GenomeNet

Database: RefSeq
Entry: NC_012995
LinkDB: NC_012995
Original site: NC_012995 
LOCUS       NC_012995            1554288 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Zygosaccharomyces rouxii strain CBS732 chromosome F complete
            sequence.
ACCESSION   NC_012995
VERSION     NC_012995.1
DBLINK      BioProject: PRJNA39573
            BioSample: SAMEA3138235
            Assembly: GCF_000026365.1
KEYWORDS    RefSeq; genomic DNA.
SOURCE      Zygosaccharomyces rouxii
  ORGANISM  Zygosaccharomyces rouxii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygosaccharomyces.
REFERENCE   1  (bases 1 to 1554288)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1554288)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1554288)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928178.
            The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A
            to G). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1554288
                     /organism="Zygosaccharomyces rouxii"
                     /mol_type="genomic DNA"
                     /strain="CBS 732"
                     /db_xref="taxon:4956"
                     /chromosome="F"
     mobile_element  complement(3741..6008)
                     /mobile_element_type="retrotransposon"
     gene            complement(10253..10339)
                     /locus_tag="ZYRO0F00132r"
                     /db_xref="GeneID:8205794"
     tRNA            complement(join(10253..10288,10303..10339))
                     /locus_tag="ZYRO0F00132r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (TTT) cove"
                     /db_xref="GeneID:8205794"
     gene            11007..11088
                     /locus_tag="ZYRO0F00154r"
                     /db_xref="GeneID:8204956"
     tRNA            11007..11088
                     /locus_tag="ZYRO0F00154r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=83.48"
                     /db_xref="GeneID:8204956"
     gene            <13490..>20530
                     /locus_tag="ZYRO0F00176g"
                     /db_xref="GeneID:8204957"
     mRNA            <13490..>20530
                     /locus_tag="ZYRO0F00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497166.1"
                     /db_xref="GeneID:8204957"
     CDS             13490..20530
                     /locus_tag="ZYRO0F00176g"
                     /note="weakly similar to uniprot|P32768 Saccharomyces
                     cerevisiae YAR050W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497211.1"
                     /db_xref="GeneID:8204957"
                     /db_xref="GOA:C5DWW7"
                     /db_xref="InterPro:IPR001389"
                     /db_xref="InterPro:IPR018871"
                     /db_xref="UniProtKB/TrEMBL:C5DWW7"
                     /translation="MIPKMIISQWLMWFSMLGVMKVLATTACLPQNQAQNGFKANFYQ
                     YDFGDEVTYADPAYMAGEYSQRQLLGTQTNVDNILIAYGMKCRLWDGRVVVPTEPWNF
                     DYSKCTNNDYIYNQQPGSVYGFDLYATDFTVELTGYFLAPQDGTYTFAFKHIDDSAIL
                     NFGEGIAFDCCDQGNAANGNTNFSINAIKPNNGPTGHTTIEVDLAANYYYPIKIVFTN
                     TEQIAMLYTTVTLPDGTLVANDFSGYVFSFDSDPQQPSCTVSNPLPFVTSTSTTSWTG
                     SFTSTYTTKTDIITDTNGNGEGQVVIGVETPTTAAVLSTAFTPYSGSTTSTFSTESTW
                     ITGTDGKTTPESIYYVETPTTPAVLTTEYTPYSGSVSSTFSTESTWITGNDGKITPES
                     VYHVETPTIPPVLSTSYTSYDGNTTSTYSTESTWISGNDGKTTPETIYYVETPTTPAV
                     LTTEYTPYSGSVSSTFSTESTWITGNDGKITPESVYHVETPTIAPILSTDYTGYSGNA
                     TSTFSTESTWITGTDGKTTPETIYHVETPTIAPVLSTSYTGYDGNTTSTFSTESTWIT
                     GTDGKTTPESIYHVETPTVAPILSTDYTSYPGNATSTFSTESTWVTGTDGKTTPESIY
                     HVQTPTVAPILSTDYTGYPGNATSTFSTESTWITGTDGKTTPESIYHVETPTVAPILS
                     TDYTGYPGNATSTFSTESTWVTGTDGKTTPESIYHVQTPTVAPILSTDYTGYPGNATS
                     TFSTESTWITGTDGKTTPESIYHVETPTVAPILSTDYTGYPGNATSTFSTESTWITGT
                     DGKTTPESIYHVETPTVAPILSTDYTGYPGNATSTFSTESTWITGTDGKTTPESIYHV
                     QTPTVAPILSTNYTGYPGNATSTFSTESTWVTGTDGKTTPESIYHVQTPTVGPILSTV
                     YTGYPGNATSTFSTESTWITGTDGKTTPESIYHVETPTVAPILSTDYTGYPGNATSTF
                     STESTWITGTDGKTTPESIYHVQTPTVGPILSTVYNGYPGNATSTFSTESTWITGTDG
                     KTTPESIYHVETPTVAPILSTDYTGYPGNATSTFSTESTWITGTDGKTTPESIYHVQT
                     PTVAPILSTNYTGYPGNATSTFSTESTWVTGTDGKTTPESIYHVQTPTVGPILSTVYN
                     GYPGNATSTFSTESTWITGTDGKTTPESIYHVQTPTVAPILSTDYTGYPGNATSTFST
                     ESTWVTGTDGKTTPESIYHVQTPTVAPILSTNYTGYPGNATSTFSTESTWVTGTDGKT
                     TPESIYHVQTPTVGPILSTVYTGYPGNATSTFSTESTWVTGTDGKTTPESIYHVQTPT
                     VAPILSTDYTGYPGNATSTFSTESTWITGTDGKTTPESIYHVQTPTVAPILSTDYTGY
                     PGNATSTFSTDSTWVTGTDGKTTPESIYHVQTPTVGPILSTVYTGYPGNATSTFSTES
                     TWITGTDGKTTPESIYHVETPTVAPILSTDYTGYPGNATSTFSTESTWITGTDGKTTP
                     ETIYHVETPTSTGASSTAAGAFSISTNGSSIPSGILSTEYSPYPGSASSTFSTETTWF
                     TGTDGKTTPETIYHVETPTVAPILSTVYTGYPGNATSTFTTESTWITGTDGNTTPETI
                     YHVETPTSTGASSTPSGVLSTEYSPYPGSASSTFSTETTWFTGTDGKTTPETIYHVET
                     PTVAPILSTVYTGYPGNATSTFTTESTWITGTDGNTTPETIYHVETPTSTGASSTPSG
                     VLSTEYSPYPGSASSTFSTETTWFTGTDGKTTPETIYHVETPTSIPVKNTPHSWSGGN
                     RTSITDDKTYYTTNTDVITSATTYCPYPTTLITQSQTFTVTQPSTLTITYTNSGATAI
                     LPVTQTTSSNEQNTVSPQATTTNEASQQGANTQQNNGGSPATFTSLATSTTNEASQQG
                     ADTQQSNGGSPATVTSLATSTEIVTELTTYCPSPTVLTTNGATYTITEATTLTITDCP
                     CTLTHTNTIMKTADSNAPVVTAFTDGSSSSGNNNGGSPETFASLATSTNDEASQQGAN
                     TQQNKGDSPETVTSLATSTEIVTELTTYCPSPTVLTTNGATYTITEATTLTITDCPCT
                     LTHTNTIMKTADSNTPAATAFTTGGSSNSGNNNSGQNSAQANVAVVTTTEVVETLTTY
                     CSDYTILSTNGAAYTVTAPTTLTITDCPCTVTRTNTVSDTQPTEGPTVAGFNTTTPAF
                     GAAGFGYTNKTQALAGPIFNNGSNYVTTIYGGNSSAITTTASPLSLSSSSPYTKQSVS
                     SKGGDNVMTQYNTVTATADESPRTEPTEVSTTTLVASNITVTEGTTAFTTITPSQSAL
                     PKRDYNRNSKLSVTISSNAANSLTSSSLIAILGFLFMLFN"
     gene            24632..24703
                     /locus_tag="ZYRO0F00220r"
                     /db_xref="GeneID:8204958"
     tRNA            24632..24703
                     /locus_tag="ZYRO0F00220r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (AGG) cove score=64.64"
                     /db_xref="GeneID:8204958"
     gene            <26301..>27908
                     /locus_tag="ZYRO0F00242g"
                     /db_xref="GeneID:8204959"
     mRNA            <26301..>27908
                     /locus_tag="ZYRO0F00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497167.1"
                     /db_xref="GeneID:8204959"
     CDS             26301..27908
                     /locus_tag="ZYRO0F00242g"
                     /note="similar to uniprot|Q0CZS0 Aspergillus terreus
                     NIH2624 ATEG_00814 Hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497212.1"
                     /db_xref="GeneID:8204959"
                     /db_xref="GOA:C5DWW8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:C5DWW8"
                     /translation="MQQSKEKSESKIYDVIDVEEGHLGISHEIRGDQPVRLEKKFNLL
                     SAIASGISTGNTWTALGGAIVASLNNGGPPGIMYEFIAVSVFYWAIGASIAELASSVP
                     ASGGVYHWAAMTPGKKWGPICGWFAGWFDFLAWNFGIASNANMVASMIVYSYGLFHPD
                     TELQRWHVYICFLILTWLCCFVVMFADWALPTINRIGSFLILGGWFVTVVVCAVMPST
                     TGKGHASNDFVWSKWQNNTGYSSDGFAFLLGMLNGAFSVGTPDCITHLAEEIPDAGRN
                     LPKVLFWQILVGFITAITYMIAMFYAINNLPIIFSSNTFSPLGEIYLQATNSRGGAIG
                     LLLIIYLPIICAIVGCYITAGRTLYVLARDNATPFSKYLGAIHPRYKSPFWATFACGV
                     LCTCLGAIYVGSATAFNAFVGSFVLLTTAAFFLAMLPNLLTKRSKLPLGSFNMGKFGY
                     AVNIISCLYILVFFVIYCFPYSLPATAENMNYTSVMVSGLTLMVAIWWMVHGRKNYKG
                     PTFDMVEKDNCSVLTDDYLVASSTGRS"
     gene            complement(<28026..>29741)
                     /locus_tag="ZYRO0F00264g"
                     /db_xref="GeneID:8204960"
     mRNA            complement(<28026..>29741)
                     /locus_tag="ZYRO0F00264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497168.1"
                     /db_xref="GeneID:8204960"
     CDS             complement(28026..29741)
                     /locus_tag="ZYRO0F00264g"
                     /note="similar to uniprot|P40445 Saccharomyces cerevisiae
                     YIL166C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497213.1"
                     /db_xref="GeneID:8204960"
                     /db_xref="GOA:C5DWW9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DWW9"
                     /translation="MSASSHSYEYNPQDVGESFHDNEQSLRKDDGTKVNVKITDSVVE
                     SSYSLELDDLESAEAIEKNPFADPSTADYYAKLYDDAGYESRKAYDPNFYWSKNEEKK
                     LVWKLDFRCGLVACIMFASLQIDRGNLAQAVADNMLSDLGMTTDDYNTGNQLFYVCFL
                     VTEIPSQLISKRLGPDRFIPLQMVLWSIVSMCQATMNSKGGFFATRCLIGMLEGGFIA
                     DLVLWLSYFYNSKELTIRLSWFWTTLSVVQICTALLAFAILRMRGIGGLEGWKWLFLI
                     EGAITFLIGVSSFYWMVPSAVQTRNWMHPKGWFNEREEKIVVNRVLRDDPSKGDMHNR
                     QTLTPKMIWRALSDYDLWPIYAVGLLLYIPNDTIQSYLTLNLKQLHFSRFDVQLLTIP
                     PYVLQIVFLLMITWFSEYVQERCFVCIISPVWATIFMGLIRWWKGSMHDVWGTYALVM
                     LMYAQPYVHAICVSWVSRNSNSIRTRAISSAMYNMFVQLGSICANQVYRQDDMPYYHR
                     GNMQLFCISLGAIPLFLLTKFYYVTRNKKKLKIWSNMSKEEQVEYINTTTDQGNKRLD
                     FLFDH"
     gene            complement(<30452..>31699)
                     /locus_tag="ZYRO0F00286g"
                     /db_xref="GeneID:8204961"
     mRNA            complement(<30452..>31699)
                     /locus_tag="ZYRO0F00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497169.1"
                     /db_xref="GeneID:8204961"
     CDS             complement(30452..31699)
                     /locus_tag="ZYRO0F00286g"
                     /note="similar to uniprot|Q12358 Saccharomyces cerevisiae
                     YLL057C JLP1 similar to Fe(II)-dependent
                     sulfonate/alpha-ketoglutarate dioxygenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497214.1"
                     /db_xref="GeneID:8204961"
                     /db_xref="GOA:C5DWX0"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:C5DWX0"
                     /translation="MSPPSAVGTVSATKTVAQDGGEKQLLEKLGKLHLNYGGPGGTYA
                     NFDTHFYKDQDEYSEDGVLRIHPKYRSKAQYPEFLPTWDPKERYPPLTFHKYDDPALR
                     ANEQLVNLFPKGADVETKRITPKLGTEVKGIQLSQLSPEGKDELALLVAQRGIVVFRN
                     QDFAKHGPEFAVEYGKYFGKLHIHQTSGHPETAPELHVTYRRPDHAEFERVFEDSHTS
                     IGWHTDVSYELQPPSYTFFSVLQGPEGGGDTLFADSVEAYERLSPTLKQFLEGLHVIH
                     SSVEQAQNSKLQGGIQRREPTGHIHPLIRWHPVLKRKSLYVNKAFSRRIVELKKPESD
                     LLLNFLYSLFNNALDLQLRAYWEPDTVAIWDNRRTIHSAVIDWEEPVNRHAFRITPQA
                     ERPIESPEFYNDPNYFPQEVTKY"
     gene            complement(<32198..>33157)
                     /locus_tag="ZYRO0F00308g"
                     /db_xref="GeneID:8204962"
     mRNA            complement(<32198..>33157)
                     /locus_tag="ZYRO0F00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497170.1"
                     /db_xref="GeneID:8204962"
     CDS             complement(32198..33157)
                     /locus_tag="ZYRO0F00308g"
                     /note="highly similar to uniprot|P41819 Saccharomyces
                     cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
                     responsible for conserved m6(2)Am6(2)A dimethylation in
                     3'-terminal loop of 18 S rRNA part of 90S and 40S
                     pre-particles in nucleolus involved in pre-ribosomal RNA
                     processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497215.1"
                     /db_xref="GeneID:8204962"
                     /db_xref="GOA:C5DWX1"
                     /db_xref="InterPro:IPR001737"
                     /db_xref="InterPro:IPR011530"
                     /db_xref="InterPro:IPR020598"
                     /db_xref="InterPro:IPR025814"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DWX1"
                     /translation="MGKAAKRSYTGTPSTNKQVDAAKHLGSVFKFNTDLGQHILKNPL
                     VAQGIVDKAQLRPSDTVLEVGPGTGNLTVRILEQVRKAYAVEMDPRMAAELTKRVRGT
                     DGERKLEILLGDFIKTDLPYFDVCISNTPYQISSPLVFKLINQPRPPRVAVLMFQREF
                     AMRLVARPGDALYCRLSANVQMWANVVHIMKVSKNNFRPPPQVESSVVRLEIKNPRPP
                     IEFNEWDGLLRIVFVRKNKTIAAGFKSSSVIDILEKNYKTFLAMNDEMVDDTKGSMTQ
                     TVKSKIETVLQETGLGEKRAGKCDQTDFLKLLYAFHQVGIHFS"
     gene            complement(<33389..>34063)
                     /locus_tag="ZYRO0F00330g"
                     /db_xref="GeneID:8204963"
     mRNA            complement(<33389..>34063)
                     /locus_tag="ZYRO0F00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497171.1"
                     /db_xref="GeneID:8204963"
     CDS             complement(33389..34063)
                     /locus_tag="ZYRO0F00330g"
                     /note="similar to uniprot|Q08981 Saccharomyces cerevisiae
                     YPL267W ACM1 Protein of unknown function potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497216.1"
                     /db_xref="GeneID:8204963"
                     /db_xref="UniProtKB/TrEMBL:C5DWX2"
                     /translation="MSSPIKRRTALVGKSTNIRSSTVRKGSVSPSKRSQVNVDYALRH
                     SPVRNVPTSSLDKNPAPAPAPLLPFVMHEETPEERTATLMNHMSLSHSIMKYHDENDF
                     SGVKENMSPSKLHRTTKNSSPTRSQLPTTAVHKPLRDLSISEHEGSVEDPRTSESIPL
                     TLHYTKKTRLPNFITPPRDKHLRQYFSTTRHDDDDHSHLFTSKSTDDIPKDKVVRKLD
                     FKICEN"
     gene            complement(<34415..>36892)
                     /locus_tag="ZYRO0F00352g"
                     /db_xref="GeneID:8204964"
     mRNA            complement(<34415..>36892)
                     /locus_tag="ZYRO0F00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497172.1"
                     /db_xref="GeneID:8204964"
     CDS             complement(34415..36892)
                     /locus_tag="ZYRO0F00352g"
                     /note="similar to uniprot|P32383 Saccharomyces cerevisiae
                     YPL268W PLC1 Phosphoinositide-specific phospholipase C
                     hydrolyzes phosphatidylinositol 4 5-biphosphate (PIP2) to
                     generate inositol 1 4 5-triphosphate (IP3) and 1
                     2-diacylglycerol (DAG) involved in kinetochore function
                     and pseudohyphal differentiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497217.1"
                     /db_xref="GeneID:8204964"
                     /db_xref="GOA:C5DWX3"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000909"
                     /db_xref="InterPro:IPR001192"
                     /db_xref="InterPro:IPR001711"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR015359"
                     /db_xref="InterPro:IPR017946"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="UniProtKB/TrEMBL:C5DWX3"
                     /translation="MSRNLRSMFRRTSGFVTSTLKDTHSDGHSSLSIAYPCAFQDIIE
                     NIENTGSSSEVLSASCDKMKRGLWMRRIGRKKQVEYLFKLESSGAIVWKDGGKRLPLD
                     SIKDIRTGEMASNYREQYGVSIKVSHLWVTVIYYVSNKLKALHVVANNQEELDVFMNC
                     ICGLVKLRMELMESISVPDNEKFANIHWHSTVSRRKEDETKDTLTFDDVRKLCDRFHI
                     YCSTNHLKKFFRMADVNNNGLLNFQEFQTFVTLLKTRPELKQLWNSITLGRSAMSLQE
                     FHQFLTQEQGEQASEQDAQAIIGRFKKTKDGGFTYDDFIKYLGAQPHAVEMQEDYDRP
                     LNQYFVASSHNTYLLGKQVGETPSVEGYMQALQQGCRCIEIDIWDDDIGPVVCHGFLT
                     PAIPLINVIEIIRKYAFITSPYPLIISLETNCNRENQAIAASIFMNSLGSMLYQNINE
                     DGPLPSPNELRHKILLKAKKTKRVSDVFNPDLQNGGTMSWEGASSSYSSSYESELENM
                     IKLKETKSASSANPTTIRRIRRVNIRKGVEVSEKLLTISAIYGLKFRNFSLPGSKTTT
                     HCFSLNERKIDNLCNDRIQELSIDKHNRRHLMRVYPHAFRYKSSNFNPIKFWRLGAQF
                     VALNWQTNDLGQQINLAMFQLSNQKNGMLHSGYVLKPLSLREPVPKLQDIPAHYDSFY
                     QTPVQVHLKVLSAQLLPKPAETKNTKDELFAPFVEIEFFSDEELLQPPTVFKGGTKPS
                     SPNAISTEVCKENGFNPVWGTEIHLKLRHTDFTFVKFTVKTGEFALALSCLKLDQLKR
                     GYRHIPLYSQEGELYIFSTLFISTHIS"
     gene            complement(<37241..>39097)
                     /locus_tag="ZYRO0F00374g"
                     /db_xref="GeneID:8204965"
     mRNA            complement(<37241..>39097)
                     /locus_tag="ZYRO0F00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497173.1"
                     /db_xref="GeneID:8204965"
     CDS             complement(37241..39097)
                     /locus_tag="ZYRO0F00374g"
                     /note="similar to gnl|GLV|CAGL0A01155g Candida glabrata
                     CAGL0A01155g and weakly similar to YPL269W uniprot|P32526
                     Saccharomyces cerevisiae YPL269W KAR9 Karyogamy protein
                     required for correct positioning of the mitotic spindle
                     and for orienting cytoplasmic microtubules localizes at
                     the shmoo tip in mating cells and at the tip of the
                     growing bud in small-budded cells through anaphase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497218.1"
                     /db_xref="GeneID:8204965"
                     /db_xref="InterPro:IPR013889"
                     /db_xref="UniProtKB/TrEMBL:C5DWX4"
                     /translation="MDSSSKPDAQFCFEQILPDLQETVTYIGNSTSLKQDHHNKLIWL
                     SKQLTSIKNEVIRVLDVSIDEPHMLSFMEWLAKGKKAYYDLVDIVNKIEPSLSHLLDL
                     VELVLMSPELVNECDGLFDLIEDCTALAVELKVRLNSKMPLLEASLEFDEISKDNIDT
                     LGIVIDTNINQCFEVQEERFTSPVRHPPSFTLKHVVRLLASHTDTAEATIPTFSPIEE
                     VLSRKYLDIKRTVSPISKSLTEILPARIDHFSKRTIIHIDHLTNLLKEKHREVLDKHN
                     IMVKEIRELKRELVDKRWNLLFLNLNHELQSILGEIEHLESKVHDYGNNLEAQDKVKK
                     QLRSKTNIVTKTFNVIYRALEFSLLDVEVASTTNELAQRWLDMRPQSDRVLSASSSFL
                     EESSFDSLSSRFRSLSMGSTETADTEQSSLPPQPARGKFGALLLKKMNIKPVMVTSPT
                     QNDVNNPFLNNLPSPKDEAISRSSSLSMEPVPQLAFKKPEAILERPETPVEKSDLLLE
                     RPETPMPDDDITSIVTSIKNHGCLEDLEVEKINYYAQMPSHIPKLQNHASFKFNWRPP
                     EKSNPPWAPYTFTYNNNSDGVGHLLPPTPLKDILMTKTHLLATHDNSFMTKI"
     gene            complement(<39330..>41528)
                     /locus_tag="ZYRO0F00396g"
                     /db_xref="GeneID:8204966"
     mRNA            complement(<39330..>41528)
                     /locus_tag="ZYRO0F00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497174.1"
                     /db_xref="GeneID:8204966"
     CDS             complement(39330..41528)
                     /locus_tag="ZYRO0F00396g"
                     /note="similar to uniprot|P33311 Saccharomyces cerevisiae
                     YPL270W MDL2 Half-type ATP-binding cassette (ABC)
                     transporter of the inner mitochondrial membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497219.1"
                     /db_xref="GeneID:8204966"
                     /db_xref="GOA:C5DWX5"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DWX5"
                     /translation="MLTLLRPVPRILRPLSKSQLRPLSYIRPLNIVRPQISLISIRIG
                     VRWNSQLSPSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLT
                     ISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAFGLTIYQFLGVFAGLLL
                     VGTAANFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYV
