYTKGAFESVLDCCEYWYGDTSGGMVPLTEKDVEGILNNVDSLSS
                     GGLRVLAFAKKVMGKEEPIEKRSKVEAGLCFLGLIGIYDPPRPESLGAVKKFHKAGIN
                     VHMLTGDFPGTAKAIAQEVGILPTNLYHYPKEVVDVMVMTGSQFDSLDENQVDELPVL
                     PLVISRCSPQTKVRMIEALHRRGKFCAMTGDGVNDSPSLKMANVGISMGLNGSDVAKD
                     ASDIVLSDDNFSSILNAVEEGRRMTDNIQKFVLQLLAENVAQALYLVVGLAFQDEDGK
                     SVFALSPVEVLWIIVFTSCFPAMGLGLERAAPDLMERPPNDSSAGIFTWEVIFDMISY
                     GVIIAAVCMGSFTTVLYGKDAGNLARNCNKSYTSPCHDVFRARSCAFATMTWCALVLA
                     WEVVDMRRSFFRRQPETDEPCRQFFRDVYENKFLFWSIVVGFAGAFPVVYIPVINTSV
                     FLHKSIGYEWGISIGFTFVFWIGAELWKFGKRLYFRGQARAQNPEADLEKNALHDPFE
                     AYSTFTSQSEILSQKVSH"
     gene            complement(<528766..>529641)
                     /locus_tag="ZYRO0E06952g"
                     /db_xref="GeneID:8204780"
     mRNA            complement(<528766..>529641)
                     /locus_tag="ZYRO0E06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499180.1"
                     /db_xref="GeneID:8204780"
     CDS             complement(528766..529641)
                     /locus_tag="ZYRO0E06952g"
                     /note="highly similar to uniprot|P38238 Saccharomyces
                     cerevisiae YBR061C TRM7 2'-O-ribose methyltransferase
                     methylates the 2'-O-ribose of nucleotides at positions 32
                     and 34 of the tRNA anticodon loop"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499225.1"
                     /db_xref="GeneID:8204780"
                     /db_xref="GOA:C5E4K9"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR028590"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E4K9"
                     /translation="MGKSSKDKRDLYYRKAKEQGYRARSAFKLLQLNEEFHFLDDPNL
                     KRVVDLCAAPGSWSQVLSRKLFDKDDYTDRQIVAVDLQAMMPIDHVTTLQADITHPRT
                     LHQILELFGNHRADFVCSDGAPDVTGLHDLDEYVQQQLIMSALQLTVCILKRGGTFVA
                     KIFRGRDIDLIYAQLGYLFDQVTCAKPRSSRGSSLEAFVVCQGYNPPEGWQPSLDTNS
                     SVVEFFQDCPVGSNENRTIAPFMACGSLESFDSDATYHVEPSATSLDPVQGPTNPPYK
                     RALELKRSGRLTRAV"
     gene            <529855..>530502
                     /locus_tag="ZYRO0E06974g"
                     /db_xref="GeneID:8204781"
     mRNA            <529855..>530502
                     /locus_tag="ZYRO0E06974g"
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /transcript_id="XM_002499181.1"
                     /db_xref="GeneID:8204781"
     CDS             529855..530502
                     /locus_tag="ZYRO0E06974g"
                     /note="highly similar to uniprot|Q03201 Saccharomyces
                     cerevisiae YDR041W RSM10 Mitochondrial ribosomal protein
                     of the small subunit, has similarity to E. coli S10
                     ribosomal protein; essential for viability, unlike most
                     other mitoribosomal proteins"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM10"
                     /protein_id="XP_002499226.1"
                     /db_xref="GeneID:8204781"
                     /db_xref="GOA:C5E4L0"
                     /db_xref="InterPro:IPR001848"
                     /db_xref="InterPro:IPR027486"
                     /db_xref="UniProtKB/TrEMBL:C5E4L0"
                     /translation="MLRRSLYLSRFIRWQSNSAEIPSGVPPFAQRSPLTKENASEKPL
                     PINVEAVYHAPLKIPIQYGDLVADLQLRSYDHESLDFFADFIMRTGFYLGMPLTGPKP
                     FPTRRERWTVIRSPFVHAKSKENFERHTHKRLIRVWDSNPEVVQMWLSYITKHSVAGV
                     GAKCNVYQRAGLSLDMDNAASELQQSPVGESHNMDEAVGEKVLELLNSDEFKKHL"
     gene            complement(<530578..>531153)
                     /locus_tag="ZYRO0E06996g"
                     /db_xref="GeneID:8204782"
     mRNA            complement(join(<530578..531080,531138..>531153))
                     /locus_tag="ZYRO0E06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499182.1"
                     /db_xref="GeneID:8204782"
     CDS             complement(join(530578..531080,531138..531153))
                     /locus_tag="ZYRO0E06996g"
                     /note="similar to uniprot|P38239 Saccharomyces cerevisiae
                     YBR062C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499227.1"
                     /db_xref="GeneID:8204782"
                     /db_xref="GOA:C5E4L1"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5E4L1"
                     /translation="MSTYEEEHGLSRENSEDARSASVDRRETRSQFQELFQTFGNNNS
                     EEDVDNSMLLLLLSQMIPASLQQEWMEQMEQSDKKGCSESFIDSLPRIPASKIKEDDS
                     CPICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTSCPLCRDDVMSHKPGIDTS
                     QVELEEDWGMFG"
     gene            <531316..>532419
                     /locus_tag="ZYRO0E07018g"
                     /db_xref="GeneID:8204783"
     mRNA            <531316..>532419
                     /locus_tag="ZYRO0E07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499183.1"
                     /db_xref="GeneID:8204783"
     CDS             531316..532419
                     /locus_tag="ZYRO0E07018g"
                     /note="similar to uniprot|P38991 Saccharomyces cerevisiae
                     YPL209C IPL1 Aurora kinase involved in regulating
                     kinetochore-microtubule attachments associates with Sli5p
                     which stimulates Ipl1p kinase activity and promotes its
                     association with the mitotic spindle potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499228.1"
                     /db_xref="GeneID:8204783"
                     /db_xref="GOA:C5E4L2"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E4L2"
                     /translation="MSNGPKPDAAKVRRDSLLQRNMLLSMRLNNSGNNENQQIGQLTS
                     EKNNGNWRKTLGVPRKLSIRSSKVGSPITGKVNNTTHGNPNVNGKRYSPQHSPKLNLK
                     SLSLKDFEIGKKLGKGKFGRVYCVRHKVTGFICAMKVMEKQEIMQYNVQKQFRREVEI
                     QSSLNHQNLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMAD
                     ALDYMHQRNIIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPE
                     LIASKEYDDKVDVWALGVLTFELVVNSPPFEEDSKELTSKRIVRGDLKFPNHISSDAQ
                     DLITKLLRHNSKDRISLREVKQHPWITKNRPFW"
     gene            complement(<532475..>534094)
                     /locus_tag="ZYRO0E07040g"
                     /db_xref="GeneID:8204784"
     mRNA            complement(<532475..>534094)
                     /locus_tag="ZYRO0E07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499184.1"
                     /db_xref="GeneID:8204784"
     CDS             complement(532475..534094)
                     /locus_tag="ZYRO0E07040g"
                     /note="similar to uniprot|P53166 Saccharomyces cerevisiae
                     YGL064C MRH4 Mitochondrial RNA helicase plays an essential
                     role in mitochondrial function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499229.1"
                     /db_xref="GeneID:8204784"
                     /db_xref="GOA:C5E4L3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4L3"
                     /translation="MIRTSTLMRLSSWQQNVLGCFVRYYSKGSKRSSFSKKGLKLASA
                     VGSSKKKGSKSTVFNYGNFSGLKENEAANSESAARLISKITEFEHLKLLPQVRQAVKQ
                     LIFQESLVKGEDLNSIRPSPIQVISVKKLSSSLMDPKLQTHAIAAETGSGKTIAYFAP
                     MLDYLKRQEEEDPERWKRFQEKAIIRSVILVPTHELVDQVYNTISKAEESLGMHTFRW
                     RSGMPHVEFLEAVKNRIDILVTTPAKLLSLFHINMISRPDRILSQVKFVALDEADTLL
                     DQSWVEDTYAAIRKLPNANHVVFCSATIPNEFNKTLQRLFPTVVPITTPRLHKLPNSL
                     DFKVIDAAVSPYKNSKVRALAQILYAITNDGTEPNLDKRCIVFVNEKRDVPILVEKLT
                     QNYGHTCVGLSGDDSVEERSKKIQAFIQPPKPLTAEEPKTDTQESTKSFQIPDSNITI
                     PSRIKSQGALSQKLKVLITTDLMARGLNFQALRNVILFDVPKTSIDLVHRVGRTGRMR
                     QGGRVFMIVDKSTKSWAKAVPKVARKNMALV"
     gene            <534298..>536202
                     /locus_tag="ZYRO0E07062g"
                     /db_xref="GeneID:8204785"
     mRNA            <534298..>536202
                     /locus_tag="ZYRO0E07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499185.1"
                     /db_xref="GeneID:8204785"
     CDS             534298..536202
                     /locus_tag="ZYRO0E07062g"
                     /note="similar to uniprot|P38688 Saccharomyces cerevisiae
                     YPL210C SRP72 Component of the signal recognition particle
                     (SRP) ribonucleoprotein (RNP) complex that functions in
                     protein targeting to the endoplasmic reticulum (ER)
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499230.1"
                     /db_xref="GeneID:8204785"
                     /db_xref="GOA:C5E4L4"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013699"
                     /db_xref="InterPro:IPR026270"
                     /db_xref="UniProtKB/TrEMBL:C5E4L4"
                     /translation="MAKDNLTRLLSQLNVHSAQGESSKVQETCVELLENGCSEPGSIL
                     KNLLVSIIQQDAYQLGLDMLKNYKHIDEKFGSEFALEKLYIFYKLNKLKEFQELYSVL
                     NPTSIDTVLKQNERQTAPLRGVLHVRAQFCYKNGFYDEAFKIYHYLATHNEKGIDDEL
                     ELACNVRAPLTVTPELRSNLKLPLAPEDSSSSYDLMFNDSMIQCSLGLYDESLELLTK
                     AHELAKQEGNESDLDAIQLQLAYVYQLKGDKVSCKQNLNDLLNRSDSSSPINLLAKNN
                     LGAFQDFSKYTTNLNLTLRELNVENFTAIDQKHFTKQQWLLLHNNFLFLHLFNNNNIQ
                     PKSTIVSRTLSNYKSLVEDINLETYSTQAKKAYHHAITMIKSTVEGSTIGFVLLAVQL
                     LVVQKEWDNAIRLGEMFLNKCWENSKIIPDGKHHIVCYILFLLYSTTARGHSKTILLQ
                     KLANETKVLPRDVEFWKHVSFQYLECGDLKNSRKLLKQITGYIPDDEIIRQVLADDDL
                     NVENGYEITSGIDVAALVGAGVTPLESNRIKKDTRSNKIQKKRLDIRKKRRAQKAKKL
                     LATRTVTRSLDPERWLPLKDRSTYRPKKKQQGKQTQGGAMNKKAEQSLDISKKSKKSN
                     ASKGKKKSRK"
     gene            complement(<536289..>536834)
                     /locus_tag="ZYRO0E07084g"
                     /db_xref="GeneID:8204786"
     mRNA            complement(<536289..>536834)
                     /locus_tag="ZYRO0E07084g"
                     /product="ribosome biogenesis protein NIP7"
                     /transcript_id="XM_002499186.1"
                     /db_xref="GeneID:8204786"
     CDS             complement(536289..536834)
                     /locus_tag="ZYRO0E07084g"
                     /note="highly similar to uniprot|Q08962 Saccharomyces
                     cerevisiae YPL211W NIP7 Nucleolar protein required for 60S
                     ribosome subunit biogenesis"
                     /codon_start=1
                     /product="ribosome biogenesis protein NIP7"
                     /protein_id="XP_002499231.1"
                     /db_xref="GeneID:8204786"
                     /db_xref="GOA:C5E4L5"
                     /db_xref="InterPro:IPR002478"
                     /db_xref="InterPro:IPR005155"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR016686"
                     /db_xref="UniProtKB/TrEMBL:C5E4L5"
                     /translation="MRQLTEEETRVLFEKLAGYIGRSISNLVDSKDQPHVFRLQKDRV
                     YYVPENVSKLATSVARPNLISLGTCLGKFTKTGKFRIHVTALPILAPNAKYKVWIKPN
                     GEMPFLYGNHVLKAHIGKMSEDIPEHAGVIVYSMNDIPLGFGVSSKSTNECRDMQPTG
                     IVAFRQADIGEYLRDEDTLFT"
     gene            <537225..>538909
                     /locus_tag="ZYRO0E07106g"
                     /db_xref="GeneID:8204787"
     mRNA            join(<537225..537376,537448..>538909)
                     /locus_tag="ZYRO0E07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499187.1"
                     /db_xref="GeneID:8204787"
     CDS             join(537225..537376,537448..538909)
                     /locus_tag="ZYRO0E07106g"
                     /note="similar to uniprot|Q12211 Saccharomyces cerevisiae
                     YPL212C PUS1 Involved in tRNA biogenesis; intranuclear
                     protein which exhibits a nucleotide-specific
                     intron-dependent tRNA pseudouridine synthase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499232.1"
                     /db_xref="GeneID:8204787"
                     /db_xref="GOA:C5E4L6"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5E4L6"
                     /translation="MSEDGLKPVYDDQVDEEAYKRGPQYKWTKARKSDYKDGDDSNGE
                     APPEKKVKYEDKPLNDENGKPVEKERRLPKRKVAVMIGYCGTGYHGMQHNPPNLTIES
                     ELFTAFVEAGAISKANSTDLKKNGFMRAARTDKGVHAGGNLISLKLIIEDPQIKEKIN
                     EKLPEGIRVWDIKRVNKAFDCRKMCSSRWYEYLLPTYSLIGPKPGSTLYDTIEQGKQE
                     LPGVLDEDDESKQFWSEVDKDAREQFSEDELQTIKSYVPPPKDQFDGTDPTYHKVKRY
                     KQMENLHRRQYRISQEKLKKFRSTMEQYLGAHNFHNFTLGKDFKESSAVRYMKEIKVS
                     EPFVIGDAKTEWVSIKIHGQSFMLHQIRKMISMATLMTRCGCPTDRISEAYGPQKLNI
                     PKAPALGLLLESPVFDGYNTRLEKFGYERIDFANYQNEMDSFKMKNIYDKIYKEEVDE
                     NVFNAFFSYIDNFDRVTGAKGEETVDKTGTSVQKSIFEFLSAKGIPSSAATNTDTSKK
                     DTSEAPKEIPVATTGTEDESQVTPQEAEN"
     gene            <539098..>540420
                     /locus_tag="ZYRO0E07128g"
                     /db_xref="GeneID:8204788"
     mRNA            <539098..>540420
                     /locus_tag="ZYRO0E07128g"
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /transcript_id="XM_002499188.1"
                     /db_xref="GeneID:8204788"
     CDS             539098..540420
                     /locus_tag="ZYRO0E07128g"
                     /note="similar to uniprot|Q01163 Saccharomyces cerevisiae
                     YGL129C RSM23 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM23"
                     /protein_id="XP_002499233.1"
                     /db_xref="GeneID:8204788"
                     /db_xref="InterPro:IPR017082"
                     /db_xref="InterPro:IPR019368"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4L7"
                     /translation="MFRLQSRQLTTSAIARAAPARGKAQGFAKKTSGNKTTARRITPD
                     TLYKNWQDTVHTARLNRYAVPVEIPTFKSSELQSLLNKVTFYSSQQYRSLYHLGAFKK
                     SQFNELFPKPISFVREESTQKLIGLLQNSSNKRFVLTGEPGVGKSVLLSQAQAYAAES
                     GQIILNFSQPYLFLNGRNDFFYDANLKQYVQPMYLKSLLRKILKSNDENLLRSITLKS
                     DYKFSNADPKDAAVKKFITFTKDKNNLFDLLTVKTHARNRGTLFQGLLNELVQQSQVP
                     VFFSVDNFSRMLTESFSAYKDVHGKNIPLLDLQVGKAIMEVIGGDIKFTNDQSSVVLA
                     ISGVDKTNRTLPVGLNKLPADPYLKRKHLDPDFAAILQKGKVQEFEVPKLSKEEVKQL
                     VEFYLKSELFLNKDIQSKSVEKLVDEKYFLSGNGNSRELLKSIVLMHL"
     gene            complement(<540507..>541856)
                     /locus_tag="ZYRO0E07150g"
                     /db_xref="GeneID:8204789"
     mRNA            complement(<540507..>541856)
                     /locus_tag="ZYRO0E07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499189.1"
                     /db_xref="GeneID:8204789"
     CDS             complement(540507..541856)
                     /locus_tag="ZYRO0E07150g"
                     /note="highly similar to uniprot|Q01159 Saccharomyces
                     cerevisiae YGL130W CEG1 mRNA guanylyltransferase (mRNA
                     capping enzyme), alpha subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499234.1"
                     /db_xref="GeneID:8204789"
                     /db_xref="GOA:C5E4L8"
                     /db_xref="InterPro:IPR001339"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013846"
                     /db_xref="InterPro:IPR017075"
                     /db_xref="UniProtKB/TrEMBL:C5E4L8"
                     /translation="MDSRNSPEVPGIIQPSNVTQDLRMMMCKLLNSPKPAKTFPGSQP
                     VSFQHADIEDKLLEQDYYVCEKTDGLRVLMLILINPVTREQGCFMIDRENNFYLVNGF
                     RFPRLPHKDKKELLETLQDGTLLDGELVIQTNPMTKLKELRYLMFDCLAINGRCLTPS
                     PTSSRLAHLGKEFFKPYFDLRLVYPDQCVTFPFKISMKHMSFSYDLLKVANSLEKLPH
                     MSDGLIFTPVKTPYFVGGKDSLLLKWKPEEENSVDFKLILNIPLVEDETLPKKDPSRW
                     YHNYEAKPIFDLYVWQGGADVNSKLQRFDCPFSKKELELLERTYKKFAELTLSDEQWQ
                     ELKNLEQPLNGRIVECTKDQETGAWKLLRFRDDKLNGNHTSVVQRVLESISDSVKLED
                     LAEVISSIKQRWEMRRQNGRPPEGTSGQLPPQNHRPSNDVGSEPQGQPNYVDEEWSE"
     gene            <542057..>546487
                     /locus_tag="ZYRO0E07172g"
                     /db_xref="GeneID:8204790"
     mRNA            <542057..>546487
                     /locus_tag="ZYRO0E07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499190.1"
                     /db_xref="GeneID:8204790"
     CDS             542057..546487
                     /locus_tag="ZYRO0E07172g"
                     /note="similar to uniprot|P53127 Saccharomyces cerevisiae
                     YGL131C SNT2 22% sequence identity with S. pombe Snt2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499235.1"
                     /db_xref="GeneID:8204790"
                     /db_xref="GOA:C5E4L9"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5E4L9"
                     /translation="MTGGEFLSLPRRRTTGKSVNYNEKEADAEMAKRIEQLEEARASN
                     KSSKPKKGRGGGIATNCSPNSTDKIKYQKFLNDKSIGWNFIPSVPPFFRKASRFSTIL
                     DLENAYVDIEEQSLYNPDSVLIKANDTIYMVSEPPGEPYYIGRVVEFVSKPEFRTIIS
                     KASKDVKKFPVKFFQVRMNWFYRSRDIQNRLNNVQPRLIYASLHQDVCPIESYRGKCT
                     VVHQNDINTVAVDKFDFLTRSNNFYFSQLFDRYTRKYYKVITTDDLLKLQSFSPFLVV
                     LNRRFRYLFVEENYPLEEIIEKYILKKDEGAKKDDELWSDRCSICREWCSKSMSLKCE
                     ECTQAVHLYCLDTPLDRKPNKGVVWFCFKCIKKQEGSEEALKELEKDQLEEKEFFDSS
                     RQVLNEVAQKELREGNFSSKNCCWFQYAGQTMVNHLKDLMYEHLSLPYPMKFSRVGSR
                     YQWSGCNNEEESTSRSYSPDFQQEERGTDTTSQLLWDMKNSKTSPDEVDRYVERCKAE
                     YPPKLNMLPESCNFLDLAVTTLMKNDFDTELAFKKCGELASRESLQEPTFTPEEVKQF
                     EDAIAEFGSELHPVSERVKTQPSSMIVRYYYHWKKTPNGKRIWGNFKGRKKNIGREQL
                     HVENLNSIVQREERKSKRDRKPTKLALESESYKSQEGWKYLDDSSFETENAPSLKPCF
                     QCMFCEIDYSPMWYKVTGGSDDDYIKKRMQTGVNEKTETSEKNLPVTKGSKSKDKENK
                     DKKLDALCIRCARIWRRYGVEWQPPLTVLKRLNGPSAASLYATLELVFNETNNNVLKL
                     SSQQAHNKCLEWELVQDSELITRQRGDMISVPERLTKLKKSSMAARMQLYKMVKRPFD
                     KAAWSKDRMLSDLQKYLEQQQPKKPKVIPTINNIVNDPNDIAQQDRPRANKTDTTKKN
                     ESSNKVEPKKEQVFGISDELKQNLSSNGDLQVHVPLNGGDCGKITLDSEAKYLQLDEK
                     IYGELNSRLDHSRKRFNSDDLSQGSHQKKRLKSHDGLHFSKDFKTWNSKNISVITDEK
                     DTARILNMYHQLDPFQSNFSHEHQPENGSEDSMPIQKSVSIEGNSFQSDFEKPKDFCN
                     VCGESFDQTLDEEINCYSCGLSVHYYCYGVKIPADASRKRKLKFYKWYCDPCSNEIHP
                     IVSTNYKCDLCYVKKFEDSLCRGHLDCPDPNALKCTTSGSWCHILCAVFNPDIKFGCA
                     TNLQPVINANHVIAKNIGQVCSICKLEGGGPIKCSLCSIKFHITCARSTPGFYLKMMM
                     IKSTNIIEDKKIIRGIYDEEYSITPVALCGNHQSELHEIKDFYPLNWKMDENSKTLLQ
                     LYCENYKENPRMSTVSTRYLEQQSIWGENLFDHLDGLEQGKMARELAINSEKDKLIKN
                     EVKICSNCGTDRSIFWYDQNICHACHISPKLGKFNANMPTQDQVGPRISKEDAAKVLD
                     VLMPMETVVKNVKEEKKVPKSLTAKGSSKKTKWVKETPGP"
     gene            complement(<546524..>547228)
                     /locus_tag="ZYRO0E07194g"
                     /db_xref="GeneID:8204791"
     mRNA            complement(<546524..>547228)
                     /locus_tag="ZYRO0E07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499191.1"
                     /db_xref="GeneID:8204791"
     CDS             complement(546524..547228)
                     /locus_tag="ZYRO0E07194g"
                     /note="similar to uniprot|Q08963 Saccharomyces cerevisiae
                     YPL213W LEA1 Component of U2 snRNP disruption causes
                     reduced U2 snRNP levels physically interacts with Msl1p
                     putative homolog of human U2A' snRNP protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499236.1"
                     /db_xref="GeneID:8204791"
                     /db_xref="InterPro:IPR003603"
                     /db_xref="UniProtKB/TrEMBL:C5E4M0"
                     /translation="MKFTPSVVIDAPTYYVDHFNGRFNTDKCVILRNMQLETDSELMT
                     ISLRHLPHPVQILDLTNNELTEFPYLRDNKDIHTLLLSRNQISQLNGDYLPRHLVHLV
                     ICNNNIVSFEQLNGLQNCPKSLRSLQLRGNRVIHLEGYREYVLRLIPSLQILDYSRVS
                     DQERKHSKSVELSDRSIDLKKDSDIMPRDKDLEMMHMVIGKMSEERKKELNEQLANAT
                     SLDEISRIEKLLSGGV"
     gene            <548343..>549971
                     /locus_tag="ZYRO0E07216g"
                     /db_xref="GeneID:8204792"
     mRNA            <548343..>549971
                     /locus_tag="ZYRO0E07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499192.1"
                     /db_xref="GeneID:8204792"
     CDS             548343..549971
                     /locus_tag="ZYRO0E07216g"
                     /note="similar to uniprot|P41835 Saccharomyces cerevisiae
                     YPL214C THI6 bifunctional enzyme with thiamine-phosphate
                     pyrophosphorylase and 4-methyl-5-beta-hydroxyethylthiazole
                     kinase activities"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499237.1"
                     /db_xref="GeneID:8204792"
                     /db_xref="GOA:C5E4M1"
                     /db_xref="InterPro:IPR000417"
                     /db_xref="InterPro:IPR003733"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR022998"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5E4M1"
                     /translation="MVFAKDEVDYSLYLVTDSTMLPEGTTLYSQVENALENGVSLVQL
                     REKNVDTKKFIEEAIEIQKLCKKFEVPLIINDRIDVALAIDADGVHVGQDDMPIPMVR
                     KLVGPDKIIGWSVGYTHEVEQLAQWGPDYVDYIGIGMVFPTNTKKNAKKSPMGPRGVA
                     RILDALENNNVDWCRTVAIGGLHPDNISRVLYQCNSLSGQRSIDGISVVSDIMAAKDA
                     GAATKNLRDILDKGYYSFVNLQLSIKTIYDLDFSSHTKRFLEQVAKNRPLVQHITNKV
                     HQNFGANVTLAIGSSPIMSEIKEEANDLAHIPHAALLVNTGSVAPLEVVKTAIQAYND
                     VKRPIVFDPVGYSATTTRIVLNDTLLASGQFTCIKGNTGEILSLAGFSGKMRGVDAHE
                     GDFDKNLLAQATREVAFRFRTIAVCTGELDFIADGTLGGTYSLSDGTKDRVLKDLPCV
                     VVSNGPIPLMGDITASGCSLGSTIASLLGGANSDENPFELVVAAVELYKEAGRLASLS
                     SEGSGSFHVQLIDKLYNCFRSNPRTWAPKVETLN"
     gene            complement(<550030..>551040)
                     /locus_tag="ZYRO0E07238g"
                     /db_xref="GeneID:8204793"
     mRNA            complement(<550030..>551040)
                     /locus_tag="ZYRO0E07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499193.1"
                     /db_xref="GeneID:8204793"
     CDS             complement(550030..551040)
                     /locus_tag="ZYRO0E07238g"
                     /note="similar to uniprot|P21560 Saccharomyces cerevisiae
                     YPL215W CBP3 protein required for assembly of ubiquinol
                     cytochrome-c reductase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499238.1"
                     /db_xref="GeneID:8204793"
                     /db_xref="InterPro:IPR007129"
                     /db_xref="InterPro:IPR021150"
                     /db_xref="UniProtKB/TrEMBL:C5E4M2"
                     /translation="MIQIVLARNGVLNQARSIPLRSRALLHQSSRLLNEKNPKPEELK
                     SPEDLARQSHLNSKPIDFTNYAPVRPGKKKTLLSDSKYESKDYQLPKWKEAFGELVIR
                     TLNLDMDKVRSGPVAGSYYYALCKNVALQYEGEKLSETAKFFYQDLKLPRTFSQWFQI
                     TILHEWLLFVRMRAMPFKYGRNYQQKLVDRTFTDIEARLFDEMNVTTGRIVDQYLKDF
                     NTQLRGAVFAYDEGFYTDDATLAAALWRNLFGGRKNIDMVHLEAMVRYVRSQLYVLSR
                     MSDRDFAVGSFKFVPPDETVERLTAEQEAQLKQKTIEKYESIDNDPKILPSDRSRLSY
                     KN"
     gene            complement(<551290..>554739)
                     /locus_tag="ZYRO0E07260g"
                     /db_xref="GeneID:8204794"
     mRNA            complement(<551290..>554739)
                     /locus_tag="ZYRO0E07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499194.1"
                     /db_xref="GeneID:8204794"
     CDS             complement(551290..554739)
                     /locus_tag="ZYRO0E07260g"
                     /note="similar to uniprot|P53125 Saccharomyces cerevisiae
                     YGL133W ITC1 Component of the ATP-dependent Isw2p-Itc1p
                     chromatin remodeling complex required for repression of
                     a-specific genes repression of early meiotic genes during
                     mitotic growth and repression of INO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499239.1"
                     /db_xref="GeneID:8204794"
                     /db_xref="InterPro:IPR004022"
                     /db_xref="InterPro:IPR013136"
                     /db_xref="InterPro:IPR018501"
                     /db_xref="InterPro:IPR028941"
                     /db_xref="UniProtKB/TrEMBL:C5E4M3"
                     /translation="MVLYKRKPIMLPDPRPLPTDLNIYVWHIDETGEWFITYEEYLER
                     LDFYTRHHFTCEITGTSCLTFFQALDSEETEFRYVEERFPLKLREPVSRFLHFNGIKR
                     LDALVEQVYAKFKNDFFPGEVVYLRKNNKELSATPSQPSPQPDDGANKENGDSTHIQY
                     QRPYIIKEKAQFNASKDPNTGEVITPAHSKYMLIEETQGSKSLIADQSQLYRDRTTFT
                     KHLIKCFCKITLRRASTKMGAPWAVKEEYLPMYGLTMDWPPEMLKYKDEEPVVKQDAS
                     KGKRKREDEVEYLQGEEEENKRIEEEQRLKHEEEASSKRKRTAEEEREDSLAQENTAQ
                     VNVITSIVEDLVLPYQGPPHVFENLYHYNNLLESVPVNRNNSSFKPFRETQKLLQVFQ
                     FLSTFAPKMCLSYFNLDQLITSLKCTDPSELKGEIVYVELLDQHGESSFAENESDWQR
                     NPKIREFIKQRDTERVRHYIAKDDPASDEVIDNVNHNGCGLLIECISALLRLFINEDG
                     DWTSLVMEEWLDNNDINGQENSKTDKQGDGSGDGDDAESEFDDINDTLEKCLNYRNVG
                     WAERLSKRQFNNHYWTLILLGIFQDCMHIPLYTDVIRVLVEKLVPSDISATQLPKQLW
                     RNFCFQLSLEEKLNCIWILVDLLSNFSADIKTAVEESMDLCGQIRSERFRFAKDLKAE
                     TSYLNLLNVDLQALEQAGTGDEPAIESHKARIAVQMEKLERLQKDKNFLDKKLMENDL
                     QRLRTLGLDRYGNRYYWMDLCGVPLGNVENTEDLSYHSGRLWIQGPAADAAEFFLQIS
                     NDELNQWKKLAEEHGKAYATKEVFHVYKTPEGSYRYVEGGNEVEICDCNGIVNSLIEL
                     NSIQKKIIDETPDCLLLSEDQWYSVDRVEDVRRLIDWFDNWGRREHDLLKQFKTMEDT
                     LDIVYSIRDKVLHLFVYDEEEERLFKELQEYEFTEEELNFDAPAKEANNNINGNNDDA
                     ENNERNNEEQQEDEEEEGEKDEGERDEEELEEIAEKIMKLDDSSKTRKILNSIQELED
                     RRDELLAKRQAATAADGDTTSSGGGKLQARAKKKRLKSIRNDKLNKQAEILTDLLNHR
                     HFVAMEDTISWKNQLSTKILGTALRKNASGKQKIKIVETVDAKLKEIMDQTSRTTAAT
                     ATN"
     gene            <555489..>559088
                     /locus_tag="ZYRO0E07282g"
                     /db_xref="GeneID:8204795"
     mRNA            <555489..>559088
                     /locus_tag="ZYRO0E07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499195.1"
                     /db_xref="GeneID:8204795"
     CDS             555489..559088
                     /locus_tag="ZYRO0E07282g"
                     /note="similar to uniprot|Q08965 Saccharomyces cerevisiae
                     YPL217C BMS1 Essential conserved nucleolar GTP-binding
                     protein required for synthesis of 40S ribosomal subunits
                     and for processing of the 35S pre-rRNA at sites A0, A1,
                     and A2; interacts with Rcl1p, has similarity to Tsr1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499240.1"
                     /db_xref="GeneID:8204795"
                     /db_xref="GOA:C5E4M4"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR007034"
                     /db_xref="InterPro:IPR012948"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4M4"
                     /translation="MSTMEQSNKEHRQRKEKNTAKKKLHTQGHNAKAFAVAAPGKMAR
                     TMQRSSDVNERKLHVPMVDRTPEDDPPPVIVAVVGPPGTGKTVLIRSLVRRLTKTALS
                     ELNGPITVVSGKRRRLTFIECPADDLNAMMDLAKIADLVLMMIDGNFGFEMETMEFLN
                     IAQQHGMPRVLGVVTHLDLFKSQSTMRAAKKRLKHRFWTEVYQGAKLFYLSGVVNGRY
                     PDREILNLSRFISVMKFRPLKWRNEHPYMLADRITDLTHPEIIHSQGTKVDRKVALYG
                     YLHGTALPADPGTKVHIAGVGDLSIGQVEKLPDPCPTPYYQQKIDEYEREKLKSEGGT
                     TGTTTRRRKRLDDKDKLIYAPMSDVGGVLMDKDAVYIDVGKKNEGPSFVPGQEKGEGE
                     RLVTSLQSADKNYAERFDGVGLQLFSNGTEYHAPEEGSSDEDADADESDKEVADSGRS
                     SLRHAKTHGKSVQDVDREVDELPSDEDEEDMEEGSEDEMPKSRLEEIDFDRDLEGDGH
                     SEKLAMESDSEFELSEPEGESWEVSTASKLKGSQNRRRKWDIGKLIYMDNIPPRECLK
                     RWRNEDVGDEEEEGSDIEQDEGEGFFKKNDGSFSKAHDYEGDLERFSPYFDKIEKLME
                     KWSSLDSLKDRFIGVPKPEDSKEDGVSDEEGKDEEVYGDFEDLEGQEEQPSESDGDEG
                     EHDSEEDSEDNESQGGDPSENESEDSFADFEKEEQKDNGGQNNNLSVEEERQQNMAKK
                     EKLRFQFEMEEGDNFKEDDPENEYDTWYELQKAKIAKQLEINNAELENMPVEQRHRFE
                     GYKAGSYVRIVFENVPMEFIENFDSRVPIIMGGLLPTELKFGIINARIRRHRWHRKIL
                     KTNDPLVLSLGWRRFQTLPVYTTTDSRTRNRMLKYTPEHTYCFASFYGPLCSPNTPFC
                     GVQVVANSETGGGFRIAATGMVEEIDANVEIVKKLKLVGFPSKVFKNTAFIKDMFSSA
                     MEIARFEGAQIKTVSGIRGEIKRALSKPEGHFRATFEDKILMSDIVILRSWYPVHVKR
                     FYNPVTSLLLKSKNEWKGMRLTGKIRADQGIETPANPDSNYQKVERVERKFNGLKVPK
                     AIQKDLPFKSQVHQMKPQKKKTYMAKRAVVLGGEEKKARTLMQQVYTLSRSKDEKKKA
                     KKQDERKERLKRLAKAEEEKVQRDKRKKKEYFTTQGKKRSGGETEGGSSKKRK"
     gene            complement(<559169..>559815)
                     /locus_tag="ZYRO0E07304g"
                     /db_xref="GeneID:8204796"
     mRNA            complement(join(<559169..559713,559791..>559815))
                     /locus_tag="ZYRO0E07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499196.1"
                     /db_xref="GeneID:8204796"
     CDS             complement(join(559169..559713,559791..559815))
                     /locus_tag="ZYRO0E07304g"
                     /note="highly similar to uniprot|P20606 Saccharomyces
                     cerevisiae YPL218W SAR1 GTPase GTP-binding protein of the
                     ARF family component of COPII coat of vesicles required
                     for transport vesicle formation during ER to Golgi protein
                     transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499241.1"
                     /db_xref="GeneID:8204796"
                     /db_xref="GOA:C5E4M5"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006687"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4M5"
                     /translation="MAWDLLGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKN
                     DRLATLQPTWHPTSEELAIGNVKFTTFDLGGHVQARRLWKDYFPEVNGIVFLVDAADP
                     ERFGEARVELDALFNIAELRNVPFVILGNKIDSANAVSEAELRSALGLMSTTGDVRVE
                     GQRPVEVFMCSVVMRDGYADAFQWLSQYI"
     gene            complement(<560064..>561350)
                     /locus_tag="ZYRO0E07326g"
                     /db_xref="GeneID:8204797"
     mRNA            complement(<560064..>561350)
                     /locus_tag="ZYRO0E07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499197.1"
                     /db_xref="GeneID:8204797"
     CDS             complement(560064..561350)
                     /locus_tag="ZYRO0E07326g"
                     /note="weakly similar to uniprot|P53124 Saccharomyces
                     cerevisiae YGL134W PCL10 Pho85p cyclin recruits activates
                     and targets Pho85p cyclin-dependent protein kinase to its
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499242.1"
                     /db_xref="GeneID:8204797"
                     /db_xref="GOA:C5E4M6"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C5E4M6"
                     /translation="MELNFEKIQRPGFVPDGLSEASDIEEDDEDGFAINDLDDDDVEN
                     SFELPIRASPYRFNNFSALNDDWRSFRRGNSGINKRVRFDNDRNNNGDEDGRNRSQSD
                     SPKGKKNVEELLQYANRVNEYLALNLEKIDMFRSELMDSDGMPYKSIGSETTLATTAT
                     TASGSVSNFELSESEMDEDKINLNSSVSGISSDSERAWEKTPLSQDSGRDELRIPSFE
                     QILQHVRRANEREGEKETTENEDNISSITNCETMETSQAIEIFQNTINCILHMSQAQD
                     QQDVPNPRDWDFNQFSMKSMPTVTYQEFITRIQTKCTYSPAVFLASAFLLQTLCLMRN
                     DNNGELCLRHRLQDSQIHRLVIACVRIATKIMEDHVHSHQYFSKVCGISKRLLSRLEI
                     SLVTCLKDEQFMVTRERLAATAKIKDELVACESNQS"
     gene            complement(<561794..>562447)
                     /locus_tag="ZYRO0E07348g"
                     /db_xref="GeneID:8204798"
     mRNA            complement(<561794..>562447)
                     /locus_tag="ZYRO0E07348g"
                     /product="60S ribosomal protein L1"