                     VSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHT
                     SKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAE
                     FFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL
                     MQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINI
                     KVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLV
                     QQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL
                     LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA
                     HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPP
                     PPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKITP"
     gene            complement(<41813..>42001)
                     /locus_tag="ZYRO0F00418g"
                     /db_xref="GeneID:8204967"
     mRNA            complement(<41813..>42001)
                     /locus_tag="ZYRO0F00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497175.1"
                     /db_xref="GeneID:8204967"
     CDS             complement(41813..42001)
                     /locus_tag="ZYRO0F00418g"
                     /note="similar to uniprot|P21306 Saccharomyces cerevisiae
                     YPL271W ATP15 Epsilon subunit of the F1 sector of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497220.1"
                     /db_xref="GeneID:8204967"
                     /db_xref="GOA:C5DWX6"
                     /db_xref="InterPro:IPR006721"
                     /db_xref="UniProtKB/TrEMBL:C5DWX6"
                     /translation="MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSK
                     YTKFEKGEPQGEPKPLVN"
     gene            <42723..>45842
                     /locus_tag="ZYRO0F00440g"
                     /db_xref="GeneID:8204968"
     mRNA            <42723..>45842
                     /locus_tag="ZYRO0F00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497176.1"
                     /db_xref="GeneID:8204968"
     CDS             42723..45842
                     /locus_tag="ZYRO0F00440g"
                     /note="similar to gnl|GLV|CAGL0B03553g Candida glabrata
                     CAGL0B03553g and weakly similar to YEL055C uniprot|P39985
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497221.1"
                     /db_xref="GeneID:8204968"
                     /db_xref="GOA:C5DWX7"
                     /db_xref="InterPro:IPR007015"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DWX7"
                     /translation="MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEW
                     SYVLKRLISGLASGRNSARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNL
                     SPDAVGKSKKDLKGKDERGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQE
                     LAELAVKKNWLRESCLYTLFQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYL
                     LLFHGKARKNGKSFKVPSSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADG
                     SHPKSANWNPRLHFVWDILIPILAPGKSDEEIPSKKSHKKKKKDTVEGIEFPEFFQAA
                     VDETFFSEKASSERKYLGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLN
                     KISQKALDAIVKACEKDASEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDIS
                     SSGLDRLFNMLSAQLSREEEPNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIV
                     TLAFFSKKGEDISDLARERLFSILSELTIQKDGQSWQHYTLKLILSKEAEGNEPINKL
                     DEDLKAIETEALDILQNISSDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYR
                     EGLNESNSLVGITEILLSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARE
                     NKEGFAKLFENVDDYQEESAGEEEDLEDGEGKSKKSDDKSKSGNDPSDESEDASSASE
                     EDSSDDSDAEDDSNVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDE
                     MDDDDDDEEDEEEDEEEESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKE
                     ARENVITFKHRIVDMLEAYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLT
                     LDKPLADKISKLLKGRLYKIKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYF
                     STCSTTSLFLGKVLVENNSEDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWL
                     LSRKKTPNA"
     gene            complement(<46021..>47202)
                     /locus_tag="ZYRO0F00462g"
                     /db_xref="GeneID:8204969"
     mRNA            complement(<46021..>47202)
                     /locus_tag="ZYRO0F00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497177.1"
                     /db_xref="GeneID:8204969"
     CDS             complement(46021..47202)
                     /locus_tag="ZYRO0F00462g"
                     /note="similar to uniprot|P39984 Saccharomyces cerevisiae
                     YEL056W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497222.1"
                     /db_xref="GeneID:8204969"
                     /db_xref="GOA:C5DWX8"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR022052"
                     /db_xref="UniProtKB/TrEMBL:C5DWX8"
                     /translation="MSISNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLE
                     WLPGSRSSNRQEMILGTHTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKII
                     KKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGL
                     SFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGS
                     VSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRA
                     SKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSP
                     EVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL
                     E"
     gene            complement(<47424..>49355)
                     /locus_tag="ZYRO0F00484g"
                     /db_xref="GeneID:8204970"
     mRNA            complement(<47424..>49355)
                     /locus_tag="ZYRO0F00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497178.1"
                     /db_xref="GeneID:8204970"
     CDS             complement(47424..49355)
                     /locus_tag="ZYRO0F00484g"
                     /note="similar to uniprot|Q08979 Saccharomyces cerevisiae
                     YPL263C KEL3 Cytoplasmic protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497223.1"
                     /db_xref="GeneID:8204970"
                     /db_xref="InterPro:IPR015915"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR025183"
                     /db_xref="UniProtKB/TrEMBL:C5DWX9"
                     /translation="MAKKGKKDKEAKKARGEQKLKKNQGKAELKDKKKAKKVLADDDE
                     DDDMDLEEVLASFKKEQEQFEKVVVESVDKPSARINPCLVSNPAHGKKELILFGGEYT
                     NQSNSTTHFYNELFTFTPDNDQWRKISSQNAPMPRSSAAMAAHPSGIALLHGGEFSSP
                     KQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTST
                     TYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGL
                     QKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE
                     ETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRI
                     LQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLA
                     VVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWENLAEIEKAKKLAEQGSD
                     EDEDDEDEEDEDEDDDEEEVRDQVLVAEEEDAEEDEEVEEEEMEIPDPRPWLPHPKAF
                     ESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWERRDQVRIEEDKMEE
                     LGGVGDIVERNPAQKTKRR"
     gene            complement(<49579..>51231)
                     /locus_tag="ZYRO0F00506g"
                     /db_xref="GeneID:8204971"
     mRNA            complement(<49579..>51231)
                     /locus_tag="ZYRO0F00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497179.1"
                     /db_xref="GeneID:8204971"
     CDS             complement(49579..51231)
                     /locus_tag="ZYRO0F00506g"
                     /note="similar to uniprot|P38628 Saccharomyces cerevisiae
                     YEL058W PCM1 Essential N-acetylglucosamine-phosphate
                     mutase a hexosephosphate mutase involved in the
                     biosynthesis of chitin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497224.1"
                     /db_xref="GeneID:8204971"
                     /db_xref="GOA:C5DWY0"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="InterPro:IPR016657"
                     /db_xref="UniProtKB/TrEMBL:C5DWY0"
                     /translation="MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATG
                     ILACLRSLALKGDVIGVMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAI
                     KGSSHERAQATHSWLQRELKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVAS
                     AKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGE
                     SLPTISSLTIDAANGIGAPKVQELLSQWACRGQVHFINDKWTNPELLNHECGADFVKS
                     NQRCPLGFNDSTGLGCSYDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQ
                     AGLQSELSLGVVQTAYANGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFE
                     ANGHGTIIFSPKFYKVIKEQKERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSIS
                     KWTPEHWGQEFTDLPNRLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQG
                     RSFVRASGTEDAVRVYAEAASLEDVEKLSNTVKELVVKSVQN"
     gene            <51411..>51644
                     /locus_tag="ZYRO0F00528g"
                     /db_xref="GeneID:8204972"
     mRNA            <51411..>51644
                     /locus_tag="ZYRO0F00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497180.1"
                     /db_xref="GeneID:8204972"
     CDS             51411..51644
                     /locus_tag="ZYRO0F00528g"
                     /note="similar to uniprot|Q05676 Saccharomyces cerevisiae
                     YEL059C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497225.1"
                     /db_xref="GeneID:8204972"
                     /db_xref="GOA:C5DWY1"
                     /db_xref="InterPro:IPR024645"
                     /db_xref="UniProtKB/TrEMBL:C5DWY1"
                     /translation="MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAP
                     GEYICVPFKRVFEKCLGHALEVTDADTNDIQGS"
     gene            complement(<51742..>52989)
                     /locus_tag="ZYRO0F00550g"
                     /db_xref="GeneID:8204973"
     mRNA            complement(<51742..>52989)
                     /locus_tag="ZYRO0F00550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497181.1"
                     /db_xref="GeneID:8204973"
     CDS             complement(51742..52989)
                     /locus_tag="ZYRO0F00550g"
                     /note="similar to uniprot|Q06674 Saccharomyces cerevisiae
                     YDR317W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497226.1"
                     /db_xref="GeneID:8204973"
                     /db_xref="InterPro:IPR014843"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DWY2"
                     /translation="MSTDHNLTKHQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAG
                     NDLQSKLELYENSDINHFTLNKFFYCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQD
                     YYLHNNTSATPPASQSSNPSLGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEY
                     ISKDLKNLLITFHFTIVQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQ
                     VKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSH
                     IFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQL
                     KHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAMYRKPGSSVLGYCVPASKAAYATA
                     YMATNPTLGELRIVTSKEIDHLT"
     gene            53337..53427
                     /locus_tag="ZYRO0F00572r"
                     /db_xref="GeneID:8204974"
     tRNA            join(53337..53373,53392..53427)
                     /locus_tag="ZYRO0F00572r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8204974"
     gene            complement(53674..53747)
                     /locus_tag="ZYRO0F00594r"
                     /db_xref="GeneID:8204975"
     tRNA            complement(53674..53747)
                     /locus_tag="ZYRO0F00594r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=67.58"
                     /db_xref="GeneID:8204975"
     gene            <54556..>56964
                     /locus_tag="ZYRO0F00616g"
                     /db_xref="GeneID:8204976"
     mRNA            <54556..>56964
                     /locus_tag="ZYRO0F00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497182.1"
                     /db_xref="GeneID:8204976"
     CDS             54556..56964
                     /locus_tag="ZYRO0F00616g"
                     /note="similar to uniprot|Q04660 Saccharomyces cerevisiae
                     YMR049C ERB1 Protein required for maturation of the 25S
                     and 5.8S ribosomal RNAs homologous to mammalian Bop1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497227.1"
                     /db_xref="GeneID:8204976"
                     /db_xref="GOA:C5DWY3"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR028598"
                     /db_xref="UniProtKB/TrEMBL:C5DWY3"
                     /translation="MAKKSKELAVSRKRAAEPEDEVESPEEDNSLTVNGLIDDEASES
                     EEDEDEEEANEGGDEGKQEDEEEADEEEDDDEAELNKLLAQEEGEDEDEEYNSSDFSD
                     DTASMTDKLSGVKLDTIADPNIYTKYADGAPRVMKPEIEPKYDSDDSDTETHNTIGNI
                     PLSAYDEMPHIGYDINGKRIMRPAKGSALDQLLEQIELPEGWTGLLDKDSGASLNLTG
                     EELELISKLQKNEQTDENINPYEPLVDWFTRHEEVMPLSAAPEPKRRFVPSKNEAKRV
                     MKIVRAIREGRIVPPQKLKEMREAEAAEEYKYDLWGDSNESVDHVMNLRAPKLPPPTN
                     EESYNPPEEYLLTPEEKEQWDKADPSERERNFVPQKYGALRKVPGYTESVRERFERSL
                     DLYLAPRVRRNKLNIDPESLIPKLPSPKDLRPFPIRCSTVYAGHQGRIRTLSIDPSGL
                     WLATGSDDGTVRIWEILTGREVYKVQLIDTEEKSQDHIECLEWNPEKDTGILAVAAGE
                     TIYLIVPPIFGFDIENNGKSKIEKGFGFDTFGAEKKSKVDVNESDDEEQDTTAGVKKS
                     VAQWHKPSKGQQEKDISITITCRKTVKKISWHRRGDYFVSVQPESGNTSVLIHQLSKH
                     LTQSPFRKSKGITMDAKFHPYKPQLFVCTQRYVRIYDLSQQVLVKKLLPGARWLSGFD
                     IHPQGDNLVASSFDKRVLWHDLDLASTPYKTLRYHDKAVRSVSFHKKLPLFCSAADDG
                     NLHIFHATVYDDLMKNPLIVPLKQLVGHDVINSLGILDSVWHPREAWLFSAGADNTAR
                     LWTT"
     gene            complement(<57014..>57712)
                     /locus_tag="ZYRO0F00638g"
                     /db_xref="GeneID:8204977"
     mRNA            complement(<57014..>57712)
                     /locus_tag="ZYRO0F00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497183.1"
                     /db_xref="GeneID:8204977"
     CDS             complement(57014..57712)
                     /locus_tag="ZYRO0F00638g"
                     /note="some similarities with uniprot|Q04659 Saccharomyces
                     cerevisiae YMR048W CSM3 Protein required for accurate
                     chromosome segregation during meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497228.1"
                     /db_xref="GeneID:8204977"
                     /db_xref="GOA:C5DWY4"
                     /db_xref="InterPro:IPR012923"
                     /db_xref="UniProtKB/TrEMBL:C5DWY4"
                     /translation="MEDPMLMGLDPGNESADFNGNDNDRLDPIGPSNDDPTMADPTMA
                     EALTKTRRVQPKLTSDILLSRRGLPYLVKNGPKRLRISTSRNKPYDNLSQIVQFYQLW
                     AHELYPRAKFKDFIKLCQNMKNDKAVREYRTELCLREMNPSRYTSLHGDHDEDDDIYQ
                     ESSIREPPATEKEPKQHDESVPSAETGAQQEEQDVLDTQEPPLDTQEPPLETRDEDMQ
                     EDEDAMEVMKELGF"
     gene            <58885..>62556
                     /locus_tag="ZYRO0F00660g"
                     /db_xref="GeneID:8204978"
     mRNA            <58885..>62556
                     /locus_tag="ZYRO0F00660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497184.1"
                     /db_xref="GeneID:8204978"
     CDS             58885..62556
                     /locus_tag="ZYRO0F00660g"
                     /note="some similarities with uniprot|Q02630 Saccharomyces
                     cerevisiae YMR047C NUP116 Subunit of the nuclear pore
                     complex (NPC) that is localized to both sides of the pore
                     contains a repetitive GLFG motif that interacts with mRNA
                     export factor Mex67p and with karyopherin Kap95p
                     homologous to Nup100p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497229.1"
                     /db_xref="GeneID:8204978"
                     /db_xref="GOA:C5DWY5"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:C5DWY5"
                     /translation="MFGSNRPAFGGGSQPFGSTASPFASQPQPQATTTFGMGVANNNA
                     QSGFGGFGAANNTSAGTGGPTGSLFGMSTNNTTQNSPFGNSTGAATTTGSNSGTAIKP
                     FQPYEEKDPTTGVQNVFQTITAMPEYRNSSLEELRLQDYQQGRKLGQGTVTPFGATTS
                     TNSSNTNQGFGILGNTNQPQSAGSGTGGLFGQRANTAQNSPFGSVSSGNNPSTTGTGP
                     FGSTTAAGGNAFGGSGAGPFGSKPAGTTGGGLFGQNNRTASGGLFGQNNNSTFGQPQP
                     SAFGSGAGAGTGASAFGSKPAGTGLFGQNTAANQPFGANPAPSTGGGLFGQNSNTGMG
                     GAGSGGGLFGQNNATGSVFGQPNNQASTGGGLFGSKPAGGGLFGQPQNNTPFGGGAAN
                     TGGGGLFGQNNSQPPAGGGLFGQNNNQPPAGGGLFGQSNTQPPAGGGLFGQSNNQPPA
                     GGGLFGQSNNQPSTGGGLFGQNTSSPFGQPNNQASTGGGLFGNKPAGGGLFGQPQNNT
                     PFGGGAANTGGGGLFGQNNSQPPAGGGLFGQNNNQPPAGGGLFGQNNSQPPAGGGLFG
                     QSNTQPPAGGGLFGQNNNQPSTGGGLFGAKPAGGGGLFGQNNNQPPAGGGLFGQSNNQ
                     PPAGGGLFGNTQNNQPPAGGGGLFGNKPAGATGGGLFGNANTNTQPALGQPSGGGLFG
                     AKPASAGGAPSTTGGGLFGNTNNATQPGGGGLFGNTNNTSQGGTGGGLFGNKPAGSTG
                     PTGTTGGLFGSTNNSLQSGASGTGATGTAGGGLFGNKPAGATGTTGGLGGGLFGNNNN
                     TNNNSLGGATQGNTGIAGAGVGGGLFGNKPQQPAGQQPGLPSQQQSNQNQVNNPYGTN
                     ELFSRVVVPSSITQPTKPSATKVNADIKKKASLTGAYRLAPRPLFTSKSLSGNAAPKF
                     DSFSGSSTRSSSASSSPDSIGKELVPTSTGSTLFSPETDEAILSADKLLFNPDKKSFK
                     NLIINKRKAGEGPAEDDGEVKKITLQSDSNGDSNSVNKSLNESTTFGGVLDSPTVGKD
                     FSAKDFGMNRDILSVSPARNQSSDLEESASDKNIKTRGIIGEDISFTDNGYYISPSFE
                     SLSTKSLPQLRKLSGLVIGHKNYGKIEFLEPVDLSNIPLALLCGNIIIFEPKSCFVYP
                     YSSTVPEPGEGINVRARISCYKCYPADKATRAPIKDANHQLVKRHIEKLKKLPNTKFD
                     SYDPVTGCYRFVVEHPITS"
     gene            complement(62793..62864)
                     /locus_tag="ZYRO0F00682r"
                     /db_xref="GeneID:8204979"
     tRNA            complement(62793..62864)
                     /locus_tag="ZYRO0F00682r"
                     /product="tRNA-His"
                     /note="tRNA-His (GTG) cove score=64.94"
                     /db_xref="GeneID:8204979"
     gene            complement(<62967..>64151)
                     /locus_tag="ZYRO0F00704g"
                     /db_xref="GeneID:8204980"
     mRNA            complement(<62967..>64151)
                     /locus_tag="ZYRO0F00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497185.1"
                     /db_xref="GeneID:8204980"
     CDS             complement(62967..64151)
                     /locus_tag="ZYRO0F00704g"
                     /note="weakly similar to uniprot|Q04213 Saccharomyces
                     cerevisiae YMR044W IOC4 Member of a complex (Isw1b) with
                     Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase
                     activity and acts within coding regions to coordinate
                     transcription elongation with termination and processing
                     contains a PWWP motif"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497230.1"
                     /db_xref="GeneID:8204980"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:C5DWY6"
                     /translation="MYQPTDVVLAKVKGFPAWPAMIIPAELIPSNVLKGKQEVEEDTD
                     DESKYIQYSSIMKFRKFDKVKNQYCVKFFWDDSYIWLKPNDMKPLSVEDCESWLKSGK
                     KKSKKLIQAFEMASRGSQGIDVWEFVEYGSAGKPDEEYVAEEEAPEEEEEEEEDIARS
                     DVSEDYEEEEEEKPTRKSQRQKQKRGKENVRATRSRSKTAKSEEPQELPPEEEPKPKK
                     RKYTRRAVEPKFNFEDDEDFYFVGLGPQDLSIQEDVSPLVNKLSNKRNLERHTEVKLD
                     IMDHLLSVNRLFLEVLVPETKSTKDDYQLILDELEAALAAKGSHHEFLTVFHTNNELL
                     LNFRVLFNLKIDELRKLKLWDSFQSAFNSIYEHYFEPDQDAWTTNTEILPPENNEIEA
                     EA"
     gene            complement(<64322..>65002)
                     /locus_tag="ZYRO0F00726g"
                     /db_xref="GeneID:8204981"
     mRNA            complement(<64322..>65002)
                     /locus_tag="ZYRO0F00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497186.1"
                     /db_xref="GeneID:8204981"
     CDS             complement(64322..65002)
                     /locus_tag="ZYRO0F00726g"
                     /note="similar to uniprot|Q75DC9 Ashbya gossypii ABR098C
                     ABR098Cp and some similarites with YMR043W uniprot|P11746
                     Saccharomyces cerevisiae YMR043W MCM1 Transcription factor
                     involved in cell-type-specific transcription and pheromone
                     response plays a central role in the formation of both
                     repressor and activator complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497231.1"
                     /db_xref="GeneID:8204981"
                     /db_xref="GOA:C5DWY7"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:C5DWY7"
                     /translation="MSDIDDVEDNSSRAGQQKERRKIEIKFIENKTRRHVTFSKRKHG
                     IMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDD
                     EDDDEEEEEAPEDPNGAAAAAAAAQMAGQPTHVPNTAGLGPHPHELHAAGGLKPDPMK
                     AAHAMQGHEGAPTMPIPTQHTAHQPHPVMPPPPHQQGFANTASPYLNPEQNAVYQQYF
                     QESQQGHY"
     gene            complement(<65347..>65691)
                     /locus_tag="ZYRO0F00748g"
                     /db_xref="GeneID:8204982"
     mRNA            complement(<65347..>65691)
                     /locus_tag="ZYRO0F00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497187.1"
                     /db_xref="GeneID:8204982"
     CDS             complement(65347..65691)
                     /locus_tag="ZYRO0F00748g"
                     /note="similar to uniprot|P07249 Saccharomyces cerevisiae
                     YMR042W ARG80 Transcription factor involved in regulation
                     of arginine-responsive genes acts with Arg81p and Arg82p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497232.1"
                     /db_xref="GeneID:8204982"
                     /db_xref="GOA:C5DWY8"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:C5DWY8"
                     /translation="MDEERNRTPASVDTQEPDDDEDEEERNSSQQKRKYPIKYIENRT
                     RRHVTFAKRRHGIMKKAYELSVLTGANVLLLILSNNGLVYTFTTPKLEPVVREREGKE
                     LVWKCLDGRPTP"
     gene            65869..65942
                     /locus_tag="ZYRO0F00770r"
                     /db_xref="GeneID:8204983"
     tRNA            65869..65942
                     /locus_tag="ZYRO0F00770r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=67.58"
                     /db_xref="GeneID:8204983"
     gene            complement(66124..66214)
                     /locus_tag="ZYRO0F00792r"
                     /db_xref="GeneID:8204984"
     tRNA            complement(join(66124..66159,66178..66214))
                     /locus_tag="ZYRO0F00792r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8204984"
     gene            <66729..>67187
                     /locus_tag="ZYRO0F00814g"
                     /db_xref="GeneID:8204985"
     mRNA            <66729..>67187
                     /locus_tag="ZYRO0F00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497188.1"
                     /db_xref="GeneID:8204985"
     CDS             66729..67187
                     /locus_tag="ZYRO0F00814g"
                     /note="highly similar to uniprot|P36010 Saccharomyces
                     cerevisiae YKL067W YNK1 Nucleoside diphosphate kinase
                     catalyzes the phosphorylation of nucleoside diphosphates
                     into the corresponding triphosphates for nucleic acid
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497233.1"
                     /db_xref="GeneID:8204985"
                     /db_xref="GOA:C5DWY9"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="UniProtKB/TrEMBL:C5DWY9"
                     /translation="MSNNERTFIAIKPDGVQRGLISNILSRFENKGYKLVGIKLVTPT
                     ENLLKQHYAEHVEKPFFPKMLSHMMSGPILATVWEGKDVVKQGRAILGATNPLNSAPG
                     TIRGDYAVDMGRNVAHGSDSVASAEREIDLWFKKEELVDYKLAQLSWIYE"
     gene            <67628..>67924
                     /locus_tag="ZYRO0F00836g"
                     /db_xref="GeneID:8204986"
     mRNA            <67628..>67924
                     /locus_tag="ZYRO0F00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497189.1"
                     /db_xref="GeneID:8204986"
     CDS             67628..67924
                     /locus_tag="ZYRO0F00836g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497234.1"
                     /db_xref="GeneID:8204986"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ0"
                     /translation="MESGRCATVITIASIVHSKILDMNPTLVRSFSRSATKMAAMNES
                     ATRSAATNWAINLLGVSAVLGAGTAMVAWKNNENNSRIRNIFKNERALTRASHN"
     gene            <68107..>69147
                     /locus_tag="ZYRO0F00858g"
                     /db_xref="GeneID:8204987"
     mRNA            <68107..>69147
                     /locus_tag="ZYRO0F00858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497190.1"
                     /db_xref="GeneID:8204987"
     CDS             68107..69147
                     /locus_tag="ZYRO0F00858g"
                     /note="similar to uniprot|Q04212 Saccharomyces cerevisiae
                     YMR041C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497235.1"
                     /db_xref="GeneID:8204987"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ1"
                     /translation="MTGKEAMHPIVDHGDITKLPPLVLGGATVNTQYNDDPTKVPLVD
                     MLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDEFPRNSYYICTKVGRIQLDEFDY
                     SREHVRFSVLRSCQRLKTDYLDLVYLHDVEFVPMHQSLEALKELKLLKDEGIIKNFGL
                     SGYPVDYLYYLTKHCAHNESEIGPLDAVLSYCNLNLQNTRLHDYWPHWKHDASLKMIN
                     NGSILSMSLLRSQETKLFHPCSDQLRQLATQAAEYCSEHGVELADLATRYAISEWLNK
                     GSTVLGVSNVEELEVALRSYRTVLHHGGELGKDDQALVSHIQNKIFGSHMNEVWPSGI
                     HHPELINDNNKE"
     gene            complement(<69183..>69845)
                     /locus_tag="ZYRO0F00880g"
                     /db_xref="GeneID:8204988"
     mRNA            complement(<69183..>69845)
                     /locus_tag="ZYRO0F00880g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497191.1"
                     /db_xref="GeneID:8204988"
     CDS             complement(69183..69845)
                     /locus_tag="ZYRO0F00880g"
                     /note="similar to uniprot|P35723 Saccharomyces cerevisiae
                     YKL065C YET1 Endoplasmic reticulum transmembrane protein
                     homolog of human BAP31 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497236.1"
                     /db_xref="GeneID:8204988"
                     /db_xref="GOA:C5DWZ2"
                     /db_xref="InterPro:IPR008417"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ2"
                     /translation="MSLYLSTLFALLTLEMAILFLVVLPLPFRVRRNFYSLYYRWTSN
                     RKVQTTIYIFAGLVSILFVDSWRRAQFKVHLHHYQRQGEDVDDNSAVTPTQALASRAY
                     NQRNTYISGFILYFLVCIPAVFTIIRRLIKYQNLINNLEGKPVKDTTPDTQPTAPSKK
                     GSASIVDDREIDHLKHDLEKKEVNLKAVQKQVKNLESYFDQQNDQKNPNTAATAGGKK
                     DL"
     gene            <70704..>71417
                     /locus_tag="ZYRO0F00902g"
                     /db_xref="GeneID:8204989"
     mRNA            <70704..>71417
                     /locus_tag="ZYRO0F00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497192.1"
                     /db_xref="GeneID:8204989"
     CDS             70704..71417
                     /locus_tag="ZYRO0F00902g"
                     /note="similar to uniprot|P54000 Saccharomyces cerevisiae
                     YMR039C SUB1 Suppressor of TFIIB mutations transcriptional
                     coactivator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497237.1"
                     /db_xref="GeneID:8204989"
                     /db_xref="GOA:C5DWZ3"
                     /db_xref="InterPro:IPR003173"
                     /db_xref="InterPro:IPR009044"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ3"
                     /translation="MSYYNRYRNRKKFEGSPAGSAGSTGSTGSSSIAQSDATFDLGKN
                     KRVTVRQFRNVNLIDIREYYMDTSTGDMRPGKKGISLTEDLYDELLKHRLNIDEALRR
                     LGSKRPRTKTVRLLSDEEDEGAGQENVKEKETFSHSRSEDESPKKKVKPAPPTLLPQE
                     EKKKNDEREANATLVIPGASKKQEPKVEPQQKQVPPQPEPVPAASTSAQDEDASDEEF
                     VQNLEEEMNKADDDISEEE"
     gene            <71762..>74563
                     /locus_tag="ZYRO0F00924g"
                     /db_xref="GeneID:8204990"
     mRNA            <71762..>74563
                     /locus_tag="ZYRO0F00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497193.1"
                     /db_xref="GeneID:8204990"
     CDS             71762..74563
                     /locus_tag="ZYRO0F00924g"
                     /note="similar to uniprot|P35724 Saccharomyces cerevisiae
                     YKL064W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497238.1"
                     /db_xref="GeneID:8204990"
                     /db_xref="GOA:C5DWZ4"
                     /db_xref="InterPro:IPR002523"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ4"
                     /translation="MSDDIRPESQPLLSPKTSRSSSEGSKHFDHDLLTHWKRQPDDKK
                     EKKSLKFRNGLRTVGGESLVTDFDQADSWGLLHEADDSSISKVNTDKDNFIDHRPILE
                     NIAGNRSNSIPAKFPSSQHRASLPNNSEHHQAEGEKERLARMSPSELEEWAKRMNYGS
                     ISQGHTVKRSTRVHRRNTLAGDDVVIDVDELMEHVKGNNKSGSSSKSNSSDHSGRNSS
                     PGDGYNSRPTSRGSSNNSSLDDVCLYLEHENSPESKVWPDIAVLEEFSKEETDKLRKQ
                     ALEDAEEFHFQYDDEDEPDEESHNNNNDGIFFSKPIVTSIDVPELGNRKVNEAEQLKK
                     GRLRPRKLAPWHLRRKALMSSSYQTLRDHTKPCDDNTHMRDNFLVGRNIQYPPHIVNN
                     NPEHFRFTYFRVDLDSTVHSPTISGLLQPGQKFEELFVAPVYTDTSSKRSVNTSTSKA
                     GTPSNQLSNNGIKALNSVAATTSELENVQPFWLDVLNPTEEEMKVLSKAFGIHPLTTE
                     DIFLGEAREKVELFRDYYLVCFRSFDIVAEKHIRRRKEKQQQLEAISPLSERESLHRS
                     QNSGKHPSGWLQSLLRRRRRSSATRTVTNSSERRRRTEKEKEEKQRYKRKSGDRYKPR
                     EGELEPLNVYIIVFRTGVLTFHFAPTPHPINVRRRARLLKDYLNVSSDWIAYALIDDI
                     TDAFAPMIELIEDEVYDIEDAILRMHSSDDSSDDSDDDSEDSDSDHESFPFDRTSRRS
                     TVTSGSRSDSSRFTRSHSTGESTFNENLIGWKKKGDMLRRIGECRKRVMSILRLLGSK
                     ADVIKGFSKRCNERWDVAPRSEIGMYLGDIQDHIITMVSSLNHYEKLLSRSHSNYLAQ
                     INIDMTKVNNDMNDVLGKITILGTVVLPMNVMTGLWGMNVLVPGQERPSLAWFYGIFA
                     TMVIMAYTAYLYTKRRFGF"
     gene            <74697..>75443
                     /locus_tag="ZYRO0F00946g"
                     /db_xref="GeneID:8204991"
     mRNA            <74697..>75443
                     /locus_tag="ZYRO0F00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497194.1"
                     /db_xref="GeneID:8204991"
     CDS             74697..75443
                     /locus_tag="ZYRO0F00946g"
                     /note="similar to uniprot|P40202 Saccharomyces cerevisiae
                     YMR038C CCS1 Copper chaperone for superoxide dismutase
                     Sod1p involved in oxidative stress protection
                     Met-X-Cys-X2-Cys motif within the N-terminal portion is
                     involved in insertion of copper into Sod1p under
                     conditions of copper deprivation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497239.1"
                     /db_xref="GeneID:8204991"
                     /db_xref="GOA:C5DWZ5"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ5"
                     /translation="MTATDLPNGVFDATYAVPMHCEGCTNDIRNCLSTIPGVKELSFD
                     LKQQMMSVNGNAPPSSIIKALERCGRDAIIRGTGKPNTSAVSILETFEKIDLTKDTPV
                     RGLARIVEVDDKKTFFDVTLNGVPYKGKYYASVHEDGDISGGPASTGGIWYRFEDPIV
                     CNEPSDLDPKLYSGQAFLKAPVSVWEMIGRSFVVTTGDDHSTGKHDQHEYCGVIARSA
                     GIWENDKQVCACSGKSIWQERKDALRNNIK"
     gene            complement(<75523..>76227)
                     /locus_tag="ZYRO0F00968g"
                     /db_xref="GeneID:8204992"
     mRNA            complement(<75523..>76227)
                     /locus_tag="ZYRO0F00968g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497195.1"
                     /db_xref="GeneID:8204992"
     CDS             complement(75523..76227)
                     /locus_tag="ZYRO0F00968g"
                     /note="weakly similar to uniprot|P35725 Saccharomyces
                     cerevisiae YKL063C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497240.1"
                     /db_xref="GeneID:8204992"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ6"
                     /translation="MQGGIRRKRDLLPRYKNGSGNKRRNGYLTTPMKKILIYSSILLG
                     FFLLFRFAYSDLNKESEYELDQAAPSAERLNAAAAAAAVASSQDKEKEEMEKVGASGA
                     QFNNEVALQQEVKNLEKEYKPDGAAGAAAPAAPAAPAGAANGAAGVGAAGIQGVPAVA
                     EQKKPENPMKAPQQLMQQQQQPQAGVAGGAAAPPVNEPIAGGAAAAVPKGAAAGAAAG
                     AAAAAADPGAKFPRNV"
     gene            76622..76741
                     /locus_tag="ZYRO0F00990r"
                     /db_xref="GeneID:8204993"
     tRNA            join(76622..76659,76698..76741)
                     /locus_tag="ZYRO0F00990r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8204993"
     gene            <78166..>79920
                     /locus_tag="ZYRO0F01012g"
                     /db_xref="GeneID:8204994"
     mRNA            <78166..>79920
                     /locus_tag="ZYRO0F01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497196.1"
                     /db_xref="GeneID:8204994"
     CDS             78166..79920
                     /locus_tag="ZYRO0F01012g"
                     /note="similar to uniprot|P33749 Saccharomyces cerevisiae
                     YKL062W MSN4 Transcriptional activator related to Msn2p
                     activated in stress conditions which results in
                     translocation from the cytoplasm to the nucleus binds DNA
                     at stress response elements of responsive genes inducing
                     gene expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497241.1"
                     /db_xref="GeneID:8204994"
                     /db_xref="GOA:C5DWZ7"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ7"
                     /translation="MSGLFQDYDSNAAATAAANIPDVLPKEFLAEDLITDSRNDTATS
                     LSLDLSKEGGFSSAGDSISNSASAKHDQGNQQNLVGTSPLEALETTKLPLSTPMSMIE
                     NTNTNSNAGNGSGIDPNLLNNNLFMDSLGLSPPTEELSGPDPYSQPSLNSLLDDYVST
                     EMLLNNNNQGPIQDTVTSPVPDVTGSRGSISHSVDFWNLPNNPKTRRRTTGFTGIDSE
                     LSDVLNGYHLNLRRNSLSNNVGGAPPPSQRHGFKKQPQRSSMSVLDGPLNTDLFNKIY
                     ENGVSSSNLKLVSPWEKNTNGDDDQGLPSNLEPMMSPKSPKNVIGTGTGSGTGGKRRP
                     ATSNQNFINPSMVLSDNASTSAKVATTGGGNSEGSFDLSLDPQAIMRESPGPNQVEGG
                     IPSPLVLPQELSSPSPKEQEATTLGQQDPLPLGQQEPLPLGQQEPLPLGVPETPLPLT
                     VPQQSQAQAQAQHEIQSPPRPLAAPAAARRRMSTANIMTIHNGNGAVNVQNQPTVSSR
                     KNSRSITPMNASDEDVKPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFS
                     RSDNLSQHLKTHKKHGDF"
     gene            <80328..>82826
                     /locus_tag="ZYRO0F01034g"
                     /db_xref="GeneID:8204995"
     mRNA            <80328..>82826
                     /locus_tag="ZYRO0F01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497197.1"
                     /db_xref="GeneID:8204995"
     CDS             80328..82826
                     /locus_tag="ZYRO0F01034g"
                     /note="similar to uniprot|P32801 Saccharomyces cerevisiae
                     YKL048C ELM1 Serine/threonine protein kinase that
                     regulates cellular morphogenesis septin behavior and
                     cytokinesis required for the regulation of other kinases
                     forms part of the bud neck ring"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497242.1"
                     /db_xref="GeneID:8204995"
                     /db_xref="GOA:C5DWZ8"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ8"
                     /translation="MSQRLIIPTLIPEWANPPPSNESESSTPLRRSQSRESSSQLRPT
                     YHGIIESNLDSITVQIKPLASLIEHENRRKINEFNLGSSIGYGQFGKVYKARLQNHIY
                     AIKSIAKKPWNAQQYSMNQTMRQIKLWRHQGGGYNLTGDEAVMMMNVQKCRWEIYILS
                     KLRSPYVVQLHKFLDSPVSKAIWIVNEWCSLGELEWKRNSVDEIPVQWSQMIGECDDV
                     LTFVEKALHDLTQGLAYLKSQGCIHRDIKPSNILVDGKQKLLKLSDFGCSILSPQVLP
                     FEDDSLTECFQAELNKIVGTPAFIAPELCQFGNPGADDVKDGFKLDVWSTGVTLYGLL
                     YNELPFYGESEFDTYHKVIHKTLENRLNGNRVNDLIIGRMLEKDPQIRIGAEKLQELV
                     ILDHKSFTASVKQGKPTTAAIARKSTTEKHPTSIQKFFTKFFKLRKKDKSTKKSVAKS
                     SNSSANSPTISPGTFNSTVGAPPNSDPLSKPSPSPRPSPFPQDDDFSEPSLHSSLSSF
                     EEPVQVSDLFKQDSAPLNKQVSPPPSDSGIVESTMSASESEPRRLDEYRLPRSSHKSS
                     HATSPELSHPHAGNTSLADANYEDEPRKLDSYDLPQHHDYPTHSRQFSTEVSEMHSSH
                     GSFELKTPPELARMIHSRQPSNLDGQTSRDINLTNHSHPSFQLSLKEGTEDSYYDTSI
                     ASKQPSFQLSVPPEIIQERSPPPVNPTPQPSGGSRNLYQHRHQPNASTSTSSSSPIKI
                     PTPMKALIHLGNSPVKEGTATDTAQHDSPLKDQGQNQAHKANGLAHSKDISNFQNYIF
                     QQGTNDAGPQDKHKSVLTEDLIEKYLNYADNSQS"
     gene            <83396..>85183
                     /locus_tag="ZYRO0F01056g"
                     /db_xref="GeneID:8204996"
     mRNA            <83396..>85183
                     /locus_tag="ZYRO0F01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497198.1"
                     /db_xref="GeneID:8204996"
     CDS             83396..85183
                     /locus_tag="ZYRO0F01056g"
                     /note="some similarities with uniprot|P23748 Saccharomyces
                     cerevisiae YMR036C MIH1 Protein tyrosine phosphatase
                     involved in cell cycle control regulates the
                     phosphorylation state of Cdc28p homolog of S. pombe cdc25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497243.1"
                     /db_xref="GeneID:8204996"
                     /db_xref="GOA:C5DWZ9"
                     /db_xref="InterPro:IPR000751"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5DWZ9"
                     /translation="MVRFLSFNSPNETDVDDSNKNGNNLMRKMALGSKFGDENGGLLK
                     NIHSFLRPRRRNSNTSGSTSRSSGKEEVLDQDQDQDQDQDQDEDMNVMNFNFQDGSSS
                     PSSSSGFNQSGSASPLPAIRKSVSTLMTDTKNTNISGNVNTNNNPVDQNLVMEELFNQ