                     /transcript_id="XM_002499198.1"
                     /db_xref="GeneID:8204798"
     CDS             complement(561794..562447)
                     /locus_tag="ZYRO0E07348g"
                     /note="highly similar to uniprot|P53030 Saccharomyces
                     cerevisiae YPL220W RPL1A and highly similar to
                     uniprot|P53030 Saccharomyces cerevisiae YPL220W RPL1B
                     N-terminally acetylated protein component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L1"
                     /protein_id="XP_002499243.1"
                     /db_xref="GeneID:8204798"
                     /db_xref="GOA:C5E4M7"
                     /db_xref="InterPro:IPR002143"
                     /db_xref="InterPro:IPR016094"
                     /db_xref="InterPro:IPR016095"
                     /db_xref="InterPro:IPR023673"
                     /db_xref="InterPro:IPR023674"
                     /db_xref="InterPro:IPR028364"
                     /db_xref="UniProtKB/TrEMBL:C5E4M7"
                     /translation="MSKINSAIIRDNVKELLKYSTETKKRNFLETVELQVGLKNYDPQ
                     RDKRFSGTLKLPECPRPNLSICIFGDAFDVDRAKSCGVDAMSVEDLKKLNKNKKLIKK
                     LAKKYSAFVASEVLIKQVPRLLGPQLSKAGKFPTPVSHTDDLYSKVTDVRSTIKFQLK
                     KVLCLAVAVGNVEMNEDSLVNQILMAVNFLVSLLKKHWQNVGSLVIKSTMGPSFRLY"
     gene            <563119..>564054
                     /locus_tag="ZYRO0E07370g"
                     /db_xref="GeneID:8204799"
     mRNA            <563119..>564054
                     /locus_tag="ZYRO0E07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499199.1"
                     /db_xref="GeneID:8204799"
     CDS             563119..564054
                     /locus_tag="ZYRO0E07370g"
                     /note="similar to uniprot|P53123 Saccharomyces cerevisiae
                     YGL136C MRM2 Mitochondrial 21S rRNA methyltransferase,
                     required for methylation of U(2791) in 21S rRNA; MRM2
                     deletion confers thermosensitive respiration and loss of
                     mitochondrial DNA; has similarity to Spb1p and Trm7p, and
                     to E. coli FtsJ/RrmJ"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499244.1"
                     /db_xref="GeneID:8204799"
                     /db_xref="GOA:C5E4M8"
                     /db_xref="InterPro:IPR002877"
                     /db_xref="InterPro:IPR015507"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E4M8"
                     /translation="MLSIHSLRLNLCFRGVSRPLGHFRFNSQGRWLDRQSNDHYTKEA
                     KVQGLRSRAAFKLMELDDKFHLFQGDKHKHQRVLDLGFAPGAWSQVAQRRIGPNGMVL
                     GVDILPCEPPKGVHSIQANILSRKTHELIRLYFSRHFQLYKSDHLHEHHGYFQHRLEE
                     QLGLIKNTDAYDEIFDVGLSSGKVDRFPIDTIISDMYECWPQITGYWNNLTNAAYYRM
                     ANTSGVAIRDHYQSIDLADAALVTAIDLLRPRGNFVCKLYTGKEDKLFEKRLRKVFQR
                     VNRFKPASSRGESKELYFIGLGKKDPIDKLDVFSV"
     gene            complement(<564166..>567028)
                     /locus_tag="ZYRO0E07392g"
                     /db_xref="GeneID:8204800"
     mRNA            complement(join(<564166..566841,567011..>567028))
                     /locus_tag="ZYRO0E07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499200.1"
                     /db_xref="GeneID:8204800"
     CDS             complement(join(564166..566841,567011..567028))
                     /locus_tag="ZYRO0E07392g"
                     /note="highly similar to uniprot|P41811 Saccharomyces
                     cerevisiae YGL137W SEC27 Involved in beta'-subunit of
                     yeast coatomer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499245.1"
                     /db_xref="GeneID:8204800"
                     /db_xref="GOA:C5E4M9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016453"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5E4M9"
                     /translation="MKLDIKKTFSNRSDRVKGIDFHPSEPWVLTTLYSGRVEIWNYET
                     QTEVRSIQATDSPIRSGKFIARKNWIIVGCDDYRIRVFNYNTGEKVVDFEAHPDYIRS
                     IAVHPTKPYLLSGSDDLTVKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPSTFASGC
                     LDSTVKVWSLGQPTPNYTLTTGQERGVNFVDYYPLPDKPYMITSSDDLTVKIWDYQTK
                     SCVATLEGHMSNVSFAVFHPTLPVIISGSEDGTLKIWNASTYKLEKTINLGLERSWCL
                     ATHPTGKKNYIASGFDNGFTVLALGKDVPTLSLDPVGKLVWAGGKNASPSDIFTAVIR
                     GNEEAEESEPLLLQTKELGSVDVFPQSLVHSPNGRFVAVVGDGEYVIYTALAWRNRSF
                     GKCHGFVWGPDSNSYAIVDETGQVRYFKNFKEVTSWSIPLQYGVERLFGGGLLGAKSD
                     GFIYFFDWENGNLVRRVDINARDVIWSDNGELVMILNTEEGRGDEASAYSLAFNKDVY
                     EEAVTKGEIDEDNGVDDAFDVLHELNESITSGKWVGDVFICTTSTNRLNYFVGGKTYN
                     LAHLTKEMYMLGYLVRDNKVYLADREIHTYGYNVSLELLEFQTLTLRGELEEAMNTIL
                     PNVESKDTLSKIARFLEGQELYEEALKTSPDTDQKFDLALKVGQLTLAYEILGEEESE
                     LRWRSLGDASLQKYNFKLASEAYMKAHDLESLFLLHSSFNNTEGLLSVAKDAEALGKY
                     NLSFKAYFIAGDVESAKNLLVKLGKFPEAALLSVTYGIESDGVNSVVTKWKESLKADG
                     KTAIADRICFSEKNAPNASPLIDIDSAPSGKEETDEQASPAEAAEEVVNEDTQPKESQ
                     TTEEPQEPTAAKPEAPVEKEESQTEVPTQEASETKEESKKE"
     gene            <567345..>568721
                     /locus_tag="ZYRO0E07414g"
                     /db_xref="GeneID:8204801"
     mRNA            <567345..>568721
                     /locus_tag="ZYRO0E07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499201.1"
                     /db_xref="GeneID:8204801"
     CDS             567345..568721
                     /locus_tag="ZYRO0E07414g"
                     /note="weakly similar to uniprot|P53122 Saccharomyces
                     cerevisiae YGL138C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499246.1"
                     /db_xref="GeneID:8204801"
                     /db_xref="UniProtKB/TrEMBL:C5E4N0"
                     /translation="MILKIFWYFFTWLSFYQISNAAPVENKIWKALETQDKICSMKYA
                     HHEGSYKKMFETLSGLSIPAPLREHDKKPYTGFKLLRSYNIQLLNLGLSSAIHVVFCR
                     EGKIQWNIKQPLEDDIDWTTPLCVYTPDASVDSTITSNKNNKNNKNNKNNKNNKNNKN
                     NKNNNKRTSKEKALEDLNNLHCFKLARRKKYTNRKASLFFPKSWVGGMFYCDLDDDMK
                     RRALDNMEGNLKFKRNKGQDLCNRQNSMPLVPMQSDDYSKYWVEFSSLGASKFSTKVF
                     KPQITKYVPYINTPNDAFSVLNFEHNGNVSVASTAALNWGKPFREQALAVFQKNKMYT
                     SGKDPWFSEIEVDEKYQLSSEDLSLWQTWTDHAATKLSSVTNKPSKSFVSLTSIDTKN
                     NATSTSHLKGFLSRILKKVESKIWNRLQLRDKIISVLGDDPESLQYLQTEWKNLQMNR
                     EMFDYSYQ"
     gene            complement(<569155..>571524)
                     /locus_tag="ZYRO0E07436g"
                     /db_xref="GeneID:8204802"
     mRNA            complement(<569155..>571524)
                     /locus_tag="ZYRO0E07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499202.1"
                     /db_xref="GeneID:8204802"
     CDS             complement(569155..571524)
                     /locus_tag="ZYRO0E07436g"
                     /note="similar to uniprot|Q08967 Saccharomyces cerevisiae
                     YPL221W BOP1 Protein of unknown function overproduction
                     suppresses a pam1 slv3 double null mutation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499247.1"
                     /db_xref="GeneID:8204802"
                     /db_xref="InterPro:IPR010308"
                     /db_xref="UniProtKB/TrEMBL:C5E4N1"
                     /translation="MRLLMLWWLTTSWLACLATAKRKVFSTSLVTCMENSKLSANTFN
                     VTFNPHDRSLRYTFTMVTDIQDYVLAEMEVYAYGFKVVTKSFNPCNMGWKQFCPLSPG
                     DVQIDSVEYVAKKYTDDIPGITYHVPDIDAYVIVKVYNYQREYLACVQAFFSNGKTVS
                     QTGVKWASAVIAGIGLLLSAVLSTFGNSTAASHISANTMSLFLYFQSVVVVTMEHVHR
                     VPPIAEAWAENLAWSMGLIRITFMQRIFRWYVQSTGGKPSLNLTSRKISVLTQRSLDY
                     IKDRQLIKRAKDVLYGNSQVMIFRGIKRLAYDVNIENTAVVCTGFTFFVLCGYVLAGF
                     IIASKNALELSAKCGWIKSTRFVDFRQNWRQVLKGALLRYIYIGFTQLTILSFWEFTQ
                     RDSPAVIVIACLFIVLAVGLMAWSAFRTTFFAQRSIEVYNNSAALLYGDERVLHKYGF
                     FYTMFNATHYWWNIVILSYMFVKAIVIGFAQSSGQAQSLLIFILDLAYFIAIIYFKPY
                     LDRPTNIMNIFISTVTLINSFLFMFFSDLFGQSYAVSAVMGWIFFILNAAFSFILLMM
                     ILTFTVMILFTKNPDVRFKPAGDDRRSFQRFSLKSTNGMNASVAAELAALGNVAKDHN
                     DNWENQLGDQKSQTDDVNVFTLDDEKLDELRAAKQRSNSTSSGINKPTTFKDKVMRKL
                     SLRRSGKGKRNPEFAGNDLTSLTPDSESVASAGTPPRNYPGVHQRQPSESRNRLMDSY
                     DDVGEGFNFLPVREGDENLSEDEFEMPRRDASLDTMAQHNGAMRSADIL"
     gene            complement(<572497..>575538)
                     /locus_tag="ZYRO0E07458g"
                     /db_xref="GeneID:8204803"
     mRNA            complement(<572497..>575538)
                     /locus_tag="ZYRO0E07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499203.1"
                     /db_xref="GeneID:8204803"
     CDS             complement(572497..575538)
                     /locus_tag="ZYRO0E07458g"
                     /note="weakly similar to uniprot|P36775 Saccharomyces
                     cerevisiae YBL022C PIM1 Mitochondrial ATP-dependent
                     protease involved in intramitochondrial proteolysis
                     involved in degradation of misfolded proteins in
                     mitochondria required for bigenesis and maintenance of
                     mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499248.1"
                     /db_xref="GeneID:8204803"
                     /db_xref="GOA:C5E4N2"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027501"
                     /db_xref="UniProtKB/TrEMBL:C5E4N2"
                     /translation="MFFGKNDNVTDIQDFPCLTLNNAPRVVPIPGILYRLTYELEVGQ
                     NILGNFKNLKSYENHLLLTGVKGRDKDQPSDSKIANSLTKFRTNHDSPNEEKSLYLTL
                     IPSEYGDPCVGCVAKVVGVLTEQKTMTISFKTQKRAIVKAPLVNSGNQVFNSTIKVVD
                     DFPGISKLTREQLKRGPQEFKELFNSIDETIRSFKSQYKQPAKNKKSSQHLLFLSPLS
                     NTLFFQLNKTGFNKAWSIILGLVVDLENNVKKRSDPEIYLEVLKLVDLITAVLPISVH
                     QKWTILTTTNFTERFQNFGNVLQNFQNVFETLYASTGYVQQYFTQASNLDKSRLIANQ
                     LKSLKFFIDDVKAQNTFPADVEKRHNKPKTLVPRNFHFDKGSNSKEGKVDEDEEDEED
                     IDLLKKFIDNIRQYEIHPDGIKMLKKDFKRFAKMSPQNTEYQVLKNYFDIITDIPFGR
                     YGEREPIDVNKSRNTLDKDHYGLQMVKKRLLEYLCILKLQEKLGNIKKRAPILLLVGP
                     PGVGKTSIAKSVAQVLNRQFQRVSLGGIHNEADIRGHRRTYVGSMCGLIINALRKSDC
                     MNPLILLDEVDKVLSTTGSSAGYSSKINGDPGAALLEVLDPEQNNTFMDHYLGFPVDL
                     SQVLFFCTANDLSGISRPLLDRMEVIEIPGYTPEEKIQIGTNFLLPKQISLNGLDSCN
                     CEFQISDKAWKSLVLEYTREPGVRSLERQLAAIVRGKVSEVVETGKYEEKNSTSRSEN
                     EVLQPKELLKYLGFPLHPITRELLQQIKHAEKEGVVNGLSYNSDGTGSVLVFEVIKTG
                     GSDGQDISNTKNGPTIISTGNLGNVLQESINIAKSVVKVMLRKKQLVFPPQVVINLQE
                     FLSSEYHLHVPAGAISKDGPSAGAAIALALLSVALKKPVEPTICMTGELTLRGKILPI
                     GGIKEKLLGARIYGMHKVLVPLANRSDLVEALTDDVAPFANGQDRSELDLVKQKMHLQ
                     VCYVDTIHDVVRHAWPDFSDASSPSSNTWTLPDNNSHRAKL"
     gene            complement(<575943..>577946)
                     /locus_tag="ZYRO0E07480g"
                     /db_xref="GeneID:8204804"
     mRNA            complement(<575943..>577946)
                     /locus_tag="ZYRO0E07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499204.1"
                     /db_xref="GeneID:8204804"
     CDS             complement(575943..577946)
                     /locus_tag="ZYRO0E07480g"
                     /note="similar to uniprot|Q08968 Saccharomyces cerevisiae
                     YPL222W FMP40 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499249.1"
                     /db_xref="GeneID:8204804"
                     /db_xref="InterPro:IPR003846"
                     /db_xref="UniProtKB/TrEMBL:C5E4N3"
                     /translation="MSDGRCVFNVLKESGTSRFVKSLTPDSAVPNVKRAIALAESQDV
                     KKRVLPFHQPRNVSRGCHFAYTLPEQRPHYRTLLKSVQTHADMDLKMDEKLEKLLSGE
                     QVYYDESQGIFPYSTAYAGFQFGTFAGQLGDGRVVNLFDVQDNKGNWQTLQLKGSGLT
                     PFSRFADGKAVLRSSIRELIISEALYHIGVPSSRALQLTLLPETRASRERKSEPCAVL
                     CRVAPTWLRIGSFDLFRFRPHLKGLLGLTHFAIDEVFNGGKDFPRKRDLNIFRKDFFP
                     NDGIEQGAEARNPVEGSTIYDEFYRHVINLNAKCVASWQTYGFMNGVLNTDNTSIMGL
                     SLDYGPFNIMDQLKPDFTPNHDDIAGRYSFENQPSAIWWNLIMLGHDLSVLIGAGPSH
                     IDKILSMQELSEELPAEVEKEVVNRANDVIALAGNEYKFTFLSEYANLMGKRIGIDLG
                     LSSDLTNAEEIAAQSSQVHDFLSNILEPLLNILETTEVDYNHFFVKLQNYRGPLFDDD
                     GAEGLSRSFLSLFLHAPQIEQLQAFKSGEIDINADSGGVRIVMGTVERLSQWAKEYVK
                     FVPDEQKRSEIAKEVNPLFTPRAWMFDEVVDDFMDNQRTELNDPESKIDNSLLSKLFL
                     MSSNPYDPSKWEESLRPDVQERWMNLEHESIREKYLKQATCSS"
     gene            <578645..>580657
                     /locus_tag="ZYRO0E07502g"
                     /db_xref="GeneID:8204805"
     mRNA            <578645..>580657
                     /locus_tag="ZYRO0E07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499205.1"
                     /db_xref="GeneID:8204805"
     CDS             578645..580657
                     /locus_tag="ZYRO0E07502g"
                     /note="some similarities with uniprot|Q03213 Saccharomyces
                     cerevisiae YMR172W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499250.1"
                     /db_xref="GeneID:8204805"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5E4N4"
                     /translation="MSDTTNPLVVGGTTAMTPNGNGLLDTSQPVTNVQVGDGPSPSLN
                     MTTAAGGSASGQQPEPLALNLNLALESDPLAANNHTAPNNNNSSRASTAGQTSTNTAA
                     AAAAAAVAAANSTGNASTNMNSNSNTTMPTPVMEGSNPGSTNSAGLTGTYPSMNSIPS
                     ASPSRTIPNDRSTNTVRMFQRMDELSARFIVMEEMFQKLCKTVEQQSLCMADLKLQNS
                     QMCQEVSGKLDEICQQQRHYGEQPNDQDSFVTDLLNSITNVSSSYLRKIRSRSRPGST
                     KVSPQQQGITPPGGQWTQYDQAATTQNFAQTQSNSVPCDKMFTLNPNGIKRRRHNPPH
                     SNVTSGAPSYTDLASLNNLGTISLPNLALDHTGITPLIRSGGSGGANGPLGFPTHPTQ
                     DQQQQQPQQPQQPPQHSSRGRGIHLEIGSELASANEDEDGYQEEDDDDDNSVLAKTHS
                     SSDGGSSSSEDASAEEEDEADDEIDNATKESSGNRSNNVNLNARAKRKRPRLADQNMR
                     NLIGNSDDVSVRNTPDRNERLVLKNSRSAIGQLVGSSTNSLPDVVGNNVVNTSPNSRD
                     LNYTLLKAPTDVRTIWKEYVSGIGGDPPIKKLEEKYGNKWRLNHNRKTFARRKRLYKF
                     IINGMNKGKSADEMIDALERRRLYRDENGEVKRRTIGWLQQSLTGI"
     gene            <581568..>583061
                     /locus_tag="ZYRO0E07524g"
                     /db_xref="GeneID:8204806"
     mRNA            <581568..>583061
                     /locus_tag="ZYRO0E07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499206.1"
                     /db_xref="GeneID:8204806"
     CDS             581568..583061
                     /locus_tag="ZYRO0E07524g"
                     /note="weakly similar to uniprot|P18899 Saccharomyces
                     cerevisiae YMR173W DDR48 DNA damage-responsive protein
                     expression is increased in response to heat-shock stress
                     or treatments that produce DNA lesions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499251.1"
                     /db_xref="GeneID:8204806"
                     /db_xref="UniProtKB/TrEMBL:C5E4N5"
                     /translation="MGLFSKVKEVVSNKSSGGDLVDKAESVAGKDKVEKARKTVGDDK
                     FSKGEDFIRNKLNNTHLDDDKKGGKSGKNGDSYGGGDAYGSSGKNKGSSYGDDSYGGS
                     SSGKNKSSYGDDSYGGGDTYGGSSSGKGKSSYGDDSYGGGDTYGSSGKGDTYGSSGKG
                     KSSYGDDSYGGSSSGKGDTYGSSGKNKSSYGDDSYGGGDTYGSSGKGKSSYGDDSYGG
                     SNAYGSSGKGDTYGSSDKGKSSYGDDTYGGSSSGKGKSSYGDDSYGGDTYGSSGKGDT
                     YGSSGKNKSSYGDDSYGGGDTYGSSGKGDTYGSSGKGKSSYGDDSYGGSNTYGSSGKG
                     DTYGSSGKNKSSYGDDSYGGGDTYGSSGKGDTYGSSGKGKSSYGDDSYGGGDAFGSSG
                     KGKSSYGDDSYGGGDAFGSSGKGKSSYGDDSYGGGDTFGSSGKGKSSYGDDSYGGSNT
                     YGSSGKGKSSYGDDDNLGSTGGYGGGSDNYGGSGGYGSSGRGGGSNW"
     gene            <585395..>589354
                     /locus_tag="ZYRO0E07546g"
                     /db_xref="GeneID:8204807"
     mRNA            <585395..>589354
                     /locus_tag="ZYRO0E07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499207.1"
                     /db_xref="GeneID:8204807"
     CDS             585395..589354
                     /locus_tag="ZYRO0E07546g"
                     /note="weakly similar to uniprot|Q03214 Saccharomyces
                     cerevisiae YMR176W ECM5 Non-essential protein of unknown
                     function contains ATP/GTP-binding site motif A null mutant
                     exhibits cellular volume up to four times greater than
                     wild-type also large drooping buds with elongated necks"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499252.1"
                     /db_xref="GeneID:8204807"
                     /db_xref="GOA:C5E4N6"
                     /db_xref="InterPro:IPR001606"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013637"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5E4N6"
                     /translation="MVPLEPNQIKARRVIEDDSNGKFLKETEWGAKVYLGSGSVPILY
                     VARDKLPDPLELYSKILDMGNEYGLVKLVVEGEEGQRERDSLSILSLHADIVWFRSRT
                     QFLKSFKTQRRKILRFHRRLYSCHKNLGHVINKVPSIDKRTLDLYRLWRCVQLRGGYK
                     QVCQRKLWAQIGRELGYSGRIMSSLSTSLRSAYVKVLLDLELDPRFLQDEEKSDIARD
                     SNGIFEVSNSKPDIKLLKGLKKFKGFKSNSHNIYESKKNFNTNYLPGYDLTNWIHSLE
                     TYDTAQHEKKNLSMYNLRQYYEKSIEYDEKLGQLNQGEISLSHFEKIYWQNLASPITI
                     DVDTSLDLPSVKHNFNLLTCLQPSEREKMLKDPWQLNRLPLHRDSLLKFLDLDLGEFT
                     YSHIDVGMLFSTKSWSMGPLGMPSLHYNHLGSTKIWYSVPPSQWDKFQNLLKELNHKN
                     SVKENEAEEEDDEVNDVNDQTFDATFKFSDIHKSFLETNQLDQDGKINVHNIFDKEPP
                     LNEERLTNELVITPDVLTRNGITLNKITQECGTYIFKFPRTHTFNVDTGFCLSECANF
                     APFSWLDKHWFKTIENDRIISPLPRIDPFQFLMKIFLNSNDSLTIDKCRNLLKDPIEK
                     ELRNRVYVQHKFISKTQIVENRFDYISDLSLQPTGASKVVLCNDSDCVTLSLREFLDM
                     VVITENGSEEIFGLSIDDRTLQVQLHLYYDDSILKRIIDLPYSESKESNIFDNKDLDS
                     LVNVQYANKRIAMSCAKEILSTRSGHGVMPLIDALKHAELLKSECGTILERVAAELIN
                     PSSIIVKQGEGFNLVDLLSQSSGFCDLETLGRIESEIKQCSIEFPEMTQFLQLCEEVN
                     EIQSEAQMAMKNQDLEILEKCFALNCSLGIKNDLIAFTIGKLSWLRVYHDVFENPYHA
                     RFEENPKDYSLDAMSWFLIFGTKYCGPEDLDKLNRVKTTIAKTQALNAKFHELFKGKK
                     PKFKISVQDIASLSAAINQEKLPLNPELVKLLKAIAESVDKVRENMVPIWKMLSVDEQ
                     LIEQLKFLIKNESIKSFELFPKFNGGPDDKRIQLKDVSEQKLFIKQRKACKLWLADAS
                     RLCSKNGIDKLKHRLENCLDLTKDVIRAPGEPTALYCFCREADNGATMVECEICKEWY
                     HTKCIKKGSWKLPDESVFICSLCSPDDTIQDEYANCVDFNDVTNLVLESLDLKLLPDR
                     NMVFDLFTIYGKMMVFKKKMERELFQDNGQLNPDIPLHNVKFFLRKAYGAKCNFGNVN
                     KILKDYCKSRDAAPIDQMAKSGHIVVTDQPQQLKQEKPSFSSFAENTDNEDEKNKAV"
     gene            <589794..>591305
                     /locus_tag="ZYRO0E07568g"
                     /db_xref="GeneID:8204808"
     mRNA            <589794..>591305
                     /locus_tag="ZYRO0E07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499208.1"
                     /db_xref="GeneID:8204808"
     CDS             589794..591305
                     /locus_tag="ZYRO0E07568g"
                     /note="similar to uniprot|Q03218 Saccharomyces cerevisiae
                     YMR177W MMT1 Putative metal transporter involved in
                     mitochondrial iron accumulation closely related to Mmt2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499253.1"
                     /db_xref="GeneID:8204808"
                     /db_xref="GOA:C5E4N7"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="InterPro:IPR027469"
                     /db_xref="UniProtKB/TrEMBL:C5E4N7"
                     /translation="MLRISNIRGSVLQFVGSQRPPSSIRIRLHNVAAFHSSAQLKNTA
                     SNDKQREELVEKQLEKNPNFHHDLGLDSHGHDHIHLRLSETEENDQMTLGSMPHRRAQ
                     KNTAHHHGHSHANVSLNPLLVLNKDQMRNNPGVRITWIGLAINVGLALGKFAGGIAFH
                     SQALVADSVHAVSDMVSDLLTLFSVTLADNRSTKDYPFGYGKIETVGSLAVSAILTTA
                     GLSIGWSSLCAIVGPIVPQSILETLGHFVGHGHGHSHSVANEVTNVNAAWIAAGSIAV
                     KEWIFQATKKIAVQSNSNVLMSNAWHHRVDSLTSLVALVTISGGHFLGLQSLDAVGGL
                     IVSGLVIKAGGEGMVGAVKELCDQSLSPEDARYVEVKLALEEALSKLISNNNAGRPYG
                     IKFLTILPSGPNLTAMSTLEVPLQKWGNVLGIREFEVVTDHIRCVLYKNLPRLKYLNI
                     EFVEEEQELTQDELDRMAKPQTELPELEHKSDGSRQGHTHSHFGMGAGHTHNH"
     gene            complement(<591361..>591801)
                     /locus_tag="ZYRO0E07590g"
                     /db_xref="GeneID:8204809"
     mRNA            complement(<591361..>591801)
                     /locus_tag="ZYRO0E07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499209.1"
                     /db_xref="GeneID:8204809"
     CDS             complement(591361..591801)
                     /locus_tag="ZYRO0E07590g"
                     /note="highly similar to uniprot|Q08971 Saccharomyces
                     cerevisiae YPL225W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499254.1"
                     /db_xref="GeneID:8204809"
                     /db_xref="InterPro:IPR008476"
                     /db_xref="InterPro:IPR021148"
                     /db_xref="InterPro:IPR023139"
                     /db_xref="UniProtKB/TrEMBL:C5E4N8"
                     /translation="MSTFNANEAENLEDIEKQFAVVAVEQAETYWNLLTKVPGSRLRL
                     TRYDDEIYNTFMEHFPEFRDVEKLKKFSEQDIKNKTAKDRWRKFCALYEKTIEDYNFG
                     TLLRTDSTQEYGQFSTCFVVRIQFYAFEIARNKHGLNDWAAAKK"
     gene            <592487..>593359
                     /locus_tag="ZYRO0E07612g"
                     /db_xref="GeneID:8204810"
     mRNA            <592487..>593359
                     /locus_tag="ZYRO0E07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499210.1"
                     /db_xref="GeneID:8204810"
     CDS             592487..593359
                     /locus_tag="ZYRO0E07612g"
                     /note="highly similar to uniprot|Q03219 Saccharomyces
                     cerevisiae YMR178W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499255.1"
                     /db_xref="GeneID:8204810"
                     /db_xref="GOA:C5E4N9"
                     /db_xref="InterPro:IPR001453"
                     /db_xref="UniProtKB/TrEMBL:C5E4N9"
                     /translation="MQRFIRPLSQATKLFDMPKVSAACMIIGDEVLNGKIIDTNSRFF
                     ARYCWDNGISLREIVTVGDDESQIVESLQHLTKKYQLVVTSGGIGPTHDDITYESIAK
                     TFQLPVKLDPELQRRMQKLSNPESHLSDQALNDFYRMATVPFGPQVKNYYVDDKLWVP
                     ICSVDHKVYILPGIPQLFKRMIEGFTPQFKEIYGLKEDTREYVRFFVKTPFTESQISY
                     FLRKLQEEAAQVSEDIKIGSYPHFGMGFNTISILGTKDNEDYLKNLSDKTIKELKGEP
                     IAAELEEKYSNLQN"
     gene            complement(<593495..>597025)
                     /locus_tag="ZYRO0E07634g"
                     /db_xref="GeneID:8204811"
     mRNA            complement(<593495..>597025)
                     /locus_tag="ZYRO0E07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499211.1"
                     /db_xref="GeneID:8204811"
     CDS             complement(593495..597025)
                     /locus_tag="ZYRO0E07634g"
                     /note="highly similar to uniprot|Q7LHP2 Saccharomyces
                     cerevisiae YPL226W NEW1 This gene encodes a protein with
                     an Q/N-rich amino terminal domain that acts as a prion
                     termed [NU]"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499256.1"
                     /db_xref="GeneID:8204811"
                     /db_xref="GOA:C5E4P0"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR023780"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4P0"
                     /translation="MPPKKFADLSEFLEDQAPEPGYVPSPYGGYFKNANNYQQQRSYN
                     NTNKGPSYNNQNSNNYYNQSYNNSQNYGSQNYRGGYNDYQYQQSAVTPDQSKTPTPSA
                     STTSLTSLNDNMANLQVSPVSAALEQIPQCKTIADCKKKLDIVIEEFNKDGASAKDLE
                     TWSIPDVLTKFAKQKNPALVKESAMLLIGKLAQHFHDKHPQEAYLLPFFDFALDAVAD
                     KENTVKRAAQQSMDSLVNIFPLEALTSSVLPRILEYLASGAKWQSKLAALGIIDRIRE
                     DSPNDLLELTFKQTVPILTDVATDFKPELAKRGYETLLNYVSILDNLDLAPRYKLIAD
                     TLQDPSKVPQCVRALSSVTFVAEVTEPALSLLVPILNRSLTLSSSSQEQLRQTVIVVE
                     NLTRLVNNRIEIESFIPQLLPGVQKVVDTASLPEVRELAGKALQVLKEDEEPNTADYF
                     PGRIATSEGKDFLLKRLPKLSINDRLLQIFLQDEKTIQYLAELLTVDANVNDWKRLQE
                     FLISVFGEINEEAIVANFINDLRAIFHQEKTQYDESEGVEIVNTDFSLAYGSRMLLNK
                     TTLRLLKGHRYGLCGRNGAGKSTLMRSIANGQLEGFPDKNTLRTCFVEHKLQGEEGDL
                     DLVSFIALDEQLQQTSREEIANALAEVGFDESKRVQTVGSLSGGWKMKLELARAMLQK
                     ADILLLDEPTNHLDTANVKWLEDYLLDHTEITSLIVSHDSRFLDAVCTDIVHYENKKL
                     AYYKGNLAKFVEQKPEAKAYYTLSDSNSQMRFPPPGILTGVKSNTRAVAKMSHVTFTY
                     PGAPNPSLNDASCALSLSSRVAVLGPNGAGKSTLIKILTGELVPQEGEVQKHPNLRIG
                     YIAQHALQHVNEHKEKTANQYLQWRYQFGEDREVLLKESRKVSEEEKEILKKEIDIGD
                     GFSARTIEAIVGRQKLKRSFQYEIKWKLWKPKYNSWVSRERLVEEGFGKLVQKFDDFE
                     ASREGLGYRELIPSVITKHFEGVGLDSEIANHTPLGSLSGGQLVKVVIAGAMWNNPHL
                     LVLDEPTNYLDRDALGAMAVAIRDWKGGVVMISHNSEFVSALCPEQWIVENGKLTQKG
                     VAQVDQTKFEDGGNAEAVGLKPVKASPSVTDDDSPANIKVKKKVKRLTRNEKKLQAER
                     RRLRYIEWLSSPKGTPKPKNSDDESEGEDE"
     gene            <597945..>599936
                     /locus_tag="ZYRO0E07656g"
                     /db_xref="GeneID:8204812"
     mRNA            <597945..>599936
                     /locus_tag="ZYRO0E07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499212.1"
                     /db_xref="GeneID:8204812"
     CDS             597945..599936
                     /locus_tag="ZYRO0E07656g"
                     /note="similar to uniprot|P35209 Saccharomyces cerevisiae
                     YMR179W SPT21 Protein required for normal transcription at
                     several loci including HTA2-HTB2 and HHF2-HHT2 but not
                     required at the other histone loci functionally related to
                     Spt10p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499257.1"
                     /db_xref="GeneID:8204812"
                     /db_xref="UniProtKB/TrEMBL:C5E4P1"
                     /translation="MADISKMTLKILYTLDNGSSGTYLARSKTPQQVRVASIPNLNSP
                     NDGEMGMGLRIGAVDLSLVLKEIYLNSPELLNGSMAKMGFDYNLYYKDICEADEPLVS
                     LGLLSQIRQKLNNRRQHQIEEEIEEDDATIVIGRVCSNFQALLKKSYSNASKDGSDTD
                     SVIPETLELKLSLIKVVHPKNARKNVPSMPNFPSKVIRPAKPTKRPTNPTPAPKAGRT
                     QSLPIWNMETKDSNGSVNSIARKIYLADRKTELEQMNEPPHNPLAYQVSALQQDNTVQ
                     RTKLDTSVSRRFESLANKKKKPQQQQQHQSKKAPNAKKSHAAPKARRCNTMAAIPTPS
                     DESKSLAKKHEKLGTDAGSLNDVVQEMLAGPDDTLPVVNDDKENFPPPPPPVENSDEA
                     QGGIDLDLLDFSELGEMDWFQNFDPFNSPSLVPAANNGEPVKNTTPRDQNTGNTMTIG
                     DEEVADVEEDPCDKIGVTSDIDRTSPIDTLSMPLMELNQQPHAKLITCQEQLKRLPLI
                     GPKHSSSGNVTGDSKKDNRAGSDTSKQSKSKDDEIDDDQTSIVGSYSTPVQEDRPKKR
                     EKSQLVVENSSPIPKRSYADDDDCDEKVPSYKKQRTIPSSPTTMFNYQDEASSQVDDD
                     DENNDLFSSFVNGSRPSNQDEMNDTPATQYQNQSSDNIK"
     gene            <600213..>601241
                     /locus_tag="ZYRO0E07678g"
                     /db_xref="GeneID:8204813"
     mRNA            <600213..>601241
                     /locus_tag="ZYRO0E07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499213.1"
                     /db_xref="GeneID:8204813"
     CDS             600213..601241
                     /locus_tag="ZYRO0E07678g"
                     /note="similar to uniprot|P40350 Saccharomyces cerevisiae
                     YPL227C ALG5 UDP-glucose:dolichyl-phosphate
                     glucosyltransferase involved in asparagine-linked
                     glycosylation in the endoplasmic reticulum"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499258.1"
                     /db_xref="GeneID:8204813"
                     /db_xref="GOA:C5E4P2"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5E4P2"
                     /translation="MAFNDFKQLQNVDLKGFLTTAAIGLIVSGYLIIYLLSHTPRLPF
                     DEELEYQTIDGKGGLVKKRLPNVCRGDSNKNKSNNDNNDEDILLSVVVPSYNETKRIS
                     HMLADAIAVLQKEMAHRWEIIIVDDGSKDGTSEYCLNLSEKVFQLQEGQLRVVKLSQN
                     RGKGGAVRHGLLHIRGKYGLFADADGASQFNDVSKLIESIKQLEGPQGKPAVAIGSRS
                     HMVNTDAVVKRSFIRNLLMYGLHTLVFVFGIRSIKDTQCGFKLFNRSAIESIFPYLHT
                     EGWIFDVEILMLALRKKIPISEVAISWHEVDGSKMDLARDSINMAKDLVVIRMAYILR
                     IYRDDKEC"
     gene            complement(<601296..>602576)
                     /locus_tag="ZYRO0E07700g"
                     /db_xref="GeneID:8204814"
     mRNA            complement(<601296..>602576)
                     /locus_tag="ZYRO0E07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499214.1"
                     /db_xref="GeneID:8204814"
     CDS             complement(601296..602576)
                     /locus_tag="ZYRO0E07700g"
                     /note="highly similar to uniprot|O13297 Saccharomyces
                     cerevisiae YPL228W CET1 Interacts with Ceg1p the mRNA
                     capping enzyme alpha subunit removes gamma-phosphate from
                     triphosphate-terminated RNA mRNA capping enzyme beta
                     subunit RNA 5'-triphosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499259.1"
                     /db_xref="GeneID:8204814"
                     /db_xref="GOA:C5E4P3"
                     /db_xref="InterPro:IPR004206"
                     /db_xref="InterPro:IPR023577"
                     /db_xref="UniProtKB/TrEMBL:C5E4P3"
                     /translation="MSQDQKPVPKRALSLDDLVNHDDDAHKVRKTADDSIVENNSDET
                     DTDDGEGKGGGVDFNTEMNFDYDKQEQSGRDSNASSSVNTIFDEKASLQSKKNNIKQD
                     LRVLNEIAATSKPNKYKNTPIWAQKWKPTVKALQSIDTKDFKIDTSFLSIIPDDDLTK
                     SVQDWVYATIFSIPPDLRPMVEMELKYGVIIDAKSPDRISPPVSTQAIYTDDGRMTPN
                     VDQAVFEELKKYIHGVSELNENSGKFSVIESQTTDSLYRVGVATQRPRFLRMSTDLKT
                     GRVAQFIEKRKVSSLLIFSPKDSYDMKLSINLEIPVPENEPPEKYKDQTPMSARTKTR
                     VSYIHNDSCTRIDVTDVERLTKGPKGRDTSNNTFEVELEINTAALLNSFDNIATDSNM
                     YASLIRTFLNNGTLIRRKMSSISYGIFEGQKKGM"
     gene            complement(<602923..>603309)
                     /locus_tag="ZYRO0E07722g"
                     /db_xref="GeneID:8204815"
     mRNA            complement(<602923..>603309)
                     /locus_tag="ZYRO0E07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499215.1"
                     /db_xref="GeneID:8204815"
     CDS             complement(602923..603309)
                     /locus_tag="ZYRO0E07722g"
                     /note="some similarities with uniprot|Q99395 Saccharomyces
                     cerevisiae YPL229W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499260.1"
                     /db_xref="GeneID:8204815"
                     /db_xref="UniProtKB/TrEMBL:C5E4P4"
                     /translation="MQTDYMTMNNFTVGRKMMDGQPQGQAQQQIPVSPPQFNSPLLSG
                     SSGSSVESDTLRYKSDMCKSFEDDLFYCPRSLLSAQEQVTCERMDMFLAEQFREYQLQ
                     AQITLSTRPKFNPYTSESFNPGTHGQ"
     gene            complement(<603930..>604541)
                     /locus_tag="ZYRO0E07744g"
                     /db_xref="GeneID:8204816"
     mRNA            complement(<603930..>604541)
                     /locus_tag="ZYRO0E07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499216.1"
                     /db_xref="GeneID:8204816"
     CDS             complement(603930..604541)
                     /locus_tag="ZYRO0E07744g"
                     /note="similar to uniprot|P15992 Saccharomyces cerevisiae
                     YBR072W HSP26 Small heat shock protein with chaperone
                     activity that is regulated by a heat induced transition
                     from an inactive oligomeric (24-mer) complex to an active
                     dimer induced by heat upon entry into stationary phase and