                     PIPPSRSLHRSGSSASISPSRRPPGLFRHSSLSSNRKDRKSMRNGPRMGGSLRKMSTM
                     DSPVSDIFGPPPPKFHSRSSSNSLHTTRRKAIESRLSQSSIPHFYDENCSSDNYPRIT
                     AETLQTIMDYGIHKPQYDSFCIIDCRFEYEFKGGHISNALNICSREGLELEFIQEIRP
                     FPTLLIFYCEFSAYRSPLMASHLRNCDRISNYEEYPNLFYPDILILEGGYKSFFDKFP
                     HLCYPCNYVRMNSTENLNDRDQELDRFRQDSKKMVSRNSSSSRITTMSMSTSSIINKQ
                     PLQPTRGPSLTHKTNSSTSSPFFKYEPPPKLSLSKHGNSPFLSSDESCSSSRMSFSNS
                     PNLSSSKMLAVDALEVESCYSFDDNESTFTTSPGPFGTPTMSGGGAGHGGAGHYNKHD
                     LEYNNSSLNPVKKSLFPDILLEEENERVK"
     gene            complement(<85395..>85910)
                     /locus_tag="ZYRO0F01078g"
                     /db_xref="GeneID:8204997"
     mRNA            complement(<85395..>85910)
                     /locus_tag="ZYRO0F01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497199.1"
                     /db_xref="GeneID:8204997"
     CDS             complement(85395..85910)
                     /locus_tag="ZYRO0F01078g"
                     /note="highly similar to uniprot|P46972 Saccharomyces
                     cerevisiae YMR035W IMP2 mitochondrial peptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497244.1"
                     /db_xref="GeneID:8204997"
                     /db_xref="GOA:C5DX00"
                     /db_xref="InterPro:IPR000223"
                     /db_xref="InterPro:IPR015927"
                     /db_xref="InterPro:IPR019758"
                     /db_xref="InterPro:IPR019759"
                     /db_xref="InterPro:IPR028360"
                     /db_xref="UniProtKB/TrEMBL:C5DX00"
                     /translation="MPSQKAFRYSLITLTWIPVIMTINDNVCHVAKIEGSSMRPTLNA
                     NERSISSDWVFLWKFNCKKAFNLNRDDIILFKSPMDPNKVYCKRIKGIQYDSVKTRHP
                     YPRSVVNIPRNHVWVEGDNVFHSVDSNNFGSLSTGLVVGKAIKVIWPPSRWGADLQLS
                     TGRQNILTTRE"
     gene            <86570..>87937
                     /locus_tag="ZYRO0F01100g"
                     /db_xref="GeneID:8204998"
     mRNA            <86570..>87937
                     /locus_tag="ZYRO0F01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497200.1"
                     /db_xref="GeneID:8204998"
     CDS             86570..87937
                     /locus_tag="ZYRO0F01100g"
                     /note="similar to uniprot|Q05131 Saccharomyces cerevisiae
                     YMR034C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497245.1"
                     /db_xref="GeneID:8204998"
                     /db_xref="InterPro:IPR016833"
                     /db_xref="UniProtKB/TrEMBL:C5DX01"
                     /translation="MASRKDQFMKIWNHPVTDFLRGKWFFYILAIFILLAHFFPNFAG
                     DDGIIRGQYSIGYGAVACIFLNSGLNNKTKRLIAEISNWRAHITVILLSFFITSSIVF
                     AFCCAIKKAHDKNMDDWVLIGFLLMAASPTTVASNVMMTSQAGGNDLLCTCEVFIGNI
                     LGAFVTPGIIQLFTDSALFKFGNPANHSSVKDVYRRVLFQVGLSVFVPLATGQIIQNV
                     LPKPTQIYSNFLKKYHLKIGAYMLLLIMFNSFSTAFKQKAFTEVSHACIIFVCFFDLG
                     LYLFFTGICFLCARPYLLLLLFKKKPVKGESSKLYYYSYGLFRPFYYNKRDTVCLLYC
                     GPAKTAALGVSLVTSQYGDEKSNLGKMLLPLVLYQAIQVLSASFLVPLFKWWCSDEIA
                     KLEAQKTDLEKNPTGKGEHDNSSNQVNQDGNVEEQESTDMSKDQHTDDSKSQFFSTIN
                     ESASY"
     gene            complement(<88017..>89508)
                     /locus_tag="ZYRO0F01122g"
                     /db_xref="GeneID:8204999"
     mRNA            complement(join(<88017..89375,89479..>89508))
                     /locus_tag="ZYRO0F01122g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497201.1"
                     /db_xref="GeneID:8204999"
     CDS             complement(join(88017..89375,89479..89508))
                     /locus_tag="ZYRO0F01122g"
                     /note="similar to uniprot|Q05123 Saccharomyces cerevisiae
                     YMR033W ARP9 Actin-related protein involved in
                     transcriptional regulation; subunit of the chromatin
                     remodeling Snf/Swi complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497246.1"
                     /db_xref="GeneID:8204999"
                     /db_xref="GOA:C5DX02"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR027665"
                     /db_xref="UniProtKB/TrEMBL:C5DX02"
                     /translation="MAPFRLDSILIIYPKSQTTVVQFGLHDDVFLVPDMEFPTRVFKT
                     INSDGVPIYSSSATETSQEIHPIENGSIVDLEAFLFFLRLIYVSILSKRSNLKGPDSF
                     DAELSNIPVFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCC
                     VIDIGTAHTDIIPVVDYAPLVPLTSTIPYGGNTINENLARILPELSGNTIESLKKSSI
                     FEVLSDDAKKSSAFTFHENPEEDEGALDVAAIVTSGRDTREILEEREKQKKEKNIKNA
                     QMEKNTFIDDEGNSVTVGKQRFQGCDELINRISDRVGKVLDQIDDVIKLRAIWENIII
                     VGGTSSIQGFKDVLLGKLIKDHLVTEPEEERSKREQNAMESLTVKQKNKFMGSGSVSN
                     LEYVQAATVIKAARYPEYFPEWKKYGYAKIPFLGAQVISKQIFAHSKDTFYLSREIYD
                     LMGPSSLWDVFF"
     gene            <89858..>90457
                     /locus_tag="ZYRO0F01144g"
                     /db_xref="GeneID:8205000"
     mRNA            <89858..>90457
                     /locus_tag="ZYRO0F01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497202.1"
                     /db_xref="GeneID:8205000"
     CDS             89858..90457
                     /locus_tag="ZYRO0F01144g"
                     /note="highly similar to uniprot|P36012 Saccharomyces
                     cerevisiae YKL049C CSE4 Centromere protein that resembles
                     histones required for proper kinetochore function homolog
                     of human CENP-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497247.1"
                     /db_xref="GeneID:8205000"
                     /db_xref="GOA:C5DX03"
                     /db_xref="InterPro:IPR000164"
                     /db_xref="InterPro:IPR007125"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DX03"
                     /translation="METRQLDGAVHNGSRLLSQLSVEQERINERASQLLQRNRERRRL
                     LQRQQERRRYEGPPRSLINHDYGAPSKNVEENREQERTQIRQRRQRIRSSHKLSQKRR
                     TPSDQALYEIRKYQRSTELLISKIPFARLVREVTEQFTTEEQQPRWQSMAVLALQEAS
                     EAYLVGLLEHTNLLALHAKRITIMRKDMQLARRIRGQFL"
     gene            complement(<90553..>92799)
                     /locus_tag="ZYRO0F01166g"
                     /db_xref="GeneID:8205001"
     mRNA            complement(<90553..>92799)
                     /locus_tag="ZYRO0F01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497203.1"
                     /db_xref="GeneID:8205001"
     CDS             complement(90553..92799)
                     /locus_tag="ZYRO0F01166g"
                     /note="similar to uniprot|Q05080 Saccharomyces cerevisiae
                     YMR032W HOF1 Bud neck-localized SH3 domain-containing
                     protein required for cytokinesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497248.1"
                     /db_xref="GeneID:8205001"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DX04"
                     /translation="MSYNYELCFWDPNDDGVNILLEHISEGIKSCTSMVNFFKQRGEL
                     EKDYARRLGAINSKLRKDMDQHAEYGNLSKSFELALTNEKARAQVHSKQSEVIYRQIH
                     SNIKSFAEQLQARYTTLSGKVERLRVDKYNKKVGCENLEKRLQEAQVRARDLQLNADN
                     LIGAKRNEHNQKELTKWETTAKEVGLKLDVLRQEHKASQKYWFREWANVTRDLQELDT
                     TRISFLKTKLQQYAEITIETSVLEQTRMDALTNQLVTYTPGDDISDFSSTYGTGRLRE
                     KRKSHQSATHSHRHMEHLDAHRKDSFGDTCNTHNDHDDFSTSKSRRSSYMDNLRRLSS
                     HLQSIGNLDESRAKRHSTPPAIQYQTSLGIPQERHHDDTPQQEEAPQEKLCKSTVREA
                     RVIQPSSAPRDLDDTVPHSRYIPTRLSPMPLHRKKLSSSSSSSSPKDLDDTVPHSRHI
                     PTRLSPMPAHTKEFSSSSSASSQPRNLDASVPHSSNFPTRLSPMPANTKELSSSSSES
                     SSNPTDFTTHVRSRHSMDSMATSVSSFVNSIDDSQRFAKSWNSSNRKRKSISYVNQKS
                     PPQSPPTPTAYHHGDDSELRYASHRHDRGDEHHLENVRNVSTDTTIVNAEMNASAGRS
                     RRKSLVVKDSVNPIEDALTEMQKISSNGFAASDVRVGRIRDNGITVTLPLVTSDGEHV
                     IKYAKAVYPLYEENVPELAQFQRGDYLLITGEVNDEWYRGEVYSNDYVSQGSSSGLIP
                     HNFIKPLT"
     gene            <94085..>96631
                     /locus_tag="ZYRO0F01188g"
                     /db_xref="GeneID:8205002"
     mRNA            <94085..>96631
                     /locus_tag="ZYRO0F01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497204.1"
                     /db_xref="GeneID:8205002"
     CDS             94085..96631
                     /locus_tag="ZYRO0F01188g"
                     /note="similar to uniprot|Q05050 Saccharomyces cerevisiae
                     YMR031C Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497249.1"
                     /db_xref="GeneID:8205002"
                     /db_xref="GOA:C5DX05"
                     /db_xref="InterPro:IPR024527"
                     /translation="MSLVSTVNDAERTDLLNSSGNRNGPVVETVTTTAVEEKPITTKS
                     VRGFSVYHKGGGAQLSKEALYRAKVKYGIYQSPARSFSTGVAEPKVASDVAANLANDN
                     KTTIEAYKRLFVDPNANTAARRSIVNGGPRVEDVVIPESHYGSHQAATRAYSVASVAT
                     DENARRLQSPQSPPATRAHSLKSANKAFYNTKLPEQVEVVPKQVGKKPMDMSKILSSA
                     ENRAQHRVTDRWDPVKADHGIRTSTQNLNRVRSTSLTGPIYKERKGVKEPSSKDASAT
                     QGDRGNYAQWAAFAVRDMDPTALTNKEFEERERAKRELLSQITSQQVLAKARENADKQ
                     LDAIDANDVHRVLFGNDAYNRAAIEIAQRNAQRQAGETDVNEGKINIGGGLWLSPDDV
                     HTIAREMVDPVLGEVHQRADDQRATDVDIKERNDYVTNEWNAWTAMHQTKENNNEALL
                     VNSQNKRTREADSARSEAEKSFTELCDRMDKQVAERNDLLNQTKQAREQLERETEEKL
                     AQNKEDNKTALRDLKGQHAKELEEAREEQRRLVQPYEERLEEVNREHESLVQERTAIN
                     EEIARLHESIKEHQYQISKYEREIKSHEEQNASAEEELKKLETDREGIQSHYNDNVVV
                     NANKAKEQALLSSEEARLQNLKVDAIINERKTELNRTEQELQREKLNMLEAMRKTAEA
                     RGDENIDEERVKQLIGMTSTEYVEEQKKLQKAAGKAEKPKASTADKGQALDKALAHDQ
                     GDQEANTKDFKEGAETKAKESKGKPSQSVAKAIATSPTKTEAKAEPSTSKGKSNGVGT
                     HPDNASGISQISDTLENGKHLSEEDLKELAEDAEQRVSGEPQPSYFKEVF"
     gene            complement(<97085..>98134)
                     /locus_tag="ZYRO0F01210g"
                     /db_xref="GeneID:8205003"
     mRNA            complement(<97085..>98134)
                     /locus_tag="ZYRO0F01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497205.1"
                     /db_xref="GeneID:8205003"
     CDS             complement(97085..98134)
                     /locus_tag="ZYRO0F01210g"
                     /note="similar to uniprot|P35735 Saccharomyces cerevisiae
                     YKL051W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497250.1"
                     /db_xref="GeneID:8205003"
                     /db_xref="InterPro:IPR019402"
                     /db_xref="UniProtKB/TrEMBL:C5DX06"
                     /translation="MIPKPGNYFFLLPIIAFIPWWGMLIAMLACWAGQGHPVYHFMDP
                     EQHTVYISDVGATNLNPLFISCAGWQGLFYVLTIACEFFQRSGYWPFKLRSNYRTAAD
                     EGHEFDPTYDSMKNEYSSMVLSSKFLMPPWYSVLERNLIFASFAAGLVGELGILFCSI
                     FTTSKYPSVHTTMVSIFVGFMCVSIVCNIGEYLSMGKHYALLHPLAAQNQVEGLEKIT
                     YSDLKWFQWKGYIWNKFTMSGIAKVTWLFWAAVFAICFGAISDNSISAIFEWLLAFWF
                     GIWFLILAFDFYAGSRYKQSRYFHQIRSFAGYYKYDRQNGSAQFSHIVDPVDDEMVVG
                     DLDSRHYVPSEEYSR"
     gene            <98668..>99159
                     /locus_tag="ZYRO0F01232g"
                     /db_xref="GeneID:8205004"
     mRNA            <98668..>99159
                     /locus_tag="ZYRO0F01232g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497206.1"
                     /db_xref="GeneID:8205004"
     CDS             98668..99159
                     /locus_tag="ZYRO0F01232g"
                     /note="some similarities with uniprot|P35734 Saccharomyces
                     cerevisiae YKL052C ASK1 Component of the DASH complex that
                     binds to microtubules and kinetochores and is essential
                     for chromosome segregation phosphorylated during the cell
                     cycle by cyclin-dependent kinases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497251.1"
                     /db_xref="GeneID:8205004"
                     /db_xref="GOA:C5DX07"
                     /db_xref="InterPro:IPR013964"
                     /db_xref="UniProtKB/TrEMBL:C5DX07"
                     /translation="MEQIDQEITLQLQRIDSNLNHCFAKISREIIPCVEKYGSVCDEL
                     VDSVSHLAGLFRGTGDVALQGQENVISESQPAEKTEDVEDGINADVDTLETNSTNDST
                     RQRRKRKVSLLLQQEYGSSSPREEEEDYVAEEGTLPSVAVLKFNTGNNNINPYDDNGG
                     DEA"
     gene            <101180..>102673
                     /locus_tag="ZYRO0F01254g"
                     /db_xref="GeneID:8205005"
     mRNA            <101180..>102673
                     /locus_tag="ZYRO0F01254g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497207.1"
                     /db_xref="GeneID:8205005"
     CDS             101180..102673
                     /locus_tag="ZYRO0F01254g"
                     /note="similar to uniprot|P28817 YDR036C Saccharomyces
                     cerevisiae EHD3 Protein of unconfirmed function plays an
                     indirect role in endocytic membrane trafficking member of
                     a family of enoyl-CoA hydratase/isomerases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497252.1"
                     /db_xref="GeneID:8205005"
                     /db_xref="GOA:C5DX08"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:C5DX08"
                     /translation="MLRSIAKASCRRQFSASSMALNKPVLFNVQDTARVVSLNRPGKL
                     NALNTEMCSLVFDTLKEYSKSDSAHLVVVKSVNHPRSLCAGGDVAAVATLNKAGQYDQ
                     SIDFFQHEYSLNFQLATYGKPIVAFMDGITMGGGVGVSVHNPFRVATEYTKLAMPEMD
                     IGFFPDVASTFALPRLINLSNENAQLALYLVLTGEVLTGEEAYLLGIASHYVPHENIE
                     DLQNRLGELVARDGRFNDGSFYDTVNEAIEEFSRPLPSGKQLLRYTVDQLRVIEACFD
                     AYSLTSIQQLLHNLERVASDPSNSEDARKFAQFTLQRLLTKSPTSMQVALRLIHENGR
                     DNLENAVKRDLYTAANFALASQQGSALPVEFNEAVTHKLINKNKDPYSWKYKLGDLSP
                     SQLTSLVSPKPSVPLSLLRNTRNITYKDYPHHHRYQLPKEQQILEYAVGGGEQKPLTR
                     RQVVEYFTNFYGPSKGKVGTDILVDLVLAKNCQEDPVTGHLTSLNRS"
     gene            <102883..>105213
                     /locus_tag="ZYRO0F01276g"
                     /db_xref="GeneID:8205006"
     mRNA            <102883..>105213
                     /locus_tag="ZYRO0F01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497208.1"
                     /db_xref="GeneID:8205006"
     CDS             102883..105213
                     /locus_tag="ZYRO0F01276g"
                     /note="similar to uniprot|P38237 YBR058C Saccharomyces
                     cerevisiae UBP14 Ubiquitin-specific protease that
                     specifically disassembles unanchored ubiquitin chains"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497253.1"
                     /db_xref="GeneID:8205006"
                     /db_xref="GOA:C5DX09"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR016652"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DX09"
                     /translation="MAQTLESASIPAVISKEECIYCYQSPYNDVTLDELTHPPHHSLN
                     VCLHCFQSVCNRHLGLHYQVALNAAGSTHSDYFNLAKVKRPEDRAEQDKRNKKIKLRV
                     VEKSEDEIYETLWSLGQFDETKLSLQISCTSKDANLSESITSKVNQILNSKSQDMVDQ
                     TSSWELTVKPCPHVESYQPPQLESVKQAAHSCTDCGLPDNLWLCLHCGNVGCGRNQVG
                     VEGHSHALKHYESNPTHSIAVKLGSLSKNSSDLYCYSCDDETKFEDQRPFVNALKSYG
                     INLEDKLASEKTLVELQVEQNMNWDFQMTDSAGKDLLKLKPDQEHGCGLINLGNSCYL
                     NSVLQCLFNGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAMKVEPQNYPEGIR
                     PKSFKKCVGQSHEEFSSGRQQDSMEFLGYLVDVLDKKIFKNGSNPNDLMKFTMEDRLQ
                     CTNCGKVKYSSEAAESLQLPMPENNDPQDLVHIIAQYFNGEEVEFTCPHCKTLVKAIK
                     KPALNTYPNTLVVNPARIRPVNWVPVKTSNELRLPGLEDPAEVLDISQFGSNGFDPAK
                     EELMPEDEQDTGFVPNPNSASQLAAMGFQPNGIARALFATGNSNTESAMEWLFQHVED
                     ADLNEPFVPPKDSSSAAGGKSQVNPELLANMTAMGLDEKLSLKALVLNKGDVNRSVEW
                     VFNNMDDDGELPQEPAGDDPKDYGHKTPAPYELTGIVCHKGNSVHSGHYVAFIRQIVE
                     NEKKWVLYNDEKIVVAAPENFEEIKKNGYIYLYSRI"
     gene            <105384..>106508
                     /locus_tag="ZYRO0F01298g"
                     /db_xref="GeneID:8205007"
     mRNA            <105384..>106508
                     /locus_tag="ZYRO0F01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497209.1"
                     /db_xref="GeneID:8205007"
     CDS             105384..106508
                     /locus_tag="ZYRO0F01298g"
                     /note="similar to uniprot|P38236 YBR057C Saccharomyces
                     cerevisiae MUM2 Cytoplasmic protein essential for meiotic
                     DNA replication and sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497254.1"
                     /db_xref="GeneID:8205007"
                     /db_xref="UniProtKB/TrEMBL:C5DX10"
                     /translation="MNYMNYGYDPHQALESAFTNLRLEQPHPMYETMDRDGTKIPLLN
                     SSQQTPLSADPQLMHPLPTPLSNKSSNYMLSPTVNKGQSTPTSIAAAGQKGGSGALTN
                     PRSSIWGQNALDAKFSSKELGVDSTGNGDNGGSNTNNNVLSETSTSTAGTISASKNLM
                     DFNTQASSSSFDTTFGSLANHSMEQQQQKANNNRKDAKTELESLKLKLQFKETQNESL
                     EHEVQMLKSIFNQGLDHKQSEFKNERQNPHVPPLSLEIPDSVEDMFKKMSKSLQKKDE
                     ELIAANQTLESILTALALNPTNSMTKYGRYDPEALAHKTVVRIETLTRENQEMSKMLA
                     YGRSKEAQIELQLMKKENEELKAKVMELQQSTINPTPSSN"
     gene            complement(<106782..>107903)
                     /locus_tag="ZYRO0F01320g"
                     /db_xref="GeneID:8205008"
     mRNA            complement(<106782..>107903)
                     /locus_tag="ZYRO0F01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497210.1"
                     /db_xref="GeneID:8205008"
     CDS             complement(106782..107903)
                     /locus_tag="ZYRO0F01320g"
                     /note="highly similar to uniprot|P14843 YDR035W
                     Saccharomyces cerevisiae ARO3
                     3-deoxy-D-arabino-heptulosonate-7- phosphate (DAHP)
                     synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497255.1"
                     /db_xref="GeneID:8205008"
                     /db_xref="GOA:C5DX11"
                     /db_xref="InterPro:IPR006218"
                     /db_xref="InterPro:IPR006219"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DX11"
                     /translation="MFIKNDHVGDRSRLEDWRIKGYDPLTPPDLLQHELPISEKGHKT
                     IVKAREEVCDILSGKDDRLVIVIGPCSIHDPKAAYEYADRLAKLSEKLSKDLLIIMRA
                     YLEKPRTTVGWKGLINDPDINNSFQINKGLRISREMFTKLVEKLPIAGEMLDTISPQF
                     LSDCFSLGAIGARTTESQLHRELASGLSFPIGFKNGTDGGLQVAVDAMRSAAHEHYFL
                     SVTKPGVTAIVGTEGNQDTFIILRGGKNGTNFDPENVKTVKSHLKKSNLVDEEETKRR
                     IMIDCSHGNSSKDFRNQPKVAKCIYDQLSAGENCLCGVMIESNLVEGRQDIPAGGGRE
                     GLKYGCSITDGCISWESTEEVLELLAEGVRNKRAVNAKK"
     gene            complement(108269..108340)
                     /locus_tag="ZYRO0F01342r"
                     /db_xref="GeneID:8205009"
     tRNA            complement(108269..108340)
                     /locus_tag="ZYRO0F01342r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=73.86"
                     /db_xref="GeneID:8205009"
     gene            complement(<108479..>109975)
                     /locus_tag="ZYRO0F01364g"