                     during sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499261.1"
                     /db_xref="GeneID:8204816"
                     /db_xref="InterPro:IPR002068"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:C5E4P5"
                     /translation="MFSTPFFDFFDNINNEVENVHNILGYSRDRDYPSRRQLTSGREN
                     DSGKIQKRPHRNNNQRLLSTRLNKWFDDDWSLSDFDLGPTNIVPPVDLFDHEENYEAR
                     ITIPGVDDSKNINLEYHKDGNEIVVSGEVPSTVTEHNRDNVKVKEVVSGQFKRVITLP
                     ENPGVNAEEINANYKNGVLSLRIPKLKQSKKDNVRKIEVAGDE"
     gene            complement(<604879..>610605)
                     /locus_tag="ZYRO0E07766g"
                     /db_xref="GeneID:8204817"
     mRNA            complement(<604879..>610605)
                     /locus_tag="ZYRO0E07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499217.1"
                     /db_xref="GeneID:8204817"
     CDS             complement(604879..610605)
                     /locus_tag="ZYRO0E07766g"
                     /note="highly similar to uniprot|P19097 Saccharomyces
                     cerevisiae YPL231W FAS2 Alpha subunit of fatty acid
                     synthetase which catalyzes the synthesis of long-chain
                     saturated fatty acids contains beta-ketoacyl reductase and
                     beta-ketoacyl synthase activities"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499262.1"
                     /db_xref="GeneID:8204817"
                     /db_xref="GOA:C5E4P6"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR002582"
                     /db_xref="InterPro:IPR004568"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="InterPro:IPR026025"
                     /db_xref="UniProtKB/TrEMBL:C5E4P6"
                     /translation="MVMKPETEQELAHILLTELLAYQFASPVRWIETQDVFLKDLNSE
                     RVVEIGPSPTLSGMAQRTMKNKYESYDAALSLHRQVLCYAKDAREISYTPDPAELEAK
                     ERAVAEAAGGEAAPAPAATPAPSAAPSAAPAAAPAAAAPAAAPAAPAAGPVAELPDEA
                     VKAGLLLRVLVAHKLKKPMDSIPMSKTIKDLVGGKSTVQNEILGDLGKEFSATPEKAE
                     ETPLEELAETFQETFSGSLGKQSSSLISRLISSKMPGGFTTTVARKYLQTRWGLASGR
                     QDSVLLVALTNEPASRLGAEPDAKAFLDSMAQKYASIAGVDLSAASAGGSSGAAGGAA
                     GAGGATIDAAAFEELNKDQRILARQQLQVLARYLKMDLNVGERKFLKEKDTIADLQAQ
                     LDFITNELGEYFISGISTSFSRKKARAFDSSWNWAKQSLLSLYFEIVHGVLKNVDREV
                     VSEALNIMNRSNETLIKFMEYHVSHTDASRGENYKLVKDLGEQLIQNCKQVIDMDPVY
                     RDISKPTGPKTVIDKNGNIRYSEEPKEKVRKFSEYVQEMALGGKLSKQSHSTIEEDLT
                     RVYKAISAQAAEHDISGTTAQEFEKVYGDLMQFLQNSKEIDASQTTRLAGVVDDSLDK
                     DSTKEVASLPTKSKISKSVSASIPRETIPFLHLRKKGSNGEWQYDRQLSSLFLDGLEK
                     AAINGVTFKDSYVLITGAGKGSIGAEVLQGLLQGGAKVIVTTSRFSKPVTDFYQAVYA
                     KYGAKNSTLVVVPFNQGSKQDVQQLVEYIYDDEKNGGLGWDLDAIIPFAAIPENGIEL
                     ENIDSKSEFAHRIMMTNLMRIMGQVKIQKSERGVETRPAQVILPMSPNHGTFGGDGLY
                     SESKLSLETLFNRWHSESWGNQMTVCGAIIGWTRGTGLMSANNIIAEGIEKAGVRTFS
                     QKEMAFNLLGLLTPEVVELCQKSPVMADLNGSLQFLPSLKEFTNKLRSDLIETSEIRK
                     AVSIETALEHKVVNGDNADAAHAKVEVQPKANIQLNFPALKPYEEVKKFSTQELEGLL
                     DLERVIVVTGFSEVSPWGSARTRWEMEAYGQFSLEGCVEMAWIMGYIKYHNGNLKGRP
                     YTGWVDAKTNEPVDDKDIKSKYESNILEHAGIRLIEPELFRGYNPEKKQMIQEVVVEE
                     DLEPFETSKETAEQFKYEHGDKVDIFEIPESGEYTVKILKGATLYIPKALKFDRLVAG
                     QIPTGWDARTYGVPEDIISQVDPITLFVLVSTVEAFISSGITDPYEMYKYVHVSEVGN
                     CSGSGMGGVSALRGMFKDRYKDQPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVG
                     ACATAVESVDIGVETILSGKAKICVVGGYDDFQEEGSYEFGNMKATSDTLDEFEHGRT
                     PSEMSRPTTTTRNGFMEAQGCGLQVIMNADLALKMGVPIYGIVGLTATATDKIGRSVP
                     APGKGILTTAREHHGELKFPSPLLNIKYRKRQLVNRQKQIKEWVENELELLGIESEGV
                     PTELRQVFYAERTEEIKREASKQLKSAQAQWGNEFYKSDPRIAPIRGALATYGLTVDD
                     LGVASFHGTSTKANDKNESATINEMMKHLGRSEGNPVMGVFQKYLTGHPKGAAGAWML
                     NGAIQILNSGIVPGNRNADNVDKLLEQYEYVLYPSMSLKTNGIKAVSVTSFGFGQKGA
                     QAIVIHPDYLYAAIDQATYEDYKLKVVSREKAAYKFFHNGMIHNKLFVGKDNPPYADE
                     LEQSVYLDPLARVSENKQSGSLEYEASALQQKDSYITANNRKTATIVSQLTQQTAAGS
                     KQGSGVGVDVELISSVNADSETFVERNFTESEIAYCKAQPSAQSSFAGTWSAKEAVFK
                     SLGVKSQGGGASLRDIEIVRDSTGGPQVTLHGEAKKAATQAGVTGVKVSISHDDFQSV
                     AVAISEKN"
     gene            complement(<611472..>612434)
                     /locus_tag="ZYRO0E07788g"
                     /db_xref="GeneID:8204818"
     mRNA            complement(<611472..>612434)
                     /locus_tag="ZYRO0E07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499218.1"
                     /db_xref="GeneID:8204818"
     CDS             complement(611472..612434)
                     /locus_tag="ZYRO0E07788g"
                     /note="similar to uniprot|P32867 Saccharomyces cerevisiae
                     YPL232W SSO1 encode syntaxin homolog act in late stages of
                     secretion post-Golgi t-SNARE"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499263.1"
                     /db_xref="GeneID:8204818"
                     /db_xref="GOA:C5E4P7"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C5E4P7"
                     /translation="MNYNPYESGVDDYEMRNTENVFDDSAAASTPYGPTGGEPNLNSS
                     PVDVGGAGAGAGVGENDFVDFMGKINQINSGLDTYEQLINNVDSYHKRLLAEVNEDQE
                     MQLRRMLDDIVAQAGTLQYQLRNEIKDVQREGLRDGSKQAQAENCRQRFLKAIQDYRI
                     IESNYKEENKEQAMRQYMVVQPDATPDEVENAVSDVGGQQIFSQALLNANRRGEAKTA
                     LAEVQARHQELLKLEKTMAELTQLFNDMEEMVVEQQEQVDNIDKNVDDAQEDVEQGVG
                     HTNKAVTSARRARRNKLRCWIIVFVIIIIILVASIVPAVVATQT"
     gene            complement(<613103..>613687)
                     /locus_tag="ZYRO0E07810g"
                     /db_xref="GeneID:8204819"
     mRNA            complement(<613103..>613687)
                     /locus_tag="ZYRO0E07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499219.1"
                     /db_xref="GeneID:8204819"
     CDS             complement(613103..613687)
                     /locus_tag="ZYRO0E07810g"
                     /note="similar to uniprot|Q6B152 Saccharomyces cerevisiae
                     YPL233W NSL1 Essential component of the MIND kinetochore
                     complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins
                     kinetochore subunits contacting DNA to those contacting
                     microtubules required for accurate chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499264.1"
                     /db_xref="GeneID:8204819"
                     /db_xref="InterPro:IPR013950"
                     /db_xref="UniProtKB/TrEMBL:C5E4P8"
                     /translation="MSKIQVSSDQLRSIYGQLYDVLQEKASLHLPELDDPVSREVNLQ
                     LQLFLTNVMEMAFNSLKIDGPPANDILNSRCEPFDLELNERVRKSYETWEEETVKVAN
                     LKRAAQETINNVWMENQMDYLRELDSKIDAEPATDTSDNASYALEQYPIDTQLYTDSL
                     ESLSKTQSKLPHMRNQLQKLQLLLQHLQDEGSVG"
     gene            <613837..>614316
                     /locus_tag="ZYRO0E07832g"
                     /db_xref="GeneID:8204820"
     mRNA            <613837..>614316
                     /locus_tag="ZYRO0E07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499220.1"
                     /db_xref="GeneID:8204820"
     CDS             613837..614316
                     /locus_tag="ZYRO0E07832g"
                     /note="similar to uniprot|P32842 Saccharomyces cerevisiae
                     YPL234C TFP3 vacuolar ATPase V0 domain subunit c'"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499265.1"
                     /db_xref="GeneID:8204820"
                     /db_xref="GOA:C5E4P9"
                     /db_xref="InterPro:IPR000245"
                     /db_xref="InterPro:IPR002379"
                     /db_xref="InterPro:IPR011555"
                     /db_xref="UniProtKB/TrEMBL:C5E4P9"
                     /translation="MSEYAPLYSPFLGFAGCASAMVLSCLGAAIGTSKSGIGISGIGT
                     FKPELIMKSLIPVVMSGILAIYGLVVAVLIAGGLSPGEEYSLFNGVLHLSAGLCVGFA
                     CLSSGYAIGIVGDVGVRKSMHQPRLFVGIILILIFSEVLGLYGMIVALILNTRGSGK"
     gene            complement(<614363..>615745)
                     /locus_tag="ZYRO0E07854g"
                     /db_xref="GeneID:8204821"
     mRNA            complement(<614363..>615745)
                     /locus_tag="ZYRO0E07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499221.1"
                     /db_xref="GeneID:8204821"
     CDS             complement(614363..615745)
                     /locus_tag="ZYRO0E07854g"
                     /note="highly similar to uniprot|Q12464 Saccharomyces
                     cerevisiae YPL235W RVB2 RUVB-like protein TIP49b
                     Homologue"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499266.1"
                     /db_xref="GeneID:8204821"
                     /db_xref="GOA:C5E4Q0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010339"
                     /db_xref="InterPro:IPR027238"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q0"
                     /translation="MSIQTSNPDESLKSLSLIAAHSHITGLGLDEHLQPRESSEGMVG
                     QLQARRAAGIILKMVQNGTIAGRAILVAGPPSTGKTAMAMGLSQSLGKDVPFTAIAGS
                     EIFSLELSKTEVLTQAFRKCIGVKIKEETELIEGEVVEIQIDRSITGGHKQGKLTIKT
                     TDMETIYELGSKMIDGLTKEKVLAGDVISIDKASGKISKLGRSFARSRDYDAMGADTR
                     FVQCPEGELQKRKTVVHTVSLHEIDVINSRSQGFLALFTGDTGEIRSEVREQINTKVA
                     EWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIIMMATNKGISKTRGTN
                     YKSPHGLPVDLLDRSIIITTKNYNEQDIKIILSIRAQEEEVELTNEALDLLTKIGGET
                     SLRYSSNLISVSQQLSLKRKATQVDVNDVQRSYLLFLDASRSVKYVQENNSQYIDDQG
                     NVGDPMDTTE"
     gene            <616134..>617243
                     /locus_tag="ZYRO0E07876g"
                     /db_xref="GeneID:8204822"
     mRNA            <616134..>617243
                     /locus_tag="ZYRO0E07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499222.1"
                     /db_xref="GeneID:8204822"
     CDS             616134..617243
                     /locus_tag="ZYRO0E07876g"
                     /note="similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
                     YPL236C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499267.1"
                     /db_xref="GeneID:8204822"
                     /db_xref="GOA:C5E4Q1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q1"
                     /translation="MDSFRQLLKFICGTCCCCCDYSESYLSINGRRYSIKKLLGESNF
                     SFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGAMKEVDNYKRFQSPYIIH
                     LVDSQVAQQRDGSKTVYILLPYFPLGSLQDSTSRNLLNGTFISEAECIRIVIGIARGL
                     RCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELDILSSANTINSNFYAHR
                     DIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVSDHCTVAYTAPELLH
                     ITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIGTGNFSFPSQDRY
                     SEGLLKLITKCLQVNPAARPDINELLTLLQELQES"
     gene            <617523..>618068
                     /locus_tag="ZYRO0E07898g"
                     /db_xref="GeneID:8204823"
     mRNA            <617523..>618068
                     /locus_tag="ZYRO0E07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499223.1"
                     /db_xref="GeneID:8204823"
     CDS             617523..618068
                     /locus_tag="ZYRO0E07898g"
                     /note="similar to gnl|GLV|KLLA0D08954g Kluyveromyces
                     lactis KLLA0D08954g and weakly similar to YMR184W
                     uniprot|Q03233 Saccharomyces cerevisiae YMR184W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499268.1"
                     /db_xref="GeneID:8204823"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q2"
                     /translation="MTVAKSYQNCAETEVPGYNDCPSFLFMPQRPSARRKQHRVISDH
                     LSANNSPSTHSTSTTDTTTAPPPILHRKPHEIAKNQEKTSNASLNKEEILHRVNELYG
                     LKSKLVTNEFEFYRRKVDNNLVSSLENDSTRAVMTRFFLEANTDRTKASNTLRAWMSS
                     DVSVLNWCPAFLKIFEHAEHA"
     gene            complement(<618222..>619082)
                     /locus_tag="ZYRO0E07920g"
                     /db_xref="GeneID:8204824"
     mRNA            complement(<618222..>619082)
                     /locus_tag="ZYRO0E07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499224.1"
                     /db_xref="GeneID:8204824"
     CDS             complement(618222..619082)
                     /locus_tag="ZYRO0E07920g"
                     /note="similar to uniprot|P09064 Saccharomyces cerevisiae
                     YPL237W SUI3 Beta subunit of the translation initiation
                     factor eIF2 involved in the identification of the start
                     codon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499269.1"
                     /db_xref="GeneID:8204824"
                     /db_xref="GOA:C5E4Q3"
                     /db_xref="InterPro:IPR002735"
                     /db_xref="InterPro:IPR016189"
                     /db_xref="InterPro:IPR016190"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q3"
                     /translation="MSSDLATDLGFDPSLKKKKKSKKVAPENLEVEDKETEKSSSNST
                     GEDDLFSGLKKKKKKSKSPAAEPSESVDEISEALGELKLKKKKKSKEAELDDFEKQLA
                     SAGVNVDGGNTQESTPVLESSVQQDVGLSYPGLLSRFFDILRTNNPELAGDKSGPKFR
                     IPPPVCLRDGKKTIFSNIQDISEKLQRSPEHLIQYLFAELGTSGSVDGQKRLVIKGKF
                     QPKQMENVLRRYILEYVTCKTCKSINTELKKEQSNRLFFLVCKSCGSTRSVSSIKTGF
                     QAHIGRRKRM"
     gene            complement(<619330..>619959)
                     /locus_tag="ZYRO0E07942g"
                     /db_xref="GeneID:8204825"
     mRNA            complement(<619330..>619959)
                     /locus_tag="ZYRO0E07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499225.1"
                     /db_xref="GeneID:8204825"
     CDS             complement(619330..619959)
                     /locus_tag="ZYRO0E07942g"
                     /note="similar to uniprot|P46683 Saccharomyces cerevisiae
                     YPL239W YAR1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499270.1"
                     /db_xref="GeneID:8204825"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q4"
                     /translation="MSLHTDPLEQEDQDAIVLDARSGDLESLKEIFSTLIHPKLITTC
                     QDAETHVTPLHMAAANGHVEVVKYIIQLVKENAPEQLSSFVNRQNDTGNTALHWASLN
                     GNLEVVKILCEEFESDPFIKNTFGHDCFFEAENNGREELEDFFLKKYDIAPANKESED
                     GKVGIKEGTEIEQVTREAELAAQQKQQEKDNETETLAQDTKKLDIRDST"
     gene            <620287..>622965
                     /locus_tag="ZYRO0E07964g"
                     /db_xref="GeneID:8204826"
     mRNA            <620287..>622965
                     /locus_tag="ZYRO0E07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499226.1"
                     /db_xref="GeneID:8204826"
     CDS             620287..622965
                     /locus_tag="ZYRO0E07964g"
                     /note="similar to uniprot|Q12751 Saccharomyces cerevisiae
                     YMR185W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499271.1"
                     /db_xref="GeneID:8204826"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR019451"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q5"
                     /translation="MSTVSDILKKPQFTRSTPLDEFFKKFDSQVLSKKGDLKNDNTNL
                     VTLLLNHFQELHDLVIDEQVRLQTENSNMLPISLHDMRYVEELIQLIVAHGIMANIPP
                     SLQPASQKSKDIPRSHNLSTLKLVVEKISNILVKEMKPNDYIRSIVLKGPLYTYTYLG
                     ILTLCTEEPNKAHYEEVLRQMENVQQTYELFAMYNFLVQELGNAVAKAKILSLLSTLA
                     VRRENGVLSLIDFVVGAREDEQLDIEKMNRVTQIIVAKPKTINSVEYFSRLFPQIFDG
                     LSMVNRPIVVNCLNSVVTALFFKNSRIINDFLFRRIYQVIFNEPLQEHSAKELNDVVN
                     VIISLTKNSSNELISALVQSVDKRQFYLNLWIYVLFLKKYQKINPLGKQHGPYYEVIL
                     TILKTFVCLFKDSEALIYLSMNLLNYQHEQWGYQIDFETQLAYITLRDNLPDLNLKQE
                     KGDNPLTKANELFAGIDESIDLFIQLLKMVNNENMVKDVFLAVLNRWVKTEQHNDNSL
                     KEVESNALVLLDLKALEKLHREFSTDILKKPQDILKLIDELIDFTSSEPLMQQDSDDK
                     DSDDEEEREAQQPDSLSLIIQILESVLSMPPKQLADAKPLLQSIDNKLQKRGNSALHK
                     DLLRMLEYKPGQTSPDASNDANDYEALEEALNNLNDSLAPMQVLGLTQLNKLVQKHSK
                     VISAARATQLHLQYLKNQDPYVYLNAIKGLSSLCQYDKTCIDTLVDCYSSIRKLDDAL
                     KIGEVFIQYIQQENQLFQGIQANKIIDACITNVRRRGEIDDRLRMSAMSILGISAQVN
                     ARGIQDRIGDMLDCSFGVLQMETKTKSGFVVRRAALHLIHDLMYNSDENAGVSLFPPQ
                     YDSSRLKTLLDYTREKDDDQLVSEQAAQLLSLLSIS"
     gene            <623313..>625451
                     /locus_tag="ZYRO0E07986g"
                     /db_xref="GeneID:8204827"
     mRNA            <623313..>625451
                     /locus_tag="ZYRO0E07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499227.1"
                     /db_xref="GeneID:8204827"
     CDS             623313..625451
                     /locus_tag="ZYRO0E07986g"
                     /note="highly similar to uniprot|P15108 Saccharomyces
                     cerevisiae YMR186W HSC82 Cytoplasmic chaperone of the
                     Hsp90 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499272.1"
                     /db_xref="GeneID:8204827"
                     /db_xref="GOA:C5E4Q6"
                     /db_xref="InterPro:IPR001404"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR019805"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020575"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q6"
                     /translation="MSSETFEFQAEITQLMSLIINTVYSNKEIFLRELISNSSDALDK
                     IRYQALSDAKQLETEPELFIRITPRPEEKVLEIRDSGIGMTKAELINNLGTIAKSGTK
                     AFMEALSAGADVSMIGQFGVGFYSLFLVADQVQVISKHNDDEQYIWQSNAGGSFTVSL
                     DTDNERLGRGTVLRLFLKDDQLEYLEEKRIKEVVKRHSEFVSYPIQLMVTKEVEKDVP
                     LTEEEKKEEKKDEEKKEGEDDKKPKLEEVDEEEEKKQEETKKIKEEVKELEELNKTKP
                     LWTRNPSEISQEEYNAFYKSISNDWEDPLYVKHFSVEGQLEFKAILFIPKRAPFDLFE
                     NKKKKHNIKLYVRRVFITDEAEDLIPEWMGFVKGVVDSEDLPLNLSREMLQQNKIMKV
                     IRKNIVKKLIEAFNEIAEDSEQFDKFYSAFGKNIKLGIHEDTQNRPALAKLLRFNSTK
                     SVDEQTSLTDYVTRMPEHQKNVYYITGESMKAVEKSPFLDALKAKNFEVLFLVDPIDE
                     YAFTQMKEFEGKTLVDVTKDFELEESEEEKKKREEEMKQYEGLTAALKQILGEQVEKV
                     VVSEKLIDAPAAIRTGQFGWSANMERIMKAQALRDSSMSSYMSSKKIFEISPRSPITK
                     ELKKRVEEGGANDRIVKDLTNMLYETALLTSGFSLEDPSSFAKRINRLISLGLNIDEE
                     EQEEEAAPEAAASTEAPSEVPADTEMEEVD"
     gene            <625615..>626355
                     /locus_tag="ZYRO0E08008g"
                     /db_xref="GeneID:8204828"
     mRNA            <625615..>626355
                     /locus_tag="ZYRO0E08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499228.1"
                     /db_xref="GeneID:8204828"
     CDS             625615..626355
                     /locus_tag="ZYRO0E08008g"
                     /note="weakly similar to uniprot|P46670 Saccharomyces
                     cerevisiae YPL241C CIN2 Tubulin folding factor C
                     (putative) involved in beta-tubulin (Tub2p) folding
                     isolated as mutant with increased chromosome loss and
                     sensitivity to benomyl"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499273.1"
                     /db_xref="GeneID:8204828"
                     /db_xref="InterPro:IPR012945"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q7"
                     /translation="MSVESFLKSKTGLEERLANHESTETLRGNALELQNQLNQISKEL
                     APHDLQKYSKELDELLKNINARVPPQVVKLQFKKKPKPRLFQNRSKKVTSNERITQSQ
                     MVSNQDFNIVQATATYENLQKCTIIGTHFINDTGSLTFKDLQSCTINLYEATFREGSI
                     IISNCNDCSIYIHTGRETQLRLHDLKGCKLMIRPSQAPQRIVMERCRECVFHEVCEPW
                     ITIQEFDNLALTQEEQRNYTFVSLEDWW"
     gene            <626606..>631450
                     /locus_tag="ZYRO0E08030g"
                     /db_xref="GeneID:8204829"
     mRNA            <626606..>631450
                     /locus_tag="ZYRO0E08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499229.1"
                     /db_xref="GeneID:8204829"
     CDS             626606..631450
                     /locus_tag="ZYRO0E08030g"
                     /note="similar to uniprot|Q12280 Saccharomyces cerevisiae
                     YPL242C IQG1 Essential protein required for determination
                     of budding pattern promotes localization of axial markers
                     Bud4p and Cdc12p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499274.1"
                     /db_xref="GeneID:8204829"
                     /db_xref="GOA:C5E4Q8"
                     /db_xref="InterPro:IPR000048"
                     /db_xref="InterPro:IPR000593"
                     /db_xref="InterPro:IPR001715"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q8"
                     /translation="MTSSVGSPGKGSVLDRYVKNLANDSSLQPPPQLRTTSQSRLNSF
                     HNLKGASRSKPNVDNQDKENVGNAKNGSLNEKNPFMAAAGGLKSSKSPNQLKFGGNKV
                     NQGINGGGGSRSSSNVNTSDLTREEKGYYEFLCRVAEIKQWIERVIGEDLPSEVDLST
                     GDCLRNGVYLATVTQKINPDLAPSVFPAGNRLQFKHTQNINAFFSLVDHVGLPNSFRF
                     ELQDLYNKQDLPQVFETLYILITMINKKWPTKTPIIENLSGKVNFSKDDIRKCKKTWP
                     RIRDFKSLNVNSVKSTVGKKATAPTGGGLIQDFSTVETSEPSSEPETPKPKNRLADAK
                     SQPTLKPEPEDEPSFMMKSSTPAKPEEQEELEEPADSESVKITTPEPEPKQLKESDEP
                     LKFEHSVSTPVRRTRQKLESIKLSPPSSETGSLYFSPTTDRRDYSSTSPIRSQSFRPT
                     ESDHLRSPYLRPADSDIVSRPPHLEYSPLKSTSFSYYSPTISRYLTYDTDFYVRRSQA
                     RERGIDFYQTYKYEPVSYSPQRKKRMTEMEFLDKVIHIQSICRGANARFDMRIQSRLL
                     KLFEKEVLRFQSIIRGNKRRVGIPQRFSINLTDDQEVSLTKLQALFRSSRIKSRNDRL
                     KLKIYRKTAQIEALQNIFRGSRLRKRVNQELYDRNVSDAPLRKLQSWIQGKRCRNHVK
                     GTSRSLSSKAIAFQKFQGSCRGLLYRRHFLFAHHFSDKALSQLKDFQERIRGANVRNS
                     VYDLIYDAEAKNRVFKRLSGMLRGRKLRESLLDVLYDDDPDFANVRPLQGIVRGVLVR
                     YTLDLVDDIIEYYHLDQFQAHVKGFLLRSKFDEREKYFKRNERSVIIIQSKIRTFIQR
                     ESFFDLLHHPNPHIKHVKKYAYLLNNTGTIEENQDKLEACQAQLDSENLKKETFEKNI
                     RQQLDTGNVLEKFGLTSGLTKELSGMDIPLCRYPTYEKLFFLLQVDPSYWKILYTFEP
                     VFVEKNMYVSFSTVNQRMGRREKIYFIRVLADILQQEVIEARSMQQYLTKPDRFWNRM
                     LRTFLRREYPEVFSIFQPLLKYINNPRVNFEGDPLVIYKDIHHTEPLSRSEAIEDEKT
                     KIKFIENLRNLWHSVEMTAEIFTRKLKEIPLEVRFIASKMFTCAADKNTDEIGTLRSI
                     SIVLVNSFIFEYMENRSLYGFDADESPNLDRKLHSFMRAIEIVFGLGKFNGYYDPLNQ
                     YADEINIQMRELLFNIILDPVFEQEADTLVYRDMVTASPQLEILTEKVLVISMKFREY
                     LLEFPDDDVIHEILEKSPTSRDFKKSGRIVLDLTASAYRFLVCDDRMRKVYDQVKRSM
                     VYMMQIEDVQTNLSDLVVSTVLPQDEPNFIKLMCANPGIKNDPMIKALQSPKYFNMKS
                     STLKKLKELERSGIIKTNSNQLQNFLNDIANTIKNPHYAIDYVTEELHLTQETLKGVA
                     KINKQFEKTLTNLRTCVNQAIRDMLKSRDFNPGHRSALDNLKGAYKKVQTRKSDKIEG
                     TMKFKWTTRQLYEKGVIKSIESENLAEQKVKVFGSSGPKFPDINFKISTSDGAVYGIQ
                     LLDRRKGFEKNLEGVDSFSFRDLLGTQVGSKVETWQLLNKKVSINTAQLLKLIIDVFL
                     KKGQ"
     gene            complement(<631600..>632907)
                     /locus_tag="ZYRO0E08052g"
                     /db_xref="GeneID:8204830"
     mRNA            complement(<631600..>632907)
                     /locus_tag="ZYRO0E08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499230.1"
                     /db_xref="GeneID:8204830"
     CDS             complement(631600..632907)
                     /locus_tag="ZYRO0E08052g"
                     /note="similar to uniprot|Q03236 Saccharomyces cerevisiae
                     YMR187C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499275.1"
                     /db_xref="GeneID:8204830"
                     /db_xref="UniProtKB/TrEMBL:C5E4Q9"
                     /translation="MFKNPFKQDCTCWICLEESNFDSAWIRHECGCNLQVHKLCYLHW
                     LYSINRNYISRNLVTKNFNLVTEDDLKRTICYLVDGHRNLHREVSLSEFLNTLPFIRS
                     KSNEPMSSSVGIMSLLGINYTISFRIVRSPMALPVEFADCPQCKNHVVNQQITFTSRS
                     FFLAIFYWTKSVIRNTTIALTLVLSTLNIGKWWFKIGLWQLRCIFPENVLRVILDIST
                     TRALNVYGETMNGLVSIPQMTRFLIFGFPVCLMGVRSSYPTLNRFRWLYTLVLSVRAG
                     HYDPKATRLLSRTLTTCNICMLLNSAVITPFLSRYYEYLVKAVTPYFCPIDKSLDVFP
                     SQGYGNVIIKTSWYDVLFESIVWPAFGSLVGGKLFDAVTWIQREFGLNWTPSCSPNDC
                     RMVFNFVGCGLTAVARQLLNMWASHMRAKELKQLQESIEENTQ"
     gene            complement(<633136..>634914)
                     /locus_tag="ZYRO0E08074g"
                     /db_xref="GeneID:8204831"
     mRNA            complement(<633136..>634914)
                     /locus_tag="ZYRO0E08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499231.1"
                     /db_xref="GeneID:8204831"
     CDS             complement(633136..634914)
                     /locus_tag="ZYRO0E08074g"
                     /note="similar to uniprot|P38687 Saccharomyces cerevisiae
                     YPL243W SRP68 Component of the signal recognition particle
                     (SRP) ribonucleoprotein (RNP) complex that functions in
                     protein targeting to the endoplasmic reticulum (ER)
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499276.1"
                     /db_xref="GeneID:8204831"
                     /db_xref="GOA:C5E4R0"
                     /db_xref="InterPro:IPR026258"
                     /db_xref="UniProtKB/TrEMBL:C5E4R0"
                     /translation="MGVYSPLLATYGVRVDQLLETVQDFVRYHDKLNKKLQKLRHRCQ
                     LTTRDTKKYRTKEKYSKLSSDDYDENSKLYGVVVLLHAERDLALAEVLKLRARQRGKM
                     KKSERKVVSTRLKRAMQTSEKLVALTTNESQWITRVQYLVYEKLARAEYLTHGKQQRH
                     KDSKKISKELALSFAALKYLEQASVITDSVVEFLHAKYEYTLKQHADGAFSSTELHNF
                     VVEKVEEASQNGDEMVKLLVENGYKPQKQASEAGTSFKEIQWRAFTAKVYDPQVEELI
                     AESKSVTVKSAPDYDTKLLKWQQALEIQESRIASQDEDEEDEADNQENDQILLAYIKY
                     NALFTSVLRDNYLFGQLWQQWTKLGTAMASRLTKSKEIERIVKNLQKYLQDIMELPGV
                     YRDDELTEQLELSKLYFQLTYTSGCLGGLYQLKGRYLESLALHVDAHQKLEERLTEMG
                     NFQDILIPLEVLSHKKIESLQQLIKAGWKSVVSLAEYEKHLKVQGQAAHQPTLIEKLD
                     TGRIIPSDVKLSNIFPLRPKLRPVPSKPTLFDLAFNYMDYAGEGSESASSWTTQRSEP
                     APASNNGDDNNSNTNKKRGFLGLFGR"
     gene            <635266..>636264
                     /locus_tag="ZYRO0E08096g"
                     /db_xref="GeneID:8204832"
     mRNA            <635266..>636264
                     /locus_tag="ZYRO0E08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499232.1"
                     /db_xref="GeneID:8204832"
     CDS             635266..636264
                     /locus_tag="ZYRO0E08096g"
                     /note="similar to uniprot|Q12520 Saccharomyces cerevisiae
                     YPL244C HUT1 Protein with a role in UDP-galactose
                     transport to the Golgi lumen"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499277.1"
                     /db_xref="GeneID:8204832"
                     /db_xref="GOA:C5E4R1"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:C5E4R1"
                     /translation="MSGGVLALFICAAGIYSSFLTWALVQEPLTTKFWPNSQHQFQAP
                     SVVAAVQAAVAMIVGLGYLKWKKCGYGPVNFVKDHGKSLAMISLSQSCSGPLATYSLQ
                     YVDFLTYMLAKSCKMLPVLLIHLLLYRTSISKEKRLVAVLVSLGVAVFSFGGSGGKQK
                     TNGDDAFSLHGYALLVVSLFLDGVTNASQDKMLKANSRKDASKPITGAHMMFALNMFI
                     VVWNLGYLFTFDRLQVDMAKFMLSLDGEIWKYLLTYAICGAVGQCFIFFTLEHYGSLA
                     LITITVTRKMISMVLSIFVFRKKVMPLQWIGIGIVFGGITWEAISKRRQAARIKKD"
     gene            complement(<636314..>637603)
                     /locus_tag="ZYRO0E08118g"
                     /db_xref="GeneID:8204833"
     mRNA            complement(<636314..>637603)
                     /locus_tag="ZYRO0E08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499233.1"
                     /db_xref="GeneID:8204833"
     CDS             complement(636314..637603)
                     /locus_tag="ZYRO0E08118g"
                     /note="similar to uniprot|Q12179 Saccharomyces cerevisiae
                     YPL245W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499278.1"
                     /db_xref="GeneID:8204833"
                     /db_xref="InterPro:IPR018647"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4R2"
                     /translation="MTQGFQTVKRARKAGTAVAKSAAADRLSNVKLSTEQANLKLKIM
                     EFTRDHLKSYKKGDKPAMFVIQGDAGTGKSVILNSLFNEIQKASTTSGDALLGTSNYL
                     IVNHPEMLKLYLNICKKFPYISRSCLERPTSLINKLQKDHSLADVVIVDEAHLLATSK
                     DAFKRFYGQNHLQELMELAKVLIIVYDEKQALRMGCFWDEGSGNGANLQTFYDQVPDE
                     RRDWYRLKQQFRVAAPPDVLQWIEDISVKGIIPKYPQKSEQFDFKIWDDCGAMFEALK
                     EHDTNLGQCRMLATYDFPYRLDGKDYYVTCGDNFKVRWDRYTPKSVLPWSERPDTIDE
                     VGSVYTIQGFDLKYAGVILGRSIGYDAENDCIKLKPEMYDDHAGFTKKKNIKDAAMVE
                     KKIIMNSLNVLLTRGVNGLYVYAWDPELRQRLAESRK"
     gene            <637763..>638572
                     /locus_tag="ZYRO0E08140g"
                     /db_xref="GeneID:8204834"
     mRNA            <637763..>638572
                     /locus_tag="ZYRO0E08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499234.1"
                     /db_xref="GeneID:8204834"
     CDS             637763..638572
                     /locus_tag="ZYRO0E08140g"
                     /note="similar to uniprot|Q12270 Saccharomyces cerevisiae
                     YPL246C RBD2 Possible rhomboid protease, has similarity to
                     eukaryotic rhomboid proteases including Pcp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499279.1"
                     /db_xref="GeneID:8204834"
                     /db_xref="GOA:C5E4R3"
                     /db_xref="InterPro:IPR022764"
                     /db_xref="UniProtKB/TrEMBL:C5E4R3"
                     /translation="MFDWKSIVKPNGKPFCALTAGLAVFLTFVFLLEQVISLEDRMVL
                     SPKNIFNLGRLSNYPLIHLSWLHLFFNLFSLMGPLNLFESQHGTVYTGVALNLTAIFA
                     GLLYCVVGKLLYPEESVAGASGWFFTLIGYFSWKASLANPRTQVLQTPYHFPTALSPL
                     ILLLLITLIIPNASFWGHLSGLTIGYLIGANEKAFSKLSPPGWLIKKIETKLDAYIEK
                     IPHFVKYYREVEVEDTDRTDYSWLFEPNVSLPLHNDPPQQTRGNGRVLGTA"
     gene            complement(<638625..>639317)
                     /locus_tag="ZYRO0E08162g"
                     /db_xref="GeneID:8204835"
     mRNA            complement(<638625..>639317)
                     /locus_tag="ZYRO0E08162g"
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /transcript_id="XM_002499235.1"
                     /db_xref="GeneID:8204835"
     CDS             complement(638625..639317)
                     /locus_tag="ZYRO0E08162g"
                     /note="highly similar to uniprot|Q03246 Saccharomyces
                     cerevisiae YMR188C MRPS17 Mitochondrial ribosomal protein
                     of the small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS17"
                     /protein_id="XP_002499280.1"
                     /db_xref="GeneID:8204835"
                     /db_xref="GOA:C5E4R4"
                     /db_xref="InterPro:IPR000266"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5E4R4"
                     /translation="MARQNFLGLVVSQGRMQKTVKVRVETKVFNRRINKELFRRKDYL
                     VHDEGQISREGDLVRIEATRPLSKRKFFSVAEIIKNKGQQFALYESQAKTQVAQEETQ
                     KTQDFLQRRSERKDSGGSVLLRDIRVIQDALSKGESPQELEEIKARYGVQNFTPETVR
                     QLLQLDVTKFEDQLKAQTSRIDSVQLRVQQLLDDEASANQFLKSHGVEDPVALKKNIK
                     KNILRKHVLQEL"
     gene            <639823..>641343
                     /locus_tag="ZYRO0E08184g"
                     /db_xref="GeneID:8204836"
     mRNA            <639823..>641343
                     /locus_tag="ZYRO0E08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499236.1"
                     /db_xref="GeneID:8204836"
     CDS             639823..641343
                     /locus_tag="ZYRO0E08184g"
                     /note="similar to uniprot|Q12523 Saccharomyces cerevisiae
                     YPL247C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499281.1"
                     /db_xref="GeneID:8204836"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E4R5"
                     /translation="MDPFRGSKRSSISFGNFQRQPNSYATGAYDGGVGLMQNPNLGSS
                     TSNSGGTGINTGNNGASANMTSRSPMYSPLQYSQFDYNQPAYSPGYSPFHPLRSPGPP
                     VLTKPVCEYEAKYPLFGLDWSNEDFVCLGSYRDGSTNSLHILHSGDLLSWDRVAECNV
                     TFPVSTIQWQPSMTHPRRFATCSDSLRIWSFCEEERNLQEQINLSLCKYDKQQQGASR
                     VNAAAGGSGSIRTNPQQQQGLIGELPPITSFHWNPVDPNLLISSSIDTTCIVWDLQSS
                     NYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPA
                     TLQPTTAAGSSSAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVL
                     VLEGHSAAVNQMRWHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVDSQQQ
                     NNPVAKWNSKNVLRTLDTPSMFYSNGGQEVNNIVWRPQGDDWFGSVAGNVFQNVRL"
     gene            <641673..>644723
                     /locus_tag="ZYRO0E08206g"
                     /db_xref="GeneID:8204837"
     mRNA            <641673..>644723
                     /locus_tag="ZYRO0E08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499237.1"
                     /db_xref="GeneID:8204837"
     CDS             641673..644723
                     /locus_tag="ZYRO0E08206g"
                     /note="highly similar to uniprot|P49095 Saccharomyces
                     cerevisiae YMR189W GCV2 P subunit of the mitochondrial
                     glycine decarboxylase complex required for the catabolism
                     of glycine to 5 10-methylene-THF expression is regulated
                     by levels of levels of 5 10-methylene-THF in the
                     cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499282.1"
                     /db_xref="GeneID:8204837"
                     /db_xref="GOA:C5E4R6"
                     /db_xref="InterPro:IPR003437"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020580"
                     /db_xref="InterPro:IPR020581"
                     /db_xref="UniProtKB/TrEMBL:C5E4R6"
                     /translation="MLKNQVTILGSTARSLGRSYRSSLAVKRWLQTNVTSSNYAKVYE
                     AKPSDLERPLDEFPRRHLGPSPKDLEKMLKTVGFEDLNSFVESVVPQNVLKKRALELE
                     APERGYSEMEMIEHLKELANKNRYEVKNFIGKGYYGTILPPVIMRNVLESPEWYTSYT
                     PYQPEISQGRLESLLNFQTVISDLTGLPVSNASLLDEGTAAAEAMLLSYNFHRAKRPK
                     FVIDSKSHPQTKSVVYTRALPLGIEVSEIDTRNVENSLKVLDDKAVCGCLLQYPATDG
                     SIVAPETLTQFAEVLHQHKSLLSVASDPLALTLLKAPGHLGADIVLGSSQRFGVPLGY
                     GGPHAAFFAVQEHLNRRIPGRIVGVSKDRLGNVALRLALQTREQHIKRDKATSNICTA
                     QALLANVAANYCVYHGPEGLKNIAKRIYGMTSILANQINTSSPHDVVNDTWFDTLTIE
                     INESTTASAVLEKALNEYNINLFAPNEKTVSLSLDETTTLKDLQNLIQLFTCSADLPS
                     EVPQFPATLARTDDILTHEVFHLYHSETAMLRYLHRLQSRDLSLANSMIPLGSCTMKL
                     NSTVEMLPITWPEFANIHPFQPTDQVQGYAQLMSSLENALCSITGFDAVSLQPNSGAS
                     GEYCGLRIIRAFLEDTGELHRRVCLIPTSAHGTNPASAAMCGLKVVSFNCLPDGSLDL
                     EDLKKKIDKHAHELAAIMITYPSTYGLYEEGLTRAIEMVHEAGGQVYMDGANMNAQVG
                     LTSPGDLGADVCHLNLHKTFAIPHGGGGPAGAPICLKSHLAPYLPRHPVVDMITYGKD
                     DIKSSKAIDSVSSGPYGNALVLPISYAYIKMMGQQGLPYASAIAMLNANYMRARLQNH
                     YEILFAKNHCAHEFIIDLREFKAQGVEAIDIAKRLQDYGFHAPTLAFPVPHTLMIEPT
                     ESENLEELDRFVDAMISIRSEIDSYLQGKPEGQMLKYAPHSLEDLILANDWDTRGYTR
                     QQAAYPLPQLKGSKFWPVVARLDDTYGDMHLMCTCPSVEEIAEN"
     gene            <645342..>647204
                     /locus_tag="ZYRO0E08228g"
                     /db_xref="GeneID:8204838"
     mRNA            <645342..>647204
                     /locus_tag="ZYRO0E08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499238.1"
                     /db_xref="GeneID:8204838"
     CDS             645342..647204
                     /locus_tag="ZYRO0E08228g"
                     /note="similar to uniprot|P39709 Saccharomyces cerevisiae
                     YAL067C SEO1 Putative permease member of the allantoate
                     transporter subfamily of the major facilitator superfamily
                     mutation confers resistance to ethionine sulfoxide"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499283.1"
                     /db_xref="GeneID:8204838"
                     /db_xref="GOA:C5E4R7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5E4R7"
                     /translation="MNTPTTSLMKEIFVDPWRRLKFGIIPVKRVLEEDNLVKTGSTEP
                     ESLSDEWDDKKRSLREVLEETPDSEVDEEEELNEYEYRDQANRPWWKFFDEQEYRITK
                     KKGKSNHWYSWFNGSPSTQEKKLILKLDILLALYACMSYWVKYLDSVNLNNAYVSGMK
                     ESLGMHGNDLVHVQNMFSIGNIVSQVPFLFVLNKVPLNYLLPTLDLCWSLMTLGQGFA
                     HTTDSIKALRFFVGFFEGPSYLAFQYLFGCFYKHDEVVRRSAFFYFGQYIGILSSGGI
                     QSAVYKSLNGRNGLAGWRWNFIFDFIISIIVALIGFYSLPGDPQNCYSIFLTDDEIRL
                     ARTRLKENKTEGNDFHKKVFDIGVWKKIIFDWKIWIVSIWAIFCWDNSNVGSGCYILW
                     LKSLTNSNGEQRYSIPKVNTLSMITPALGLVYLTVTALIADKLHSRWSAILFTQIFNI
                     IGNVILAVWNVQEGAKWFAFMLQCMGWAMAPVLYGWVNDICRRDSESRGIIMTAMNIA
                     ASVFSVWTSVVFFPTTEAPRYLKGYSFAAANALALILWTFLVLWFYKNEERKYAKENG
                     IILYNSNVGVPPKEERQQLGNIYHDDQERSSSPAEAEGEHVHIVGDKGDKIINI"
     gene            complement(<647243..>651127)
                     /locus_tag="ZYRO0E08250g"
                     /db_xref="GeneID:8204839"
     mRNA            complement(<647243..>651127)
                     /locus_tag="ZYRO0E08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499239.1"
                     /db_xref="GeneID:8204839"
     CDS             complement(647243..651127)
                     /locus_tag="ZYRO0E08250g"
                     /note="similar to uniprot|P35187 Saccharomyces cerevisiae
                     YMR190C SGS1 Nucleolar DNA helicase of the RecQ family,
                     involved in maintenance of genome integrity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499284.1"
                     /db_xref="GeneID:8204839"
                     /db_xref="GOA:C5E4R8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002121"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR004589"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018982"
                     /db_xref="InterPro:IPR022758"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4R8"
                     /translation="MSMVSKPSNNLRSECKWLKETNSLQEEKELALKVINSNTLNKRP
                     RVDKVSQETSVSSITPLSSFNNDTQLPQRESQSQSKQKQPPLPTAPRQVPNYSTQRRD
                     RSELQRLLIGCLKSQNKLLLRRCRISESTSLSEDAKRTQIVDGIKPELSKLMSQMTTL
                     EEELDILSQSNDTNLSTDRTHSTVIPSPEEMNPGDEISAAPEPAATEALLFSSKPVQN
                     ELVQVLEEDDDDMEPMIVSQKDQQRASTMTPLSQQESESEQARRSIAARNLRNRENNV
                     NYRIPDHDDPFDYVMGVAENHGEASDVTMDAEDDIDSNYLKSDDGTENKVDQSDLDFV
                     VMDEEARDSIDRSYQDSQWPGLSESQKQDIENDSIEMILSSPQPKMTQTSPADENVER
                     IDLIEDDFEKDQIVEDTMMNDYGVAPFVRNMNANLSNSDLELIVSEGNEEEEAEAISD
                     SDLEKFDEERENRAQVPDIKELDDDLKIINERKLEEEDFLPTPIMVKQENPPELITKI
                     HKSQDILDDDDDDLLRDIAKGDQDKAVVHQPQPRYAWSDEVDYRLHQSFGLRSFRPNQ
                     LQAVNSTLAGKDVFVLMPTGGGKSLCYQLPAIVKSGKTRGTTIVISPLISLMQDQVEH
                     LLNNNIKASMFSSRGTADQRRQTFNLFIHGLLDLIYISPEMISASEQCKRGIKKLHND
                     GKLARIVVDEAHCVSNWGHDFRPDYKELKYFKREYPHVPMMALTATASEQVRLDVIHN
                     LELKDPVFLKQSFNRKNLFYGVVRKTKNTIAEICESINTRFANQTGIIYCHSKNSCEQ
                     TAAQIQRNGIRCAFYHAGMEPDERSDVQRAWQNDDLQVICATVAFGMGIDKADVRFVY
                     HYTVPRTLEGYYQETGRAGRDGKPSFCITYYTFRDVRSIQTMIQKDKNLDKDNKEKHL
                     NKLQNVMMYCENGLDCRRKLVLSYFNEEFDAKDCHKNCDNCCNSFKVATEQRDVTEDA
                     KKIVKLVDELQDSRVTLIYCQDIFKGSRSSKIVQAGHTELEFHGAGKSMPKSDVERIF
                     FQLINLGILAEYPIVNNSGFASNYVKLGKRARELLRGALPVQMQFNMSSSRPNSGLDS
                     NALPPSSSTSRISSRTVNLGGNKRDNHTVEPISLNNENEWKSTQELSELTHAYETLKE
                     ASMNAGYRMNPPVTNFIPDAALRKLAKKLPISESEFSSMPEIGPRHAKKFKVFRKTIM
                     ELRRRRSNLGGGNDINASNSIVLSEGSLPDNSVVASRFIAMDSAESQQNEEIIRQIRM
                     SQQRSTQPSQPSQRTGRASKSSYSKKRFKRRG"
     gene            <651705..>654089
                     /locus_tag="ZYRO0E08272g"
                     /db_xref="GeneID:8204840"
     mRNA            <651705..>654089
                     /locus_tag="ZYRO0E08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499240.1"
                     /db_xref="GeneID:8204840"
     CDS             651705..654089
                     /locus_tag="ZYRO0E08272g"
                     /note="similar to uniprot|P04386 Saccharomyces cerevisiae
                     YPL248C GAL4 DNA-binding transcription factor required for
                     the activation of the GAL genes in response to galactose
                     repressed by Gal80p and activated by Gal3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499285.1"
                     /db_xref="GeneID:8204840"
                     /db_xref="GOA:C5E4R9"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR002409"
                     /db_xref="InterPro:IPR005600"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E4R9"
                     /translation="MKRLNTIDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKA
                     NRTPLTRAHMTKVETKLDRLEQLFRELFPEEDLDKVLNDRNTGQLKERLKRFLVRRAK
                     GVGNDRMDDHESVGIGLGTHSDSNQEHITEGEVPKDPLRGFDWVEGQDMPIGSDRVGF
                     IVTDISNSGYYGQECPRLIFKKLGIDSVPLLTTKASSINAVTDPHALCSRNVTSKYVK
                     AYFDNFHIYYPLIDTHIFLKLYDNQAGLRYVDQWQILFNTVLAIGAWSSEGESTDADL
                     FYYSNVKSHLKPKVFEAGSVTLVIAFHLLSRYAEWRQNPNTGYLYHGHALRMAISLGL
                     HRDLPPEGIPDVIKERRRRIWTCLYSHEVHSALLDGRPLQYMFFDDQVTISLPNSVED
                     ENTWTKGPSIYMGAIETAKLLKEFGYVWFVDSKITTSRCLQLCQRLDACQKAMPKYLQ
                     ADEHLTGLTYYLKKYPWISFIRFYLRWERQWLQIYVLRRLLQSEGALKVEPNSELDKC
                     ATMLSDIAQKTIWGVANYLNNHHLTSFFAWYCTFYLFNASLVPLAQIYTGTGDRQESL
                     NQLSTCIRLFKQLKDYNLSTCEKYIHILDHLCDGGMNTTDSATRGTNVEVKKQQTTHS
                     PPLPTMSNALSPSVKSAASLSDLEKLFSSRTPVLNLRVPSQPAQYPTQPVQLPQVSPI
                     IPSTTAASNASNMPQPPSQLIRQTTPAASLPGNECSPSGSTTTTTAPNSAIKTGHPLD
                     NEGPFWTDQAAYNAFGLTSSLFNTTTMDDVYNFLFDEEDHTPPKSKSWQDSDRH"
     gene            <654410..>655456
                     /locus_tag="ZYRO0E08294g"
                     /db_xref="GeneID:8204841"
     mRNA            <654410..>655456
                     /locus_tag="ZYRO0E08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499241.1"
                     /db_xref="GeneID:8204841"
     CDS             654410..655456
                     /locus_tag="ZYRO0E08294g"
                     /note="weakly similar to uniprot|P42933 Saccharomyces
                     cerevisiae YMR191W SPG5 Protein required for survival at
                     high temperature during stationary phase not required for
                     growth on nonfermentable carbon sources"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499286.1"
                     /db_xref="GeneID:8204841"
                     /db_xref="UniProtKB/TrEMBL:C5E4S0"
                     /translation="MALNSWRQWAKLTKKQLRQLGRVIDEELGGVIERNLPRPNGRLV
                     KVPVPVPVRQAPPKFRASATTVSTRGYHQSAHQFVRSRLVRTDIRLVKSVPRVTMFSS
                     APRVPNGVPRGLFTNWNIIGRNAGQRMYSTASIKFTHEAVNNMAVSLRCFFNSLDGLI
                     PPNNGSQLSGRFPGPVHGQAKLSSRDVSLIRDMELFEMIKYHKNEALLAEGEETVGAY
                     VEFKAPQLDMNKAIPQKTFANSLALDVWRDEIWNYTNELKILERNVRRIYENYGSLPI
                     TTTKDSIRIHFPTLTMLETDKLITELEITMGNVYPDPQGPPSDILSNLDVSSDSDFSS
                     VLSPSISNEAFSLV"
     gene            <655793..>658909
                     /locus_tag="ZYRO0E08316g"
                     /db_xref="GeneID:8204842"
     mRNA            <655793..>658909
                     /locus_tag="ZYRO0E08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499242.1"
                     /db_xref="GeneID:8204842"
     CDS             655793..658909
                     /locus_tag="ZYRO0E08316g"
                     /note="similar to uniprot|Q12344 Saccharomyces cerevisiae
                     YPL249C GYP5 GTPase-activating protein (GAP)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499287.1"
                     /db_xref="GeneID:8204842"
                     /db_xref="GOA:C5E4S1"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5E4S1"
                     /translation="MGKKKGKKSSAAANKAPKNSKDTVTETPVIERPVEETANDKIEL
                     KDESGENLDSLDDLNETTENFQNEEITSENPSSEFIPVKPEAPFDQASAQSSAEVKPL
                     FADESGQDEKTESKREKLVKPEEPSTQPLHIQKPATPVTQSPVQDFGTFKPNSPPPVP
                     SRRPASSTHGQHKHEEEKSTDEASSPCPNPLPIDTNAGVSRSGSYSSKPTSPRPKPPS
                     VEGSPVSEAAFKGASSGFSSARPVPPTPTVDSPSAPGINAHKEEHSRKPISPALPPRN
                     SLHSTTTVKEYSRHDSEEVPGLRSFHKVPTKEKDNQKPEQRVHNNGFGGLNLVSPTPI
                     TLSEETQMQESEEPKTAGMMNMDLNDATEAATPERLATPAKLDRSKEFEKSVGEGDAK
                     GSLTSHVSPSKRPETQSPISPPLPARGTSIKRRSIPPPLEQEMQSDEFRKSLAFAHAR
                     DTKGTPPPINRSKRLESAAEINLIANRFKETRQSYQTEDEASRENIEKGQSALKSSFS
                     TFLESLPATPVTPSGKFEDPQTPELGVTPSAQTELGEDELHLLKTDWSFWTQVVNDFG
                     SVAANPEKLEQKITDGIPQQIRGIIWQLIANSKSVEFEVIYNTLRDTESPHESSIRRD
                     MKRTKFIPENKFENLFNVIKVYSVFDPDVGYTQGMAFIVTPLLLNTDTEAEAFGLLVR
                     LMKGYGLRRMYLPEMPGLMLMLYQFDRLLEENSPQLYNHLTRQGVRSSMYATQWFLTF
                     FAYKFPLEFVLRIYDIVFVEGMESFLKFAVNLMLKNIDSLLDLQFDKLLDFLKDELFF
                     YYLKANVEQRKMETDDDGSVFKKEISSIESPQKRIRTEDEEYDVDQFVHDAMNHVHIT
                     PISLRRYASEYDEIHEIEQQKEAQYESMRIKNQQLHKEVRKLESSYTLLNREHVDIAN
                     ELIKNRLKIETLSDENNDMKITILELRKQLEEIGRKQTSPSPDNELPSDIRHDLNRTI
                     KRNAEVMNENLRLQDRVTELERSLATLKTKQVVSATSNTAGNTPKLTNGWSGFKKVFK
                     KEEANHPK"
     gene            complement(<659035..>661290)
                     /locus_tag="ZYRO0E08338g"
                     /db_xref="GeneID:8204843"
     mRNA            complement(<659035..>661290)
                     /locus_tag="ZYRO0E08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499243.1"
                     /db_xref="GeneID:8204843"
     CDS             complement(659035..661290)
                     /locus_tag="ZYRO0E08338g"
                     /note="highly similar to uniprot|P13711 Saccharomyces
                     cerevisiae YGL205W POX1 Fatty-acyl coenzyme A oxidase
                     involved in the fatty acid beta-oxidation pathway
                     localized to the peroxisomal matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499288.1"
                     /db_xref="GeneID:8204843"
                     /db_xref="GOA:C5E4S2"
                     /db_xref="InterPro:IPR002655"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR009075"
                     /db_xref="InterPro:IPR009100"
                     /db_xref="InterPro:IPR012258"
                     /db_xref="InterPro:IPR013786"
                     /db_xref="InterPro:IPR029320"
                     /db_xref="UniProtKB/TrEMBL:C5E4S2"
                     /translation="MTKSSTVNQECAAFKPQKLIQSERSNSRVDVDQINAFLESSPER
                     RDQAQALIQEIVKDPILKTDSSMYDRSKREERAVTARKIARLALYMEHDIKTARKHFK
                     GNDLIEDLQRDTESKLPALSNKDLSIFDRRLSLLHNIDPQLGTRVGVHLGLFGNCIKG
                     NGTNEQIHYWLQERGSSFMKGIYGCFGMTELGHGSNVARLQTKATYNPDSDTFTLLTP
                     NLPATKFWIGGAANSATHCSVYARLIVEGKDYGVKTFVVPLRNPETFQLLPGIAIGDI
                     GHKMGRNGIDNGWIQFHNVVIPREYMLSRFTQVIPSKAPNGKATVKTQPQLDQISGYS
                     ALLSGRVNMVMDSFRFGSKFAIIGARYAVGRQQFAKPKQPETQLIDYPLHQYRVLPQI
                     AVPYLVSPVAFKLMDQYYSILDELYKVSSPATFDKTGLAIVSKKLKNLFIDSASLKAT
                     NTWLVAELIDQLRQSCGGQGYSSYNAFGKGYDDWVVQCTWEGDNNILSLSSAKSILKK
                     FAASRRGVFDRSLDSGSFDYLEPSFVRAVLTGQETASLRQLQDYTKVWAIALVKFLDH
                     IARLIDVTKDLDSVAKLLVLVSKFHSLHSMLQAYYEKLKNPQDSHVTDAASEAALWDI
                     YKLFSLYFIDKHSGEFQQFKVFTPDQISQTVQPKLLELLQKVRKSIIPLTDAFKLPDD
                     MINAPIGYFDGDIYHNYFSEIIKQNPAEADGAGVPPNADLFTRLLARGSEFDHALGGS
                     PRSEIIERLGK"
     gene            <662545..>667491
                     /locus_tag="ZYRO0E08360g"
                     /db_xref="GeneID:8204844"
     mRNA            <662545..>667491
                     /locus_tag="ZYRO0E08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499244.1"
                     /db_xref="GeneID:8204844"
     CDS             662545..667491
                     /locus_tag="ZYRO0E08360g"
                     /note="highly similar to uniprot|P22137 Saccharomyces
                     cerevisiae YGL206C CHC1 vesicle coat protein presumed
                     vesicle coat protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499289.1"
                     /db_xref="GeneID:8204844"
                     /db_xref="GOA:C5E4S3"
                     /db_xref="InterPro:IPR000547"
                     /db_xref="InterPro:IPR001473"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR015348"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016025"
                     /db_xref="InterPro:IPR016341"
                     /db_xref="InterPro:IPR022365"
                     /db_xref="UniProtKB/TrEMBL:C5E4S3"
                     /translation="MSDLPIEFTELADLTSLGISPQFLDFRSTTFESDHYVTIRETND
                     GVNSVAIVDLANNNNVIRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKSKLKSF
                     TLDEPVLFWKWLNEKTLGLVTARSILISHVFDGNVGAKPQLLTIRHASLNNTQIINFV
                     TNKNEDWFAVVGILQENGRIAGKIQLYSKQRNISQAIDGHVAIFANILLDGNVNPVQV
                     FVTGNRNVQTGAGELRIIEIEHDNSLPVSYQKKTVDIFFPPDAVNDFPIAVKVSEKYG
                     VVYLLTKYGFIHLYELETGTNLFVNRITAESVFTAASYDNQNGICCINKKGQVLAVEI
                     STSQIVSYILNKLSNVSLALTVASRGGLPGADGLFQKQFESLLSQGDYQGAAKVAASS
                     NQLRNQNTINRLKNVQAAPGAISPILLYFSTLLDKGKLNRDETIELAKPVLQQDRKQL
                     FEKWLKEDKLECSEPLGDIVKPFDTTLALACYLRAGSHAKVVSCLAELQQFDKITAYC
                     QKTGFQPNFLVLISSLIRFSPDRAAEFAISLLQNPETASQLEIEKIADLFFSQQHVQQ
                     GTSLLLDALKGDTPNQGHLQTRVLEVNLTHAPQVADAILGNNIFSHYDKPTIASLSEK
                     AGLYQRALENYTDIKDIKRCIVHTNALPVDWLVAYFGKLNVEQSLACLRTLMENNLQS
                     NIQIVIQVATKFSDLIGSSVLIKLFEEYRATEGLYYYLASLVNLTEDKDVVYKYIECA
                     AKLNQYKEIERIVKDNNVYDAEKVKNFLKNAELEDQIPLIIVCDRFDFVHELVLYLYK
                     TRNMKFIEAFVQQVNPSKTPQVVGALLDVDCDEDFIKGLLQSVFGQVSIKELTEEVEK
                     RNRLKLLLPFLEQTLAQGAQDQGVYNALAKIYIDSNNAPEKFLKENDQYNTLDVGHYC
                     ERRDPYLAYIAYEKGTNDEDLIRITNENSMYKYQARYLLKRSDSELWNTVLNSDNVHR
                     QQLIEAVISVGIPELTDPEPVSLTVQAFMSNGLKIELIELLEKIILEPSTFSDNVALQ
                     GLLLLSAIKYEPSKVASYIEKLEKYDANEIAPLCISHGLTEEAFEIYEKHEMPEKALK
                     VLIEDVMNLDRAQTYVEKVNTPGLWSQLGTAQLDGLRIPSAIESYIKAEDPSNYENVI
                     EVAEKEGDYEELLPYLTMARKSLKEPKIDGSLILAYASLGKVHEIENLLSGPNVADLE
                     DVGDRLMDIKNYKAAKLCYASVSNYSKLASTLVYLDDYQAAVDTARKASNIRVWKLVN
                     DACIDRKEFRLAQICGLNLIIHAEELGELVEKYESNGYFDQVISLFEAGLGLERAHMG
                     MFTELAILYSKYEPSKTYEHLKLFWSRINIPKVIRAVEEAHLWNELVFLYAHYDEWDN
                     AALTMIDKSAKNLDHSYFKEVIVKVSNLEIYYKAINFYVTEHPSLLVDLLAVLTPRLD
                     IPRTVKLFAKSDNLPLIKPFLVNVLPKNNSVVNQACHDLMIEEEDYKALQDAVDSYDK
                     FDQLALAARLESHELIFFKKIAALLYRRNKKWAKSLSILKEEKLWRDAIETAAISGDS
                     KVVEDLLTDFVETENKESFVALLYTAYHLVRYDFVLEISWLHNLGDLSKPYEISVQKE
                     HTDAIKKLSDELVQKGSVSEGPADGQPLMLTNGAPGLF"
     gene            complement(<667983..>671075)
                     /locus_tag="ZYRO0E08382g"
                     /db_xref="GeneID:8204845"
     mRNA            complement(<667983..>671075)
                     /locus_tag="ZYRO0E08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499245.1"
                     /db_xref="GeneID:8204845"
     CDS             complement(667983..671075)
                     /locus_tag="ZYRO0E08382g"
                     /note="similar to uniprot|P32558 Saccharomyces cerevisiae
                     YGL207W SPT16 Subunit of the heterodimeric FACT complex
                     (Spt16p-Pob3p) facilitates RNA Polymerase II transcription
                     elongation through nucleosomes by destabilizing and then
                     reassembling nucleosome structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499290.1"
                     /db_xref="GeneID:8204845"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="InterPro:IPR013953"
                     /db_xref="InterPro:IPR029148"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C5E4S4"
                     /translation="MVELNIDFDVFKKRLLTLHSQYKTYENSPNSLLFVLGSSNTENP
                     YQKTSILHNWLLSYEFPSTIIAVLPDKVVIITSAAKAKHLEKAVELFSNEPVKLELWQ
                     RNSKDPEHNKKLFEDVIDVIQKAGKSVGAPEKNVYQGKFMLEWSPLWDEAVKKYELNV
                     VDISAGLSQTWEVKDDNEKALLSVASKSSDKFMDYLADEMVRAVDEELRITNVKLSDK
                     IENKIDDDSFLKKIAPELSKLCPKGYPFNLDLLDWTYSPIIQSGEKFDLRVSARSTND
                     QLDGNGSILASCGIRYNNYCSNVTRTFLIDPSDEMVRNYEFVLELQKEIVNNKLKVGS
                     TPKEVYDSVVEFVQKVRPDLVGNLTKNLGSVIGLEFRDSSFVLNAKNETRKVQAGDCF
                     NISFGFNNLKDSKTDKSYALQLSDTVLLASEENSEPQYLTNCARSPSQVSFYFNNEED
                     ENESKKAKKPAKPEPNSKILKTKLRGEARGDSQENQKEQIRKENQKKLHEKLQKNGLL
                     RFSAADANGTGNEQRQYFKKYESYVRDSQIPSNVRDLRVHVDWRSQTVILPIYGRPVP
                     FHINSYKNGSKNEEGEYTYLRLNFHSPGAGGISKKTEELPYEESPDNQFVRSITLRSK
                     DGERMSDVFKQITDLKKESTKREQERKVLADVVRQDKLIENKFGRTKRLDQIFVRPSP
                     DPKRVPSTVFIHENGIRYQSPLRSDSRIDILFSNIKNIIFQSCKGELIVIIHIHLKNP
                     ILMGKKKIQDVQFYREASDMSVDETGTGRRGQSKFRRYGDEDELEQEQEERRKRAALD
                     KEFKYFADAIAEASNGMLTVESAFRDLGFQGVPNRSAVFCMPTTDCLVQLVEPPFLVI
                     NLEEIEICILERVQFGLKNFDMVFVYKDFSKPVTHINTVPIESLDFLKQWLTDMDIPY
                     TVSSINLNWSTIMKSLTEDPHQFFLDGGWSFLAMGSDDEGSGESDEEISEYEASEEEP
                     SDESAFSDDEDAYSEGEAEFSDDGSEEVSADEESEAGEDWDELEKKAAKLDRVSNYRE
                     "
     gene            complement(<672301..>673347)
                     /locus_tag="ZYRO0E08404g"
                     /db_xref="GeneID:8204846"
     mRNA            complement(<672301..>673347)
                     /locus_tag="ZYRO0E08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499246.1"
                     /db_xref="GeneID:8204846"
     CDS             complement(672301..673347)
                     /locus_tag="ZYRO0E08404g"
                     /note="some similarities with uniprot|Q04739 Saccharomyces
                     cerevisiae YER027C GAL83 One of three possible
                     beta-subunits of the Snf1 kinase complex allows nuclear
                     localization of the Snf1 kinase complex in the presence of
                     a nonfermentable carbon source contains glycogen-binding
                     domain and some similarities with YGL208W uniprot|P34164
                     Saccharomyces cerevisiae YGL208W SIP2 Member of a family
                     of proteins including Sip1p and Gal83p that interact with
                     Snf1p and Snf4p and are involved in the response to
                     glucose starvation component of Snf1 protein complex
                     involved in response to glucose starvation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499291.1"
                     /db_xref="GeneID:8204846"
                     /db_xref="InterPro:IPR006828"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5E4S5"
                     /translation="MNPSIIQLLLQHDEIVVKHGHSEYSPVVLITTNKKQGKERIRDK
                     ESKTNGRMDNNVTYSLSQMNLDPPTLGRRKSTLIFDDEEEMGYTNHQEHSKSMDSDSS
                     SSTESLRTGMCPVEITWQQGGNKVYVTGSFTGWRKMIGLVPVPDQPGLLHAKLQLPIG
                     THRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRGQKDTLSARSRIAMEIENEPDD
                     IGNGFTRFKEEIPLKPQVEYTQDIPAVFTDPSVMEQYYLTLDQQQHNHQNMAWLTPPT
                     LPPHLEDVPLNSYNGIQGDSNNENNSGALPIPNHVVLNHLATSSIKHNTLCVASIVRY
                     KRKYVTQILYAPLQ"
     gene            complement(<673465..>673980)
                     /locus_tag="ZYRO0E08426g"
                     /db_xref="GeneID:8204847"
     mRNA            complement(<673465..>673980)
                     /locus_tag="ZYRO0E08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499247.1"
                     /db_xref="GeneID:8204847"
     CDS             complement(673465..673980)
                     /locus_tag="ZYRO0E08426g"
                     /note="some similarities with uniprot|P53035 Saccharomyces
                     cerevisiae YGL209W MIG2 Protein containing zinc fingers
                     involved in repression along with Mig1p of SUC2
                     (invertase) expression by high levels of glucose binds to
                     Mig1p-binding sites in SUC2 promoter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499292.1"
                     /db_xref="GeneID:8204847"
                     /db_xref="GOA:C5E4S6"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5E4S6"
                     /translation="MKASLPQDNDDRPFRCEICNRGFHRLEHKKRHIRTHTGEKPHKC
                     SFPGCGKSFSRSDELKRHLRTHTGTSQRKTKKTPSKRVEKDRIPTPAPSTAKNIVSST
                     SPVKLPPVPLALPVTMPLTPVSSRPVSAQSSAISLPTLATLEQPEEKVVLPPVSKMLK
                     QIDVFNTGKSI"
     gene            complement(<674946..>675395)
                     /locus_tag="ZYRO0E08448g"
                     /db_xref="GeneID:8204848"
     mRNA            complement(<674946..>675395)
                     /locus_tag="ZYRO0E08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499248.1"
                     /db_xref="GeneID:8204848"
     CDS             complement(674946..675395)
                     /locus_tag="ZYRO0E08448g"
                     /note="similar to gnl|GLV|CAGL0C02497g Candida glabrata
                     CAGL0C02497g and some similarites with YER029C
                     uniprot|P40018 Saccharomyces cerevisiae YER029C SMB1
                     associated with U1 U2 U4 and U5 snRNPs as part of the
                     Sm-core that is common to all spliceosomal snRNPs U1 snRNP
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499293.1"
                     /db_xref="GeneID:8204848"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5E4S7"
                     /translation="MSKVQVKQDARLPDLIGFRLRVLTQDGRVYVGELLAFDKFMNLV
                     LKNCIEERIPKTQLDKLQNETSDKNDIKVEKRTLGLAILRGEQVLSSVVQDKPQLSKR
                     ERLDGIKNQEKKISKERRSRNKQTKEKKNGKVEKKKFQPPPGLRKRV"
     gene            <675512..>675997
                     /locus_tag="ZYRO0E08470g"
                     /db_xref="GeneID:8204849"
     mRNA            <675512..>675997
                     /locus_tag="ZYRO0E08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499249.1"
                     /db_xref="GeneID:8204849"
     CDS             675512..675997
                     /locus_tag="ZYRO0E08470g"
                     /note="similar to gnl|GLV|KLLA0B00649g Kluyveromyces
                     lactis KLLA0B00649g and weakly similar to YER030W
                     uniprot|P40019 Saccharomyces cerevisiae YER030W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499294.1"
                     /db_xref="GeneID:8204849"
                     /db_xref="InterPro:IPR019098"
                     /db_xref="UniProtKB/TrEMBL:C5E4S8"
                     /translation="MAEEDKKREEITTKEEPAKQEPSKEEPAKQEPSKEEPAKQEPSK
                     EEPAKEDPSKEEIGAKRKSTGSSRRVKRRRNYEENDAKVENEKPDQDEESEVDDAKLD
                     SLVAQDEEDDDLAEIDTSNIVTTGRRTRGKVIDYKKTAEELPQRQEEEDSDDDEEFKE
                     T"
     gene            complement(<676074..>676811)
                     /locus_tag="ZYRO0E08492g"
                     /db_xref="GeneID:8204850"
     mRNA            complement(join(<676074..676684,676766..>676811))
                     /locus_tag="ZYRO0E08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499250.1"
                     /db_xref="GeneID:8204850"
     CDS             complement(join(676074..676684,676766..676811))
                     /locus_tag="ZYRO0E08492g"
                     /note="highly similar to uniprot|P51996 Saccharomyces
                     cerevisiae YGL210W YPT32 probably involved in intra-Golgi
                     transport or in the formation of transport vesicles at the
                     most distal Golgi compartment; ras-like GTPase, highly
                     homologous to YPT31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499295.1"
                     /db_xref="GeneID:8204850"
                     /db_xref="GOA:C5E4S9"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4S9"
                     /translation="MNNEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNDFNMESKS
                     TIGVEFATRTIEVEGKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKPSSYE
                     NCNHWLTELRENADDNVAVGLIGNKSDLDHLRAVPTDEAKNFAQENQLLFTETSALKS
                     ENVDLAFRELITAIYQMVSKHQVDLGDANTQGNAPKGPTISLTPAPNENKKKSANNCC
                     "
     gene            <678434..>682189
                     /locus_tag="ZYRO0E08514g"
                     /db_xref="GeneID:8204851"
     mRNA            <678434..>682189
                     /locus_tag="ZYRO0E08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499251.1"
                     /db_xref="GeneID:8204851"
     CDS             678434..682189
                     /locus_tag="ZYRO0E08514g"
                     /note="some similarities with uniprot|P40020 Saccharomyces
                     cerevisiae YER032W FIR1 Protein involved in 3' mRNA
                     processing interacts with Ref2p potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499296.1"
                     /db_xref="GeneID:8204851"
                     /db_xref="UniProtKB/TrEMBL:C5E4T0"
                     /translation="MVDGQDTLQGVHPILRNPDLPNPTASPTLMSPRSQVRFSVPDTS
                     FMNEAQVSVSESPSKIVFPKGSEEDSVYETANEEIGDEFRNLGKEGHFMDMHSRVMID
                     VPEEIWDFHTRRLIKHRRSRSTGDQSIYNGNANGNLEMSRSLQSIIVDTLDSMGKFKE
                     KYRAENSNSEDSSGISQVSPLNLRRETNYDLYLTPYSPLNNYDVPIPLEISLPPYLSP
                     KNKERKRSSLIFDGKHYSPFNMDSFESSAEEDVEDRDRLNESSHMSADAEEEGSISAD
                     SIPSAVHDISFDVSSLHDVDEELGIDQDANVNLKVQRKNLKRQSPSKSSPLTRKSHTK
                     SASRNLNDQQVPDLPPTQEPEVADEPPLDQEGIEEEEKNEQEALAPVLSKKSLDILET
                     PSKQIYIPDFDSDPTPATSTAGSLKFFDTLDDREEGHEEAFTTNPNREVDILDMTFKF
                     PPLPPKEDESHEEKDTSNPNREAHNLDMAFKFPPSPPKEDADFLRVDNSPVDPQFESR
                     RSKLMQQKVLTPGGRRHMHSRSRSMHNVQDMFAATSTPPTAAPAAITTTTNNNNNTET
                     PSGSPLRQNYAVQEGAALFEMDKQKEQIPPRESPRGFAEDEYGLPTTPTPFARFNGDL
                     PVTPSSTGRNRSELAMTPTPFSRRRRGKPVTPTSFEEQVHEVDMTPESEPYVEHEEES
                     DPSSVYEEVHALKEQPSHEQPEPTRNQEDFVSQDQSSYNKTDESLKIISEKNLNYDHF
                     DFSDEVEREVALSTPVKQKELSPPPVSPVNPMTSFQSFTRPVIPPENEYENIVSMPPE
                     HNKINYNLLSPGRSLSNNGSESSKNSQFSKNTNQSSRTSYPAEREMINPLVENLKKSD
                     VPYSFPYPFDPVLNNAMKLQRHSMPAFDIYNGSAPSFRQLNEEISFQDNDRYKQGLHQ
                     QQPDIPADKSAQRVYSRPKSVIGPGAYVEDQVSSNVGPRSEVPSCNQRKGQMHHRSRS
                     LEQSTYPRALNDYHGESYHEPKDHLLSQNTMRPRSFHAPRRSIQSFMADDLYGPDDYR
                     MFEDYQNVNQHAQEDDSERPADVVSYPHRLAPSADFRDVLETLDNMSPSTQRSKEFSS
                     REPDHYTLPETPVRSKRNAATDEGYRTEYEVRDGKLVEVLVLDDDSDESIHNQSEKDS
                     PLSPSKVSQYSSPNRNHEELLKMCEDTATHAKKVILQLVDDKKTKKAGGKKKKLSRPP
                     PPVTTKEVEQVARLTPRQNNHRRSSSIGQERYLRNLHRAMKSKPYPQ"
     gene            complement(<682374..>685205)
                     /locus_tag="ZYRO0E08536g"
                     /db_xref="GeneID:8204852"
     mRNA            complement(<682374..>685205)
                     /locus_tag="ZYRO0E08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499252.1"