                     /db_xref="GeneID:8205010"
     mRNA            complement(<108479..>109975)
                     /locus_tag="ZYRO0F01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497211.1"
                     /db_xref="GeneID:8205010"
     CDS             complement(108479..109975)
                     /locus_tag="ZYRO0F01364g"
                     /note="similar to uniprot|P38081 YBR056W Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497256.1"
                     /db_xref="GeneID:8205010"
                     /db_xref="GOA:C5DX12"
                     /db_xref="InterPro:IPR001547"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DX12"
                     /translation="MFDKLKNKLEDVIDKKRTGKGHGNKEVEVKIPDSSQIDKKSIYK
                     YRYNHGVNLGALFVLEKWIYDDLFDKGGDTEYDAVNNQLKDSGAEATAQKLHEHYQAY
                     LKSIDFEFLVDSGVTALRVPIGYWHVGNGQFVDGLPYSPLKKVYENAKAWDVLKQLIS
                     TSNNYGIGILVDIHALPGGANADAHSGSSLKNASFFGNSSYVNQVCNEILPFIVKDVC
                     QNNDNIIGLQIVNEAKFDNNASGQKKYYSKATKAIRAIDDDLPIVISDGWWPQQWADW
                     VQQQGLDTNLIVDSHIYRCFSDSDKQKSAQQIIDDLPNSASLPKDQADYMVGEFSCVL
                     DTQTWDKTQGDRGQLVKQYGNAKTSSFSKNASWGWFFWTLQFQHGDGGEWGFIPMVNS
                     SSIPRRPGGTHAILSDNQIQSFVQQHSDYWKDKGGDKMEHWRYEDALKSSIADIKAFA
                     EFNNSLVGRWHSWKVQRRQQYIQQKGDSDYMWEWDQGYQKGLDECNHY"
     gene            complement(110474..110557)
                     /locus_tag="ZYRO0F01386r"
                     /db_xref="GeneID:8205011"
     tRNA            complement(110474..110557)
                     /locus_tag="ZYRO0F01386r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAA) cove score=70.82"
                     /db_xref="GeneID:8205011"
     gene            <111286..>111756
                     /locus_tag="ZYRO0F01408g"
                     /db_xref="GeneID:8205012"
     mRNA            <111286..>111756
                     /locus_tag="ZYRO0F01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497212.1"
                     /db_xref="GeneID:8205012"
     CDS             111286..111756
                     /locus_tag="ZYRO0F01408g"
                     /note="similar to uniprot|P32495 Saccharomyces cerevisiae
                     YDL208W NHP2 Nuclear protein related to mammalian high
                     mobility group (HMG) proteins essential for function of
                     H/ACA-type snoRNPs which are involved in 18S rRNA
                     processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497257.1"
                     /db_xref="GeneID:8205012"
                     /db_xref="GOA:C5DX13"
                     /db_xref="InterPro:IPR002415"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5DX13"
                     /translation="MGKESKESKEPKETKGEDNYEARLPAVLPFAKPLASKKLNKKLL
                     KTTKKASKAKNVKRGVKEVVKALRKGEKGLVIIASDISPPDVISHLPVLCEDHSVPYI
                     FVPSKQDLGSAGATKRPTSVVFIVPGSNKKQDGKSKEEEYKESFNEVVKEVEAL"
     gene            <111944..>113266
                     /locus_tag="ZYRO0F01430g"
                     /db_xref="GeneID:8205013"
     mRNA            <111944..>113266
                     /locus_tag="ZYRO0F01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497213.1"
                     /db_xref="GeneID:8205013"
     CDS             111944..113266
                     /locus_tag="ZYRO0F01430g"
                     /note="similar to uniprot|Q03782 Saccharomyces cerevisiae
                     YDR240C SNU56 U1 snRNP protein serine-rich has no
                     counterpart in mammalian U1 snRNP"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497258.1"
                     /db_xref="GeneID:8205013"
                     /db_xref="GOA:C5DX14"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C5DX14"
                     /translation="MAPKKRVATEDPVPKSSKKGRKHDVFESQDIWKNLDRIRTQNAK
                     AGSIIPNSYLFVPIFSDPGDYELCINALHEFVDSGKLKLQSCDDCVIPGYVCLQDFSL
                     MDCSLVLSILFGYKNKKWISPNNSKDFFTIPKGLNVSGTFYLPSSCTGYNVRTVPTLR
                     ESQFQTHYNFKEYYISSTSLSQIVQSLVTFFHSIKFGKSSKVTSSCFSKALNQIYQTM
                     DLGVKELPFLGEALYNPTNLTKINLPSIEKSKNNLQSYAQKLIKYNAALEPSSSSSSK
                     NEKQTTSTHSTTRQNTPSRTNSGTGSSVNTTTHGSRPNFMTQDQIKQHCVATIKASQE
                     VVKAKSPYQILKTYVKCPRQGYIDKVYQNLNDLRAQTNCNIVVLNLNNLHESRPWFDS
                     LNVSNFTTYAQQPHPSTVRVVSIGGIGEHVQKALELIYKILLQENVHV"
     gene            <113613..>116627
                     /locus_tag="ZYRO0F01452g"
                     /db_xref="GeneID:8205014"
     mRNA            <113613..>116627
                     /locus_tag="ZYRO0F01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497214.1"
                     /db_xref="GeneID:8205014"
     CDS             113613..116627
                     /locus_tag="ZYRO0F01452g"
                     /note="weakly similar to uniprot|Q03780 Saccharomyces
                     cerevisiae YDR239C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497259.1"
                     /db_xref="GeneID:8205014"
                     /db_xref="UniProtKB/TrEMBL:C5DX15"
                     /translation="MFSSSNNSTSGGNKGKRRSFFLWGSSGSLSGGQPATVTNSSTNG
                     KPSNGSNSKTSTRPSNPKASPMKSTLDKKPINNRNPFVQSDRPATINRGKSATELNST
                     PRKPSSTSEKHKVSSPHDSTTATGVRNKHSSSRLTSNEKSRVSSSTSHRHTSSSHTTS
                     SDKTRDSSSHGHTSSQTSSHPHKRTTSSSDKQKSSTSSTSSSSPKKESSREISSSSSS
                     LKKELNEPLALSSSSSGQKPLRARRPPPPVDLSVLRNSMKQVPEGRQLEEKPDLEAKG
                     VFPPKQLSEERVVALNYVERGLPPSTPQDVRGEREGKGEAQVSGNEFNPKQHRRQRSE
                     AEKFEEELDYFIKEHSAVQDSPISQRGSFPEEELDREIDLQNGLATHLDPAKASNNED
                     LLGGLLTYVDPLKLPEASQRNRVASPPRLASPPVINPLPSVQTEPSLEPPPPLPPKEP
                     LEPLAAVYSSPLPASGTERKSRELTETEKRKSGTSATGDEQADRFSFTDSLADNSVKS
                     VQQVALDDTRGAAPIVSNLSYRDSMDAATYADNNNRMSRTYTNSLDRPPLMNESLHQR
                     EEDAPENPISDTASLGEMVTTSKPRTVDSEEIFSAKDFDQDSAMQPVEAKEPPPPRRK
                     FRVVNEDRPTFYMNGFDEYLNKDNDEFDDTATHYSIRSHESAFSKGISTAPSEKSNTY
                     VPTNLNNQSLENNPAIFGIRSGVAGLDSASEKDILKSVVSSSRTKAGSIFTGPGSLSN
                     HQSTRSNKSNNSSTTVSSGSPKPDKSVRLVSSYVEELRLKYYRASNFLQAPPNLPVTL
                     KQKNNLVQPKNVKVKIRTSSKQIGIKHGRAKQKLFTLETTDEDANEDGTHKASSNNNK
                     INVDHTREFHNLLNQKASPSKRTAQDHSPSKSKGDDDLEEFLHDIPGDDAYDSDDAMA
                     PLREGEDTADADVSRSNTVKSYFTKQEEKLQHINNSSQYEKLPTNINIQDYLDKDPIS
                     KTVSTQSGNSGLNEPFSYGQGLRVANPDSSSD"
     gene            <116916..>119828
                     /locus_tag="ZYRO0F01474g"
                     /db_xref="GeneID:8205015"
     mRNA            <116916..>119828
                     /locus_tag="ZYRO0F01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497215.1"
                     /db_xref="GeneID:8205015"
     CDS             116916..119828
                     /locus_tag="ZYRO0F01474g"
                     /note="highly similar to uniprot|P41810 Saccharomyces
                     cerevisiae YDR238C SEC26 Involved in endoplasmic-to-Golgi
                     protein trafficking encodes a subunit of yeast coatomer"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497260.1"
                     /db_xref="GeneID:8205015"
                     /db_xref="GOA:C5DX16"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011710"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016460"
                     /db_xref="InterPro:IPR029446"
                     /db_xref="UniProtKB/TrEMBL:C5DX16"
                     /translation="MTVDPQQPAYTLVFDPSRSNASYTVGEFQKALERGSDEDKIATM
                     KQILVTMLDGNPLPQLLMHIIRFVMPSRNNKLKKLLYLYWEIVPKLDEEGKLRHEMIL
                     VCNAIQHDLQHPNEYIRGNTLRFLTKLKETELLEQLIPSVMPCLEYRHSYVRKYAILA
                     VLSIYQVSDHLLPDAKDIISSFLAVETDPICKRNAFLGLAELDREAALAYLEENMAAI
                     EGLESLLQSSFVQFIRRDAVQVPSLKPQYVELLLDLLDSTTSDEVVFDTALALTTLSA
                     NPSVLAKAATKLINLAVKVFDNNVKLIVLDRVEDINNKNPGALEDLTLEILRVLNAED
                     MDVRSKALNIAMNLVSSRNVDNVVKLLKKELQTTVTNSDKEKSMQYRQLLIKTIHTVA
                     IRFVEVAASVVSLLLDFIGDLSSVAASGIISFVKEVIEKYPHLREGILSNLIDVLDKI
                     RSAKAYRGALWVLGEYAESSSDIQKCWKHIRSSVGELPIVQSELRNRSQNSEEEEKEK
                     EALNHRHAGPVILPDGTYGTETAFDFTSSAPAEDPDARPPIRRFVLNGDFYTASVLAS
                     TIIKLVLRFEKVSQDITVLNALKAEGLLILVSTIRVGQSSLVEKKIDEDSLERIMCAI
                     TMLLDEANPAEKSSEKEILDLAYLDATRSSFKSQVAISKRKNAQLSAKNLTKTAEPID
                     KSLIFRQFTQVESNTSKSDMIEEDLQAAIKGDSERPNKNSITSKLKKIVPLTGFSDPV
                     YAEAYITNHQFDVVLDVLLVNQTRETLKNLHVQFATLGDLKVIDKPPSTNVVPHGFHR
                     ITTTVKVSSADTGVIFGNIIYDGGHGEDARYVILNDVHVDIMDYIKPAKTDDETFRTM
                     WNAFEWENKISVKSQLNSLHAYLRELTRGTNMGILTPPEALGEEDCRFLSCNLYAKSS
                     FGEDALANLCIEKSPASGQVVGHVRIRSKGQGLALSLGDRVALIAKQHDKVQLTHI"
     gene            complement(<120146..>120904)
                     /locus_tag="ZYRO0F01496g"
                     /db_xref="GeneID:8205016"
     mRNA            complement(<120146..>120904)
                     /locus_tag="ZYRO0F01496g"
                     /product="40S ribosomal protein S0"
                     /transcript_id="XM_002497216.1"
                     /db_xref="GeneID:8205016"
     CDS             complement(120146..120904)
                     /locus_tag="ZYRO0F01496g"
                     /note="highly similar to uniprot|P32905 Saccharomyces
                     cerevisiae YGR214W RPS0A protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S0"
                     /protein_id="XP_002497261.1"
                     /db_xref="GeneID:8205016"
                     /db_xref="GOA:C5DX17"
                     /db_xref="InterPro:IPR001865"
                     /db_xref="InterPro:IPR005707"
                     /db_xref="InterPro:IPR018130"
                     /db_xref="InterPro:IPR023591"
                     /db_xref="InterPro:IPR027498"
                     /translation="MSLPATFDLTTEDAQLLLAANTHLGARNVQVHQEPYVFKTRPDG
                     VNVVDVGKTWEKLVLAARIIAAIPNPEDIVAISSRTFGQRAVLKFSAHTGATPIAGRF
                     TPGSFTNYITRSFKEPRLIIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAI
                     PCNNRGKHSIGLIWYLLAREVLRLRGALVDRTQPWSVMPDLYFYRNPEEIEQQVAEET
                     AGAATEEEEAKEEVTEEQTEATEWAEETTEAVAW"
     gene            <122337..>124487
                     /locus_tag="ZYRO0F01518g"
                     /db_xref="GeneID:8205017"
     mRNA            <122337..>124487
                     /locus_tag="ZYRO0F01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497217.1"
                     /db_xref="GeneID:8205017"
     CDS             122337..124487
                     /locus_tag="ZYRO0F01518g"
                     /note="similar to uniprot|Q12209 Saccharomyces cerevisiae
                     YLR047C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497262.1"
                     /db_xref="GeneID:8205017"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:C5DX18"
                     /translation="MSMMDVKRALCLFMGWLDNNLPTFDDDTDRHLRRERIMECTKLC
                     FFLTSGLILVALPLWNTLSLTSGFFRVTHFFKHTVFKNHSRIHSWRIWHNTSLQQLVF
                     WSVFVGICTFAGAGRDLIQITKRMGRLSVALMPPLLFLTLRPSPLPETLYLSLVPIHR
                     WMSRVVVVESLLHTILYLWFMYLKGSLIKVFKPANFSGVIAMVLFVLIGVTSVSKMRR
                     WNFQVFYYVHYLSTWATVILLHYHARPSIPSYTFLNVAILVWQIIYRISHTKITTITA
                     VPISPSLTLVEFPKDDLSSKPILPSGHVRLSQQHSSWLKWLFHQLAPLQHPYTIASLP
                     TDDTVKLIVRNSNFPLISNTAYRVTGAFEPKLNFMSKVKLGQILRTTSSSGNLNSASL
                     LHSPLSYNIHARRALICVGGSAISFALPLLRILNFNGVTVKLIWVSKDYRDLKVLNHF
                     KHNFEGMEIYVSGASGSEQDIQIDYVDSYPDSDDASVASSLGEEGQGYNERTPLTWGT
                     PNHNTLSTKSHLSLVDGTNKTKNYGSTANTGSSNNISNKTAMGEIDPNDEIDFTEIFS
                     LGNAKSILSNRAQVQRLNANSPTPAPISDHELFRKPSLIEAPTGLEGNEVDEESRLIS
                     DNDKVLRIPSGIKVFFGRPSLGEKDYLWCMERECAYDERADDGCEIYNGGNTHTHDLS
                     DIVVMAAGPVGLVESTRRFATDYGLNFHAECYTV"
     gene            complement(<124663..>126075)
                     /locus_tag="ZYRO0F01540g"
                     /db_xref="GeneID:8205018"
     mRNA            complement(<124663..>126075)
                     /locus_tag="ZYRO0F01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497218.1"
                     /db_xref="GeneID:8205018"
     CDS             complement(124663..126075)
                     /locus_tag="ZYRO0F01540g"
                     /note="similar to uniprot|P53304 Saccharomyces cerevisiae
                     YGR212W SLI1 N-acetyltransferase confers resistance to the
                     sphingolipid biosynthesis inhibitor myriocin (ISP-1) by
                     inactivating it co-operates with Ypk1p in mediating
                     resistance to myriocin converts myriocin into
                     N-acetyl-myriocin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497263.1"
                     /db_xref="GeneID:8205018"
                     /db_xref="GOA:C5DX19"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:C5DX19"
                     /translation="MVIGHRKLSSLERYFYTRSIINLHSCFYVGIQLNQLPSRTQIQH
                     ALKSTIDTFIQLRCNVGIDEEDGKPYLKIIDQSLELKDVVEFVDWAKFDEDKMNYVFQ
                     NYAFPYHTEKPLWKVLVIPNERKLVLLMSHVLFDGMAGVIILQEFLKNLNQSMNAIEN
                     TISTVYEPGEIQSFTSNHHPYEDWPIGWKAKLLQFLFAQYLKWKPINADMVGPKSEDF
                     KFNSYFLPHGLLEKRSDSTGGLYQVRCDNLQRNIHLTPEELEKVLQLCKDHRVSFSSL
                     LTALFARSLAKFSDPTSYTGSQMKICLPMNTRSACNKYLQNDDYTKQLGNFVAATTLI
                     ANTNDNKPLWELAEAFQKTIVQKVQNGIPDAIGECRLLDVIDMQEFFKAKIAATKPSD
                     TFEVSNLGFQPFNDVEGPFKVTDAFFNQPQGISANFFCSVISTGGGLNCHLTIPRDLE
                     RDLAPCIQYVDDWLHEKGRK"
     gene            complement(<126313..>127770)
                     /locus_tag="ZYRO0F01562g"
                     /db_xref="GeneID:8205019"
     mRNA            complement(<126313..>127770)
                     /locus_tag="ZYRO0F01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497219.1"
                     /db_xref="GeneID:8205019"
     CDS             complement(126313..127770)
                     /locus_tag="ZYRO0F01562g"
                     /note="highly similar to uniprot|P53303 Saccharomyces
                     cerevisiae YGR211W ZPR1 Essential protein with two zinc
                     fingers present in the nucleus of growing cells but
                     relocates to the cytoplasm in starved cells via a process
                     mediated by Cpr1p binds to translation elongation factor
                     eEF-1 (Tef1p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497264.1"
                     /db_xref="GeneID:8205019"
                     /db_xref="GOA:C5DX20"
                     /db_xref="InterPro:IPR004457"
                     /db_xref="UniProtKB/TrEMBL:C5DX20"
                     /translation="MSGPQENLFKPVGDTVEEINVDEAPEQEQVQVKNTGAADAMGHP
                     VQEIESLCMNCHADGTTRLLLTSIPFFREIVIMSFECPECGFKNSEIQPASQIQEKGA
                     KYMLKVENQSDFNREVIKSETATCKFLELDIEIPAKRGQLTTVEGLLSEMIDDLAADQ
                     EARKSIDENLHDKIQEVIERVRSYIDCKPGTLPLTFILDDPAGNSWIEYRPGEPLHKW
                     SHTDYFRNDEQNVLVGIITRDQLEMRRQEKLSELSNRERNPSEAVKVGSSASEFLSDA
                     TEIENFDNEVQTFRASCPSCVRECETHMKPVNIPHFKEVIIMSTVCDNCGYRSNEVKT
                     GGAIPDKGRKTVLYCDDPADLSRDILKSETCTLTIPELHVEIQQGTLGGRFTTLEGLL
                     QQVYEELETRVYSQTSDSMDEATKQRWQGFFGNLKEALEGKRKFTVIMEDPLAGSYIQ
                     NVYAPDEDPNMNISDYERTREQDEDLGLNDIKVDQ"
     gene            <128820..>130061
                     /locus_tag="ZYRO0F01584g"
                     /db_xref="GeneID:8205020"
     mRNA            <128820..>130061
                     /locus_tag="ZYRO0F01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497220.1"
                     /db_xref="GeneID:8205020"
     CDS             128820..130061
                     /locus_tag="ZYRO0F01584g"
                     /note="highly similar to uniprot|P42942 Saccharomyces
                     cerevisiae YGR210C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497265.1"
                     /db_xref="GeneID:8205020"
                     /db_xref="GOA:C5DX21"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DX21"
                     /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDASASIGSFPFTTIDPNRA
                     TGYVQIDCACSRFGKESLCKPNYGWCTNGKRHVPIMLLDVAGLVPGAHIGRGLGNKFL
                     DDLRHADALIHVVDVSGTTNAEGKNTRGYDPLNDIEWLQDEIRLWIEGNLKKRWGSIV
                     RKHTATKSNVVDTLQAQFGGYGSQFSMIQRALDRLEGLPPLEHWNDDWITRVVKSFMV
                     EKFPTVLALNKIDHPDADKNVSKIMLKYPNTKSVLCSAVTEIFLRKLNKQGFIRYEEG
                     TEFVDTCEDDPENLKPLDDKILSRIEGIRDLVLYRFGSTGVVQVLQAATDILNLIPVY
                     AVRNIQTFQGGNGQNVFRDCFLVKRGTSVGKVTRHIMGTEVTIAAIETVGGVRVSEDA
                     PVEPGKNDILSFKIAPKSKDT"
     gene            complement(<130346..>132037)
                     /locus_tag="ZYRO0F01606g"
                     /db_xref="GeneID:8205021"
     mRNA            complement(<130346..>132037)
                     /locus_tag="ZYRO0F01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497221.1"
                     /db_xref="GeneID:8205021"
     CDS             complement(130346..132037)
                     /locus_tag="ZYRO0F01606g"
                     /note="highly similar to uniprot|P06169 Saccharomyces
                     cerevisiae YLR044C PDC1 Major of three pyruvate
                     decarboxylase isozymes key enzyme in alcoholic
                     fermentation decarboxylates pyruvate to acetaldehyde
                     subject to glucose-ethanol- and autoregulation involved in
                     amino acid catabolism and to YLR134W uniprot|P16467
                     Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
                     pyruvate decarboxylase, key enzyme in alcoholic
                     fermentation, decarboxylates pyruvate to acetaldehyde,
                     regulation is glucose- and ethanol-dependent, repressed by
                     thiamine, involved in amino acid catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497266.1"
                     /db_xref="GeneID:8205021"
                     /db_xref="GOA:C5DX22"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DX22"
                     /translation="MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLR
                     WAGNANELNAAYAADGYARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVP
                     SVSSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQ
                     RPVYLGLPANLVDQKVPASLLNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILA
                     DACCSRHDVKAETKKLIDLTQFPSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAV
                     ESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLL
                     QAVPEAVKNYKPGPVPAPPSPNAEVADSTTLKQEWLWRQVGSFLREGDVVITETGTSA
                     FGINQTHFPNQTYGISQVLWGSIGYTTGSTLGAAFAAEEIDPKKRVILFIGDGSLQLT
                     VQEISTMIRWGLKPYLFVLNNDGYTIERLIHGETAEYNCIQPWKHLELLNTFGAKDYE
                     NHRVSTVGEWNKLTQDPKFNENSRIRMIEVMLEVMDAPSSLVAQAQLTAATNAKQ"
     gene            complement(<132759..>135314)
                     /locus_tag="ZYRO0F01628g"
                     /db_xref="GeneID:8205022"
     mRNA            complement(<132759..>135314)
                     /locus_tag="ZYRO0F01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497222.1"
                     /db_xref="GeneID:8205022"
     CDS             complement(132759..135314)
                     /locus_tag="ZYRO0F01628g"
                     /note="similar to uniprot|P46675 Saccharomyces cerevisiae
                     YLR045C STU2 Microtubule-associated protein (MAP) of the
                     XMAP215/Dis1 family regulates microtubule dynamics during
                     spindle orientation and metaphase chromosome alignment
                     interacts with spindle pole body component Spc72p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497267.1"
                     /db_xref="GeneID:8205022"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DX23"
                     /translation="MSEEDFTRLPLEQKLDHKLWKARLNGYQELNQNFKGGKGQEHWR
                     RPELFGKYLMDSNVVAHEQAVISLETFLKEVDVPAKGIDLKTIFEIWIPALAEKGLSS
                     SRATTKEKANECIIVLCSLDRSIMQSVELILPFCEKKMPKLVANSLHSLRELIKSFGL
                     TNCNSQQLLPQLLAPLAKLAGHADKNVRSETLGLIVEIYKCTGRNKAFLQELLLDQLK
                     PIQQRELDKLFTAADSENPQDQASRLFVWQRREQENSAKDHDGDTIMEQQFSQGHGTS
                     AAPASVPAAAAPPVPIDPLDLLPEQTILDKLPENFYSRLSSSKWKDRVESLQEFYDRV
                     LVPLKKLKFHKEDYSELLSALGHVIQKDANVQAVSLAAQCVSEICQKMKNTNFNKHYV
                     GFVFTPLLERTKERKTTVVETIRNALQALCRQQYPLASHGHNEDMLQEILDFMKHKTP
                     QIRQETTLLFIFNLKQLGQQLGGNGAKKILQKYLPDEICPAVTKIVNDTQPAIRECGF
                     ECFAVLIKILSRKELHFELEKLDNLKRQKIQDHLDKLPELESSVESEPTAAASATATA
                     TPTTAAAQSPTEASTIPSKRGPTSPLKKSNSPNVPKSRVLLTSRTLGTPPANAPLQPA
                     ATTTSRTQAQAQFNTELTKLQKDKSEWIQERHQLLSQVNKLSNSQTQLVSENEALREQ
                     LKLSQTNLHERGLQLRSKDLQLTKLQDRIAQLELDLRESHMQMQQRQLSSSEPASAIS
                     TNLGVRSISSSSMDPTSATGNGYSNRSKHLRTPSESSDDLPRRVDSLQLSSSQPGVAG
                     VTGSLSNPVATTTTTSSSSSDAINEESWKRAAEVTSQLKARIERMRAKTRGIK"
     gene            <135826..>136143
                     /locus_tag="ZYRO0F01650g"
                     /db_xref="GeneID:8205023"
     mRNA            <135826..>136143
                     /locus_tag="ZYRO0F01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497223.1"
                     /db_xref="GeneID:8205023"
     CDS             135826..136143
                     /locus_tag="ZYRO0F01650g"
                     /note="highly similar to gnl|GLV|CAGL0K00803g Candida
                     glabrata CAGL0K00803g and similar to YLR043C
                     uniprot|P22217 Saccharomyces cerevisiae YLR043C TRX1
                     thioredoxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497268.1"
                     /db_xref="GeneID:8205023"
                     /db_xref="GOA:C5DX24"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C5DX24"
                     /translation="MGVSAIASSAEFDKALAVAGKLVVVDFFATWCGPCKMISPMVEK
                     FSNEYSQADFYKVDVDQVPEVAQKNEVSSMPTFILFKDGKQVAKVVGANPAGVKQAIA
                     SNV"
     gene            complement(<136165..>137055)
                     /locus_tag="ZYRO0F01672g"
                     /db_xref="GeneID:8205024"
     mRNA            complement(<136165..>137055)
                     /locus_tag="ZYRO0F01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497224.1"
                     /db_xref="GeneID:8205024"
     CDS             complement(136165..137055)
                     /locus_tag="ZYRO0F01672g"
                     /note="similar to uniprot|P42941 Saccharomyces cerevisiae
                     YGR208W SER2 phosphoserine phosphatase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497269.1"
                     /db_xref="GeneID:8205024"
                     /db_xref="GOA:C5DX25"
                     /db_xref="InterPro:IPR004469"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR023190"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DX25"
                     /translation="MSEFVVTYISHSAQLDEAQVKHLNHELESVFSKSELSTKRLAPH
                     VVDVTFTVDSDWSSVKRALDPLIDSQNQIDIIVQRNDSHRQKKLVVFDMDSTLIYQEV
                     IEMIASYANVEPQVAEITNRAMNGELDFAQSLQERVSLLKGLEIDPLYDAIKPRLQVT
                     KGVPELCESLKAHGVKLAVLSGGFTPFAEYIKDKLHLDYARANNLETQDGKLTGTTRG
                     PVVDGNCKAETLRSLCEQYGIDPQDSMMVGDGGNDLPAMAAAGYGVAWHAKPKVQQLA
                     PCKLNTESMINLLYVIGYIN"
     gene            <137411..>138145
                     /locus_tag="ZYRO0F01694g"
                     /db_xref="GeneID:8205025"
     mRNA            <137411..>138145
                     /locus_tag="ZYRO0F01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497225.1"
                     /db_xref="GeneID:8205025"
     CDS             137411..138145
                     /locus_tag="ZYRO0F01694g"
                     /note="similar to uniprot|P53039 Saccharomyces cerevisiae
                     YGR172C YIP1 Golgi integral membrane protein binds to the
                     transport GTPases Ypt1p and Ypt31p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497270.1"
                     /db_xref="GeneID:8205025"
                     /db_xref="GOA:C5DX26"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:C5DX26"
                     /translation="MSYYQNPKGSSGFYQPSSQFAFPQGSMSFQGASSTSANGADSLG
                     ISPDPLPSGLFNALSTKGYPHEPPLLEEIGINFAHVITKTRIVCNPVSSRNILSDEIL
                     GDSDLAGPLIFFLLFGLFLLLAGKVHFGYIYGVALFGTVSLHNLSKFMGNNESGSPAK
                     LQFFNTASVLGYCFLPLCFLSLIGVFLSLDNTLGYALGAIFVAWSTWSSSAFFNSLLQ
                     LHDARALIAYPLLIFYTVFALMAIFV"
     gene            <138232..>139890
                     /locus_tag="ZYRO0F01716g"
                     /db_xref="GeneID:8205026"
     mRNA            <138232..>139890
                     /locus_tag="ZYRO0F01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497226.1"
                     /db_xref="GeneID:8205026"
     CDS             138232..139890
                     /locus_tag="ZYRO0F01716g"
                     /note="similar to uniprot|P22438 Saccharomyces cerevisiae
                     YGR171C MSM1 Mitochondrial methionyl-tRNA synthetase
                     (MetRS), functions as a monomer in mitochondrial protein
                     synthesis; functions similarly to cytoplasmic MetRS
                     although the cytoplasmic form contains a zinc-binding
                     domain not found in Msm1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497271.1"
                     /db_xref="GeneID:8205026"
                     /db_xref="GOA:C5DX27"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="UniProtKB/TrEMBL:C5DX27"
                     /translation="MLLRRCLIQRRLVSHVTTPIFYPNAKPHLGHLYSSLICDVFHRW
                     KTLQGEENLFTTGTDEHGLKIQLASERNGFQNPKQFVDKLYDDFITLDKAFNVNFTRF
                     IRTTDTDHINNVRKLWNLCDKNGFIYQGEHKGWYSISDETFYPESKVIEDPVNTGKYL
                     NTETNNEVVYHSEKNHFFKLSHFNDQLIDYIESNPQFIYPEVKRVQILNELRNNRLQD
                     LSISRPSFRLKWGIDVPGDPSQKMYVWFDALCNYLTSIGGIDAIMNNEPHTKLLHTRK
                     EIQSPRDWWSNTTHVIGKDIIRFHTIYWPSFLMAAGLPLPRQVVVHSHWICNGMKMSK
                     SLGNVVDPLLMKKHYGEDPMRWFLLENSQLEEDGDFQESKLFSLTEMFASKWGNLVNR
                     CCGPKFNLQRAVQFYSDGRNPLLVNDDNLQAEVNNLVKKLSNIPISMDKKMNNFQTAS
                     ALRDVWSIINDTNAFMQNAEPWTKGPAEQDAIIFLCMETSRILSILCQPIIPDLAAKL
                     LDRIDVEKDNRTTDFSRIGADTTYGVGSNVKGRTVPIKRVTKRT"
     gene            complement(<139924..>141406)
                     /locus_tag="ZYRO0F01738g"
                     /db_xref="GeneID:8205027"
     mRNA            complement(join(<139924..141310,141381..>141406))
                     /locus_tag="ZYRO0F01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497227.1"
                     /db_xref="GeneID:8205027"
     CDS             complement(join(139924..141310,141381..141406))
                     /locus_tag="ZYRO0F01738g"
                     /note="similar to uniprot|P46957 Saccharomyces cerevisiae
                     YJR006W HYS2 DNA polymerase III (delta) 55 kDa subunit
                     essential for cell viability involved in DNA replication
                     and DNA repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497272.1"
                     /db_xref="GeneID:8205027"
                     /db_xref="GOA:C5DX28"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR024826"
                     /db_xref="UniProtKB/TrEMBL:C5DX28"
                     /translation="MDALLQKFNEKRPDDPKAQKRISVEEREEDVNPFALPTGSRNYN
                     AQYYHMYEHRLRTMKNRVRKECIERWNDDFKLNGEPVVMKQKVLDIQAGQPCWAIGSI
                     YCEMKYKPNILEEVINDTYGAPDLTKSYTDVEGTDEVMLEDESGRVLLVGDYISKTPF
                     VTGTVIGVLGMEAEAGTFQVLDICYPTPLPQSPLPKHDKHDNRKIALISGLNLNSTSP
                     GRLLKLQLLQEFLLGRICNDDEIINIGKLVILGDSVDAKVDEKGPGDMINCLEELGKF
                     LSNILQSIPIDLMPGMKDPTDKSLPQQPLHKALFRDSLRPLFEEVNKQLFNVVTNPYC
                     FTFEGLKLLAIAGQNINDICKYIIPYQEDGKSEDSQLEDTVDHRLDLMECTMKWQNLA
                     PTAPDTLWTYPYKDDDPFLLAEWPHIYAVGNQPDFGTRELDLKGRRIKMISVPEFSST
                     GKIVLLDIKTLETEIVNIEL"
     gene            complement(<141731..>145060)
                     /locus_tag="ZYRO0F01760g"
                     /db_xref="GeneID:8205028"
     mRNA            complement(<141731..>145060)
                     /locus_tag="ZYRO0F01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497228.1"
                     /db_xref="GeneID:8205028"
     CDS             complement(141731..145060)
                     /locus_tag="ZYRO0F01760g"
                     /note="similar to uniprot|P53037 Saccharomyces cerevisiae
                     YGR170W PSD2 Phosphatidylserine decarboxylase of the Golgi
                     and vacuolar membranes converts phosphatidylserine to
                     phosphatidylethanolamine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497273.1"
                     /db_xref="GeneID:8205028"
                     /db_xref="GOA:C5DX29"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:C5DX29"
                     /translation="MVFIKGRKKKLYTKPRLALKVNVIQVKEVDLFRDFECHPVCLVT
                     TNTFNSMRTGKLKYRGTKWNQELKIKLPTKPTSEWVRIIIYDELPPSSALTQDVGGGD
                     YSSREAVKGESRLSGVSGRGSSAGVSSSQEYSTSSTNDVKLPRQRKYLYVGEAKLSVL
                     DLFKNHDESAQAEFVIPPTWYKIYDRRRHTSGKIDESCGQVELGFHLVTLQKQDNLGQ
                     AYNQWKNSLSADLRYQKTLKKSNNAIGGISNKQASGSASDLEKYPGPKYVDDEDDGFD
                     SYVDYSDEDGVGDFDSDYELLAALQSHDSDDVAFDADSVGLSSMVSALDEYEVVRPEE
                     ASVPPSMSTLGFGGGGAGGGSNETKDSTPDDAFEDEPEELSDTIDEYSEDEDDNTADI
                     TVKKSGNRLTNLRKKRNHNRKFKQIYLSNWANYKLSKKQHAAGIVFMEIQSIKDLPCS
                     KTKVSRRKYDMDPFVIAVFGRRVFKTSWRKHTLNPIFNECAAFEVFPNETHFGFHFNV
                     MDKDAFSYNDKVARCHLSWSEMMDSQRGPDGDWVPLELPLQTMKANLNDRSPKLLVKM
                     KFLPYARLKEFFWKNAVNMGTGLEKFDIAQLSFYLDRIGSFTTEEVCDFFKHFKRSPW
                     SGECITKDELIEYLQKWNQSSGFKNVWKCPCCAKSCKPTRNTMKSKLVVENDLITHFA
                     VCSYERKYKLLKPSYVSSDFASKRWYSKILIKLTYGKYALGSNNANILVQDRETGIIL
                     EEKISAHVKLGMRIIYNGKGKQSKNFRQLLKTLSIRQGKKFDDPSSVKQIESFIKYHS
                     LNMSECENANYKTFNEFFYRKLKPGTRIPEGDTSKIFVSSADSRCTVFSSVHQSKEIW
                     IKGSNFTIPRLTGGYAPELFNDRACSLAVFRLAPQDYHRFHSPCSGTIGRPIYINGEY
                     YTVNPMAVRSSLDVFCENVRVIIPIESPEFGTLLCIPIGAMMVGSIVLTCKEGDTIAR
                     GQELGYFKFGGSTVIVVIPSDKILFDSDLSKNSVDGIETLVKVGMSVGHTPDISEYKR
                     ERVKLEDPEQIESVKRKISIKHENADILGRLSWQYRALENFVTKQYGKPEIVSEEVGG
                     NHTNEGYLVENSSSSTFPSSG"
     gene            <145921..>147465
                     /locus_tag="ZYRO0F01782g"
                     /db_xref="GeneID:8205029"
     mRNA            <145921..>147465
                     /locus_tag="ZYRO0F01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497229.1"
                     /db_xref="GeneID:8205029"
     CDS             145921..147465
                     /locus_tag="ZYRO0F01782g"
                     /note="weakly similar to uniprot|P36119 Saccharomyces
                     cerevisiae YKR023W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497274.1"
                     /db_xref="GeneID:8205029"
                     /db_xref="GOA:C5DX30"
                     /db_xref="InterPro:IPR009349"
                     /db_xref="UniProtKB/TrEMBL:C5DX30"
                     /translation="MTKLQAVEYAVIKIPDILPLQESEVRALCDQLLTSSNGNPDRIA
                     EGFLDILGHSDLSFDFVIGFNNLLSAEEQKPAVESQPKIPPPKESKKPVYRERSTPSL
                     PSEHLSKKNNSSNSKSSNSNSNNNNTNSQDKKNQKEKKNQKGQLLREIEQVSKFLEQE
                     PNPNDVQKFACNCQGSRHPLFEAAPNCLSCGKIICIREGLHLSGCSHCGQDFISLEER
                     FKILQLLKQEKEELENGSARPPEPTEKQRAGKNKAGKSYKISTGIGTNLFTEQDKLFD
                     LLERQKEREKRREKVLRTKEDEQKQEEQNKIVQEREASLDPELAQAQDRLDKLLYFQD
                     TSAERTKIIDNVSDFSMANDSNQWGSARERALMLKKQQRNLRKWQKLENERNGRRDKY
                     VVSMDIGPNGKVTMKEVHKDRGGAVAHSDEEISDVSDEEDARDLKTIHALKDEIESDR
                     RQKGSKLESNTWDYERDKKQFKRPVYIGKDTEDVSKSAKQQQDHARKPRVQADGSDEH
                     FWDKLV"
     gene            complement(<147522..>149159)
                     /locus_tag="ZYRO0F01804g"
                     /db_xref="GeneID:8205030"
     mRNA            complement(<147522..>149159)
                     /locus_tag="ZYRO0F01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497230.1"
                     /db_xref="GeneID:8205030"
     CDS             complement(147522..149159)
                     /locus_tag="ZYRO0F01804g"
                     /note="similar to uniprot|P42950 Saccharomyces cerevisiae
                     YJL103C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497275.1"
                     /db_xref="GeneID:8205030"
                     /db_xref="GOA:C5DX31"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /translation="MTKKLSLELRQTRKPIQTACGFCHEKHLQCDVGRPCQNCRKRNI
                     ASFCRDKVKRRRKRKRSDASNFDKDEAATQTLNFNTVNPGEGSSSAMTQDEKNTGTTT
                     ATTTRTTTNFRSESKASSSTENISRAMKDPADTIIANSLLDKPTIGDTDDTGWGFGSI
                     WTNDEYMTLNDLTSFASESMPNQLGPIEEQRSPRRTLGEPLARRYDSSQPFQYLNFGS
                     KLHKTDSRPYISLEQPGNVPSIPAFTMNKGSNDEDASPQQKESQQMQLWQQQASQLQQ
                     QASQLQQQASQLQQQRTQQNEPVSEWTPFQLRLLIKTPKDLFDKKNLVKPHNYRKAYK
                     DLLECLHKMFLGSYYRRQNGRWRPVSDDEDQMRRRLMRKEQLQHIAKSIGELYMPKFV
                     ALTSNMIEEDLLLQELVLQRSLLELENMSKLVNCTPICIWRRSGEICFVSNEFCSLTG
                     FYKREILDQRRFIVEFMDHQSVVSYYDLFHEHLAFGPKDSTRTILNKDQAVYTECNLL
                     LNNGSYLKCACCLTARRDAFNISLLLMGQFLPIFDVQ"
     gene            complement(<149490..>151799)
                     /locus_tag="ZYRO0F01826g"
                     /db_xref="GeneID:8205031"
     mRNA            complement(<149490..>151799)
                     /locus_tag="ZYRO0F01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497231.1"
                     /db_xref="GeneID:8205031"
     CDS             complement(149490..151799)
                     /locus_tag="ZYRO0F01826g"
                     /note="similar to uniprot|P36120 Saccharomyces cerevisiae
                     YKR024C DBP7 Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497276.1"
                     /db_xref="GeneID:8205031"
                     /db_xref="GOA:C5DX32"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DX32"
                     /translation="MRCDELNEILPCIYLLQQELIASEKDKSRAFLVNMSDDDGMLLN
                     FSTNESGAGDSKPSSTKVTGGRWKDRRKMKMMMEGRPNKKRKINQPAATADADADASG
                     KGGNTDDANNAKESTGEKVVEFRNSGKSNNANSNNGQVVSSLFTSNREISTAVNTNER
                     DDSTEQAPSNAPLSGDSFEDLGIKGALLSHLKEKMKIQKPTSIQKLVLSHLLSQWTGQ
                     NDDLFINAQTGSGKTLAFLLPIFARILDMQTRVDRKSGCFALIVAPTRELASQIYSVA
                     SMISNCCHYLVPCLLIGGERKKSEKARLRKGCNFIVGTPGRVLDHLQNTKVIREQFSQ
                     SLRYVVLDEGDKLMELGFEETITEILKIVHDFPLDNSIFPSLPSRIVHVLCSATLKGG
                     VKKLGDVALQNYKLLSNRQIEGSSTASEVPDQLLQKIAIVPPKLRLVTLAGSLDTITK
                     SHKGSESTCRTMVFLSCSDSVEFHFQAFSSSDEHHRNLVGDTVRLLTKGNRILPSFTA
                     GGDPETIFYKLHGSLSQPMRTATLEHFSRDDEASKGKHKIMFCTDVASRGLDLPHVGT
                     VIEVDPPFSTEDHLHRIGRTARAGQSGEALLFLLPGEEEGYLDCIKRFHPKGWKLLKY
                     DKDILQPVFQSMSVNRSDREGKSKKEEDPWDSNVTTWHLNVERRMLEDQTLKSIAVKG
                     FTSHIRAYATHIAAEKPFFNVKCLHLGHLAKSFALRERPKSLAQQSSKDGAKQTAENK
                     KNTAKMGSKDKMFHMARLAVKQSASEFNY"
     gene            <151885..>152676
                     /locus_tag="ZYRO0F01848g"
                     /db_xref="GeneID:8205032"
     mRNA            <151885..>152676
                     /locus_tag="ZYRO0F01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497232.1"
                     /db_xref="GeneID:8205032"
     CDS             151885..152676
                     /locus_tag="ZYRO0F01848g"
                     /note="similar to uniprot|P36121 Saccharomyces cerevisiae
                     YKR025W RPC37 RNA polymerase III subunit C37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497277.1"
                     /db_xref="GeneID:8205032"
                     /db_xref="GOA:C5DX33"
                     /db_xref="InterPro:IPR006886"
                     /db_xref="UniProtKB/TrEMBL:C5DX33"
                     /translation="MSAESENKLFVTEEEDVTPEPSIAGGQVDAEGDIDLQGNSNGND
                     ENDDDDVIQEIPLNLAGQNEILHIFQYANKPKKIGRRAAEHPFITGARYKGTSSVWEL
                     DIPLDETAFYNKDKNEGEWKDANTQTLRGVGVGSEGQYAGFVADGQVYLTPVERIAQL
                     RPHFKYIDEVGQQRKQDDSKNNVTPASQKAQVVTMSVRSVNDPIQSRLAGSLLAHKVE
                     EEEEFVDLTWVEDAFEQFKESMIADSSNHELKPIGDEHDYLENLL"
     gene            complement(<152743..>153651)
                     /locus_tag="ZYRO0F01870g"
                     /db_xref="GeneID:8205033"
     mRNA            complement(<152743..>153651)
                     /locus_tag="ZYRO0F01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497233.1"
                     /db_xref="GeneID:8205033"
     CDS             complement(152743..153651)
                     /locus_tag="ZYRO0F01870g"
                     /note="highly similar to uniprot|P14741 Saccharomyces
                     cerevisiae YKR026C GCN3 Alpha subunit of the translation
                     initiation factor eIF2B the guanine-nucleotide exchange
                     factor for eIF2 activity subsequently regulated by
                     phosphorylated eIF2 first identified as a positive
                     regulator of GCN4 expression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497278.1"
                     /db_xref="GeneID:8205033"
                     /db_xref="GOA:C5DX34"
                     /db_xref="InterPro:IPR000649"
                     /db_xref="UniProtKB/TrEMBL:C5DX34"
                     /translation="MSEFSITDTYLKFLEEDPDITMPIAAIEALVTLLRVKNPKTAAE
                     MINTIKSAAKDLTDSIPNSISLRAGCDIFMRFVLRNTHIYGDWESCKQHLIENGQLFV
                     SRSKMSRTKIAQIGCQFIADDDVILVHGFSRAVFSLFKYAAEKFIRFRVVVTESRPTA
                     QGMQLYSLLQEIGIPVIMIVDSAVGSVIDKVNKVFVGAEGVAESGGIINLVGTYSVGV
                     LARNARKPFYVVTECHKFVRMFPLSPVDLSLPEEALDFSKPAEKPLSGPTLDYTAQEY
                     ITALITDLGVLTPSAVSEELIKMWYD"
     gene            <153868..>156282
                     /locus_tag="ZYRO0F01892g"
                     /db_xref="GeneID:8205034"
     mRNA            <153868..>156282
                     /locus_tag="ZYRO0F01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497234.1"
                     /db_xref="GeneID:8205034"
     CDS             153868..156282
                     /locus_tag="ZYRO0F01892g"