                     /db_xref="GeneID:8204852"
     CDS             complement(682374..685205)
                     /locus_tag="ZYRO0E08536g"
                     /note="weakly similar to uniprot|P40021 Saccharomyces
                     cerevisiae YER033C ZRG8 Cytoplasmic protein of unknown
                     function transcription is induced under conditions of zinc
                     deficiency"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499297.1"
                     /db_xref="GeneID:8204852"
                     /db_xref="UniProtKB/TrEMBL:C5E4T1"
                     /translation="MRSFIRSHKKANSLDENPTGFAPPHSNNEGLTAPDMPKNDTVSF
                     IQSTPPQSGSNFQGFKHSPGFESFHKLNKKMFPGKLFKKNSSSNSPLLQPGPFGPKEY
                     SSAPGTPQANKYEMPGDVGMGRNSHDDNRFLAVKGTVTHSWGDNGDKEQQVIVLNNNN
                     NNNNDNDSNDNNNNNGSNHSGKFQSSTQPSTPVLSSDLGPAVRIASERKAQEAPPRSF
                     QLPGYAPRSSTEDGSLRQGEQQQPQVYSKLSSVKNKNRQARIHSHDDILHLGQDSSVT
                     MDFLKSTFSPDTLDEDSPDMRTLNDDNGDEATAKVNNTSKLSNFKGPDNVTKRSPAVK
                     FQEDHGASQDVEVGDTEHLPPEEEDYEEDEEYEEDDEEDATSRFSFEISGINGRTSSV
                     KYYSKPEPSEAMYIDDLYEDENFDDDLNCFEDEDGEMEFPSNLLGISDNSDNESVVKK
                     DLTPDDAHLSEPKPVKKYQDLFALSDEEEEDGADHSGLAGLGLDTKTINVSAQSFASN
                     EKRPLSSVPSSARHSKHMESTEKDQKSSPTNLNDSRTSDSFNHDTTMRSPSASQSTTT
                     VCSQAPLQTSPHIQSSPTMSMPSIRLQSPSTIKPPATNKPPRYHASPGAQSPLDVQPS
                     IPALSGKQPSLPKSKAVKSFSDIFDLEDGLSDEDEDQDDLIGEVNAAEDGSFSIPDRE
                     SPNASDDSQQRKYLQMHTSPLGRPKTPVQIYLTPPGNSASTSVTPFDSQPHLSNTTPS
                     LPPPARSQSLKYHDLSSNLDSEIPGLMSNLYFIDEKEEDKYMEEHKLADDDYLDEINT
                     VPEDFTFSDSEHDDPAKPSLRRSLRGSFRGTHSYSSQPTGTAKENAPARNKLEIKNKT
                     VTFFNHGWDRSPIDKYQRSPRTSEQYLDSIDDYITSPSKADYENFAPLTPNNSVNKPS
                     PGFINDKSLSPIQEGSSSVDNSPKIPSLR"
     gene            complement(<685474..>686586)
                     /locus_tag="ZYRO0E08558g"
                     /db_xref="GeneID:8204853"
     mRNA            complement(<685474..>686586)
                     /locus_tag="ZYRO0E08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499253.1"
                     /db_xref="GeneID:8204853"
     CDS             complement(685474..686586)
                     /locus_tag="ZYRO0E08558g"
                     /note="highly similar to uniprot|P53088 Saccharomyces
                     cerevisiae YGL211W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499298.1"
                     /db_xref="GeneID:8204853"
                     /db_xref="GOA:C5E4T2"
                     /db_xref="InterPro:IPR000541"
                     /db_xref="InterPro:IPR011063"
                     /db_xref="InterPro:IPR012089"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020554"
                     /db_xref="UniProtKB/TrEMBL:C5E4T2"
                     /translation="MSFVPPSDPVNKKQVKVSQLCELCRCRKAIIRRPKNLQKICKSC
                     FFHVFETEIHNTIVNNNLFYRGEKVAIGASGGKDSTVLAYVLKLLNDRYDYGIELVLL
                     SIDEGIVGYRDDSLATVKRNQVQYGLPLEIISYRELYDWTMDEIVACAGVRSSCTYCG
                     VFRRQALDRGSSKLGISHVVTGHNADDMAETVLMNILRGDVARLEKSTAIITQSSGSP
                     IKRSKPFKYSYQKEIVLYAHYKKLDYFSTECSYAPEAFRGTARELMKNLEMVRPSCII
                     DIIHSGENLVLKPKKPKRTGTPKQMEVRTDGSVSLGFVDGNKCEKCGYLSSNRICKAC
                     MLLEGLENNRAKVTLDNDTSTQGTARLTRTLESLKF"
     gene            complement(<686734..>687798)
                     /locus_tag="ZYRO0E08580g"
                     /db_xref="GeneID:8204854"
     mRNA            complement(<686734..>687798)
                     /locus_tag="ZYRO0E08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499254.1"
                     /db_xref="GeneID:8204854"
     CDS             complement(686734..687798)
                     /locus_tag="ZYRO0E08580g"
                     /note="similar to uniprot|P32912 Saccharomyces cerevisiae
                     YGL212W VAM7 Regulator of vacuolar morphogenesis
                     hydrophilic protein heptad repeat motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499299.1"
                     /db_xref="GeneID:8204854"
                     /db_xref="GOA:C5E4T3"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="UniProtKB/TrEMBL:C5E4T3"
                     /translation="MRPQRIEVAVVIDDIRIVKESYALYGVLVKVIRSNDESANEQSY
                     EHRVYRRFSEFWDLKMKLEKEFGTELPYELPQRQFGLWKQSSLDPDVIEERKITLANF
                     LQDLLNDSFDTKWKNSPQVCKFLKLSSNWNSYEPKNSDLPSSQGNINDPTQWLTTFRD
                     SKHLLESCKRGMASSVTRDLMQLRLVLHDLENALKRGSEKLGQAEFARRQNLLQTLKK
                     DMNEFALESSSRPHDSSNSNNNNEHNDLKVALFEGPTEPRTPKKPAIGRRRFGETEET
                     APLNNQQLLQLHKDSMSKQDLEMKEMHKIVQRQKDLSLAMNQELLQDNELLDSLNDGV
                     DNTASKLRTANRRAKQFNNE"
     gene            <687971..>689242
                     /locus_tag="ZYRO0E08602g"
                     /db_xref="GeneID:8204855"
     mRNA            <687971..>689242
                     /locus_tag="ZYRO0E08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499255.1"
                     /db_xref="GeneID:8204855"
     CDS             687971..689242
                     /locus_tag="ZYRO0E08602g"
                     /note="similar to uniprot|Q02793 Saccharomyces cerevisiae
                     YGL213C SKI8 essential for protection against viral
                     cytopathology dispensable for mitotic but required for
                     meiotic recombination and spore viability antiviral
                     protein mRNA is induced early in meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499300.1"
                     /db_xref="GeneID:8204855"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E4T4"
                     /translation="MSNVFISTANCGKAHNADIYGTSVCLPYTVTCSGDGTIKLWKNK
                     LLDNELPKENVITQFVHRTGVHHVDTFYSVEKGGHELCIVSCVSFAGTIHFYQVDVKS
                     GKVEAVDLLPSQDKKKSYWSLKWFKSDDQMVCHRLAATDVKGNTLVWRFHPFAQEFDE
                     ELAKKEEEKRAKRLARGQSVEDPSTNSENDEELKLQPHLKLHGEIPSVEPVFATCVGI
                     SHNGLVATGFANGSVVVSELSTLRRIHNFEGFGIQGIEQNSNTVRAVEFSPLGTLLAV
                     ASDSGSYGCVSLYETEYGERVGSLTVPTHSAQTSIGTFAHDGWVFGLSFNPTGEFLAT
                     CGYDSKVRIWDVKLRERVSTLNISAGDIEVEEDIMLQDENGESVKNPPVMDVKFINKG
                     VRGGMGSETNEGLCCVCLDRSVRWFRAAGGS"
     gene            complement(<689547..>691463)
                     /locus_tag="ZYRO0E08624g"
                     /db_xref="GeneID:8204856"
     mRNA            complement(<689547..>691463)
                     /locus_tag="ZYRO0E08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499256.1"
                     /db_xref="GeneID:8204856"
     CDS             complement(689547..691463)
                     /locus_tag="ZYRO0E08624g"
                     /note="similar to uniprot|Q2U0T7 Aspergillus oryzae
                     AO090011000310 Predicted protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499301.1"
                     /db_xref="GeneID:8204856"
                     /db_xref="GOA:C5E4T5"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:C5E4T5"
                     /translation="MKVFFWSLCLSFFIGSLEALAVSKQVKLGDISYYVPGVPELTVD
                     VGMMSSLFGTLESSFLFPLTVFGYSGNLDYSTIESVSKNFSCSDDVYSDYFLETIMVQ
                     SPNVGVVSYSNCSLSTLNVSTIISLGGSALPNGPYFASYLDGQLSVYKAYRLYADAYG
                     AFQAGIVPSDENAESFMALPAGVEVAHAQTIAVPSKLYYTVTEEQPLAGYRVGVKDLY
                     DIAGTKTGGASRKYYELYDEAALTCPSVQRLIDMGAVIVGKLKLTQFANGGNPTANYV
                     DYHAPFNPRGDGYQSPSSSSCGSGAAEAAYDWLDFTVGSDTGCSVRCPAGSQGLYGLR
                     PSFDAISLDGVIPMNDLMDTAGYFSRDPSLFKVFGETWYGENKNISTSYTSFPKTVYT
                     FAFEEGDSDFIESGASSEALALFNTFVSNVVSFVNGSNAKLDIYSKYEQDTGSSLANV
                     FNNTWYGLAGFYQYVNIWERFSKDYQEASNGDIPFMDPIPKFRWEWAYNNLTQDGYDR
                     CVEQKWQFDDWWNANVTSTNPQTCSSSLYIFLSNDGSTAYRNVYNSAPNADGFSAFSE
                     MYISSFARTPEAIVPLGEVAYNSTITLTEKYLPVTAAIGAAPGCDFMVLDLIEQMGRA
                     NLIGGVATGQKLFP"
     gene            complement(<692604..>694010)
                     /locus_tag="ZYRO0E08646g"
                     /db_xref="GeneID:8204857"
     mRNA            complement(<692604..>694010)
                     /locus_tag="ZYRO0E08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499257.1"
                     /db_xref="GeneID:8204857"
     CDS             complement(692604..694010)
                     /locus_tag="ZYRO0E08646g"
                     /note="weakly similar to uniprot|P35190 Saccharomyces
                     cerevisiae YGL215W CLG1 cyclin-like protein that interacts
                     with Pho85p in affinity chromatography cyclin-like protein
                     that interacts with Pho85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499302.1"
                     /db_xref="GeneID:8204857"
                     /db_xref="UniProtKB/TrEMBL:C5E4T6"
                     /translation="MASTFMYYPGHAPGGPVVDTCAAANAAALQHHQQQHQQSHLRQM
                     EAHQQQQQQQQHSQQQQQYAASAAAAAAAPYGYYQNGLAAAQGMAAVQQQQQHQQQQA
                     AAFYNQQQHQHQQQAVAHHRRTSSFRQQPTLPPLGMFYPGAPPATILPLPLQQEAPAP
                     REEYVNGGVNQFLDYDLDLMSEFVIKKSYNAFGTDAGAVIRETGSNQTVDLFTKGVFS
                     VLSATRLPAVTIFMALDLLSKYVTKTHAASGSIRSGCVNVVYQNTMVAFVLANKFNDD
                     KTFTNKSWSQATGMDVLCINNFEREWLDVLEWRLFDDKFVHYDEYAHAFEIFCQEKRC
                     PSPPNMLPAPHSTDNYLSPPSDCQTPVHLNANVYSSPGFLEKDTNDFYYGQPGVLSSP
                     VSQFTPNSAAAYSTTSGGPMNYNFYNFGPPQPAAAVQPMMGLPPAHMWNMDERFGNFA
                     SSNFPGFDNNYYCYSAVY"
     gene            complement(<694586..>696922)
                     /locus_tag="ZYRO0E08668g"
                     /db_xref="GeneID:8204858"
     mRNA            complement(<694586..>696922)
                     /locus_tag="ZYRO0E08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499258.1"
                     /db_xref="GeneID:8204858"
     CDS             complement(694586..696922)
                     /locus_tag="ZYRO0E08668g"
                     /note="similar to uniprot|P53086 Saccharomyces cerevisiae
                     YGL216W KIP3 Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499303.1"
                     /db_xref="GeneID:8204858"
                     /db_xref="GOA:C5E4T7"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5E4T7"
                     /translation="MDSKERQSSIVVAVRVRPFTDYESSHLMPEGRDEFYVNMGDSNL
                     VLPNGNSVGDSDEKYQKSNTRLPAMLRPQGIRRIVECVDDKMLIFDPADTNPLNKVGE
                     TVLNSMYSRKNRSRRRLRRNGGEVRFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFN
                     GTVFAYGATGCGKTYTISGSPENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYN
                     ESIRDLLCPETSSKKLVILEDSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSAT
                     DANEASSRSHAVLQIHIMQHNRTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYE
                     GANINRSLLALGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIS
                     PSSTHYDETLNTLKYANRAKEIKTKVSRNNQTLDRHVSSYLKMISEQKQEIDELRRRE
                     QVVIDMRLKKYQLTQEKVQLAIEDCLQNVQTAFAKAGNFHNSKNIKSLMLCKRRFLQL
                     VQLELINVISLVQEWTDPQIYQSSTLLHDQLTNKIRELEDAFDQPGELDLVLERCRTV
                     DLPKLKEMEGWNDARDLPYFEAQLDHLAEFIRNEILINASAMVERVLQDEILSQRFKF
                     LSLCLAHDTNIAAAVQDLVKIDEEFETFGRNFVISSGSSRSSSPPTVSSTQSILKPAT
                     RRSGPRRVTKATDSPTGSSSPNGNNGSNRKNLQTPVVTKTVRWLNLESPSTTPEPTDM
                     DVSMQDAEPVGTAVGAGRPTMLPRQAPRNSLLDRRLGE"
     gene            <697343..>699097
                     /locus_tag="ZYRO0E08690g"
                     /db_xref="GeneID:8204859"
     mRNA            <697343..>699097
                     /locus_tag="ZYRO0E08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499259.1"
                     /db_xref="GeneID:8204859"
     CDS             697343..699097
                     /locus_tag="ZYRO0E08690g"
                     /note="similar to uniprot|P53083 Saccharomyces cerevisiae
                     YGL219C MDM34 Mitochondrial outer membrane protein
                     colocalizes with mtDNA nucleids required for mitochondria
                     shape"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499304.1"
                     /db_xref="GeneID:8204859"
                     /db_xref="GOA:C5E4T8"
                     /db_xref="InterPro:IPR027536"
                     /translation="MSFRFNSQAFEDNSFNEKIREKLTQALNSSSSDSRSPKVTKTTM
                     GEGSTSKKDSGSGGKSRKFDILKSGITVSKVNFPTTPQLEILDLDISAQPRSLVKGIC
                     KISCKDAMLQIQTEVEANLLLVYSECSPSFATPNMICNDSFTIPITMVFSEIRLEAIT
                     NIFVKHSGIGISFNDVNLDFKFDCSMKILQSTIERRLKNSMHHLFKEVLPSVIFSMSQ
                     SLFLSEAARNQEMHNESRGDSRPSPRVVLEESDLQELSPANMLRLSTLISSRQTLSLH
                     GTVLNVPSTIPGCLERQNLHRFNSRIPSLSNYYASYKEEEKSRQVEVKKSVGSSVPLP
                     HTSFAANPNLLPVRTLQEGAYDLPTITGIQNRIFERSTDENERPRRRKLKIKMSGRKQ
                     QPQAPKEEEPKQAEQQPETEPQQQRLLPTPEIPSREQASTPVDIDPTVSTPDSPDTEI
                     TSPKPLSIRNPILSDVEKMDSEDASAKSFVAPLKLPVSITSKYFNYPADHISAQTPRR
                     YSPQRINWEDALFNTSELSNLRTSLYSPIARGSLLNPTKERPDRGRILDNRRLSFVGL
                     NFKGGKWGDDDDPPPYSG"
     gene            complement(<699208..>699525)
                     /locus_tag="ZYRO0E08712g"
                     /db_xref="GeneID:8204860"
     mRNA            complement(<699208..>699525)
                     /locus_tag="ZYRO0E08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499260.1"
                     /db_xref="GeneID:8204860"
     CDS             complement(699208..699525)
                     /locus_tag="ZYRO0E08712g"
                     /note="highly similar to gnl|GLV|CAGL0I06985g Candida
                     glabrata CAGL0I06985g and similar to YGL220W
                     uniprot|P53082 Saccharomyces cerevisiae YGL220W
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499305.1"
                     /db_xref="GeneID:8204860"
                     /db_xref="InterPro:IPR002634"
                     /db_xref="UniProtKB/TrEMBL:C5E4T9"
                     /translation="MKFHLSDPYMVNQHQETRRSRMVSKDQIEIRIKENVSELYQTIV
                     TDISGGCGQSFDIVVVSNSFQGKNKLQRSRWMNTVLKEEIAQIHAFSCKCYTEAEWSK
                     IVT"
     gene            <699587..>700456
                     /locus_tag="ZYRO0E08734g"
                     /db_xref="GeneID:8204861"
     mRNA            <699587..>700456
                     /locus_tag="ZYRO0E08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499261.1"
                     /db_xref="GeneID:8204861"
     CDS             699587..700456
                     /locus_tag="ZYRO0E08734g"
                     /note="similar to uniprot|P53081 Saccharomyces cerevisiae
                     YGL221C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499306.1"
                     /db_xref="GeneID:8204861"
                     /db_xref="GOA:C5E4U0"
                     /db_xref="InterPro:IPR002678"
                     /db_xref="UniProtKB/TrEMBL:C5E4U0"
                     /translation="MSRALARSQLQRFINAVTKYYPSGYADSSWDNTGLLIDCSVEKA
                     SSEEPRVLLTVDLTASVVQEAIEKGCNAILAYHPFIFPSWKSLSPHSNPQHRSALRLI
                     QEGISVYSPHTAVDAAKGGVNDWLAFGLAGNDRYRVVSNVVLEPIKGQCINGEEPSEV
                     GYGRLVTLSAPLSLAQIVENVKKSLGIPHVQVASLAKDHQQHNIRKIALCAGSGSGVF
                     KSLREDVDLYYSGELGHHEVLRYKESGKAVIVCNHSNTERGFLRDEFSKQLQDEGIEN
                     IVSETDVDPLQVV"
     gene            <700580..>701137
                     /locus_tag="ZYRO0E08756g"
                     /db_xref="GeneID:8204862"
     mRNA            <700580..>701137
                     /locus_tag="ZYRO0E08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499262.1"
                     /db_xref="GeneID:8204862"
     CDS             700580..701137
                     /locus_tag="ZYRO0E08756g"
                     /note="similar to uniprot|P40022 Saccharomyces cerevisiae
                     YER034W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499307.1"
                     /db_xref="GeneID:8204862"
                     /db_xref="UniProtKB/TrEMBL:C5E4U1"
                     /translation="MDPYALKQDNRKRFKDKQHAKQRHATPSDRKYRALKRQEQAHED
                     EQEAPPPPPSNEYRYHEDVTMAYGEQQDEERNTHANKRVRELLMNKDEGSGLNLDQGG
                     LSKESQAAVTRKELEKMDVAGLNRVLGRSHTPDLVKHTNDPLAPPRQATKSQEKARKE
                     PSPNKNVSTVPQDLKDDEDFLDGLI"
     gene            <701308..>702291
                     /locus_tag="ZYRO0E08778g"
                     /db_xref="GeneID:8204863"
     mRNA            <701308..>702291
                     /locus_tag="ZYRO0E08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499263.1"
                     /db_xref="GeneID:8204863"
     CDS             701308..702291
                     /locus_tag="ZYRO0E08778g"
                     /note="weakly similar to uniprot|P53080 Saccharomyces
                     cerevisiae YGL222C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499308.1"
                     /db_xref="GeneID:8204863"
                     /db_xref="UniProtKB/TrEMBL:C5E4U2"
                     /translation="MSTDAMYMNSPHVLRASGKHTNRTSHVTKLDKQRIQQNDKGSNK
                     SKNGQVAISVPKTQVLPNGEKPDFGNSNSTRKSKNGTQKKGGAKEQKDVTKGLRSLRL
                     PDEKTKSSRQQQQKEKETQSTKSQSSRPRSNSNASAGLNSSSTPISSTPPTVPTSPLE
                     KPAAAIPNVTPLMAPGAIPVPPPLTGLPNLMPNSIPHPLPPPPTGVQPLPMQPPLFGG
                     PGYPYGNYAVRPMPYMNPQTPSPVVSQMYPQIPLPMMQMQMQMPQVNSDTEAQTTMMQ
                     TTMMTAKPSATSTSSCSNSRRPTTTKSTSFAGASFASKDPVINKLPKPSFA"
     gene            complement(<702554..>704386)
                     /locus_tag="ZYRO0E08800g"
                     /db_xref="GeneID:8204864"
     mRNA            complement(<702554..>704386)
                     /locus_tag="ZYRO0E08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499264.1"
                     /db_xref="GeneID:8204864"
     CDS             complement(702554..704386)
                     /locus_tag="ZYRO0E08800g"
                     /note="highly similar to uniprot|P40024 Saccharomyces
                     cerevisiae YER036C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499309.1"
                     /db_xref="GeneID:8204864"
                     /db_xref="GOA:C5E4U3"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4U3"
                     /translation="MPPVSSSKAKRDAKRVERENKKLEAGKTVRKFGKTKDNSEQKDE
                     ADVAAENVAAMKLQQDEEGISDRVVTGVLDSLKTSRDIKLSSVSLLFHGKVLIQDSIL
                     ELNYGRRYGLLGENGCGKSTFLKALAAKEFPIPEAIDVYLLDEPAEPSEYSALEYVVR
                     EAENELKRLEELVEKIIIDEGPESDYLESLYERMDSLDPDTFETRAAIILVGLGFNKD
                     TIQKKTKDMSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEACVWLEEYLKRFDRTL
                     VLNSHSQDFLNGVCTNMIDMRLQKLTSFGGNYDSYAKTRSELETNQMKQYNKQQEEIA
                     HIKKFIASAGTYANLVRQAKSRQKILDKMEADGLVQPVVPDKVFSFRFQEVERLPPPV
                     LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAG
                     RVSRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLGRYGLTGDG
                     QKAQMGTLSEGQRSRVVFALLALQAPNILLLDEPTNGLDIPTIDSLAEAINTFNGGVV
                     VVSHDFRLLDKIAQDIFVVENKTAYRWDGSILEYKNKLAKNVVL"
     gene            <704618..>705790
                     /locus_tag="ZYRO0E08822g"
                     /db_xref="GeneID:8204865"
     mRNA            <704618..>705790
                     /locus_tag="ZYRO0E08822g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499265.1"
                     /db_xref="GeneID:8204865"
     CDS             704618..705790
                     /locus_tag="ZYRO0E08822g"
                     /note="weakly similar to uniprot|P53079 Saccharomyces
                     cerevisiae YGL223C COG1 Essential component of the
                     conserved oligomeric Golgi complex (Cog1p through Cog8p) a
                     cytosolic tethering complex that functions in protein
                     trafficking to mediate fusion of transport vesicles to
                     Golgi compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499310.1"
                     /db_xref="GeneID:8204865"
                     /db_xref="UniProtKB/TrEMBL:C5E4U4"
                     /translation="MDVDAVGFLRTHSVVEVRDLDLEISGDAAKLYDKFAQELREQYG
                     EILEVTKSVGELFGCLKRGDFELRDLCFRDDLYKLKKLEPLEGTIERENVKESAADDN
                     GAANKVLLISNWSLAISDFVSRFAVSLSSAKLFDQVITQFQNLQEYGQWQEYETVIRD
                     KCEQFVQYLLDSSSNNITFTVGQWARIWSLVFKGTNFPWNGEQVLKLDEILFQSLFQE
                     SLDVLMNDTDEEVSKFVHSSEFEQKLNAKILQDIERQFQLLEDLVSQQEEDTTPTFEY
                     PRAVQELDVAQVVENCRLHSIGLTTRSRVQMYNLVDPLIQMINDLQVHGGQSDQVTQL
                     RRKLATVLKNKIPVTDEHKEPNESLTMDQVLEHLMTNQNDSSASRLIRKQINALGA"
     gene            <705988..>706827
                     /locus_tag="ZYRO0E08844g"
                     /db_xref="GeneID:8204866"
     mRNA            <705988..>706827
                     /locus_tag="ZYRO0E08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499266.1"
                     /db_xref="GeneID:8204866"
     CDS             705988..706827
                     /locus_tag="ZYRO0E08844g"
                     /note="similar to uniprot|P53078 Saccharomyces cerevisiae
                     YGL224C SDT1 Pyrimidine nucleotidase overexpression
                     suppresses the 6-AU sensitivity of transcription
                     elongation factor S-II as well as resistance to other
                     pyrimidine derivatives or to YER037W uniprot|P40025
                     Saccharomyces cerevisiae YER037W PHM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499311.1"
                     /db_xref="GeneID:8204866"
                     /db_xref="GOA:C5E4U5"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR010237"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5E4U5"
                     /translation="MTIAKDSQREYRLHILKQLEENARHLETLDYSGSKVTFPLDQGI
                     PEPDPHAKVFFFDIDNCLYHRSTNIHEIMQQSIRSYLINELSIDEDEAETLNQGYYKE
                     YGLAIRGLMMFHGIDAMEYNRTVDDSLPLQHILKPDLQLRKVLYELRQRGHIDKMWLF
                     TNAYKHHALRVVRILGIADLFDGITYTDYNVGPNSLICKPDPRAFEKAKLESGLGDYS
                     NAYFIDDSGNNVEQGLLLGMSKCIQVVEDNHVDEILGNIPMGALLVNSVSDLPRAVPE
                     LFK"
     gene            complement(<706896..>708026)
                     /locus_tag="ZYRO0E08866g"
                     /db_xref="GeneID:8204867"
     mRNA            complement(<706896..>708026)
                     /locus_tag="ZYRO0E08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499267.1"
                     /db_xref="GeneID:8204867"
     CDS             complement(706896..708026)
                     /locus_tag="ZYRO0E08866g"
                     /note="weakly similar to uniprot|P40026 Saccharomyces
                     cerevisiae YER038C KRE29 Essential protein of unknown
                     function heterozygous mutant shows haploinsufficiency in
                     K1 killer toxin resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499312.1"
                     /db_xref="GeneID:8204867"
                     /db_xref="InterPro:IPR014803"
                     /db_xref="UniProtKB/TrEMBL:C5E4U6"
                     /translation="MSSDSDEDAIIFRQNVNDNELDSSSSSSSSTDEDDRLLQTLKRT
                     SYSSRRVTRSSPIKKSKSVQIQKFDLGRNFDPQLASSLDRIQNVKDEVDNPSTVTTVK
                     EQKSNTVRSRIKPRDASSQYIDLIVRETISGRYIDWHFISNDTRFEDVDIDDELIEDS
                     DNHAVRDAIRRKYPTLLELIESLGADLSLLQEDKPLTRKRDYDSLSEMTPVDSMMRAI
                     GCYQDDKQFIKYLLCFILDRKIWESQDCDDDWCSQMLESVGDEQIIDFYLSLVDPKDY
                     FMHYRLSRCISRLQSPLIHRIIRPITIEEEFTQLIEDKNYESLLYFTLFVYGSHEMPF
                     GPSSRTQYFKDCVEDMCNEGTNAVELSLLRGLLSLFLKIRIS"
     gene            complement(<708203..>709297)
                     /locus_tag="ZYRO0E08888g"
                     /db_xref="GeneID:8204868"
     mRNA            complement(<708203..>709297)
                     /locus_tag="ZYRO0E08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499268.1"
                     /db_xref="GeneID:8204868"
     CDS             complement(708203..709297)
                     /locus_tag="ZYRO0E08888g"
                     /note="similar to uniprot|P40107 Saccharomyces cerevisiae
                     YGL225W VRG4 May regulate Golgi function and glycosylation
                     in Golgi Golgi GDP-mannose transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499313.1"
                     /db_xref="GeneID:8204868"
                     /db_xref="GOA:C5E4U7"
                     /db_xref="InterPro:IPR004689"
                     /db_xref="InterPro:IPR013657"
                     /db_xref="UniProtKB/TrEMBL:C5E4U7"
                     /translation="MSELKVGNEHALARITNNGPISILAYCCSSILMTVTNKFVVNKD
                     DFNMFFVMLVVQCLVCTLVLVVLKGLGYAKFRPLNKTDIKNWMPISFLLVLMIYTSSK
                     ALNLLPVPIYTIFKNLTIILIAYGEVLFFGGSVTSMELSSFLLMVFSSVVATLGDRQD
                     VAAKAQAEALALAQKNAGGVNGAGSGGSLGTAGLANAAANALPGAASSLNVGYVWMLF
                     NCVSSALFVLIMRKRIKLTNFKDFDTMFYNNALAMPILLIASFLFEDWSSANLRVNFS
                     NESMTALVISGAASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLLFFDAPKNF
                     LSILSIFIGFLSGIVYVAAKQKKMKQQPPK"
     gene            <711088..>713649
                     /locus_tag="ZYRO0E08910g"
                     /db_xref="GeneID:8204869"
     mRNA            <711088..>713649
                     /locus_tag="ZYRO0E08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499269.1"
                     /db_xref="GeneID:8204869"
     CDS             711088..713649
                     /locus_tag="ZYRO0E08910g"
                     /note="some similarities with uniprot|P18494 Saccharomyces
                     cerevisiae YER040W GLN3 Transcriptional activator of genes
                     regulated by nitrogen catabolite repression (NCR)
                     localization and activity regulated by quality of nitrogen
                     source"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499314.1"
                     /db_xref="GeneID:8204869"
                     /db_xref="GOA:C5E4U8"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="UniProtKB/TrEMBL:C5E4U8"
                     /translation="MPEGANTFNLYDIIDQTPPTGLTDDIDKESNGENDQHTAPSTFA
                     FNASTFDTMLEVLPDDVGLNIPAFSGAESVPDSDGKRQTSKDINDDDIQGITNSNLGM
                     EGLDDTNLQSHMDLMPPTRPIDIASNQLSGEIAPLWDFKMEDFMMTPAPGDFNSSAPN
                     SFNSNRHFLQSESAPTGQHGSFNGFGSTGFNLTQTLGMGMPQHHFNYNQSTSSSPKTG
                     TNHFNNSNTNGNNNYNHNTDDNVTFNTPQRENSFSQRHSIGSRKPSNQFSKTVHTEDG
                     GIALSSSTTTNSVKKNSLVRQVSSTSLSNYKRGSSSGIPDLPKKPPIQCYNCKTNKTP
                     LWRRDAQGNTMCNACGLFQKLHGTMRPLSLKSDVIKKRNTKKRTEKEKQSQEHGNQSN
                     NTNTNNNNNNTNNNNTKNSRQSTRKNARGSIHGNNDSGGVGGFPVLTQSITVPVTSFE
                     TGVAGSPIVSSLENRSQQLQASSQASSQAQSQSQYERQQNVTTESLNPYNLMDHNKKM
                     ASSNTQCSRKSRRSSTSSNNSSSSKSFSRSVVPILPKPSPGAPQFNVNYNGSSSAGNS
                     AASSPRVFAAGCNPESPMNSCQQTASSNSASKTGISIPRPKSSRNYSSSSSFMAASLH
                     QLQQQHQKQEQPQQHQQSPNVQMGSGGFSMPNSWNSGSQTSIGYSPNSTRSPKGGFDF
                     VGSPVDSSGPGTRTGSRKSHTSLLSQQLQNSALYNEEMAHQQGQSEAHTPNVPQSNGS
                     SNVGTPQPVPLGRNSVTASPRNSYADSLLQQRGMKDELGSSFRRQNSVWARKNVSLKE
                     HVISSNAEATVCSNPNILAATPTVSTTASPAASGETSTEAHKNITDELDWLKFKM"
     gene            <713990..>715735
                     /locus_tag="ZYRO0E08932g"
                     /db_xref="GeneID:8204870"
     mRNA            <713990..>715735
                     /locus_tag="ZYRO0E08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499270.1"
                     /db_xref="GeneID:8204870"
     CDS             713990..715735
                     /locus_tag="ZYRO0E08932g"
                     /note="weakly similar to uniprot|P40028 Saccharomyces
                     cerevisiae YER041W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499315.1"
                     /db_xref="GeneID:8204870"
                     /db_xref="GOA:C5E4U9"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5E4U9"
                     /translation="MGVPQIWELLRPYLQDKRVPLKKFVSDFKFSHGRSPRIAIDGYS
                     WLFECGFILNQETPGKYASHGTIGKAVLNFVYRLKELLALNITFILVFDGSMKPSFKK
                     NFGSPLSCAEDDYWSTWNSHMEIHERNGHCLKIMLDSEGLHFMQVVKGVLGSMRISYV
                     EACGEGEAQCAWLQRNGHVDYVLTNDSDALVFGATRLLRNYSKFTNDLGATGNSPLGK
                     QRSSSKDLFVTVVDLDQLNSATNDRYNWWSLLFFSVLLGADYNQGVKGMGKVKAAKLA
                     QLQDPDFAQRFRDMFADLRRRPQLSEYQNFQQELTEFCKDHSVELFDRNYRAMLGELS
                     LEGWPSLNAIMYYFHPILIPQMDFQVFDKSNVNISGSNGYKEINFLQLQAYLGDFRLP
                     AVTNFEKWFTETILDSFLLRRLLSQDRNLTDYVQIVDQRTFEISGKWPLSCWKIKYKP
                     YILFFQVGESGRNSFPYTMWIPQGLIPQDHILITKWKRTPKSKTPSPSKSKISPQKNT
                     LDSFLKKHASPVKDFSPAKKIDDQVTLEPVKKRLFVDSNDSSNDSEDDSLVILDEITL
                     KDNSSLSTWKKRRQK"
     gene            <715937..>716491
                     /locus_tag="ZYRO0E08954g"
                     /db_xref="GeneID:8204871"
     mRNA            <715937..>716491
                     /locus_tag="ZYRO0E08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499271.1"
                     /db_xref="GeneID:8204871"
     CDS             715937..716491
                     /locus_tag="ZYRO0E08954g"
                     /note="highly similar to uniprot|P40029 Saccharomyces
                     cerevisiae YER042W MXR1 Peptide methionine sulfoxide
                     reductase reverses the oxidation of methionine residues
                     involved in oxidative damage repair providing resistance
                     to oxidative stress and regulation of lifespan"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499316.1"
                     /db_xref="GeneID:8204871"
                     /db_xref="GOA:C5E4V0"
                     /db_xref="InterPro:IPR002569"
                     /db_xref="InterPro:IPR028427"
                     /db_xref="UniProtKB/TrEMBL:C5E4V0"
                     /translation="MVPTLSKGIKFNSQTDKILTVGAGCFWGTEHIYRKYLGERIDDC
                     KVGYANGSEMKKDQTNSVTYKRLCIGDTGFCEVLQIAYNPQKLSLKELVDLFFRCHDP
                     TTANQQGPDAGTQYRSALFAHSEGDLKELKELKDQWQPKWGNKITTEVELIKNFYDAE
                     DYHQLYLDKNPEGYACPTHYVRNL"
     gene            complement(<716557..>716946)
                     /locus_tag="ZYRO0E08976g"
                     /db_xref="GeneID:8204872"
     mRNA            complement(<716557..>716946)
                     /locus_tag="ZYRO0E08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499272.1"
                     /db_xref="GeneID:8204872"
     CDS             complement(716557..716946)
                     /locus_tag="ZYRO0E08976g"
                     /note="similar to uniprot|P53077 Saccharomyces cerevisiae
                     YGL226W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499317.1"
                     /db_xref="GeneID:8204872"
                     /db_xref="GOA:C5E4V1"
                     /db_xref="InterPro:IPR004203"
                     /db_xref="UniProtKB/TrEMBL:C5E4V1"
                     /translation="MWARVTLKPLARRSASSLSYTPPSMVDLPSRWSTMNPQLQEEIT
                     EYLTWKMEDSWKLMTVDELKASYYISYGQWGPRGKTDIQLTPTMLIWKGLFSTLLFTA
                     LGVSLINLKRDKHMDKALNGLQRNSSE"
     gene            <717090..>717428
                     /locus_tag="ZYRO0E08998g"
                     /db_xref="GeneID:8204873"
     mRNA            join(<717090..717110,717189..>717428)
                     /locus_tag="ZYRO0E08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499273.1"
                     /db_xref="GeneID:8204873"
     CDS             join(717090..717110,717189..717428)
                     /locus_tag="ZYRO0E08998g"
                     /note="similar to uniprot|Q92316 Saccharomyces cerevisiae
                     YGL226C-A OST5 Zeta subunit of the
                     oligosaccharyltransferase complex of the ER lumen, which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499318.1"
                     /db_xref="GeneID:8204873"