                     /note="similar to uniprot|P39677 Saccharomyces cerevisiae
                     YJL102W MEF2 mitochondrial elongation factor G-like
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497279.1"
                     /db_xref="GeneID:8205034"
                     /db_xref="GOA:C5DX35"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DX35"
                     /translation="MMLNRLFGSLRTYATRANLSKLRNIGIIAHIDAGKTTTTERMLY
                     YSGKINRIGDVDQGDTITDFLPQERARGITIQSAAISFNWQDNYKINLIDTPGHADFS
                     FEVIRAVKVLDGCVTILDAVAGVEAQTEKVWKQSKNIPKICFINKMDREGAGYSRTVK
                     ELITKMRTKVALINMPLFKYDTKTQTNSFEGVIDLVNQKVLKWSAQDPDHVEVIEAIE
                     AASEIKEQFLQGRESLVEALGEFDESLVEYFLDQAEGDYLKIPANLLNQSIRQATLHQ
                     HLTPVLCGASFKNIGVQPLLDAVVDYLPSPLDARIPEVNHDHLPMSQDPKVGVLINGN
                     KNLCVAFAFKVITDPIRGTMIFIRVYSGTLNSNSTVYNCSRASKFKLGKLVLLHANVY
                     EETPQLYPGEIGVLSGANVANNVSTGDTIVSHSVKKDGLKSLNKNTELTLRINPIAVP
                     PPVFVVCVEPKTLGNKKAMEEALSLIVREDPSLVVSKDEETGQTLLGGMGELHLEIAR
                     DRLLNDLHAGVNIGKVMVSYKEAINESSQESTAENDSGCRFTLSVEPIPLDVPIEETI
                     ASDKSGSKWYPLGSDNNYLVVEPHETYKLDNWKLQVPYDSIINAILSSSIAALQKGGK
                     VANFALHSCAVKLKGNWQVPLDMENVTEVLPLTRNLIMGMLDSLPSNDYSVLEPVMNL
                     EVNIPQKDVGPVMQDLTGARKANILSIEDEHEMSETDDSLSSADFHKMAQQQYLPPDM
                     TLKSARLGEIGISNKIIRALVPLREMVAYTNKIRSLTQGRGTFHIDYHGMDRVTQDRL
                     ESVINE"
     gene            156375..156447
                     /locus_tag="ZYRO0F01914r"
                     /db_xref="GeneID:8205035"
     tRNA            156375..156447
                     /locus_tag="ZYRO0F01914r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (ACG) cove score=73.40"
                     /db_xref="GeneID:8205035"
     gene            complement(<156594..>158606)
                     /locus_tag="ZYRO0F01936g"
                     /db_xref="GeneID:8205036"
     mRNA            complement(<156594..>158606)
                     /locus_tag="ZYRO0F01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497235.1"
                     /db_xref="GeneID:8205036"
     CDS             complement(156594..158606)
                     /locus_tag="ZYRO0F01936g"
                     /note="similar to uniprot|P32477 Saccharomyces cerevisiae
                     YJL101C GSH1 Gamma glutamylcysteine synthetase catalyzes
                     the first step in the gamma-glutamyl cycle for glutathione
                     (GSH) biosynthesis expression induced by oxidants cadmium
                     and mercury"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497280.1"
                     /db_xref="GeneID:8205036"
                     /db_xref="GOA:C5DX36"
                     /db_xref="InterPro:IPR004308"
                     /db_xref="UniProtKB/TrEMBL:C5DX36"
                     /translation="MGLLSLGTPLSWLESRKYNEHVKRNGIEQLLKVFAAASSRDGDP
                     LAWGDELEYMMVEYDSQDGSGNAMLDVKRDEILTSLNTEYLPLCTAHNVHFHPEYGRY
                     MLEATPHRPYYGYSGEYVEFNMCQRRQVALEKYREMDISKELGILTLAVFPRMGCDEF
                     VNLPAELRDQKNNASRSLFLPDEVINRHIRFPTLTTNIKTRRGEKVCINVPVYVDSKT
                     PMVDDTVYERDWFVPEDKESLLASEPRHIYMDAMGFGMGCCCLQATFQAPNLEMARYL
                     YDSLANLATVMLAASAASPMFKGWLADQDVRWNVISGAVDDRTPFERSKDPLLPKYNP
                     QGLGGIDPSEYDHVQRLPKSRYSTQDLYLGGNKFFSQSYNDTEVPLNRNVLDRLMEND
                     IAPMDYDLAKHFAHLYVRDPLVIFEESLEQDNDHSTNHFENIQSTNWQTLRFKPPTQE
                     AVPDNKEAPGWRVEFRTLEVQLTDFENAAYTALCYLIVESLLTFHNHINAYIPMSDVW
                     SNMTRAHARDALVEGKFAWKDSFEPNETGSSLKSMDEIFHSPKFGIFPVFVDPLLRHK
                     SFVLKNWQELKFSNEHKRLYYYLKLLSDRASGNLPSTARFLRQYVLAHSDYKKDSKVS
                     KQINYDVLKMCDRITRLDDSKQELSQFFGPEIAEYLKNTRPSSTLK"
     gene            <158932..>160455
                     /locus_tag="ZYRO0F01958g"
                     /db_xref="GeneID:8205037"
     mRNA            <158932..>160455
                     /locus_tag="ZYRO0F01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497236.1"
                     /db_xref="GeneID:8205037"
     CDS             158932..160455
                     /locus_tag="ZYRO0F01958g"
                     /note="similar to uniprot|P42951 Saccharomyces cerevisiae
                     YJL100W LSB6 Phosphatidylinositol 4-kinase that binds
                     Las17p which is a homolog of human Wiskott-Aldrich
                     Syndrome protein involved in actin patch assembly and
                     actin polymerization"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497281.1"
                     /db_xref="GeneID:8205037"
                     /db_xref="GOA:C5DX37"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="UniProtKB/TrEMBL:C5DX37"
                     /translation="MPQIDHTASPGQLVTSNTYDWLQQQEGPLHENKQYEVHHSVFKP
                     LDKYAYLSNDPTYAQERERKRQSIRQKFEYVVSECLDAFKTYHVELRRIKAGSSGSYF
                     VYGRDPQSGPLGVFKPKDEEPYGPLSPKWTKWMHRTFFPCFFGRSCLIPNLGYICESA
                     ASLLDERLGLGMVPPTDTVVLESHRFYDQMQTWLFLCGVEPRLQKKLGSFQLFLYDYM
                     GAEEFLAKYPLPGMYRDHPSLNQQINQHLKHENQNSSAGPQDKFEWTEVNLMKFRLEL
                     EKLIILDYIMRNTDRGLDNWMVKVVPIHRKAGTTWNFHLAAIDNGLTFPWKHPDEWRS
                     YPYGWLYLPVHMLAQPFSESTRRHFLPLLTSEQWWSESYKEFTALFSRDSDFKIRMWR
                     KQWAVLKGQAFNVVETLRDIRQGPLELVRRTRCLVLDEKMQVPIAMPILNTAINERIP
                     IQAGSPMNLYSSPAGINEVAHQREDDDQDHSTAPFTSKTVIIEHLEIVTNTPVLTWC"
     gene            <160655..>162958
                     /locus_tag="ZYRO0F01980g"
                     /db_xref="GeneID:8205038"
     mRNA            <160655..>162958
                     /locus_tag="ZYRO0F01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497237.1"
                     /db_xref="GeneID:8205038"
     CDS             160655..162958
                     /locus_tag="ZYRO0F01980g"
                     /note="similar to uniprot|P36122 Saccharomyces cerevisiae
                     YKR027W FMP50 The authentic non-tagged protein was
                     localized to the mitochondria and uniprot|P40955
                     Saccharomyces cerevisiae YJL099w CHS6 chitin biosynthesis
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497282.1"
                     /db_xref="GeneID:8205038"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR015374"
                     /db_xref="UniProtKB/TrEMBL:C5DX38"
                     /translation="MSFLFKSKSRKKPTLAKDLQKNGASGFFPEDQVMESNGEDANVN
                     TYNGSNAYNLIEFPRILERRFGESLGNRTRMLSELVASDKLGLGPPDMVHATLYDKFH
                     KEEIGEYFFITGVDLSSGSMPIAFLNMLKLNQMENQASREGQISTYCCVNIFRQLDIR
                     IRYESDKNFQINAVDCQNGTSTVQLSDAIWEETFVSACMRSFLTNVDVERKLPGLVEY
                     PFAIAQGSTTNCKRAITSLCKFLPRLVECGWDSTKSVHPTVLHNNLTETLLILISVAP
                     DLIAFTLQLLEKLGQDDPSNKVYYDIVKVAVMRVHGEKELEMIALIEKILSSLFPRLH
                     HTPPKDSDSLHLVNCITDLLNLQAKFLLERGDNELALAISKFSTELSSDTFDSWYNLA
                     QSYIQLEQYDKALVAINCMPRLADSDKYKMALWNQPTLVDYYKRPLGGAQSRCDLSTN
                     EINNLSSTMKNQKESELLELVYGRIVMANESGRGCIKELWEKSCVDLGPIYGPQAHNL
                     INFVSPQEVKLVADINLLARNTVAKSPSWFEEQVCDLLMALAARIGWNGLLQLRSQLF
                     VMEKEYSGDAQTDLNSSGNAPPEIRRKRLCERWLDQLFLDLYEDLRISALSQEHRDVK
                     YSGLEWELLGIILLRTWNLHDAVACLRTSIMARFDPVSCHKLLQLYMKQDFYNNLTLD
                     PDLVLELVTMQIAYQSRFYDSFQVPSLLVLYRLSDYIDPDTIRNRIMALPFAERGILA
                     MVDSMINWIKQMTKDTPDDGTDAIANV"
     gene            <163993..>164334
                     /locus_tag="ZYRO0F02002g"
                     /db_xref="GeneID:8205039"
     mRNA            <163993..>164334
                     /locus_tag="ZYRO0F02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497238.1"
                     /db_xref="GeneID:8205039"
     CDS             163993..164334
                     /locus_tag="ZYRO0F02002g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497283.1"
                     /db_xref="GeneID:8205039"
                     /db_xref="UniProtKB/TrEMBL:C5DX39"
                     /translation="MRLNKVDAARDKSKSFRPVYPYSHNEERISLGDQSGSSGNNNDE
                     NYMNHNEKISQWIESLPIFETSNYELKSYCYYSDFAPNWEEVKLEDQLREEMSAPMSD
                     EILHLSSNKTR"
     gene            complement(<164578..>165376)
                     /locus_tag="ZYRO0F02024g"
                     /db_xref="GeneID:8205040"
     mRNA            complement(join(<164578..164757,165374..>165376))
                     /locus_tag="ZYRO0F02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497239.1"
                     /db_xref="GeneID:8205040"
     CDS             complement(join(164578..164757,165374..165376))
                     /locus_tag="ZYRO0F02024g"
                     /note="some similarities with uniprot|P43550 Saccharomyces
                     cerevisiae YFL053W DAK2 Dihydroxyacetone kinase, required
                     for detoxification of dihydroxyacetone (DHA); involved in
                     stress adaptation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497284.1"
                     /db_xref="GeneID:8205040"
                     /db_xref="UniProtKB/TrEMBL:C5DX40"
                     /translation="MFALEFLYQYARTRSTFKTLIDALQSFVEASNNGAREGAGKTRQ
                     IDPLVESGSYSVKREL"
     gene            <165836..>166066
                     /locus_tag="ZYRO0F02046g"
                     /db_xref="GeneID:8205041"
     mRNA            <165836..>166066
                     /locus_tag="ZYRO0F02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497240.1"
                     /db_xref="GeneID:8205041"
     CDS             165836..166066
                     /locus_tag="ZYRO0F02046g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497285.1"
                     /db_xref="GeneID:8205041"
                     /db_xref="UniProtKB/TrEMBL:C5DX41"
                     /translation="MQSYPSFENLICNSIDLTFYEGPGMKKALLRSQLALASQCELVT
                     CICNEISECDPMKRASGNKLIYWKGLKFSSFF"
     gene            complement(<167567..>168073)
                     /locus_tag="ZYRO0F02068g"
                     /db_xref="GeneID:8205042"
     mRNA            complement(<167567..>168073)
                     /locus_tag="ZYRO0F02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497241.1"
                     /db_xref="GeneID:8205042"
     CDS             complement(167567..168073)
                     /locus_tag="ZYRO0F02068g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497286.1"
                     /db_xref="GeneID:8205042"
                     /db_xref="GOA:C5DX42"
                     /db_xref="InterPro:IPR001424"
                     /db_xref="UniProtKB/TrEMBL:C5DX42"
                     /translation="MRLTSTLIYLLGFALCVFAAAAPEVEDSPKKAKYVAKFDKKVKG
                     FIKFKSTPEGEVKVNVKLHDLPKEGGPFLYHVHEKPVPSNGSCDATLGHLNPYNGSLN
                     ATKPAYKEVGDLSGKHGKITSSPFDTSYVDPYLSLNMSDPAFIGNRSIVIHYANNTRF
                     ACSNITRN"
     gene            complement(<169045..>170850)
                     /locus_tag="ZYRO0F02090g"
                     /db_xref="GeneID:8205043"
     mRNA            complement(<169045..>170850)
                     /locus_tag="ZYRO0F02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497242.1"
                     /db_xref="GeneID:8205043"
     CDS             complement(169045..170850)
                     /locus_tag="ZYRO0F02090g"
                     /note="similar to uniprot|Q07824 Saccharomyces cerevisiae
                     YLL028W TPO1 Proton-motive-force- dependent multidrug
                     transporter of the major facilitator superfamily able to
                     transport eight different compounds including polyamines
                     quinidine cycloheximide and nystatin involved in excess
                     spermidine detoxification"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497287.1"
                     /db_xref="GeneID:8205043"
                     /db_xref="GOA:C5DX43"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DX43"
                     /translation="MAKIDSAADTDWSKAPPQRRLGRVCGGKYLEDYQMDESSPEALE
                     RPLIKVECDVPLTYTESIEKDGKEWVMLTYAPGDKENPFNWSSKRKWFYTWVLNLMTL
                     MIGLGNTVYNSTISGMCKDLHRSTEIGQLGLFVFNQTSGVLPLFLAPFCELVGRKVVY
                     TAGFIGFCLTFIGLALGRNMATILVLRTLQGGCGSIGTILVGGTFDDMFIPEERAIPM
                     ALFSHIAIFGTMAAPIYAGFADQAIGWRWVEGIQGLANIPLLIIVVLFFKETRGGVFL
                     QQRAKILRKDTGDERWVAKEELEAPELKDALYNSSVKAIGMLLSEPVVFFFGMWIAFT
                     WFITFLFLSVITITFSEQKHWSEGIAGLPYISLCIGVTLGFFLNFLQIRKYDKIRSKA
                     TGAIAPEHRLYGAMAGGIFLPIGLFIYSFTQYHWLHWIGPNIGLVCIAFGIFFIFESC
                     YSYTSDCYGPSASSAIAGQSYLRNELGAVAPLFAAQMFRGMHSEWAGLLCSLVGTGLS
                     LLPFILFKFGPSIRGKSKRAIVYEDHMVSSDESDDSNSNIGFADKDYKDDGGLFDDGE
                     PSKSSQSRLTNDDDHDNAHIEDAHAVNSRAMTNVH"
     gene            complement(<171872..>172711)
                     /locus_tag="ZYRO0F02112g"
                     /db_xref="GeneID:8205044"
     mRNA            complement(<171872..>172711)
                     /locus_tag="ZYRO0F02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497243.1"
                     /db_xref="GeneID:8205044"
     CDS             complement(171872..172711)
                     /locus_tag="ZYRO0F02112g"
                     /note="weakly similar to uniprot|Q08909 Saccharomyces
                     cerevisiae YOR385W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497288.1"
                     /db_xref="GeneID:8205044"
                     /db_xref="UniProtKB/TrEMBL:C5DX44"
                     /translation="MESEPLSLPSYNDVYNSDVSKSELAQKLPPPYHVNSQRKRTMPI
                     VHSIGERGPRLFLSEESLNKYRHTNFHEQYLVNLQNAGIPLFQFLKTSRFKRMIGKSS
                     FVINKYLLQKLETGVGDEKPILTDGTYGLYKIPFCWIFRKKKGGKTTYTFRYSEGTNV
                     SEHELIEDHNEYSGMLNGDEFRYASPDGNFDKLLLILGSNAVSGLYTREDCDYLMVKH
                     SKLAHIILSESPGDQISTTTLLLACQGLLINHLVRNHFFQGTVANRPPPRSAVWDPLW
                     QDQ"
     gene            complement(<172837..>173763)
                     /locus_tag="ZYRO0F02134g"
                     /db_xref="GeneID:8205045"
     mRNA            complement(<172837..>173763)
                     /locus_tag="ZYRO0F02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497244.1"
                     /db_xref="GeneID:8205045"
     CDS             complement(172837..173763)
                     /locus_tag="ZYRO0F02134g"
                     /note="weakly similar to uniprot|Q08909 Saccharomyces
                     cerevisiae YOR385W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497289.1"
                     /db_xref="GeneID:8205045"
                     /db_xref="UniProtKB/TrEMBL:C5DX45"
                     /translation="MEKFESLGAEKTPISPQVQTSVSPNANIRTMPIIVPANFSSPVF
                     LFSSVDSCAIYQQKDYKKCVLNSEGIGIPLFETRFRNFNKGFVSVDKYVLLNVKDPPP
                     KAPYRIKKQDGNLILYKVEYCKAYLCDHKNYSAWEVAFSAPLSHVGKYDFIQDMGTRP
                     EFFGTADGFDLSWKAFGSIAWGGRELFANYDDIHRLITYDSLPDSEPRDDNCKGKPLS
                     PQGIYSRNWKSSKLKDSCSMLSFLEPGDASGLGIRSVPPVTEFLSIHGILLHFHIVSL
                     IQEEERRARAARNAAGSGSAAGAWTASFGGGF"
     gene            complement(<174860..>175801)
                     /locus_tag="ZYRO0F02156g"
                     /db_xref="GeneID:8205046"
     mRNA            complement(<174860..>175801)
                     /locus_tag="ZYRO0F02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497245.1"
                     /db_xref="GeneID:8205046"
     CDS             complement(174860..175801)
                     /locus_tag="ZYRO0F02156g"
                     /note="weakly similar to uniprot|Q08909 Saccharomyces
                     cerevisiae YOR385W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497290.1"
                     /db_xref="GeneID:8205046"
                     /db_xref="UniProtKB/TrEMBL:C5DX46"
                     /translation="MEMNAYPGDEKLPVSPQVQTPLSSNLNIRTMPIIPANFSSSFFL
                     FSSIDSYARYNDQDYKKCELDPEGMGIPLFQVRFRSFKKESMLIEKYVLLDASDSPPK
                     APYRIKKQDGNLILYKVEYCKVYLRYYSNYSAWEVVFLDPLTRLGKYEFLHNVGTKLS
                     FCGTADGFDLSWRAIDSSVWGEHELFANYDDIHRLVTYDSLPDSEPRDENCKNKPLSP
                     RGIYLRNWKSSKLRNSCNILSFLEPGDASGLGIRSVPPVTEFLSIHGILLHCRIVALI
                     QEAQSREAAERRRRAMNSSMNMSMASAGAMAGSGCCC"
     gene            <176789..>178576
                     /locus_tag="ZYRO0F02178g"
                     /db_xref="GeneID:8205047"
     mRNA            <176789..>178576
                     /locus_tag="ZYRO0F02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497246.1"
                     /db_xref="GeneID:8205047"
     CDS             176789..178576
                     /locus_tag="ZYRO0F02178g"
                     /note="similar to gnl|GLV|DEHA0A14894g Debaryomyces
                     hansenii DEHA0A14894g and weakly similar to YLL028W
                     uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
                     Proton- motive-force-dependent multidrug transporter of
                     the major facilitator superfamily able to transport eight
                     different compounds including polyamines quinidine
                     cycloheximide and nystatin involved in excess spermidine
                     detoxification"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497291.1"
                     /db_xref="GeneID:8205047"
                     /db_xref="GOA:C5DX47"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DX47"
                     /translation="MPSISSESDDLAKNEHEHIEDSNHYYESDNSPYKKSTEDEAVAN
                     TATFGTNSERDTTDPSTDLGKRGKRRKSLVSTQESITHVSPYEQDPDPEKHILQEWDC
                     YDQLGYSLPVWRKWSVIAVIGVCQLSMNFNTSVYPHAISLISEDFHISKQAANTSQMI
                     FLVAYAFGCELWAPWSEEYGRWIVMQCSLFSSNVWQILGGLAPNFGSIIVARFLGGIS
                     LAGGSVTLGVAADMWDPADHGYAVAFVVLCSVGGTVIGPIFGGLMEEHLSWHWNFWIQ
                     LIFNGVTQVLHFFIVPETRSTVIMDRSAKKMRKSGRDPHVYGPGEVKAFSVKELLKTW
                     IRPFHMFVCEPIVLFCSLLSGFADHLIFICNQAFGPIFEQWNFSTTAQGLTFITLVIA
                     YLIGYMLHLIDIRQQRKIMDKMLHSSRGPERRLLLLLFLAPLLSLGLFGFAWTTMGPR
                     YTPWIAPAIFSTVIGIGNYSIYMATIDYMVSAYGPYSASATGGNGFARDLLAGIAAMY
                     ATPLYNNIGGKFHYQWASTLLGCLGVLCTIPIYIFYWKGPTIRKRSKFAQALSEEFEE
                     ERRREHKYQQKEQEECANSTTSGNGVEDV"
     gene            <178997..>180142
                     /locus_tag="ZYRO0F02200g"
                     /db_xref="GeneID:8205048"
     mRNA            <178997..>180142
                     /locus_tag="ZYRO0F02200g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497247.1"
                     /db_xref="GeneID:8205048"
     CDS             178997..180142
                     /locus_tag="ZYRO0F02200g"
                     /note="similar to uniprot|P32804 Saccharomyces cerevisiae
                     YGL255W ZRT1 High-affinity zinc transporter of the plasma
                     membrane responsible for the majority of zinc uptake
                     transcription is induced under low-zinc conditions by the
                     Zap1p transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497292.1"
                     /db_xref="GeneID:8205048"
                     /db_xref="GOA:C5DX48"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="UniProtKB/TrEMBL:C5DX48"
                     /translation="MEHSHIHSEPWWTKWSPENVTIADDSVSEAWKYCTLQGVYFGEN