                     /db_xref="InterPro:IPR020294"
                     /db_xref="UniProtKB/TrEMBL:C5E4V2"
                     /translation="MSYADLQKEFKVAETFEPVFQLSSQSRYALFSLVIAVLLISMAL
                     VSAYSKKGFLIRLAIFAALSAAGSMFSGIGVVFLANSLGVYV"
     gene            complement(<717476..>720061)
                     /locus_tag="ZYRO0E09020g"
                     /db_xref="GeneID:8204874"
     mRNA            complement(<717476..>720061)
                     /locus_tag="ZYRO0E09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499274.1"
                     /db_xref="GeneID:8204874"
     CDS             complement(717476..720061)
                     /locus_tag="ZYRO0E09020g"
                     /note="similar to uniprot|Q753T4 Ashbya gossypii AFR242C
                     AFR242Cp and weakly similar to YGL227W uniprot|P53076
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499319.1"
                     /db_xref="GeneID:8204874"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR006594"
                     /db_xref="InterPro:IPR006595"
                     /db_xref="InterPro:IPR013144"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="UniProtKB/TrEMBL:C5E4V3"
                     /translation="MSAYMDNVDREFIKGLFPEYLLQQPVAYSLWMSYYRHKKVFHKM
                     KHNGISDIGKQQLLSRESGYYRLSNKLSYSARKEIWQKLMSLGVLGTLSFDSANDEYL
                     VQVYKYFHPGPNNNLSGNASSGALPNGSIGMQYASGSGDEMEDLTKPAIAEEEILAEL
                     AMQDADDMEEDDDRDTAEAMDDDEDDDDEDDDDEDNDESNEGVRLGRRDGSNVTDDAN
                     QDSSSGSRSSHGSHHETMNFYPALATHAHPTKSKNNNMTSDVYQMLGYSLPSQWVTQP
                     NNCVLLSADGISRLSPNPNWQAYNAYERSTASTRNRLRNSFSGNQKNDFAVTWANNFL
                     HLNKLGIFYYEIRILGVTSSQGAQNSNIIVGYKCWPDSDVSGTVSKSENERAGLSGSG
                     VPGLGGGLRSSVRSGGGSTGSAAGDDSSSGAKSGIEEGFFGYRGSDGSITVGSQYKSY
                     AKPFGRDDVIGCGVNYVDGTIFFTKNGVFLGTAFTDFHEVNLIPYIALRQGNSVRTNF
                     GLYEEFVFDILGYQNRWKAKAYKHIFKSSDHSDLLDEFDLSDEEDNDQEVKGEKAMEI
                     DNDGLQDTDSDIACIKDSLLLKDTRFEDDQLRKPDVEKINNLNTGDDSIPSTLHTMIN
                     DYLIHEGLIDVSKGFLKDLQRENVSNSSDDRGAAVIRHNERQIIKEEKNLKIRQDLRR
                     FITEGNISQCLSYIESQLPGLLQENIELLFEIRVAQYLLTILHYKKYSIESIVSKGQE
                     LSKDFVYNESVPEDLRERFRAQLSNVSALLAYDDPVNESPEELARYLSNEYLQDRLFQ
                     VINTNILKFLKKNSDSKLETVIRYTRSMLATLMTCNVEGSSVYNGTELRYFKILNIDE
                     DLLNL"
     gene            complement(<720719..>722068)
                     /locus_tag="ZYRO0E09042g"
                     /db_xref="GeneID:8204875"
     mRNA            complement(<720719..>722068)
                     /locus_tag="ZYRO0E09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499275.1"
                     /db_xref="GeneID:8204875"
     CDS             complement(720719..722068)
                     /locus_tag="ZYRO0E09042g"
                     /note="highly similar to uniprot|P39954 Saccharomyces
                     cerevisiae YER043C SAH1 S-adenosyl-L-homocysteine
                     hydrolase catabolizes S-adenosyl-L-homocysteine which is
                     formed after donation of the activated methyl group of
                     S-adenosyl-L-methionine (AdoMet) to an acceptor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499320.1"
                     /db_xref="GeneID:8204875"
                     /db_xref="GOA:C5E4V4"
                     /db_xref="InterPro:IPR000043"
                     /db_xref="InterPro:IPR015878"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020082"
                     /db_xref="UniProtKB/TrEMBL:C5E4V4"
                     /translation="MSAPAQNYKVADISLAAFGRKEIELSEHEMPGLMAIRKAYAAEQ
                     PLKGARIAGCLHMTIQTAVLIETLVALGAEVTWSSCNIYSTQDHAAAAIAASGVPVFA
                     WKGETEEEYMWCIKQQLFAFKDNKKLNLILDDGGDLTSYVHESHPEMLEGCFGLSEET
                     TTGVHHLYRMVKENKLKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMLAGKV
                     AVVAGYGDVGKGCSAALRNMGARVIVTEVDPINALQAAMEGYQVLTMDEAASQGQVFV
                     TTTGCRDIIRGDHFLKMPQDAIVCNIGHFDIEIDVAWLKENAKECINIKPQVDRYLLS
                     TGKHVILLANGRLVNLGCATGHSSFVMSCSFSNQVLAQIALFKANDKAFREKYVEFQK
                     TGPFSLDVHVLPKILDEAVAKFHLGKLGVQLTQLTDVQSEYLGIPQEGPYKADHYRY"
     gene            complement(<722374..>724443)
                     /locus_tag="ZYRO0E09064g"
                     /db_xref="GeneID:8204876"
     mRNA            complement(<722374..>724443)
                     /locus_tag="ZYRO0E09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499276.1"
                     /db_xref="GeneID:8204876"
     CDS             complement(722374..724443)
                     /locus_tag="ZYRO0E09064g"
                     /note="some similarities with uniprot|P53075 Saccharomyces
                     cerevisiae YGL228W SHE10 Putative
                     glycosylphosphatidylinositol (GPI)-anchored protein of
                     unknown function overexpression causes growth arrest"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499321.1"
                     /db_xref="GeneID:8204876"
                     /db_xref="GOA:C5E4V5"
                     /translation="MKILTKFFLLLVVTTCSLHYYCQIGQCSTQLQRVCHYTTPSVWD
                     ELLVEKNEFYREQLNPKVKVLKSHISQINSHYQDKVLPKLVDLGNRFYFDIVSPRIDN
                     VCEFWEEFELKPYRERSLNQIRKVRQRIWFYYSVYLKPNLTKLDNQYALSDKYGKVHN
                     KIAPFVAEIAQNFQNVYHQAAAKVHPHWENLRRTVNAKWEPISSSLWQRCRTNEICFK
                     TNAQLKNIWKNLKLGCDYLSIYVHDALSPYSDGLESNVRATKAKSKSKPRVNASASAR
                     GNARAGAKAGAKAGTSEISASATADPTTSASATVTAGFEDDYDDEEPLYTSTSTIMLT
                     VTMSTDQNELSPSQNTANAELGISEQDAIKDEFEAWFKVVDQKSSGVVKTFNKEVNKY
                     LHHRVQQLDSIFQNKTKTVSEVLQNRYKNLNRAIQDINCTCETDTGAGNQTCFDSTGT
                     TQLSEYITRSKMRELFAEAHSTLDQSMLQLKQDLEPIAQEVESRVSLIREEMVEVYEE
                     WGDAMVSEWSKRLAYIDVVAGHLDDNGASTDEESSENWRKFLNLKKQVIKARDELAEH
                     PADLHEIKQFVKKVHYLIEVLAKEAGEYLYILRARANLAFQAREQESKQREDSPRMDR
                     DSTQNVENSNTTTASAEKSGKKAKKVKRVAQNGTNSTEKFSAGPDSSSKEPSMETTVQ
                     NNVTLQI"
     gene            <725543..>728698
                     /locus_tag="ZYRO0E09086g"
                     /db_xref="GeneID:8204877"
     mRNA            <725543..>728698
                     /locus_tag="ZYRO0E09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499277.1"
                     /db_xref="GeneID:8204877"
     CDS             725543..728698
                     /locus_tag="ZYRO0E09086g"
                     /note="weakly similar to uniprot|P43612 Saccharomyces
                     cerevisiae YFR040W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499322.1"
                     /db_xref="GeneID:8204877"
                     /db_xref="InterPro:IPR007587"
                     /db_xref="UniProtKB/TrEMBL:C5E4V6"
                     /translation="MSFWPFGQSISSSNINKILDEYFSVLHSLEKSNPNVAKSVRQSL
                     HGAQETIQRSGGEFVDSLDYVPEDELLESTGSIQQRDRSNSSSGSSSSSSSSSLSSSK
                     SGSSGTDLDDDEIQNSTAPLVTATSIASLNSSYINRLLNESELLNELTRQNSNLLDFI
                     CFGFFYDEKTKNKIPFLEYLIDQLMDCIDKISPSTTSLADVLEVESTPPQPPPPPETE
                     RTTGSMDDENNDNNDDDDEDDETNDKEPNYLSRATIISEIFSLDIWLITESLVNNQSY
                     LSKIWSMLNHPNLKTERSPLVPIFLKINQNFLITKQDQYLNFVRLRTNLVDDMLQHIS
                     ISMLMDFFLKCIATDKFESPTGLIELVNDQRLIPKCLNFLNNDVYSSDVQACAGDFLK
                     ALIAISANAPLDDMSIGPNALTRQLASQESIDQLVDIIINKRGPALNTTVSIVIELIR
                     KNNSDYDQVNLLTTTIRSHPPSNHDPIYLGYLLKTFSRHLPTLFKIIIDAENDNNKPM
                     LENQLHQKFRPLGFERFKIVELVAELLHCSNMGLMNSKRAERIVKERDHFRKHMVNQL
                     QDAIQDLTIASKDSPNATITSSSSKRRSSKSRRDSKSDRRYSADDSDISSKDKRQKRR
                     QKENQKHQQLKYTHDNNDDDDDNGCQVYDNDEGNDNEAAKSVSPMTTTTTTTTDYDSI
                     TTNGHDAGVTQDNDNDDNNTNNINNNTNTNASASTTTTNNNNNNNNNNNNNNNNNNNN
                     NDNNDNDDNININDNGINNEFDDEEDEVDESFEIPYVNVNQSNKLRKKPTVGDFFKIQ
                     LYDVQFLPKIIELFLTHPWNNFWHNVIFDIIQQIFNGRMDFSYNSFLVYSLFNLRGSL
                     QFMPTELQKQNSRDFTLTKDFILQGYQDSYHFYEKYHTNLGYMGHLVLIAEEVVKFSK
                     LYKVELISPDIHQALQDEEWRFYAEDVLNDTRMMYSKILGGGNYVDDGNGNIIPQLPD
                     PSLPPSENENSTVGGGLINVESLEEQLGLSTESDLHDKLRELLISSSQKEIDSRNERN
                     GVIVLGPPSQDFDDDTIDDDE"
     gene            complement(<728771..>729667)
                     /locus_tag="ZYRO0E09108g"
                     /db_xref="GeneID:8204878"
     mRNA            complement(<728771..>729667)
                     /locus_tag="ZYRO0E09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499278.1"
                     /db_xref="GeneID:8204878"
     CDS             complement(728771..729667)
                     /locus_tag="ZYRO0E09108g"
                     /note="similar to uniprot|P43613 Saccharomyces cerevisiae
                     YFR041C ERJ5 Endoplasmic reticulum protein that may
                     function as a cochaperone as suggested by the presence of
                     a DnaJ-like domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499323.1"
                     /db_xref="GeneID:8204878"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5E4V7"
                     /translation="MPSIGIGIWLLLICAVGYCFTNAEVEIFQLQQELVKKYGSDIDF
                     YHFLKLPNLQGSTAKEITKNFRKLSKKYHPDKNKKFKKLYGRLNIATQVLTNENTRKT
                     YDYYLKHGFPDYDFSKGGFFFRRVQPKTWFIILFVYTSASLIHYILLKTQAQSQRKRI
                     QFFIDQVKSQDDTRGLGEKKLAFQQHAEDEPREITIRYGDVFITEEDGAETAISPDTV
                     PEPGVLDTLFFRLPWIIIRPFVKPLLKPFVSDKKQERSKKSEKVNLEVDVQDSKPKKN
                     ATTKSNQKVLANGKVLTARKRK"
     gene            <729760..>730431
                     /locus_tag="ZYRO0E09130g"
                     /db_xref="GeneID:8204879"
     mRNA            <729760..>730431
                     /locus_tag="ZYRO0E09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499279.1"
                     /db_xref="GeneID:8204879"
     CDS             729760..730431
                     /locus_tag="ZYRO0E09130g"
                     /note="similar to uniprot|P43614 Saccharomyces cerevisiae
                     YFR042W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499324.1"
                     /db_xref="GeneID:8204879"
                     /db_xref="UniProtKB/TrEMBL:C5E4V8"
                     /translation="MLRIQENYLVLLKTKVSVQIQSSMALFSHSTISKLYQWYQICTT
                     FLYLALLARWIILLPLVGSKFLPGGIHEFLCHLMVWSSLAELVWLFKFHGFKNGLQSR
                     TLVKCLNFFYFVTVLHFHDDYEHALVLKNTSYSSFIIGLSLTQSHSHWCKLFKRGFVS
                     KKSWFYKLETWIWMPVLYISEFYLLLLNVQNPNFHSTPVLDRINRVVLVLFFPIALTL
                     YKRQL"
     gene            complement(<730474..>731187)
                     /locus_tag="ZYRO0E09152g"
                     /db_xref="GeneID:8204880"
     mRNA            complement(<730474..>731187)
                     /locus_tag="ZYRO0E09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499280.1"
                     /db_xref="GeneID:8204880"
     CDS             complement(730474..731187)
                     /locus_tag="ZYRO0E09152g"
                     /note="similar to uniprot|P43615 Saccharomyces cerevisiae
                     YFR043C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499325.1"
                     /db_xref="GeneID:8204880"
                     /translation="MIMDSVSSPEQPKNKILVTFGDGDSIHQRELISQLFGIDIGIGD
                     RIVKGLVWKTKYYRVEFDLYIDDYNDFSSWFQEFASEEFAALREAMAGLVVVDQYEPT
                     KPLNPLGLQDTFVVWVNTDSKVGQDQVDEINDKLFQTEESTVELVNLHSNEDTNEYGE
                     KIGIPRFKEIVDTCSWKNCDMDYLTSTSSTTNPEVSLELIVQRMQHARLKHANSEMDN
                     DEALQIAQEIAEELTGKED"
     gene            <731394..>731816
                     /locus_tag="ZYRO0E09174g"
                     /db_xref="GeneID:8204881"
     mRNA            <731394..>731816
                     /locus_tag="ZYRO0E09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499281.1"
                     /db_xref="GeneID:8204881"
     CDS             731394..731816
                     /locus_tag="ZYRO0E09174g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499326.1"
                     /db_xref="GeneID:8204881"
                     /db_xref="UniProtKB/TrEMBL:C5E4W0"
                     /translation="MLVNLFKSHKERPVDPVTECSFNDGTPSPDKSSIPECPVKNHNS
                     SQLRRPQSHDEERKTKFYSRICNKVINSINSRTFKVLMILAAVLNVLQLIAFFLIGVL
                     YLPKRTKKNLKNDDIYFMMDHVADNYIDYDFFLNESVL"
     gene            <731918..>732499
                     /locus_tag="ZYRO0E09196g"
                     /db_xref="GeneID:8204882"
     mRNA            <731918..>732499
                     /locus_tag="ZYRO0E09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499282.1"
                     /db_xref="GeneID:8204882"
     CDS             731918..732499
                     /locus_tag="ZYRO0E09196g"
                     /note="similar to uniprot|P53073 Saccharomyces cerevisiae
                     YGL231C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499327.1"
                     /db_xref="GeneID:8204882"
                     /db_xref="InterPro:IPR009445"
                     /db_xref="UniProtKB/TrEMBL:C5E4W1"
                     /translation="MSKVDAAAVEPHQWATNLTDSKYAKNLTIVTSNSMPSPSGFSSI
                     ESTGRDSLEGRKNKFNSHVKSEDVVTLQMQKAWQIALAPAKSIPMNFFMSYMSGTSLQ
                     IIPIMTALMLLSGPIKSIFQVRANFRPVLGTSVTESQILVPMLVFIACQFALMYIGFQ
                     KLNSMGLIPNTTSDWLSWEKRIDYNNGIRSFSF"
     gene            complement(<732536..>733473)
                     /locus_tag="ZYRO0E09218g"
                     /db_xref="GeneID:8204883"
     mRNA            complement(join(<732536..733342,733420..>733473))
                     /locus_tag="ZYRO0E09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499283.1"
                     /db_xref="GeneID:8204883"
     CDS             complement(join(732536..733342,733420..733473))
                     /locus_tag="ZYRO0E09218g"
                     /note="similar to uniprot|P53072 Saccharomyces cerevisiae
                     YGL232W TAN1 Putative tRNA acetyltransferase RNA-binding
                     protein required for the formation of the modified
                     nucleoside N(4)-acetylcytidine in serine and leucine tRNAs
                     but not required for the same modification in 18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499328.1"
                     /db_xref="GeneID:8204883"
                     /db_xref="GOA:C5E4W2"
                     /db_xref="InterPro:IPR004114"
                     /db_xref="UniProtKB/TrEMBL:C5E4W2"
                     /translation="MSKRSFGGVSRDSGKRKKFKLSTGFLDPGTSGIYATCARKHEKQ
                     AAQELSIVFEEKLEEMYGDELKKINEEKNDGEDDDKEVEALSIEDEVKRELSQLNGSK
                     DSSNQGQDRQKEILKFIDLSCECVIFCKTRRPVVPEQFVKSIMEDLADPSDMAKRTRY
                     IQKLTPITYSCSSSMEQLGKLAAKVLQPHFHDPSVTQDYKFAVEVTRRNFNTLERDDI
                     IKKVVSEVLNGSEHNHQIDLKNYNKLILVECFKNNIGMSVVDKDYITKFRKYNVQQIY
                     EKKLKEQNEK"
     gene            complement(<733659..>736304)
                     /locus_tag="ZYRO0E09240g"
                     /db_xref="GeneID:8204884"
     mRNA            complement(<733659..>736304)
                     /locus_tag="ZYRO0E09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499284.1"
                     /db_xref="GeneID:8204884"
     CDS             complement(733659..736304)
                     /locus_tag="ZYRO0E09240g"
                     /note="similar to uniprot|P22224 Saccharomyces cerevisiae
                     YGL233W SEC15 Essential 113kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which mediates polarized targeting of vesicles to
                     active sites of exocytosis Sec15p associates with Sec4p
                     and vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499329.1"
                     /db_xref="GeneID:8204884"
                     /db_xref="GOA:C5E4W3"
                     /db_xref="InterPro:IPR007225"
                     /db_xref="UniProtKB/TrEMBL:C5E4W3"
                     /translation="MDQEAQTQVSQEFQKVLLSSVSASLPSIVDDDTKNLSGQDDVLE
                     LDPSAFDKWVPYLRRSVERDQLGLATEELYNSVDDHFEGLEVELLQDSQVNDKLRNSI
                     GQISRVHNLIENSLVRDISNIQDQLNYSTNEVIMKKEVYVNDKKTSLKILEANILITK
                     VLQILELSNKCQELIIERDFFKALQNLDSLEKIYLQEFKNYNFQFLKEIYNSIPYLKS
                     SIKNECINSIRNHFNSNIGKNIADVGEGYFNVYDEKLFPTWLEKKDHMKLANFKFNSP
                     VEVSLRDEDLVEELNLEKFFHLDEFHDSILIFRSLNELDYLISEFRREYEFRKAKLID
                     PLTWRKSQKGNGSAFGDFTNDLFAQSLTMDFLKQYFLKILGFLLYDINLNRSTDFILV
                     DNDYNATNEFWDALMLRLEPYLKHFVRKLQTEEELGEFKNFMCMYVCILENHNLNIEP
                     LYRLLIVVFEKVCNVNTTAFSAEFDILLHDDDFMPLAISDRGLYEKMLKICWMKDDEL
                     AKARAEAAEQNGQFTITLPFSPLYPMTCTLLKKTYNKLIHFIGTYYRHELHTLNNILV
                     KTMESIFSKIINEKIRAKLDSTSREEIAQILINLDYFVIAAKEFSNMMTRDNILQNPS
                     IEIKLASINNYVESRKYAEDQLIELIDSKVTDILETVDLDWRAMEVRQEPDISIVDVA
                     QFLEMMFSSTLVNLPYSVQTLLIFREFDSLTRQFLDILLHETPPKITQESILNFEVDM
                     KYLEGIISRIFPQRESESNGNNELQSPLMITSPTINGFTRSSNTIGNNVKSLEATFTE
                     LKQCIELMKLENMGEYNDSEIRLRKYPRIKPEDASLLISKVEIPMNDVQSSFDDIDLN
                     NSSQESNFRELSTNGKKIAKFFNRG"
     gene            complement(<736735..>738267)
                     /locus_tag="ZYRO0E09262g"
                     /db_xref="GeneID:8204885"
     mRNA            complement(<736735..>738267)
                     /locus_tag="ZYRO0E09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499285.1"
                     /db_xref="GeneID:8204885"
     CDS             complement(736735..738267)
                     /locus_tag="ZYRO0E09262g"
                     /note="highly similar to uniprot|P43616 Saccharomyces
                     cerevisiae YFR044C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499330.1"
                     /db_xref="GeneID:8204885"
                     /db_xref="GOA:C5E4W4"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="InterPro:IPR017153"
                     /db_xref="UniProtKB/TrEMBL:C5E4W4"
                     /translation="MLTRALGVSSCLRRIATPNIVKRTVMTTNLQPKFEKLFDRIDAL
                     KPAFIERLGQAVEIPAVSGDETLRPQVVKKAHFLVDQLSKLGFTDIQLKHLGKQPPPT
                     SIPDLQLPPVVLSRFGNDPSKKTVLVYGHYDVQPASLEDGWDTEPFKMYVDEKLQLMR
                     GRGTTDDTGPLTGWLNVVQAHKEAGVELPVNLVTCFEGMEESGSLGLDDLIAREAQGY
                     FKGVDAVCISDNYWLGTKKPVLTYGLRGVNYYQTTVEGPAADLHSGIFGGVVAEPLVD
                     LTQVLSSLVDSKGKILIDGIDEMVAPLTEKEKKLYENIDFSLDDLNAATGSQTALYNK
                     KEDILMHRWRYPSLSLHGVEGAFSSAGAKTVIPAKVHGKFSIRTVPDIDSDKLTKLVQ
                     DHCNKVFAKLGSPNKCSTELVHDGNYWVSDPHNASFTAAAKATKDVYGVEPDLTREGG
                     SIPITLTFQDQLKCNVLLLPMGRGDDGAHSINEKLDISNFVGGMKMMGAYLHYYAESK
                     EN"
     gene            <738556..>739658
                     /locus_tag="ZYRO0E09284g"
                     /db_xref="GeneID:8204886"
     mRNA            join(<738556..738567,738660..>739658)
                     /locus_tag="ZYRO0E09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499286.1"
                     /db_xref="GeneID:8204886"
     CDS             join(738556..738567,738660..739658)
                     /locus_tag="ZYRO0E09284g"
                     /note="weakly similar to uniprot|P43617 Saccharomyces
                     cerevisiae YFR045W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499331.1"
                     /db_xref="GeneID:8204886"
                     /db_xref="GOA:C5E4W5"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5E4W5"
                     /translation="MVESKELTTELIAGSAAAVFQTTISYPFEFLKTGLQLQRSLPGT
                     APFNMLHSVKTYFTGSSALNIAAIIKTTTRFTTFEKACQMLRDPSLPAGTPLSGPRLL
                     MAGTITGFMESLWIIPFENIKVTMIENGIKDSEKSQKKPEVTDKTTKKPLQENRPTFH
                     ASTSNGKPQLTPQEAAFLKYEKAPPLHFFPTIKEIYLTRGIQGFFKGSFPTIFRQMGN
                     TAVRFTVYTSLKQTISPNKPLKEHYAFAIGFVSSCAVVGITQPIDVVKTRMQSKYAWM
                     TYKNSLNCAYRIFVEEGVGKFWKGWIPRLFKVGLSGGMSFGVYQYVENLVTLMRSEGY
                     LE"
     gene            complement(<739724..>742108)
                     /locus_tag="ZYRO0E09306g"
                     /db_xref="GeneID:8204887"
     mRNA            complement(<739724..>742108)
                     /locus_tag="ZYRO0E09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499287.1"
                     /db_xref="GeneID:8204887"
     CDS             complement(739724..742108)
                     /locus_tag="ZYRO0E09306g"
                     /note="similar to uniprot|P07244 Saccharomyces cerevisiae
                     YGL234W ADE5 7 Bifunctional enzyme of the 'de novo' purine
                     nucleotide biosynthetic pathway contains aminoimidazole
                     ribotide synthetase and glycinamide ribotide synthetase
                     activities"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499332.1"
                     /db_xref="GeneID:8204887"
                     /db_xref="GOA:C5E4W6"
                     /db_xref="InterPro:IPR000115"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR004733"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="InterPro:IPR020559"
                     /db_xref="InterPro:IPR020560"
                     /db_xref="InterPro:IPR020561"
                     /db_xref="InterPro:IPR020562"
                     /db_xref="UniProtKB/TrEMBL:C5E4W6"
                     /translation="MSLNILILGSGGREHALVWKLAESPSVKKIYLAPGNGGTAVGAH
                     GKTVNVPDMSISPSNFENLAKFAVEHDIGLVVPGPEQPLIDGVAEFFKKVGIPVFGPG
                     KATAAFEGSKTFSKDFMHKHNIPTARYGNFSAYEDAKKFLDSVDFQVVLKADGVAGGK
                     GVLIPNSMQEAQESLKAIMVEKQFGSAGDSIVIEEYLEGDEISILTISDGYSYVNLPA
                     AQDHKRIGENDTGLNTGGMGAYAPAPVATPQLLQQIDSEIVKPSIDGMRKERRPLVGV
                     LFTGIILTKNGPKVLEYNVRFGDPETQTVLPLLSDDTDLAEVMLAAAEHRLDSVEIKL
                     KENTYATTVVLAAGGYPDKYDKGEEITVDEELLPKGSYVFHAGTTLKDGKIVTAGGRV
                     IAASAVGSTLREAVDTAYQAIKCIHFKNSYYRKDIAHRAFRDADVAASTGITYADSGV
                     SVDNGNLLVQRIKEKVKSTSRPGADSDIGGFGGLFDLKQAGYNTDDTLLVGATDGVGT
                     KLMIAQENNIHNTVGIDLVAMNVNDLVVQGAEPLIFLDYFATGKLDLKVASDFVSGVA
                     DGCIESGCALVGGETSEMPGMYPEGHYDTNGTAVGAVRKTDILPKISAMQEGDVLLGL
                     ASDGIHSNGFSLVRKIIEHTGLPWDAKSPWDSTKTLGEAVLVPTKIYVKQVLPSIKEN
                     LLLGLAHITGGGLIENIPRALPSHLQAKLDINTWEIPEVFKWLGKAGNVPVDDILRTF
                     NMGIGMVLIVKKENVSRVKQHLKTANQKTFEIGTLVHKNENQPGCVIDNAVNLY"
     gene            <742766..>744850
                     /locus_tag="ZYRO0E09328g"
                     /db_xref="GeneID:8204888"
     mRNA            <742766..>744850
                     /locus_tag="ZYRO0E09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499288.1"
                     /db_xref="GeneID:8204888"
     CDS             742766..744850
                     /locus_tag="ZYRO0E09328g"
                     /note="highly similar to gnl|GLV|KLLA0A00935g
                     Kluyveromyces lactis KLLA0A00935g and similar to YGL236C
                     uniprot|P53070 Saccharomyces cerevisiae YGL236C MTO1
                     Mitochondrial protein required for respiration in
                     paromomycin-resistant 15S rRNA mutants forms a heterodimer
                     complex with Mss1p that plays a role in optimizing
                     mitochondrial protein synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499333.1"
                     /db_xref="GeneID:8204888"
                     /db_xref="GOA:C5E4W7"
                     /db_xref="InterPro:IPR002218"
                     /db_xref="InterPro:IPR004416"
                     /db_xref="InterPro:IPR020595"
                     /db_xref="InterPro:IPR026904"
                     /db_xref="UniProtKB/TrEMBL:C5E4W7"
                     /translation="MSKSNARDMLTRRVFQLRNFPTLRNSLVSKRSLVLTADLERTLS
                     KLPDEGVVVVGAGHAGCEAATGSARTGAPTVLITPFLNKIGTCSCNPSMGGVGKGTLL
                     REVDALDGVAAKVTDLAGIQFKMLNRSRGAAVWGPRAQIDREIYLREMQNKLNNYPNL
                     RLWEGKVKDLIVDIRKNQNSNYTYGAVKGVILEDGSLLKSSKVVITTGTFLSAEIHIG
                     LETFPAGRMGEGATYGISETLEDAGFQLGRLKTGTPARLDGRTIDYTHLEKQYGDDPP
                     HPMSLINEDVSIKDQVLCYGTYTNLGLHDYIRSNLHRAMHIRETIKGPRYCPSIEAKI
                     LRFSDKDSHRIWLEPEGLNTDVIYPNGISNSMPEDVQIQMMRMIPGLENVEILQPAYG
                     VEYDYVDPRQLRQTLETKLISGLYLAGQINGTTGYEEACAQGVVAGINAGLLHMNREP
                     LKLSRSDAYIGVLIDDLITKGVEEPYRMFTSRSEFRVSVRADNADFRLTELGRKLGVV
                     GDDRWSIFQSYKNQYLNIESKLKDFNLSARKWTNLLNIQVADSAKNRSAWELFRFNGV
                     TLEKMMEAVPELGIDINELPRHVLVKVNVQGKYSPYISRQNQYVKAFQADENMVLPQN
                     FDYSQLPSLSFECKTLLNTIQPETIGQARRIQGITAASLFELYRLVKSKQRVLQSTPN
                     SVNIPNTAEQKL"
     gene            complement(<744883..>745848)
                     /locus_tag="ZYRO0E09350g"
                     /db_xref="GeneID:8204889"
     mRNA            complement(<744883..>745848)
                     /locus_tag="ZYRO0E09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499289.1"
                     /db_xref="GeneID:8204889"
     CDS             complement(744883..745848)
                     /locus_tag="ZYRO0E09350g"
                     /note="weakly similar to uniprot|P43618 Saccharomyces
                     cerevisiae YFR046C CNN1 Kinetochore protein that
                     co-purifies with Nnf1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499334.1"
                     /db_xref="GeneID:8204889"
                     /db_xref="UniProtKB/TrEMBL:C5E4W8"
                     /translation="MDTPKRFNDPGSDFLATTPFRERALQEQRLKEELLSSATPGWRR
                     KSPERHVDAISKDPSEVKEYLRDLSSVLVSQGRNLTSFLAEQVSTQDDQADTEIKSSP
                     KEPTPQKPHYSIAESVLSQLESGIRKPKIRKIDGLVIKDKARTPFQEDHLPERQMSLQ
                     ESVRSPSVVEESIPIPEDDYEDEPLVENGLDPSPLASAPIESPQGFESDQSSVDSEPE
                     TVDPLNITRLKHSLGQFMNENDIKLGQGSWRSLQDASVTLVERLAKHFTEEDRKIVLD
                     RQSILKMLEQFEIVPLRATNDDIFEMCCKYLPLEDLNELEMGLFL"
     gene            <746695..>747645
                     /locus_tag="ZYRO0E09372g"
                     /db_xref="GeneID:8204890"
     mRNA            <746695..>747645
                     /locus_tag="ZYRO0E09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499290.1"
                     /db_xref="GeneID:8204890"
     CDS             746695..747645
                     /locus_tag="ZYRO0E09372g"
                     /note="some similarities with uniprot|P06774 Saccharomyces
                     cerevisiae YGL237C HAP2 Subunit of the heme-activated
                     glucose-repressed Hap2p/3p/4p/5p CCAAT-binding complex a
                     transcriptional activator and global regulator of
                     respiratory gene expression contains sequences sufficient
                     for both complex assembly and DNA binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499335.1"
                     /db_xref="GeneID:8204890"
                     /db_xref="GOA:C5E4W9"
                     /db_xref="InterPro:IPR001289"
                     /db_xref="InterPro:IPR018362"
                     /db_xref="UniProtKB/TrEMBL:C5E4W9"
                     /translation="MNDQGEEHQPLDIGLLRYSTDEIGMRSAPNTMSDKITKVAKDVL
                     VEQSNPADIYLYDQPQEALRQNAHKRSLETQQSLTSTTSNYGNDKNTTDYTNDTNNRI
                     NSNNDSNNDSPHDINYNNSSNNNMDVQSMLTPLKQRDRHDYREDHHKQQNLGPDKGPP
                     ITASHESSIPASQEMQSADTLLTRTTFDTRGSNEGNDPTEQPFYVNAKQYYRILKRRY
                     TRAKLEENLRISRERRPYLHESRHKHAMRRPRGQGGRFLTLAEIEAMKLKEGSASSGS
                     SVSSPPSIKSESEHMGPGPRLIEKQGPKPKKLKPADGSHR"
     gene            complement(<747966..>750848)
                     /locus_tag="ZYRO0E09394g"
                     /db_xref="GeneID:8204891"
     mRNA            complement(<747966..>750848)
                     /locus_tag="ZYRO0E09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499291.1"
                     /db_xref="GeneID:8204891"
     CDS             complement(747966..750848)
                     /locus_tag="ZYRO0E09394g"
                     /note="highly similar to uniprot|P33307 Saccharomyces
                     cerevisiae YGL238W CSE1 Nuclear envelope protein that
                     mediates the nuclear export of importin alpha (Srp1p)
                     homolog of metazoan CAS protein required for accurate
                     chromosome segregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499336.1"
                     /db_xref="GeneID:8204891"
                     /db_xref="GOA:C5E4X0"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR005043"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013713"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E4X0"
                     /translation="MGDLGTIAKFLEESVVASTAKSAERNLGSLETQPEFGLSLLHIV
                     ASTNLPLATRLAGALFFKNYVKRRWIDEDGNHLLPASDTELIKKEIVPLMISLPNNLQ
                     IQIGEAISAIADSDFPGNWPTLLNDLASRLTADDMVTNRGVLIVSHSIFKRWRPLFRS
                     DELFLEIKMVLEVFTEPFLSLLKTVDEQIQQNGNNQQQLQVLFEVFLLLVKLYYDFNC
                     QDIPEFFEDNIQTGMGILHKYLAYSNPLLDDPDDSETASVLIKVKSSIQELVQLYTTR
                     YEDVFGDMINDFIQITWSLLTAMSSEPKYDILVSKSLAFLTAVSRIPKYFEIFNNEFA
                     MNNIAEQIILPNVTLRESDIELFEDDPIEYVRRDLEGSDTDTRRRACTDFLKELKEKN
                     EQLITNIFATHVQKFFEQYQLNPTENWRYKDLSIYLFTALAINGNVTSSGVSSTNILL
                     DVVDFFTKQIAPDLTNSVPHVILRVDAIKYIYIFRNQLNKPQLIEILPILANFLERDE
                     YVVYTYAAITIERILTIRESITSPNFVFNKMDLTNSAEPLLTNLIKLILKQGSSPEKL
                     AENEFLMRAVFRVLQTAEDTIQGLASHLLQELLGIVTIISKNPSNPRFTHYTFESIGA
                     IESHSPLELLPQIVQSIVPVFLEILSEDIQEFVPYVFQLFAFCVEKGKSVPDSIKQLA
                     QPILSPPLWEMKGNVPAVTRILKSFIKADQSLFPNLIPVLGVFQRLIASKAYDIYGFE
                     ILEVIILHIDMERLKPYLKQIAVLLLQRLQTSKTERYVKQLVVFLATISIKLGPDFVV
                     EFIDGVQDGVFSQIWGNFILTTLPGIGHLLSRKIALVGTLNVMISGNIFVNKYQPLLV
                     PTLEAIVETASSQSIANLTNDHIDFDNMEEISTFGSSFSRLVSVTERPVDPLADIDLT
                     NGLRSYVATSLSKYNESSGMALVSNLAPQLPQDAQIKLKDLMSVAV"
     gene            complement(<751079..>751864)
                     /locus_tag="ZYRO0E09416g"
                     /db_xref="GeneID:8204892"
     mRNA            complement(<751079..>751864)
                     /locus_tag="ZYRO0E09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499292.1"
                     /db_xref="GeneID:8204892"
     CDS             complement(751079..751864)
                     /locus_tag="ZYRO0E09416g"
                     /note="similar to uniprot|P53068 Saccharomyces cerevisiae
                     YGL240W DOC1 Processivity factor required for the
                     ubiquitination activity of the anaphase promoting complex
                     (APC) mediates the activity of the APC by contributing to
                     substrate recognition involved in cyclin proteolysis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499337.1"
                     /db_xref="GeneID:8204892"
                     /db_xref="InterPro:IPR004939"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="UniProtKB/TrEMBL:C5E4X1"
                     /translation="MIVVTTREVTKSSMDPQQVENLLDKLAPTSALGPVINQKEPKTV
                     LDDTVIDEGTKNMFVNGFQDESKYAHMTAEKLSTRFLQGLQLFDTDSTCNVNHLAHWK
                     PSSFKMGNSIDNALDDNPDTYWQSDGVQPHQLDITFSKRIDVILIAFYFSLIADESYT
                     PRLIKIYVGHSPSDALFYKTLEVRNVNGWVALTFEDNRSSDNLLKCQFIRIVFPVNHE
                     NGKDTHLRGIRIFAPSKKTSVENSEWMQSLASSNQLVTQCSLR"
     gene            complement(<751942..>752829)
                     /locus_tag="ZYRO0E09438g"
                     /db_xref="GeneID:8204893"
     mRNA            complement(<751942..>752829)
                     /locus_tag="ZYRO0E09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499293.1"
                     /db_xref="GeneID:8204893"
     CDS             complement(751942..752829)
                     /locus_tag="ZYRO0E09438g"
                     /note="highly similar to uniprot|P43619 Saccharomyces
                     cerevisiae YFR047C BNA6 Quinolinate phosphoribosyl
                     transferase required for biosynthesis of nicotinic acid
                     from tryptophan via kynurenine pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499338.1"
                     /db_xref="GeneID:8204893"
                     /db_xref="GOA:C5E4X2"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR004393"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR022412"
                     /db_xref="InterPro:IPR027277"
                     /db_xref="UniProtKB/TrEMBL:C5E4X2"
                     /translation="MAHYENLLPSNGQWKQDITNWLQEDVPSFDYGGFVVGSDQKAAT
                     LFCKQDGYLSGVPFANEVFKQCELQVEWYFQEGDQLLISKAPQGKLPVAKVTGKAKDV
                     LLAERTALNILSRSSGIATSSRRLMEAAKSVGYRGTIAGTRKTTPGLRRLEKYSMLVG
                     GCDPHRYDLSSMVMLKDNHIWSTGSITNAVYAARRVCGFAVKIEVECQSEQEADEAIE
                     AGADVIMLDNFEPEGLKICASSLKTKWKGQREFLLECSGGLKLDNLQGYLCPEIDIYS
                     TSSIHQGTGVVDFSLKIDH"
     gene            complement(<753030..>756059)
                     /locus_tag="ZYRO0E09460g"
                     /db_xref="GeneID:8204894"
     mRNA            complement(<753030..>756059)
                     /locus_tag="ZYRO0E09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499294.1"
                     /db_xref="GeneID:8204894"
     CDS             complement(753030..756059)
                     /locus_tag="ZYRO0E09460g"
                     /note="similar to uniprot|P53067 Saccharomyces cerevisiae
                     YGL241W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499339.1"
                     /db_xref="GeneID:8204894"
                     /db_xref="GOA:C5E4X3"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E4X3"
                     /translation="MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQV
                     AADTQQELPSRQFALLTLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDE
                     HQPSKIRNGASYAVVQISAVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVIS
                     EEMFFEEGIGFETLKIVFHVMNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKE
                     LTVEACKEILQMWVNFLTTQNKTISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYH
                     QFRTIVMRDLENASQIYMQMVENSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQT
                     VLRCLSRLCCLNQDTVDSWQTDFNSFVSKETGLVASFTIRDQAAELLSSFDSQDYATV
                     LVLLVHEISQISDFSDGWIFNESLLYLLQSLLLNEANSLEFMDAVTRIFTKLQSILEK
                     SLSCVFVNCRIILLIPKLLEKIMDSFPNVRDLVQNFLFLSLDFALSQDNELIKSATLI
                     SFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNS
                     ENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQECLGKLLKNVDVKTFITFWEICF
                     PPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKRKPLDPTLSITICNDVFEPLQNILN
                     QSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDALLSPGVPDQAATHVGSLT
                     VTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVFCFVTSADAQQTVDFLF
                     NTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFFLNDQRLNSMQVNGDLI
                     PYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQDPQLLMAGTYGIET
                     NTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDETDDRGEELDEQCLADNLDSRSVHQ
                     LLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL"
     gene            <756328..>756855
                     /locus_tag="ZYRO0E09482g"
                     /db_xref="GeneID:8204895"
     mRNA            <756328..>756855
                     /locus_tag="ZYRO0E09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499295.1"
                     /db_xref="GeneID:8204895"
     CDS             756328..756855
                     /locus_tag="ZYRO0E09482g"
                     /note="highly similar to uniprot|P53066 Saccharomyces
                     cerevisiae YGL242C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499340.1"
                     /db_xref="GeneID:8204895"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5E4X4"
                     /translation="MDKEGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINE
                     SRDPLGDTALHLCCRYGSWEVLDEILDQDGIEIDPQNTKELDTPLHVTVRYAHDEPEH
                     GTFIARNLVEVGADPRIKNMNGDKPVDLIHGDDLDELIDLLQGAELAADNDRVDDGEE
                     GEIIEDDGEDVDDED"
     gene            complement(<756951..>758084)
                     /locus_tag="ZYRO0E09504g"
                     /db_xref="GeneID:8204896"
     mRNA            complement(<756951..>758084)
                     /locus_tag="ZYRO0E09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499296.1"
                     /db_xref="GeneID:8204896"
     CDS             complement(756951..758084)
                     /locus_tag="ZYRO0E09504g"
                     /note="similar to uniprot|P53065 Saccharomyces cerevisiae
                     YGL243W TAD1 tRNA-specific adenosine deaminase deaminates
                     adenosine-37 to inosine in tRNA-Ala"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499341.1"
                     /db_xref="GeneID:8204896"
                     /db_xref="GOA:C5E4X5"
                     /db_xref="InterPro:IPR002466"
                     /db_xref="UniProtKB/TrEMBL:C5E4X5"
                     /translation="MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIV
                     AIDKKNSDLRLISIATGVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYL
                     NSNSDNQIDLVERASEDQLFHFKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDD
                     PIQFVDPAVTSIVRGRFNYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCM
                     TWKLLNKPVYLKYLVTPNTTDLLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEE
                     PSAMSSIKLYSTPESTVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLR
                     PEFTNATYLQFKATIQDRNALIQDCRKLLSPKGWISTSRDDCE"
     gene            complement(<758296..>759978)
                     /locus_tag="ZYRO0E09526g"
                     /db_xref="GeneID:8204897"
     mRNA            complement(<758296..>759978)
                     /locus_tag="ZYRO0E09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499297.1"
                     /db_xref="GeneID:8204897"
     CDS             complement(758296..759978)
                     /locus_tag="ZYRO0E09526g"
                     /note="similar to uniprot|P53064 Saccharomyces cerevisiae
                     YGL244W RTF1 Subunit of the RNA polymerase II-associated
                     Paf1 complex directly or indirectly regulates DNA-binding
                     properties of Spt15p (TATA box-binding protein) and
                     relative activities of different TATA elements"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499342.1"
                     /db_xref="GeneID:8204897"
                     /db_xref="GOA:C5E4X6"
                     /db_xref="InterPro:IPR004343"
                     /db_xref="UniProtKB/TrEMBL:C5E4X6"
                     /translation="MSDIEEDLLALAGADEEEDDDEVLASSAKRSGKSDRASSKKRRI
                     EVEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEEENPFPLEGKYKDEADRDYLGGLP
                     EMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRSKQQEEGKKTRSSTRSTVATG
                     HSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDYGYEDKKYSDEEDEEEYDPY
                     SRRSRFEEDEDEVQWAEEALDREANVADFNKAKIGRSFVANFCFYPGFNDIVRGNYGR
                     VNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRKVFQMRYFSDG
                     AITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDIVRNRMVFN
                     KKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQHENDKVG
                     INKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQEIQKEEN
                     EKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI"
     gene            <760326..>762104
                     /locus_tag="ZYRO0E09548g"
                     /db_xref="GeneID:8204898"
     mRNA            <760326..>762104
                     /locus_tag="ZYRO0E09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499298.1"
                     /db_xref="GeneID:8204898"
     CDS             760326..762104
                     /locus_tag="ZYRO0E09548g"
                     /note="similar to uniprot|P43620 Saccharomyces cerevisiae
                     YFR048W RMD8 Cytosolic protein required for sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499343.1"
                     /db_xref="GeneID:8204898"
                     /db_xref="InterPro:IPR003734"
                     /db_xref="UniProtKB/TrEMBL:C5E4X7"
                     /translation="MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFA
                     GHAAGVKSREDHVADRNRLAPYPSNGSKSSSVRRRPSGRFSDISIDNILSDASDVPSG
                     RREERQSSSSLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTT
                     GYGPKRAAASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVY
                     DECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVET
                     IEDVDNNFELDSNGNYDADITPDHLPNAMGNQDTFNPSEPQFFAEETPVEQERRERRE
                     NFNFDSSSKNDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI
                     RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFE
                     SRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFW
                     SFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIF
                     VIVLGVLFSVAEILVRYVMIRNRLSG"
     gene            complement(<762205..>764325)
                     /locus_tag="ZYRO0E09570g"
                     /db_xref="GeneID:8204899"
     mRNA            complement(<762205..>764325)
                     /locus_tag="ZYRO0E09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499299.1"
                     /db_xref="GeneID:8204899"
     CDS             complement(762205..764325)
                     /locus_tag="ZYRO0E09570g"
                     /note="highly similar to uniprot|P46655 Saccharomyces
                     cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
                     forms a complex with methionyl-tRNA synthetase (Mes1p) and
                     Arc1p complex formation increases the catalytic efficiency
                     of both tRNA synthetases and ensures their correct
                     localization to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499344.1"
                     /db_xref="GeneID:8204899"
                     /db_xref="GOA:C5E4X8"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR004526"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR011035"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020056"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020059"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="UniProtKB/TrEMBL:C5E4X8"
                     /translation="MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAP
                     VVFNGSSDDTFAKIISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDA
                     VLNLRTFILGGLKISAADIVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGG
                     AHEYLTKSMQGIKKAVTAGKKKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHA
                     KAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYF
                     QEMYDLCVQLIKEGKAYCDDTDVEKMREERMEGIPSAKRDLSVEENLRIFTEEMKNGT
                     EFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIE
                     GVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFARVNFMRTLLSKRKLQWMVDHGL
                     VSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQGPSKNVINLEWNLIWAVNKKIIDPVA
                     PRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVGEKKVIYSNKIIIDKEDASVL
                     EVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKKTKHKVTWLANTDYVPVEMVDF
                     DHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDMKVGDIIQFERKGYCRLDSKA
                     EGDKPYIFFTIPDGKSVNRYGAKK"
     gene            <764748..>765890
                     /locus_tag="ZYRO0E09592g"
                     /db_xref="GeneID:8204900"
     mRNA            <764748..>765890
                     /locus_tag="ZYRO0E09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499300.1"
                     /db_xref="GeneID:8204900"
     CDS             764748..765890
                     /locus_tag="ZYRO0E09592g"
                     /note="similar to uniprot|P53063 Saccharomyces cerevisiae
                     YGL246C RAI1 Nuclear protein that binds to and stabilizes
                     the exoribonuclease Rat1p required for pre-rRNA
                     processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499345.1"
                     /db_xref="GeneID:8204900"
                     /db_xref="InterPro:IPR013961"
                     /db_xref="UniProtKB/TrEMBL:C5E4X9"
                     /translation="MVVTSNLFVKQKGTTTALKQPKELTFYSRTDDDNFLVEDDVHLQ
                     YYYLPDADLEKRLDLSSGIKKLKDTASNFKDQGTLFGLLQSIQNYEQRKNKKIKADIV
                     TFRGIMRKLISAAFDTSNFNPIDLRIVSFDGQLFIKEVPKQEAKPAPGSPAQLAWYSG
                     YKFETLATLPQPLPLVSRTTLDKRPKKLVNTGEEYITVVKTGVGNVKVILGAEVDCIF
                     DFKEEGKDNLKHYAELKCSADVSTPADARKFERKVFRTWLQCFLVGIPRIIYGFRDNN
                     NVLKTVEEYTTTEVPVLLKSNNPAMNSSCLDAIKWYGTLTEWLLKMIPRDGDTIRAYR
                     LVYENNHLRLTEIEDTESEYQGLVEGEEILSDEFKKWRKSMNERNL"
     gene            complement(<765913..>766839)
                     /locus_tag="ZYRO0E09614g"
                     /db_xref="GeneID:8204901"
     mRNA            complement(<765913..>766839)
                     /locus_tag="ZYRO0E09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499301.1"
                     /db_xref="GeneID:8204901"
     CDS             complement(765913..766839)
                     /locus_tag="ZYRO0E09614g"
                     /note="similar to uniprot|Q07551 Saccharomyces cerevisiae
                     YDL124W NADPH-dependent alpha-keto amide reductase reduces
                     aromatic alpha-keto amides aliphatic alpha-keto esters and
                     aromatic alpha-keto esters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499346.1"
                     /db_xref="GeneID:8204901"
                     /db_xref="GOA:C5E4Y0"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y0"
                     /translation="MTRPIIPTIEIKETHTHIPVLGFGTGTQWRIAKREGETKGQFID
                     KLVDQLVTAVDLGFNHIDTAEFYLTHEEVGEALRRSQLPRDKLFITDKYNQGAWTGLD
                     CSGPIQAAKKGLEALGIKYFDLYMLHRPDITKENAGIDLQEAWRQVEELYEAGIAKAI
                     GVSNFPLETLKQMESYCRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPLAP
                     LFRARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDF
                     ELEKSDVELINEVGSKKHFQWCLPHFFDVYRS"
     gene            complement(<766929..>767438)
                     /locus_tag="ZYRO0E09636g"
                     /db_xref="GeneID:8204902"
     mRNA            complement(<766929..>767438)
                     /locus_tag="ZYRO0E09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499302.1"
                     /db_xref="GeneID:8204902"
     CDS             complement(766929..767438)
                     /locus_tag="ZYRO0E09636g"
                     /note="some similarities with uniprot|P53062 Saccharomyces
                     cerevisiae YGL247W BRR6 Essential nuclear envelope
                     integral membrane protein required for nuclear transport
                     depletion alters nucleoporin distribution and nuclear
                     envelope morphology suggesting a role in the spatial
                     organization of nuclear pores"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499347.1"
                     /db_xref="GeneID:8204902"
                     /db_xref="GOA:C5E4Y1"
                     /db_xref="InterPro:IPR018767"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y1"
                     /translation="MTQLLTQSSTSNNASHIGEFVRLAFNSSILVIILSVVIKFILLI
                     KQDVDQKVQLKIAEQVIRVKRCQKHYEDNGCVSHVPALETLCDGWHHCMHSTGQVQSA
                     SLWTQTLAETLNAFVEAISFRSLVFVLLAVCALVLVTNVVIASYRVQYYIRGDRMSTY
                     QPSNNARIE"
     gene            complement(767795..767865)
                     /locus_tag="ZYRO0E09658r"
                     /db_xref="GeneID:8204903"
     tRNA            complement(767795..767865)
                     /locus_tag="ZYRO0E09658r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.56"
                     /db_xref="GeneID:8204903"
     gene            <769341..>769706
                     /locus_tag="ZYRO0E09680g"
                     /db_xref="GeneID:8204904"
     mRNA            <769341..>769706
                     /locus_tag="ZYRO0E09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499303.1"
                     /db_xref="GeneID:8204904"
     CDS             769341..769706
                     /locus_tag="ZYRO0E09680g"
                     /note="similar to uniprot|P19955 Saccharomyces cerevisiae
                     YFR049W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499348.1"
                     /db_xref="GeneID:8204904"
                     /db_xref="InterPro:IPR020373"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y2"
                     /translation="MRSTCVRLAHHYTPMIRFVGGRHHHTPHSSEILPHPCAENGLLP
                     NSKDTVPAGEFLKNLRPFKVIPYKSKAETVQPDSRYQYQQRPLQEGEKTHAYELSPRF
                     QFKGFSESEIESINGGGAL"
     gene            complement(<769778..>770845)
                     /locus_tag="ZYRO0E09702g"
                     /db_xref="GeneID:8204905"
     mRNA            complement(<769778..>770845)
                     /locus_tag="ZYRO0E09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499304.1"
                     /db_xref="GeneID:8204905"
     CDS             complement(769778..770845)
                     /locus_tag="ZYRO0E09702g"
                     /note="similar to uniprot|P22434 Saccharomyces cerevisiae
                     YGL248W PDE1 Low-affinity cyclic AMP phosphodiesterase
                     controls glucose and intracellular acidification-induced
                     cAMP signaling target of the cAMP-protein kinase A (PKA)
                     pathway glucose induces transcription and inhibits
                     translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499349.1"
                     /db_xref="GeneID:8204905"
                     /db_xref="GOA:C5E4Y3"
                     /db_xref="InterPro:IPR000396"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y3"
                     /translation="MSKFEVTVLGASGGPDVGETQCFLIRPFGWHGLESVCVDGGAGT
                     TQISRMLAGELRVGLIESFYERDYEPVNQFFDSDVQVRPGLSDSTLHALDSSPRITSY
                     RSAKVYESIKGYYVTHPHLDHIAAMVVDSPLIFNSPKPMAKTIWGLPFTTSAIERFIF
                     NDSIWPNLIHGGGQRLKTESLTDQIATTNPTFTHIEITPFRVSHGKGAYSPREKIFST
                     VYLFRDITTDHCIIICGDMEPDSDEPLLSNLCSYLAARVPLHKIKAIIVECSSPIDTK
                     ELYGHMSPTRLVEELSHLQNVYGCEQRPDMDVIITHVKGHCSFKDPRLVILNEVRQEA
                     QRFGLEGIRFSVAVKGYTFYL"
     gene            complement(<771237..>772022)
                     /locus_tag="ZYRO0E09724g"
                     /db_xref="GeneID:8204906"
     mRNA            complement(<771237..>772022)
                     /locus_tag="ZYRO0E09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499305.1"
                     /db_xref="GeneID:8204906"
     CDS             complement(771237..772022)
                     /locus_tag="ZYRO0E09724g"
                     /note="highly similar to uniprot|P30657 Saccharomyces
                     cerevisiae YFR050C PRE4 20S proteasome beta-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499350.1"
                     /db_xref="GeneID:8204906"
                     /db_xref="GOA:C5E4Y4"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR016295"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y4"
                     /translation="MNHDPFSWGRPSDATYGAYDQQLAHPKMNTQQPIVTGTSVLSVK
                     YNNGVVIAADNLGSYGSLLRFNNVERLIPVGDNTVVGISGDISDMQHIETLIEELVTE
                     NNYDNSFADSVEGLKPSYVFEYLAAVMYHRRSKFNPLWNAIIVAGVEDGKPFSRYVNL
                     LGVTYSSPSLATGFGSYMAVPLLRKLVDRDSDVAKLDLQTAENAIVECLKVLFYRDAR
                     SSKQYSLAIIDNDLGLQFKTNQRIENLSWSFAKDIKGYGTQKV"
     gene            complement(<772264..>773880)
                     /locus_tag="ZYRO0E09746g"
                     /db_xref="GeneID:8204907"
     mRNA            complement(<772264..>773880)
                     /locus_tag="ZYRO0E09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499306.1"
                     /db_xref="GeneID:8204907"
     CDS             complement(772264..773880)
                     /locus_tag="ZYRO0E09746g"
                     /note="similar to uniprot|P43621 Saccharomyces cerevisiae
                     YFR051C RET2 Delta subunit of the coatomer complex (COPI)
                     which coats Golgi-derived transport vesicles involved in
                     retrograde transport between Golgi and ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499351.1"
                     /db_xref="GeneID:8204907"
                     /db_xref="GOA:C5E4Y5"
                     /db_xref="InterPro:IPR008968"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027059"
                     /db_xref="InterPro:IPR028565"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y5"
                     /translation="MVVLAASITTRSGKPLLSRQFRELTKDRVLELLSNFQSLVTNLS
                     SEHTFVEGNHVRYVYRPFDDYYIILITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENE
                     IYDSAFEILTAFDEVVIMGYKENLSSTQVTTYLTMESHEERIQEIIERNKEFEATEER
                     KRRAKEIAKREQERRMGIPSMDFSMPSNKFIGSNDPNVTNAYNSYYSHASPAAQQSYL
                     KSQKLGDQPVEDLSSQDSLPRRSDGSAGMKLGGARSKKAVTPVRHSSSSRPSIKPENE
                     EDSFTNNGILILIKEIVNAQISRDGAVSSSELKGVLELRINEKSLGHAKLVLGNDVNV
                     KDRNMQFRTHPNIDKNAFLSNKSIGLRSNDKAFPANDQTLGVLRWRKVGANDDKTLIP
                     LECSTWVSPSEEGEGMFEVTVEFEVNPDYNKDLKDLVFTVPVLTENVFISPDNNDCNA
                     SLAGVDEEMGIAIKVDHVEPGQPAVFSFVIEAGYEDALFPLNVNFAHVEQGSSSLTGV
                     SVANITDSQTEEQLPYDLITSLRAEEYAVV"
     gene            complement(<774077..>776068)
                     /locus_tag="ZYRO0E09768g"
                     /db_xref="GeneID:8204908"
     mRNA            complement(<774077..>776068)
                     /locus_tag="ZYRO0E09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499307.1"
                     /db_xref="GeneID:8204908"
     CDS             complement(774077..776068)
                     /locus_tag="ZYRO0E09768g"
                     /note="weakly similar to uniprot|P53061 Saccharomyces
                     cerevisiae YGL249W ZIP2 Required for 'ZIPpering' up
                     meiotic chromosomes during chromosome synapsis involved in
                     meiotic recombination and disjunction"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499352.1"
                     /db_xref="GeneID:8204908"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y6"
                     /translation="MELEYWILDSSAVNSSDGGYENTFTNTKETVRLEKKSQKLLQKL
                     SHSSGPKVQLQKVKTDSLEHFQLEAMPLKFTPKQYNIRCLPWPKIEISDNLQNFHSPK
                     EKLKLEDESKRLFVWLTDLSKSQIQHDPIARRKNRLQGRESFKIKFEFLTSCIKQCSK
                     INRCEFMPSVLGTRFKETLRENIPKTVSFAFGEKLKLEHHFCKTASLEDYILEATEVP
                     LLPRISAELLRWPVPSANPNELVFEMLRSQLFDLEFNKLEFFKMDITCTQSNKRAKIK
                     LPKNWKMCKSELKQWDWNPFKQIEKTAIAESTTRETIATYAFNPPIFVLEFHKFPYNS
                     FDFINLEEDTFGSLKFASASRLAPTMTKKPSATSEREKTMDSTINSEHDNTSMIPHKR
                     SFIDDDLLTILHSRKRSRKHDDHYTSTPSHGATMFRIMNQEMNRYQAVGSSPVSAALE
                     PPKTPAIPFEPANDPRRILVNATKIRENHKIIQYLSNETQLQLVEQELPLQCDFIIDA
                     TSCIVIVQLDLFFQLQADKTMFYENTLKSLLNEFKTVVVLIKYPVIIDIADRDVFWKI
                     RLYLQPPDFQLFLTEETPQEIGKWINMLSNEPLNDQPLGSHPLLLLHFNKFLVQELLS
                     KYTLKKILLMAIKNQNKELSCLLTDAQLKRIQKLMALGW"
     gene            complement(<776416..>777264)
                     /locus_tag="ZYRO0E09790g"
                     /db_xref="GeneID:8204909"
     mRNA            complement(<776416..>777264)
                     /locus_tag="ZYRO0E09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499308.1"
                     /db_xref="GeneID:8204909"
     CDS             complement(776416..777264)
                     /locus_tag="ZYRO0E09790g"
                     /note="similar to uniprot|P53060 Saccharomyces cerevisiae
                     YGL250W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499353.1"
                     /db_xref="GeneID:8204909"
                     /db_xref="InterPro:IPR018822"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y7"
                     /translation="MDNSDDVGVALVDEEEDLLEYDNSMSSSGEQEGSDREEAGNGNA
                     NGSEDKVHVVSDNEIRQAAEQLLQHKLPQVFIEYNGHGFLLFDCEEKDQLQFNLPVIC
                     EDTKGFVHGCNELFNLIRRFLEDYHGKLSFVSKELILELPCLDLTLCEDNVYNSQITF
                     SDITTIFDILRQRSLENLETDVPECIRGTVSTRPRFVSRYNTLVELTQSSATLKNIKP
                     FQNDETHPLVLDDNGLPSTHGQTKEVVVMNLEEDEDNADREMDDKQDRSDSEELLEIV
                     DNEEEG"
     gene            <777831..>781106
                     /locus_tag="ZYRO0E09812g"
                     /db_xref="GeneID:8204910"
     mRNA            <777831..>781106
                     /locus_tag="ZYRO0E09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499309.1"
                     /db_xref="GeneID:8204910"
     CDS             777831..781106
                     /locus_tag="ZYRO0E09812g"
                     /note="similar to uniprot|P51979 Saccharomyces cerevisiae
                     YGL251C HFM1 Meiosis specific DNA helicase involved in the
                     conversion of double-stranded breaks to later
                     recombination intermediates and in crossover control
                     catalyzes the unwinding of Holliday junctions has ssDNA
                     and dsDNA stimulated ATPase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499354.1"
                     /db_xref="GeneID:8204910"
                     /db_xref="GOA:C5E4Y8"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y8"
                     /translation="MFNASSFKITQDDTSLTTSFHEDIPAVQPPQPKRRRVLKKSENK
                     ELIKNGLSTSALPDSFQSFFRFREFNKMQSEAFPDLYETDMNCVISSPTGSGKTVLFE
                     LAIMRLIKETGDAIDNIKILYVAPTKSLCCERLKSWGPNFLNLTVGMLTSDTSYLETE
                     KVRKCNIIITTPEKWDLLTRKWKAYNRLFELVKLILVDEIHTLRERRGATLEVVLTRM
                     NIMCQSIRIIAISATIPNVEDISSWLRSKDTQERAKILKFDDSYRQVPLQKIVYGYSF
                     YNKNDFFYDSMYNSKLDEILRMHSKNRPVLIFCPTRASTVSTAKYVVQNCFHLAPGSD
                     RNADEQFHDQGLLECYHQNVAFHHAGLSIEDRTKVEQGFLEGKIKILCSTSTLAIGVN
                     LPAYLVIIKGTRIWNTSAAQEYPQLDVLQMIGRAGRPDFENEGCAIIMTDSKMKQTYE
                     KMLHGTDNLESSLHLELTEHLSAEISLGTISSTETAVNWLRNTFFYVRFSRNPDVYGK
                     ITKFMDHINVQDSQLVQFCEGILQNLLLNQIIEKQDDRLICTPYGYAMVRHYVLFDST
                     KIFINAPKSQSVQNILRLLSGSKEFTDIRIRHNEKRLYKEINSSPLTKFPFLTEKKQS
                     QIIDTTFQKVSLLIQYELGGLEFPSYQGASKLHQTLVQDKALVFRNCFRILKCMVDAF
                     IERKDGISLKNTLFLLRSVNGNCWEDSTMVLRQLKSIGLVSVRKLVHHDVNNLEQMRQ
                     ISDQQIEYYLGQKRGSGSKIKRDLTLLPQLQVRCKLEYCSHKGHQLEVTLKIELSAQF
                     ETSIWHGQGLSLDIQTLKSTGELLDFRRLKLAHLKTPRSFRILTMMQLQSDSIEISIN
                     CLEVAGIGKSIQFSTKDLPQKFHETPPVKSYATVLDKCLIHSDSESDLEDSSLSSDDC
                     LFQYLDKNPINRQINKEDVPDNRRVRSNGNFECNHACKDKSHCRHLCCKEGIPKELLR
                     SKRAASTNHPAPDSFRAPQQSVDVIPTSDIKEALESDSSLEEIIPFQPETKRFNSTFE
                     YGLQSVHNSTKPTTCADPNVTNAGAMMPQSLNSIALPSGSSDSNETDHTRLAFLGSDV
                     DLN"
     gene            <781375..>783141
                     /locus_tag="ZYRO0E09834g"
                     /db_xref="GeneID:8204911"
     mRNA            <781375..>783141
                     /locus_tag="ZYRO0E09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499310.1"
                     /db_xref="GeneID:8204911"
     CDS             781375..783141
                     /locus_tag="ZYRO0E09834g"
                     /note="highly similar to uniprot|P32608 Saccharomyces
                     cerevisiae YGL252C RTG2 Sensor of mitochondrial
                     dysfunction regulates the subcellular location of Rtg1p
                     and Rtg3p transcriptional activators of the retrograde
                     (RTG) and TOR pathways Rtg2p is inhibited by the
                     phosphorylated form of Mks1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499355.1"
                     /db_xref="GeneID:8204911"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="UniProtKB/TrEMBL:C5E4Y9"
                     /translation="MSAISDSDTETEVISRNLCGVVDIGSNGIRFSISSKAAHHARIM
                     PCVFKDRVGISLFEVQYAANSLEKEPIPEDIINDIRAAMKRFKLICEDFGVPQSSVRV
                     VATEATREALNSVVFTEAIHDSTGWEVELLTREDEGRIGAYGVVSSFNIVNGLYMDLG
                     GGSTQLSWIKCINGEVEQSSTPVSLPYGAGALARRLHSEDKRALFLEIKKAYSGAIER
                     IGIPEEMLLDAKEKGGFDLYTCGGGLRGMGHLLLSQSKDYPIQTIINGFSCSYEEFSS
                     MSDYLFLKNKVPGSKDTKIFKVSERRASQLPAVGLLMSAAFESLPQIKTVHFSEGGVR
                     EGTLYSILPREIRAQDPLIVATRPYAPLLASKYLELLMTAIPVKDVPPIVYKRVAPAL
                     CNLAFVHASYPKELQPTASLHVATAGIIAGCHGLSHRARALIGIALCSRWGGDIPEGE
                     EKYMDLLKNVVLRDGDKSERKRVIFWTKYIGTIMYVICGVHPGGNIRDGAFNFSILEK
                     EEGENEVRELTNDEAMTPTPGDANNRKKREFEVVVKISKDDLKTSASVRSRIITLQKK
                     IRKLSRGSSVKVKISVQYAEIH"
     gene            <783344..>784144
                     /locus_tag="ZYRO0E09856g"
                     /db_xref="GeneID:8204912"
     mRNA            <783344..>784144
                     /locus_tag="ZYRO0E09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499311.1"
                     /db_xref="GeneID:8204912"
     CDS             783344..784144
                     /locus_tag="ZYRO0E09856g"
                     /note="highly similar to gnl|GLV|CAGL0A04807g Candida
                     glabrata CAGL0A04807g and similar to YFR052W
                     uniprot|P32496 Saccharomyces cerevisiae YFR052W RPN12
                     Subunit of the 19S regulatory particle of the 26S
                     proteasome lid synthetically lethal with RPT1 which is an
                     ATPase component of the 19S regulatory particle physically
                     interacts with Nob1p and Rpn3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499356.1"
                     /db_xref="GeneID:8204912"
                     /db_xref="GOA:C5E4Z0"
                     /db_xref="InterPro:IPR005062"
                     /db_xref="InterPro:IPR006746"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z0"
                     /translation="MSTSLPELVKSLSVAFDLKKYDSCQKLLPAIKVELIKNNLVIPD
                     LSSQNKAYLNDLNVAKSFFEIGALVSIYCSDLESFQNYFAQLRVFYFSPNQQLAESEN
                     KSKILSLYMLILLSQGEITKFHSELEFLDKHIRNLEEDELLSYPIRVERWLMEGSYQK
                     AWDLLKSGLKQQEFDVFTGTLMNAIREEIARNTEMAYEKLPLSNIKVLLFFNSEKEAE
                     HFAVQRGWKVANGSVEFEEDEESNETPLEKTHLIEKTLNYAINLESIV"
     gene            complement(<784297..>785757)
                     /locus_tag="ZYRO0E09878g"
                     /db_xref="GeneID:8204913"
     mRNA            complement(<784297..>785757)
                     /locus_tag="ZYRO0E09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499312.1"
                     /db_xref="GeneID:8204913"
     CDS             complement(784297..785757)
                     /locus_tag="ZYRO0E09878g"
                     /note="highly similar to uniprot|P04807 Saccharomyces
                     cerevisiae YGL253W HXK2 Hexokinase isoenzyme 2 catalyzes
                     phosphorylation of glucose in the cytosol predominate
                     hexokinase during growth on glucose functions in the
                     nucleus to repress expression of HXK1 and GLK1 and to
                     induce expression of its own gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499357.1"
                     /db_xref="GeneID:8204913"
                     /db_xref="GOA:C5E4Z1"
                     /db_xref="InterPro:IPR001312"
                     /db_xref="InterPro:IPR019807"
                     /db_xref="InterPro:IPR022672"
                     /db_xref="InterPro:IPR022673"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z1"
                     /translation="MVHLGPKKPPARKGSMADMPQDLLDQVRGLEVIFSVSTEKLRAV
                     TKHFIDELQKGLSKKGGNIPMIPGWVLEYPTGKETGNYLAIDLGGTNLRVVLVKLNGD
                     RTFDSSQSKYKLPHHMRTTRNPKDLFDFIASSLKNFIEEEFPNGCEDTLPLGFTFSYP
                     ASQGKINEGVLQRWTKGFDIPGVEGHDVVPMLQESLSEKGVPINVVALINDTTGTLVA
                     SHYTDPETQMGVIFGTGVNGAYYDVCKDIEKLQGQLPEDITPDTLMGINCEYGSFDNE
                     HVVLPRTKYDVIVDEESPRPGQQSFEKMSSGYYLGEIIRLVLIDLHEQGFIFKDQDVS
                     KLREPYVMDTSYPSMIEEDPFENLEDTFDLFQKDLGITTTTPERKLIRRLCELIGTRA
                     ARLSVCGIAAICQKRGYKTAHIAADGSVFNKYPGFKERAAAALNDIYGWGIEDRHKQP
                     IQIVAAEDGSGAGAAIIAALTQQRLAANKSVGVIGK"
     gene            <786545..>788164
                     /locus_tag="ZYRO0E09900g"
                     /db_xref="GeneID:8204914"
     mRNA            <786545..>788164
                     /locus_tag="ZYRO0E09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499313.1"
                     /db_xref="GeneID:8204914"
     CDS             786545..788164
                     /locus_tag="ZYRO0E09900g"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008C FLR1 Plasma membrane multidrug transporter member
                     of the major facilitator superfamily involved in efflux of
                     fluconazole diazaborine benomyl methotrexate and other
                     drugs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499358.1"
                     /db_xref="GeneID:8204914"
                     /db_xref="GOA:C5E4Z2"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z2"
                     /translation="MGYINGFRNTFFVDLLERANLVQVEPYPNQLQVSNTAKPSQPSV
                     DLEKGDSNDSHNKGTEKESSDTTKDVDPFLVEFTGSDDPEHPLNWPNSKTTLVITEIM
                     VLTCVTYMGSSIYTPGQEEIQHDFHVGHVVGTLNLSLYVLGYGLGPLIFSPLSEFAKI
                     GRQRLYIITLFLFCMLQIGCALVQNIAGLVILRFITGFLCSPSLATGGASIGDIVRPE
                     IVPIFIGLWGVGAVAAPVTGPLLGASMVVANGWRWIFWLMVWMSGGILIILVFFFPET
                     SVENILYRRCQRIRKLKNDDRYYTLKERQESKLTRKDIAITALYRPFQMIFEDPIVMA
                     LDGYLALCYGTFYLFFEAFPIVFIGVYDFTLIEVGLAYMGFTVGCAIAYVVCLTFMVF
                     VVAKKFKNNTMTPEVFLILGMMTSWCLPLSLFLFGWAASVHWTLPMLAEIFFVLCVFN
                     LFQSTFAYLAFSYPKYLASVYAGNGVCRAGFACAFPLFGKAMYDNLAIKGYPVAWGSS
                     ILGFFSMALATIPFFLYKYGPYLRSKSKFSG"
     gene            <788952..>790643
                     /locus_tag="ZYRO0E09922g"
                     /db_xref="GeneID:8204915"
     mRNA            <788952..>790643
                     /locus_tag="ZYRO0E09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499314.1"
                     /db_xref="GeneID:8204915"
     CDS             788952..790643
                     /locus_tag="ZYRO0E09922g"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008C FLR1 Plasma membrane multidrug transporter member
                     of the major facilitator superfamily involved in efflux of
                     fluconazole diazaborine benomyl methotrexate and other
                     drugs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499359.1"
                     /db_xref="GeneID:8204915"
                     /db_xref="GOA:C5E4Z3"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z3"
                     /translation="MRSLISAYVNTYRNTFAVDILERFNLVQVDEHFALKDESDDSLC
                     KEDISKDVPNADLEALEKQPSGNVTLASAGGIISAGDDNSGELKDAKDATDPYLVQFR
                     GTKDPDHPHNWLGFKKFVVILEIMLLTCVTYMGSAIYTPGQEEIQKEFGVGHVVGTLN
                     LSMYVLGYGLGPMVFSPLSEFAMYGRQQLYIITLFLFSMLQIGCALVHNIAGLVILRF
                     ITGILCSPSLATGAASIGDIVTPQWVPVFIGMWSIGAVAAPVTGPLLGASMVVAKNWR
                     WIFWLLMWMSAALLIVLIFFFPETGEDNILYRRCVRIRKITGDDRYYTFKAREEAKLT
                     FKDIAVVALYRPFEIIVKEPIVLALDIYIALCYGTFYLFFEAFPIVFAGVYHFTLIEL
                     GLAYMGFCVGCVFAYAISLIFLSQYGARQAKKNRFTPETFLVLAMGVCWCLPLALFLF
                     GWAASVHWTLPMLAEIFFVICVFNLFQATFSYLAMSYPKYMASVFAGNGVMRAGFACA
                     FPLFGKAMYDNLAIKGYPVAWGSSLLGFFSIGLAVLPFLLYKYGPYLRSKSKFSG"
     gene            <793128..>794813
                     /locus_tag="ZYRO0E09966g"
                     /db_xref="GeneID:8204916"
     mRNA            <793128..>794813
                     /locus_tag="ZYRO0E09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499315.1"
                     /db_xref="GeneID:8204916"
     CDS             793128..794813
                     /locus_tag="ZYRO0E09966g"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008C FLR1 Plasma membrane multidrug transporter member
                     of the major facilitator superfamily involved in efflux of
                     fluconazole diazaborine benomyl methotrexate and other
                     drugs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499360.1"
                     /db_xref="GeneID:8204916"
                     /db_xref="GOA:C5E4Z4"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z4"
                     /translation="MQALIAAYVNTYRNTFAVDVLERLNLVQVDEEYALKDESDSSLS
                     KDSTSKDESNVDLEALEKQPSAVLANTGGSVSGGDGNSGELKDGKDATDPYLVQFRGT
                     KDPDHPHNWLGFKKFVVILEIMLLTCVTYMGSAIYTPGQEEIQKEFGVGHVVGTLNLS
                     MYVLGYGLGPMVFSPLSEFAMYGRQQLYIITLFLFSMLQIGCALVHNIAGLVILRFIT
                     GILCSPSLATGAASIGDIVKPELVPVFIGMWSIGAVAAPVTGPLLGASMVVAKNWRWI
                     FWLLMWMSAALLILLVFFFPETGEDNILYRRCMRIRKITGDDRYYTFKAREEAKLTFK
                     DIAVVALYRPFEIIVKEPIVLALDIYIALCYGTFYLFFEAFPIVFAGVYHFTLIELGL
                     AYMGFCVGCVFAYAISLIFLTQYAARQAKKNKFTPETFLVLAMGVCWCLPLALFLFGW
                     AASVHWTLPMLAEIFFVICVFNLFQATFAYLAMSYPKYMASVFAGNGVMRAGFACAFP
                     LFGKAMYDNLAIKGYPVAWGSSLLGFFSIGLAAIPFLLYKYGPYLRSKSRFTG"
     gene            <796142..>797788
                     /locus_tag="ZYRO0E09988g"
                     /db_xref="GeneID:8204917"
     mRNA            <796142..>797788
                     /locus_tag="ZYRO0E09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499316.1"
                     /db_xref="GeneID:8204917"
     CDS             796142..797788
                     /locus_tag="ZYRO0E09988g"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008C FLR1 Plasma membrane multidrug transporter member
                     of the major facilitator superfamily involved in efflux of
                     fluconazole diazaborine benomyl methotrexate and other
                     drugs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499361.1"
                     /db_xref="GeneID:8204917"
                     /db_xref="GOA:C5E4Z5"
                     /db_xref="InterPro:IPR004734"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z5"
                     /translation="MYIDTYRNSFAVDVLEYFKLVKLNQEIPKRRISSEESSLQPEHV
                     NIDVDALEKQSFEGPNEAGDIDGAVEQMHDFKDTRDPFLIDFTGPEDPEHPHNWSTLK
                     KTIVITEVSLLTFITYMGSSIYTPGQEQIQQEFGVGHVVATLNLSVYVIGYGIGPIIF
                     SPLSEFAIFGRQQLYIVTLFLFTMLQAGCALVHNIAGLVILRFLTGVLCSPSLATGAA
                     SIGDVVRPKYVPILLGLWSGAAYAAPCVGPLIGAAMVIAKNWRWIFWLLMWMSALLLV
                     TLIFFFPETSEDNILHRRCERIKKITGDDRYYTFKAREESKLNAKDIAIIALYRPFEI
                     MVKEPIVQALDIYIALTYGIFYLFFESFPIVFSGIYHFTLIELGLSYLGFLVGSFVAY
                     AASIIFLHYYADRKMANGTFTPETFLVLAMCVSWCLPCGLFIFGWAASVHWMVPIAAE
                     LLFVMCDFNLWESIFSYLAVSYPKYVASVFAGNGVLRAGFACAFPLFGKAMYDNLAID
                     GYPVGWGSSLLGFITIGLALLPFLFYKYGPYLRSKSKFTG"
     gene            <801410..>802273
                     /locus_tag="ZYRO0E10032g"
                     /db_xref="GeneID:8204918"
     mRNA            <801410..>802273
                     /locus_tag="ZYRO0E10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499317.1"
                     /db_xref="GeneID:8204918"
     CDS             801410..802273
                     /locus_tag="ZYRO0E10032g"
                     /note="similar to uniprot|P32643 Saccharomyces cerevisiae
                     YER175C TMT1 Trans-aconitate methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499362.1"
                     /db_xref="GeneID:8204918"
                     /db_xref="GOA:C5E4Z6"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z6"
                     /translation="MSAFSEKDFDAKSYSSSRPSYPDEFYRVIDEYHVGARNRLIDVG
                     CGPGVATFQLADKLKPFNQIFGTDISNTMVERARGRKGENFEKYEGVNFEVSPGDDFS
                     FLKGPDNKCDMVTAVQCVHWLDFDSFQKSVAAVLREGGTFVIWGYADPIFPEYPKLDA
                     LLDDFSYGPDHLGPYWESGRQILRNLLRDLHLNTELFTDFQEACFNIDYIRSNQTDPL
                     LIKRTITLAQFQDYLKTWSAFHSWKKSHSQERDITEGFVDRVQQLYPHLTKRSKFQVV
                     WKSFYKLCRKL"
     gene            complement(<804765..>806651)
                     /locus_tag="ZYRO0E10054g"
                     /db_xref="GeneID:8204919"
     mRNA            complement(<804765..>806651)
                     /locus_tag="ZYRO0E10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499318.1"
                     /db_xref="GeneID:8204919"
     CDS             complement(804765..806651)
                     /locus_tag="ZYRO0E10054g"
                     /note="similar to uniprot|Q07824 Saccharomyces cerevisiae
                     YLL028W TPO1 Proton-motive-force- dependent multidrug
                     transporter of the major facilitator superfamily able to
                     transport eight different compounds including polyamines
                     quinidine cycloheximide and nystatin involved in excess
                     spermidine detoxification"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499363.1"
                     /db_xref="GeneID:8204919"
                     /db_xref="GOA:C5E4Z7"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z7"
                     /translation="MVKIDASADLDWNNLPPQQRLGRIVGGKYIETVHMDESSPEAME
                     RPMTKVECDIPLTYTESVEKDGKEWVMLTFAPGDPENPFNWSLRLKWFLTTLLCLMTL
                     FIGLATTAYSSGIDRMAKHFNSSSEVGQLGLFTFNETCSIAPLFLAPFCELVGRKVIY
                     TGGYLCFCLCFIGLALGKNMATIICLRACLGLFGCIGTILVGGTFDDMFVADERAIPM
                     ALFAYVAILGTVGAPIYAGFIDQAIGWRWIEGIQGLSNVPLLIIIFLFFKETRGGVTL
                     QKRAKSLRKDTGDERWVSKEELEAPGLKDALYNSSVKAIKMLISEPVVFFFGLWISFA
                     WFLTFLFLSVIGITFSHFKHWSEGVAGLPYISLVIGVTIGFLTNFLQIRKYENMRKKS
                     KYPLPPENRLYGAMTGAVFLPIGLMIYSFTQYHWLHWIGPNIGLACISLGIFFIFESC
                     YSYTSDCYGPDASSAIAGQGFMRNTLGAVSPLFGKYMFLNMHSQWAGLLCSLVAFGLT
                     LLPFVLYKFGPAIRARSKRAIVYHGEEDDEDDEIAEQQSSSSTGGGRSLQDDAHVENA
                     NNNQLFEKNEGSRESDSPETARETDSLSPSEKVDNHAGVSRSVEEHSDTVSESELHGH
                     TGRA"
     mobile_element  812956..815114
                     /mobile_element_type="retrotransposon"
     gap             818075..818709
                     /note="gap of 635 nt"
                     /estimated_length=635
     gene            complement(818710..822132)
                     /locus_tag="ZYRO0E10100r"
                     /db_xref="GeneID:8204920"
     rRNA            complement(818710..822132)
                     /locus_tag="ZYRO0E10100r"
                     /product="ribosomal RNA"
                     /note="RDN25-1 25S rRNA"
                     /transcript_id="XR_002648416.1"
                     /db_xref="GeneID:8204920"
     gene            complement(822770..824572)
                     /locus_tag="ZYRO0E10104r"
                     /db_xref="GeneID:8204921"
     rRNA            complement(822770..824572)
                     /locus_tag="ZYRO0E10104r"
                     /product="ribosomal RNA"
                     /note="RDN18-1 18S rRNA"
                     /transcript_id="XR_002648417.1"
                     /db_xref="GeneID:8204921"
     gene            827379..827499
                     /locus_tag="ZYRO0E10106r"
                     /db_xref="GeneID:8204922"
     rRNA            827379..827499
                     /locus_tag="ZYRO0E10106r"
                     /product="RDN5-1 5S ribosomal RNA"
                     /transcript_id="XR_002648418.1"
                     /db_xref="GeneID:8204922"
     gene            complement(828578..832000)
                     /locus_tag="ZYRO0E10108r"
                     /db_xref="GeneID:8204923"
     rRNA            complement(828578..832000)
                     /locus_tag="ZYRO0E10108r"
                     /product="ribosomal RNA"
                     /note="RDN25-1 25S rRNA"
                     /transcript_id="XR_002648419.1"
                     /db_xref="GeneID:8204923"
     gene            complement(832253..832411)
                     /locus_tag="ZYRO0E10112r"
                     /db_xref="GeneID:8204924"
     rRNA            complement(832253..832411)
                     /locus_tag="ZYRO0E10112r"
                     /product="ribosomal RNA"
                     /note="RDN58-1 5.8S rRNA"
                     /transcript_id="XR_002648420.1"
                     /db_xref="GeneID:8204924"
     gene            complement(832638..834440)
                     /locus_tag="ZYRO0E10114r"
                     /db_xref="GeneID:8204925"
     rRNA            complement(832638..834440)
                     /locus_tag="ZYRO0E10114r"
                     /product="ribosomal RNA"
                     /note="RDN18-1 18S rRNA"
                     /transcript_id="XR_002648421.1"
                     /db_xref="GeneID:8204925"
     gap             834441..835074
                     /note="gap of 634 nt"
                     /estimated_length=634
     gene            complement(835288..838709)
                     /locus_tag="ZYRO0E10118r"
                     /db_xref="GeneID:8204926"
     rRNA            complement(835288..838709)
                     /locus_tag="ZYRO0E10118r"
                     /product="ribosomal RNA"
                     /note="RDN25-1 25S rRNA"
                     /transcript_id="XR_002648422.1"
                     /db_xref="GeneID:8204926"
     gene            complement(838962..839119)
                     /locus_tag="ZYRO0E10127r"
                     /db_xref="GeneID:8204927"
     rRNA            complement(838962..839119)
                     /locus_tag="ZYRO0E10127r"
                     /product="ribosomal RNA"
                     /note="RDN58-1 5.8S rRNA"
                     /transcript_id="XR_002648423.1"
                     /db_xref="GeneID:8204927"
     gene            complement(839345..841147)
                     /locus_tag="ZYRO0E10134r"
                     /db_xref="GeneID:8204928"
     rRNA            complement(839345..841147)
                     /locus_tag="ZYRO0E10134r"
                     /product="ribosomal RNA"
                     /note="RDN18-1 18S rRNA"
                     /transcript_id="XR_002648424.1"
                     /db_xref="GeneID:8204928"
     gene            complement(<843747..>845354)
                     /locus_tag="ZYRO0E10142g"
                     /db_xref="GeneID:8204929"
     mRNA            complement(<843747..>845354)
                     /locus_tag="ZYRO0E10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499319.1"
                     /db_xref="GeneID:8204929"
     CDS             complement(843747..845354)
                     /locus_tag="ZYRO0E10142g"
                     /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
                     YLL055W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499364.1"
                     /db_xref="GeneID:8204929"
                     /db_xref="GOA:C5E4Z8"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z8"
                     /translation="MESQSSSEEHVVVDIIDKDKSVEENAVKDSTEINDQEKKYAVVK
                     SKDTDVVLKFMEEHDSEVPEITPDQERTLRRKVALIIVGFTFLIDLTLYSDKAVLSYD
                     SILGLFQDTGLTQNTYNDANTLFYVGYLIGQFNLIFVQKFSIGRVVAIMTGVWTIVIF
                     LHCTAYNYQGIIALRFFLGFVESIAVPTLNITMNQFLTPSEKNSYGPIWYISSMGVTI
                     PVGFIAYGILYAKSNVPTWKLFTIIIGGCTFLITILVFLWYPNNPADAKFLSTNEKVW
                     VIRRVQKSSRASIEQKVIKKYQIVEAVKDPITWLFFLFFLTQQLANNLAYQQNLLFEG
                     LGHITNLDSTLVSVASGGFASVCSIVATVFLLYTKDYTAFSVVFWSIPSFASSIALTT
                     IPWDKRIALLAMLCVASPLFGIPWILMFSWNTTSCSGYTKRITRNAIVMIGYSISNII
                     SPQIWRAKDAPRYIPAWIVQIVLSFFFAPMLALVVRYILKKRNVRRLTDLKSNNGLVE
                     IDGEAVKVDVAMLDLTDLENKSFIYPL"
     gene            complement(846673..846746)
                     /locus_tag="ZYRO0E10164r"
                     /db_xref="GeneID:8204930"
     tRNA            complement(846673..846746)
                     /locus_tag="ZYRO0E10164r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.64"
                     /db_xref="GeneID:8204930"
     gene            complement(847046..847127)
                     /locus_tag="ZYRO0E10186r"
                     /db_xref="GeneID:8204931"
     tRNA            complement(847046..847127)
                     /locus_tag="ZYRO0E10186r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=83.48"
                     /db_xref="GeneID:8204931"
     gene            850696..850768
                     /locus_tag="ZYRO0E10208r"
                     /db_xref="GeneID:8204932"
     tRNA            850696..850768
                     /locus_tag="ZYRO0E10208r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8204932"
     gene            complement(<850980..>852656)
                     /locus_tag="ZYRO0E10230g"
                     /db_xref="GeneID:8204933"
     mRNA            complement(<850980..>852656)
                     /locus_tag="ZYRO0E10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499320.1"
                     /db_xref="GeneID:8204933"
     CDS             complement(850980..852656)
                     /locus_tag="ZYRO0E10230g"
                     /note="weakly similar to uniprot|Q07824 Saccharomyces
                     cerevisiae YLL028W TPO1 Proton- motive-force-dependent
                     multidrug transporter of the major facilitator superfamily
                     able to transport eight different compounds including
                     polyamines quinidine cycloheximide and nystatin involved
                     in excess spermidine detoxification"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499365.1"
                     /db_xref="GeneID:8204933"
                     /db_xref="GOA:C5E4Z9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E4Z9"
                     /translation="MPRIIDDLEPEPKKCEQEFVEDVNSPVEDNSSGTSPTGISPAEK
                     FRQESSSIHTVNGKRVLQEYEVYDKLGYEFPQWKKWSIVTVIFVCQLSMNFNGSVYPH
                     ALSLISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEEYGRRNIMQLSLFFTNIWQ
                     ILGGKAPNFGTIIVARFLGGISQAGGSVTLGVVADMWQPQDHGYAVAYVVLASVLGAV
                     IGPVFGGLMEEHLSWHWNFWIQLIFGGVTQLLHFFLVPETRASVLTDREAKRRRKSGE
                     DPEIYGPHEVKSLDFKEIMRTWLRPFYMFLCEPIVLFCSLLSGFADHLIFICNQSFTP
                     IFKQWHFSTTACGLIFITLVVSYAIAYPLHLIDIYYMRKKMDELMHSPRGPERRLLLL
                     LYLAPLLSIGLFGFAWTSMGPSYTPWIAPAIFSTVIGIANYSIYMATIDYMVAAYGPY
                     ASSATGGNGLARDLLGGIAAMYAGPLYNNIGGKFHYQWASTLLGCLSIICSIPIYIFY
                     WKGPLIRKKSKFAQEIARSLEDEMEHVQPGHTDKTINVQSNPSKEVSDKV"
     gene            complement(<855171..>855635)
                     /locus_tag="ZYRO0E10252g"
                     /db_xref="GeneID:8204934"
     mRNA            complement(<855171..>855635)
                     /locus_tag="ZYRO0E10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499321.1"
                     /db_xref="GeneID:8204934"
     CDS             complement(855171..855635)
                     /locus_tag="ZYRO0E10252g"
                     /note="some similarities with uniprot|P28319 Saccharomyces
                     cerevisiae YKL096W CWP1 Cell wall mannoprotein linked to a
                     beta-1 3- and beta-1 6-glucan heteropolymer through a
                     phosphodiester bond involved in cell wall organization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499366.1"
                     /db_xref="GeneID:8204934"
                     /db_xref="UniProtKB/TrEMBL:C5E500"
                     /translation="MQLVVLILVLTSAFNVLVVSDMFRLRTLRSGDIITMEDGPLDDA
                     NVTNENNRLRINKDKTDLYAAVDDDHHLLFANNSYASEKTEGYFQQTSKHVASSPFSI
                     KDGYLNYKNSKKFYAVAEDNGYTLYTRAAGGDAVEIVLMVESIDGKEIPDFP"
     gene            856908..856981
                     /locus_tag="ZYRO0E10274r"
                     /db_xref="GeneID:8204935"
     tRNA            856908..856981
                     /locus_tag="ZYRO0E10274r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.64"
                     /db_xref="GeneID:8204935"
     gene            complement(<857927..>858262)
                     /locus_tag="ZYRO0E10296g"
                     /db_xref="GeneID:8204936"
     mRNA            complement(<857927..>858262)
                     /locus_tag="ZYRO0E10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499322.1"
                     /db_xref="GeneID:8204936"
     CDS             complement(857927..858262)
                     /locus_tag="ZYRO0E10296g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499367.1"
                     /db_xref="GeneID:8204936"
                     /db_xref="UniProtKB/TrEMBL:C5E501"
                     /translation="MRQIFLRLLFPTKITHGIIQNRLNRSQTYTNLYGAILFSFVVYL
                     QTSRNFTSMVFIHHAVIHELGSSFKAHELLVMFFGRIYLSFPSIQLSTKLTNSRCGKK
                     NRGGSHYST"
     gene            complement(<859580..>861139)
                     /locus_tag="ZYRO0E10318g"
                     /db_xref="GeneID:8204937"
     mRNA            complement(<859580..>861139)
                     /locus_tag="ZYRO0E10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499323.1"
                     /db_xref="GeneID:8204937"
     CDS             complement(859580..861139)
                     /locus_tag="ZYRO0E10318g"
                     /note="highly similar to uniprot|P15202 Saccharomyces
                     cerevisiae YDR256C CTA1 Catalase A breaks down hydrogen
                     peroxide in the peroxisomal matrix formed by acyl-CoA
                     oxidase (Pox1p) during fatty acid beta-oxidation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499368.1"
                     /db_xref="GeneID:8204937"
                     /db_xref="GOA:C5E502"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:C5E502"
                     /translation="MRSRTSYITDCLGIAPSSSSFSIRKSITTMSPANYSVPLYTTSN
                     GCPVRDPNAMLKMGKFGPTLLQDHHLIDLIAHFDRERIPERVAHAKGSGAHGYLEVTD
                     DVSDIVSADFLNGIGKKTPLFLRFSTVGGEKGTADSARDPRGFAIKFYTQEGVIDWVN
                     INSPIFFIRNGVQFPYLVHTQKARDPKTNLKDPNMFWDFLLNNPESVHNTMFVFSDRG
                     TPFSYRHMHGYSAHTYKWVNKEGKFHYVQVHLLTDQGIKNLNNEEAHALEADDPDHAG
                     RDLYESIEGGEYPSWTIYIQTMTAEQAEQADFSVFDLTKTWPQKEYPLRRVAKLVLDR
                     NPENYFAEVEQSAFSPANTVPGIEPSADPVLQARLFSYADTQRYRLGPNFNQLPVNRP
                     LQAYCPFQRDGPGRTDGNYGAVPNYPSSFEPLNYRADASNNEAHEKWVGEATSFHWGA
                     TEKDYEQPRIFWELFKNTGQQDAFIHNVTENVKATRPDVQKRVLELFSKINPEISELM
                     SHSLETKAKRT"
     gene            <861907..>863475
                     /locus_tag="ZYRO0E10340g"
                     /db_xref="GeneID:8204938"
     mRNA            <861907..>863475
                     /locus_tag="ZYRO0E10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499324.1"
                     /db_xref="GeneID:8204938"
     CDS             861907..863475
                     /locus_tag="ZYRO0E10340g"
                     /note="highly similar to uniprot|Q2UD26 Aspergillus oryzae
                     AO090012000349 Choline dehydrogenase and related
                     flavoproteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499369.1"
                     /db_xref="GeneID:8204938"
                     /db_xref="GOA:C5E503"
                     /db_xref="InterPro:IPR000172"
                     /db_xref="InterPro:IPR007867"
                     /db_xref="InterPro:IPR012132"
                     /db_xref="UniProtKB/TrEMBL:C5E503"
                     /translation="MELRGSKYDWAYKTTMVKRDDYERIEKPNTRGKALGGSSSLNYF
                     SWIPGCKPTFDRWEEFGGEEWTWDPLVPYLRKSATYHDDLKLYPEELKKIGGGGPLPI
                     SHAELVDELAPFREKIIEAWKSRDLPMSENIYDGEMIGLTHCVDSIYHGVRSSSVYFL
                     KEKPNITILSQVHSKKVIIDAADKVAKGVTIIKPSGEEHSYYAKREVIVAQGVFESPK
                     LLMLSGVGPKKELETHGIDVIVENPHVGQHLLDHPGVPFVLHVKDGFGMDDHLLREGP
                     AHTAAVEQYKKKSTGPVGSGLLELVGFPRIDEYLEKDPHYLQAKKANGGKDPFCPEGQ
                     PHFELDFVSMFGSAFQWHYPTPKEGCYTSVVVDLVRPISEPGEVKLNSADPLVQPNIN
                     LNFFADELDIIAMREGIRFSYDVLTKGKGFKDIVVGEYPWEMPLDDDKEMRKQILDRV
                     QTAFHPCGTARLSKSSEQGVVDSSLKVHGVKGLRVIDASVIPVIPDCRIQNSVYAIGE
                     KGADAIKEAHKDLY"
     gene            <867393..>868394
                     /locus_tag="ZYRO0E10362g"
                     /db_xref="GeneID:8204939"
     mRNA            <867393..>868394
                     /locus_tag="ZYRO0E10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499325.1"
                     /db_xref="GeneID:8204939"
     CDS             867393..868394
                     /locus_tag="ZYRO0E10362g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|P53111 Saccharomyces
                     cerevisiae YGL157W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499370.1"
                     /db_xref="GeneID:8204939"
                     /db_xref="GOA:C5E504"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5E504"
                     /translation="MAVLVTGATGFIAQWVLDCLLKENYQVIGTVRSQEKGDKLHKQF
                     GSPSKLSFEIVKDISDTEAFEPLFKKRGKEIDIVLHMASPCHFNTSDYEKDLLIPALN
                     GTKGVLNAIKKYGDVKKVVVTSSYAAITDMVNSADGSLVFTEKDWNPATWERCQTDAV
                     NAYCASKKFAEQAAWEFSKETGVSLTTINPVFVFGPQKFDEDVTSQLNTSNEIINGLI
                     HSKPGDKLEPDYHSAYVDVRDVARAHLVAFQKDTTGERLGLSNGAFNCQSILDILNEK
                     FPQLDNTKGPEPGMGDTKPGAVFDNRHSKEVLAFPFISLEQCVYDTVAQVLKKEGRL"
     gene            870306..870377
                     /locus_tag="ZYRO0E10384r"
                     /db_xref="GeneID:8204940"
     tRNA            870306..870377
                     /locus_tag="ZYRO0E10384r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (TCC) cove score=71.59"
                     /db_xref="GeneID:8204940"
     gene            complement(<871237..>871980)
                     /locus_tag="ZYRO0E10406g"
                     /db_xref="GeneID:8204941"
     mRNA            complement(<871237..>871980)
                     /locus_tag="ZYRO0E10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499326.1"
                     /db_xref="GeneID:8204941"
     CDS             complement(871237..871980)
                     /locus_tag="ZYRO0E10406g"
                     /note="similar to uniprot|P33751 Saccharomyces cerevisiae
                     YDR538W PAD1 Phenylacrylic acid decarboxylase confers
                     resistance to cinnamic acid decarboxylates aromatic
                     carboxylic acids to the corresponding vinyl derivatives"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499371.1"
                     /db_xref="GeneID:8204941"
                     /db_xref="GOA:C5E505"
                     /db_xref="InterPro:IPR003382"
                     /db_xref="InterPro:IPR004507"
                     /db_xref="UniProtKB/TrEMBL:C5E505"
                     /translation="MLGMQFFSRALCVGGHVRSFCFSQVRGPVKLRSFGTNLAKRNSS
                     SSSLTEKQVCNGTVAPKPKRIVVSITGATGIALGVRILQILKELNVETHLIISKWGMA
                     TMKYETDFTLEDLRSIATHTYPAKNVAAAVSSGSFLHDGMIVVPCSMKTLAAIRCGYT
                     EDLIVRAADVTLKEKRKLLVVPRETPLSEIHLENMLSLARMGVIIFPPVPAFYTKPTS
                     LDDIIEQSCGRILDCFGIHTNNFSRWDGF"
     gene            <872520..>874055
                     /locus_tag="ZYRO0E10428g"
                     /db_xref="GeneID:8204942"
     mRNA            <872520..>874055
                     /locus_tag="ZYRO0E10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499327.1"
                     /db_xref="GeneID:8204942"
     CDS             872520..874055
                     /locus_tag="ZYRO0E10428g"
                     /note="similar to uniprot|Q03034 Saccharomyces cerevisiae
                     YDR539W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499372.1"
                     /db_xref="GeneID:8204942"
                     /db_xref="GOA:C5E506"
                     /db_xref="InterPro:IPR001158"
                     /db_xref="InterPro:IPR002830"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:C5E506"
                     /translation="MAPKLTPVLKFRDFLEALRREGDLVEIFQEVDPHLEVGAIMRKV
                     YENKLPVPLFKNLKQPKGNVDPDNLFDIAGCIGGLRAFGNDHARIAHHLGLSSDTGMK
                     EIIDHLLEAKKRKPIPPVKVNRDSAPCKENILKGDQINLEQLPAPYLHDEDGGKYLQT
                     YGMFVLQTPDKSWTNWSIARAMIHDEKHLTGLVMNPQHIRRVADQWKTVGKENAVPFA
                     LCFGVPPASILVSSMPIPEGVSEADYIGSVVGEPIQVVQAETNQLEVPAESEIVLEGT
                     LNLDHMVPEGPFGEMHGYVFPGTGHPCPTYTVETISYRNNAILPVSNPGLCTDETHTL
                     IGSLVAAEAKQICLNHPVLSKIVMDAFMPYESQVLWLAFKINVKELVKLNTDSKSLAD
                     LFAKEIYGNKVGMTTQEIILVGDDIDIFNFKKLMWAYVTRHTPGDDQYFYDEFVAFPL
                     APFISQGPRIKTKRGGNCVTDCLFPIQYRDPNFRFVTCDFDSYDSAIRDKINQNWSNY
                     GYQ"
     gene            <874684..>876855
                     /locus_tag="ZYRO0E10450g"
                     /db_xref="GeneID:8204943"
     mRNA            <874684..>876855
                     /locus_tag="ZYRO0E10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002499328.1"
                     /db_xref="GeneID:8204943"
     CDS             874684..876855
                     /locus_tag="ZYRO0E10450g"
                     /note="some similarities with uniprot|P32319 Saccharomyces
                     cerevisiae YBL017C PEP1 Type I transmembrane sorting
                     receptor for multiple vacuolar hydrolases cycles between
                     the late-Golgi and prevacuolar endosome-like compartments"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002499373.1"
                     /db_xref="GeneID:8204943"
                     /db_xref="GOA:C5E507"
                     /db_xref="InterPro:IPR006581"
                     /db_xref="InterPro:IPR011040"
                     /db_xref="UniProtKB/TrEMBL:C5E507"
                     /translation="MRCNQWKPEIRMHFVQVLWALWALVTAQESVPCVSRSHIERPHK
                     PNAFNRGNVYTFSDSHTLMFYFERSLQITFDSGRNWQTVDVFGEDISWVDIDEFYKER
                     AFVTTTSGEIHMTEDQGRSWKQLSLPQEIEDEKDCVLDTHPFNTNLLLLHCIIIPGNF
                     ELEHSPETIPDSSSFMEDIAYASADAGKSFRRISAPFEEYEATQDLEYRGTTCQFATL
                     SKESIFDKDGIYCMHQLESRTEIQKQSSHPYGMNIGKKSFRETQPSVPKTYTMGTLFY
                     TTDLGQSTKLFDELEGFSVKDVSILPFHVLVTTSEANEVDGAANRLWVSTGGPFKPAC
                     LPKRVAYLPQRVRKPLELDPESILLRAILEEDEGHGKFEHLLLSDSSGLNFSLIDSIA
                     QEHAQHVMIKKLDNLEGAVWGEFIFREVHNRITELDMDETKLDKKVNWFQRIIEFIKK
                     HILHRVPYMFFRTKGSFDNGNMYDMFSKTKGSFDNGKTWTNLKVVDPSGTHKHIFQCD
                     IDDVENCSFQEVFSPYFDAPINEPTAGILMETGVVGKHALRLGEEDNMTFISRDGGSS
                     WEVVFEFPVSAAFLDFGNIIVAVPESSCLKDSSVEKFFYSLDQGNNWREYYLDELTHA
                     SNIVLDGWGLNVVIGLGNGKKQPTEYTFYTVDFSEVLGGSACTDNDWEKWYLSDGKCF
                     NGVKYSFNRRKADAQCLMRKTFEELTLNEESCEPRDIKSSI"
     gene            879386..879458
                     /locus_tag="ZYRO0E10494r"
                     /db_xref="GeneID:8204944"
     tRNA            879386..879458
                     /locus_tag="ZYRO0E10494r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8204944"
CONTIG      join(CU928181.1:1..881646)
//
DBGET integrated database retrieval system