                     EYNGNLGARISSIFVILVTSSALTLFPLIAKKVSWLRVHKYVYLFARSFGTGVILATA
                     FIHLMDPAYQEIGGFSCVAQVGNWSLYSWCPAIMLTTVYFTFLVDLFGGVYVERKYGI
                     AHSEDHDHAMDAVIAPHVHDDSHLHNMNKETVDDSSLSKKDSVDVSVRSSQDTLEKVI
                     SFKSEFSAFLVLEFGVLFHSVMIGLNLGTTGDEFSTLYPVLVFHQAFEGLGIGARLSA
                     IDFPHNKRWWPYVLCMAYGLTTPIAIAIGLGVRKSYQSNSYAVNVVSGVLDAISAGIL
                     LYTGLVELLARDFLFNRQRAKTLRELIFNLFCLSWGVGLMALLGKWA"
     gene            <180280..>181380
                     /locus_tag="ZYRO0F02222g"
                     /db_xref="GeneID:8205049"
     mRNA            <180280..>181380
                     /locus_tag="ZYRO0F02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497248.1"
                     /db_xref="GeneID:8205049"
     CDS             180280..181380
                     /locus_tag="ZYRO0F02222g"
                     /note="similar to uniprot|Q03102 Saccharomyces cerevisiae
                     YML131W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497293.1"
                     /db_xref="GeneID:8205049"
                     /db_xref="GOA:C5DX49"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DX49"
                     /translation="MVQAKQWVLKTTPVPGETFNFNPNESTSTFQLATRELSPEQLQD
                     GEVLVEVILLSNDPAQKFWIASVDKNYARPIEPGEDIPARGVGKVIASKNNSYEVGDY
                     VSGKLCWNTHVIVSDAPEYGLRKLPATAEDKLWYHLSVLGSTALTAYFIFFHYAGLRE
                     RQEDYDKTFLVSGAAGAVGTVSVQLALNVFNAKKVIAIAGGPEKVKFVESFDPKRVIG
                     VDYKSPTFEQDLLKAAGGDKNIDYFVDNVGGPILDAGARLLKTHATIVACGGISGYND
                     REKFVFKSYGTVITKRLTIKGVLVTDLMDKFPEAVRSLKSFIDSGKLSTKDAATFKDA
                     TGDKFEDIPLIWNGLFHGTNKGKLISIVRSPQ"
     gene            <181671..>183341
                     /locus_tag="ZYRO0F02244g"
                     /db_xref="GeneID:8205050"
     mRNA            <181671..>183341
                     /locus_tag="ZYRO0F02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497249.1"
                     /db_xref="GeneID:8205050"
     CDS             181671..183341
                     /locus_tag="ZYRO0F02244g"
                     /note="similar to uniprot|P43554 Saccharomyces cerevisiae
                     YFL049W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497294.1"
                     /db_xref="GeneID:8205050"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:C5DX50"
                     /translation="MSSSEGEAIIVDKNALLRHERQLLKQLVLISSEDELLQGPLDQF
                     PLKQIDIPDYTGEKKRDELNLDYVMIKHDLQGEKRISGQGQLYDGRTWLFNTFRFGGN
                     SKESNHWFVLVSDLMKSLLYEGDEESFIKEYSELLPLEANEQQRAFLKERKLLNHDTS
                     SQQPIRFYTTRSVFVRFGAAVILGGLRVFDDYWESLAREKNLTPHHRVFKLDKKLLTI
                     LQKLKPSLFMRLNSSNENEDDDLDNRPWNGELFETPYPTITEQASAEIRDEYGRQFAE
                     GQHTGAVVPGQSINGSLELSSQFKLPKYHSKNSFQQAAQSNALDVAIGGSPETPVNHA
                     GSHLSSSVSNMEVYTSSGPPTSTKSGGKRLLSNIMDTNISSAKGKKSEEHELISAGNG
                     LVPTNVHLNVNGWKFETLPLRILGNEPEFSARGLPFYEKDKILDRLKKLSPNQIKELE
                     HLHDSVTLNKGLQSVRKIRSKKWTKYWQYKAGLPVGILKHDVEKSRDRYLRDVLNQKT
                     SNTIYNDATLIDEVQITSRAPNANFFNNSNIKGFKPPYAPPVRKEHKK"
     gene            complement(<183515..>184780)
                     /locus_tag="ZYRO0F02266g"
                     /db_xref="GeneID:8205051"
     mRNA            complement(<183515..>184780)
                     /locus_tag="ZYRO0F02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497250.1"
                     /db_xref="GeneID:8205051"
     CDS             complement(183515..184780)
                     /locus_tag="ZYRO0F02266g"
                     /note="similar to uniprot|P43555 Saccharomyces cerevisiae
                     YFL048C EMP47 Integral membrane component of endoplasmic
                     reticulum-derived COPII-coated vesicles which function in
                     ER to Golgi transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497295.1"
                     /db_xref="GeneID:8205051"
                     /db_xref="GOA:C5DX51"
                     /db_xref="InterPro:IPR005052"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DX51"
                     /translation="MKLTHIVSNALLLIGSVVNAHGSESSKNDNEKLNADISLPDLLS
                     VNKLPSNWIVGEDANLEQGRMVLTPNKASKGSLWQRNNYKLKNGFTVEWTFRSVEFSG
                     KSEGGLAFWIVNPASYKNNDKKLYDGPSKFDGLQLLVDNNGKLGSSISAQFSDGSVAL
                     KKQDIYDKSFASCLMGYQQSSVPSTARLTYSREDDNLLKLQIDNRVCFQTRKAQFPQG
                     DYMIGVTADNAQTTESFEILKMQFYDGVIQDSLIPNVHSMAQPRVYTKVVDKNTGQET
                     LLEKEAFDAQSDKFSNYDLFKKLDRLEGKVLANDIVSLDKKLDEILSVQEELIKYVAQ
                     LVMQKQDSEGGSENFADFISMNEKLEKMLREQEKVRETTRSSSQAGPHVDEIASKLAV
                     WLLPLMVIMLIMAYYTFRIRQEIVKTKLL"
     gene            complement(<185044..>185418)
                     /locus_tag="ZYRO0F02288g"
                     /db_xref="GeneID:8205052"
     mRNA            complement(<185044..>185418)
                     /locus_tag="ZYRO0F02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497251.1"
                     /db_xref="GeneID:8205052"
     CDS             complement(185044..185418)
                     /locus_tag="ZYRO0F02288g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497296.1"
                     /db_xref="GeneID:8205052"
                     /db_xref="GOA:C5DX52"
                     /db_xref="InterPro:IPR011893"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DX52"
                     /translation="MPFPKVSIVFCIKCKWNLRSSWYMQELLQTFGDQLGEVSLIPGP
                     QGQFKILGQEKEDGEEIIIWDRSVEGGFPDSKCLKQRVKALLFHDEVSIGKHNEKNSK
                     VGSSQSELLRSNETCGSDCKDC"
     gene            <185567..>187726
                     /locus_tag="ZYRO0F02310g"
                     /db_xref="GeneID:8205053"
     mRNA            <185567..>187726
                     /locus_tag="ZYRO0F02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497252.1"
                     /db_xref="GeneID:8205053"
     CDS             185567..187726
                     /locus_tag="ZYRO0F02310g"
                     /note="similar to uniprot|P43556 Saccharomyces cerevisiae
                     YFL047W RGD2 GTPase-activating protein (RhoGAP) for Cdc42p
                     and Rho5p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497297.1"
                     /db_xref="GeneID:8205053"
                     /db_xref="GOA:C5DX53"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR000591"
                     /db_xref="InterPro:IPR001060"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5DX53"
                     /translation="MPLFADSFWSDDLDSGLKVLFEKLHQGCGQCDLFIQLFASRMQF
                     EVNYGRQLGGIKQGVDDLDKFADDPEATILSALHGIIENTSLEGNQHLMVASNIEQLV
                     LTPFSKWCHDHRKRVEYSEKILKTNVSNFDKSRSYVSKLEREYFNRCRQLEDFKKANY
                     ANDDELIKAMESLKLLQKYEKDVAREKEYQKFATVGNIDFDYKSMREVLQLLLTKLPK
                     YNYTVPFINYTLENTNSGSDITRFLLENMSLKDLDHAEVFGQDLMNLGFLKYCNGVGN
                     TFVNSKKFQYQWKSYSYRFVDIPQSADENDSTALPLEPRLSAYIQDFNLNLPSSATTD
                     SGEDTSTGETTVVEPETGESDKNLFKLMKEVELADKKYYRECLKMDTLRCSVEELLVD
                     HLTFMERCELDRLKAVKKATFDFCATVSNKISSLKISVDNMIQKEDSMDPNADLLHFL
                     MKYRTGYFQPHVITYNNYYNPGAFQNFGIDLETRCRLDKKVVPSIASVILSYMDQVYP
                     ELPSDKVRISVWTAPVKLNLSHQLRNLLNRRQFKDDAEIMEVIKESNSDASTVASVLK
                     IYLLELPEPLVSDDIYDVLKMLYAKYTIHPTTEEDSQNSQTEEELQEMESNKIRGLYT
                     TLSSLPKPHIATLDAITTHFCRLIKILKMGENGQEIASEFTHSISQEFANCIIKVRVS
                     DGNDLGYRIFYDLLTHKKEIFGVLKRQGSRAKSENSN"
     gene            complement(<187805..>188668)
                     /locus_tag="ZYRO0F02332g"
                     /db_xref="GeneID:8205054"
     mRNA            complement(<187805..>188668)
                     /locus_tag="ZYRO0F02332g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497253.1"
                     /db_xref="GeneID:8205054"
     CDS             complement(187805..188668)
                     /locus_tag="ZYRO0F02332g"
                     /note="weakly similar to uniprot|P38634 Saccharomyces
                     cerevisiae YLR079W SIC1 P40 inhibitor of Cdc28p-Clb5p
                     protein kinase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497298.1"
                     /db_xref="GeneID:8205054"
                     /db_xref="UniProtKB/TrEMBL:C5DX54"
                     /translation="MTPATPPRSRERRSSMVNDRELPHFETGSAPPETPHRSLQSRGP
                     VTPSTTTTKSHKELSAPYLFPPRERSPFKGFQSPEFTPFRELKEQQEQDEQFPPQELQ
                     KVSRVLFPKSSKDEIGEDPSPSKLELLPPTRPTSSRSRKFSSESPTEYKNESFKQAKQ
                     VPGTPSDKLTNFELAKKWYNNSDNDDNYDGDDDEDDEGLIRQVTPTNPFQSSSPVSEE
                     TRNSRKQSLLKSNPDVEDVITYLNKDGAVARRHRLSSAEKEAFKPKRLFAKELQELES
                     GNEAAEGSNRN"
     gene            <189525..>189995
                     /locus_tag="ZYRO0F02354g"
                     /db_xref="GeneID:8205055"
     mRNA            <189525..>189995
                     /locus_tag="ZYRO0F02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497254.1"
                     /db_xref="GeneID:8205055"
     CDS             189525..189995
                     /locus_tag="ZYRO0F02354g"
                     /note="similar to uniprot|P25385 Saccharomyces cerevisiae
                     YLR078C BOS1 v-SNARE (vesicle specific SNAP receptor)
                     localized to the endoplasmic reticulum membrane and
                     necessary for vesicular transport from the ER to the
                     Golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497299.1"
                     /db_xref="GeneID:8205055"
                     /db_xref="UniProtKB/TrEMBL:C5DX55"
                     /translation="MFSAKFKELKQQYHSSDARKQLFASEDSPFNGDSVVSRRNVMGQ
                     SSGSQAQEFSGNENDSLPLYHGLEKEQSAFQRGNAQLEMILEMGYQSLDDIVEQNQIL
                     QKMQDKMTRSLTTLGVSQGTISNVNRRLFKDKLIFWIALVLMFLGMYMLVKWLR"
     gene            complement(<190022..>191770)
                     /locus_tag="ZYRO0F02376g"
                     /db_xref="GeneID:8205056"
     mRNA            complement(<190022..>191770)
                     /locus_tag="ZYRO0F02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497255.1"
                     /db_xref="GeneID:8205056"
     CDS             complement(190022..191770)
                     /locus_tag="ZYRO0F02376g"
                     /note="similar to uniprot|Q7LI62 Saccharomyces cerevisiae
                     YLR077W FMP25 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497300.1"
                     /db_xref="GeneID:8205056"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="InterPro:IPR009091"
                     /db_xref="UniProtKB/TrEMBL:C5DX56"
                     /translation="MMLRRSLLGCGNRLTLRIPSLRNFSSCTRLYKNSEQIDEAELWA
                     PNLTSQPYKAKKSSKEEFQWPDQSEEQAQRAHEIRVEKLMRLSAVFQGLLILLGVGAA
                     TTTYMKWPQIKSWWVTKDDYKVDDNTIERLVKSKTKKSMDEIAVISDANFGPEVSGLY
                     LAGSNEIAGKNKAGYILPKRIPLFDHKVLRDVCLSDEPNGKENLAIDERGDLLKWSQD
                     AISTILPDQNLVKVKLSNNVAYALNKKGEILVIPVKDPSSLTKHVEHKRSWVLPWKTY
                     CSYDWKLDTKDSFKAKGENKIIQFDTGKHHLALVSNKGNAYSCATGIKSKPQDRSHSY
                     GQFGVPTLSQFDEFPPCNKLYEIELLNRALDSNNSVYKRDILQVACGDYHTLARDAEG
                     KLFGFGINKNGQLGLPISYDNEQIPFPKIISRFGSYFGRDSKFKCVDINCSTQTSFVT
                     LETSDDNGKKDVFYFSFGDGLNGELGNGNYKNCQPEPAPIKSIDSPVKEWSCGGHHIW
                     CKLADGQVLVWGFNERGQLGTGKRIKVNRPQPIPGLLKPGDQLQPDQLYRTKLFLQPQ
                     QSVAAGETSTCIYWKK"
     gene            <191880..>192527
                     /locus_tag="ZYRO0F02398g"
                     /db_xref="GeneID:8205057"
     mRNA            <191880..>192527
                     /locus_tag="ZYRO0F02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497256.1"
                     /db_xref="GeneID:8205057"
     CDS             191880..192527
                     /locus_tag="ZYRO0F02398g"
                     /note="highly similar to uniprot|P43557 Saccharomyces
                     cerevisiae YFL046W FMP32 The authentic non-tagged protein
                     was localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497301.1"
                     /db_xref="GeneID:8205057"
                     /db_xref="InterPro:IPR012439"
                     /db_xref="InterPro:IPR024461"
                     /db_xref="UniProtKB/TrEMBL:C5DX57"
                     /translation="MSGTSFTRMSLMKFVGLNSRRAFHATSKRLTDFETVHIQNTNRY
                     KQLLMEKGKFEESQANAIVNLMSDALRGGISHVSQDLAKRERLTQLTYQQRVDFAKLR
                     DQLLTADRSEFHNLQNDYERVRKDLDKLKNKVKEEITKANASFKLDLSLEKGRIREES
                     SHHDMQIKEIDTRIDKEITNMRMQIDSVKTQVMQWLIGVCTGTFALVLAYVRLLS"
     gene            complement(<192620..>193387)
                     /locus_tag="ZYRO0F02420g"
                     /db_xref="GeneID:8205058"
     mRNA            complement(<192620..>193387)
                     /locus_tag="ZYRO0F02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497257.1"
                     /db_xref="GeneID:8205058"
     CDS             complement(192620..193387)
                     /locus_tag="ZYRO0F02420g"
                     /note="highly similar to uniprot|P07283 Saccharomyces
                     cerevisiae YFL045C SEC53 involved in synthesis of
                     GDP-mannose and dolichol-phosphate-mannose required for
                     protein assembly in endoplasmic reticulum
                     phosphomannomutase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497302.1"
                     /db_xref="GeneID:8205058"
                     /db_xref="GOA:C5DX58"
                     /db_xref="InterPro:IPR005002"
                     /db_xref="InterPro:IPR006379"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DX58"
                     /translation="MVDIPEFAHKEKPDTLVLFDVDGTLTPARLHVSDEVIDVLQQLR
                     KKVCVGFVGGSDLSKQKEQLGDDVLQNFDYAFSENGLTAYRLGKEMATQSFINWIGEE
                     KYNKLAVFILGYLSKIDLPRRRGTFLEFRNGMINVSPVGRNASTSERNEFEAYDKEHQ
                     IRAKFVEALKKEFPDLGLTYSIGGQISFDVFPTGWDKTYCLQHVEKDGFKEIHFFGDK
                     TYKGGNDWEIYEDPRTIGHSVTSPDDTVRILKEIFKF"
     gene            complement(<193772..>194443)
                     /locus_tag="ZYRO0F02442g"
                     /db_xref="GeneID:8205059"
     mRNA            complement(<193772..>194443)
                     /locus_tag="ZYRO0F02442g"
                     /product="60S ribosomal protein L10"
                     /transcript_id="XM_002497258.1"
                     /db_xref="GeneID:8205059"
     CDS             complement(193772..194443)
                     /locus_tag="ZYRO0F02442g"
                     /note="highly similar to uniprot|P41805 Saccharomyces
                     cerevisiae YLR075W"
                     /codon_start=1
                     /product="60S ribosomal protein L10"
                     /protein_id="XP_002497303.1"
                     /db_xref="GeneID:8205059"
                     /db_xref="GOA:C5DX59"
                     /db_xref="InterPro:IPR001197"
                     /db_xref="InterPro:IPR016180"
                     /db_xref="InterPro:IPR018255"
                     /db_xref="UniProtKB/TrEMBL:C5DX59"
                     /translation="MARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVD
                     EFPLCVHLVSNELEQLSSEALEAARICANKYITKMSGRDAFHLRVRVHPFHVLRINKM
                     LSCAGADRLQQGMRNAWGKPHGLAARVAIGQILFSVRTRDNNKDIVIEGLRRSRYKFP
                     GQQKIILSKKWGFTPLDRDEYLKRRQAGEVKDDGAYVKFLTNKGSLENNFNNFPDYFL
                     SRTQV"
     gene            <194856..>195347
                     /locus_tag="ZYRO0F02464g"
                     /db_xref="GeneID:8205060"
     mRNA            <194856..>195347
                     /locus_tag="ZYRO0F02464g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497259.1"
                     /db_xref="GeneID:8205060"
     CDS             194856..195347
                     /locus_tag="ZYRO0F02464g"
                     /note="similar to uniprot|Q08004 Saccharomyces cerevisiae
                     YLR074C BUD20 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497304.1"
                     /db_xref="GeneID:8205060"
                     /db_xref="GOA:C5DX60"
                     /db_xref="InterPro:IPR003604"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:C5DX60"
                     /translation="MGRYCVKRYKTKRRTKDLDIIFNELSSKDKIQQLLNQPLDETKP
                     GLGQHYCIHCAKYMESAIALKTHLKSKVHRRRVKDLKSMPYTQEVADAANGVNLNKFL
                     DRVEQLKNKTIPEKSENEQLLSGHLEEALAHAKTTEPTLPWAGDDKEQEVKDKDNDEV
                     FMG"
     gene            complement(<195440..>196372)
                     /locus_tag="ZYRO0F02486g"
                     /db_xref="GeneID:8205061"
     mRNA            complement(<195440..>196372)
                     /locus_tag="ZYRO0F02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497260.1"
                     /db_xref="GeneID:8205061"
     CDS             complement(195440..196372)
                     /locus_tag="ZYRO0F02486g"
                     /note="similar to uniprot|P43558 Saccharomyces cerevisiae
                     YFL044C YOD1 Yeast OTU Deubiquitinating enzyme 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497305.1"
                     /db_xref="GeneID:8205061"
                     /db_xref="InterPro:IPR003323"
                     /db_xref="UniProtKB/TrEMBL:C5DX61"
                     /translation="MRLKLSGGNGYNKVVSIDNDATLERLILASEAPLPVAGIRYGYP
                     PQRVDNNQEASQSKLDSLGISSGEKITLIFQDEGNKSKSVTEAPPSSQPSNDQLSPNK
                     CKISLPTGEETVLQVRQIPDDNSCLFHSLSYCVYKDISLSPTLRTVCSDRIRNDKVLY
                     SDAVLDRPNEEYAQWILRKDSWGGGIEIAILSKNFGVAVYVLDMDAQKFEKFNEDQFD
                     QFVIVMFNGVHYDSLELVNQRTVFDRRDEIFSEAVLEAALEIAKQLKKGGHSFNTRRD
                     RIICNTCKTILVGERDVARHAESTGHVDFGQAKN"
     gene            complement(<196719..>199166)
                     /locus_tag="ZYRO0F02508g"
                     /db_xref="GeneID:8205062"
     mRNA            complement(<196719..>199166)
                     /locus_tag="ZYRO0F02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497261.1"
                     /db_xref="GeneID:8205062"
     CDS             complement(196719..199166)
                     /locus_tag="ZYRO0F02508g"
                     /note="similar to uniprot|P43560 Saccharomyces cerevisiae
                     YFL042C Due to a sequence change (deletion of G at 46151)
                     YFL043C is now part of YFL042C."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497306.1"
                     /db_xref="GeneID:8205062"
                     /db_xref="InterPro:IPR004182"
                     /db_xref="UniProtKB/TrEMBL:C5DX62"
                     /translation="MSLLPNVDLRGSSGSGNGNGNNVEDADATLRRRSSNTNNHSDLM
                     TVGSSNGSNGSSVRHRHGKSSSSLDVTAPVNLKSTPADPHLSDVNSVSSNTSVSDNTT
                     ALGSVNDIIERNTVERNHDKEVQAPKSGDTSDKNGTSNAVANGNGNSNTRFLENMISS
                     FSFKSTPQNPPPLQTQVNNSQPEEISSPNIISHRRQVSSQKKNGKKATSPVLGPGSPT
                     FSPASEAEKPKEIPGKTQLEEFHNYDDTKFVDETYLDTPFHYAVMERNAEFHTLFKDV
                     SKDDRLLDDFSCALSREFLYQGRMYISESHVCFYSSLLGWIAKVVIPFKDITFIEKTS
                     TAGLFQNAVSIETATGKTQFNGFISRDIAFTLLKEVWARTLLAEGEKQSAQEKRRSAS
                     SSFSQDQHFPLDSRSFSESRRPSGPPSRASYISENDALIEDAIRSVDDVTPTHSEEEA
                     DGELRNASVTLEEDEDDSAFENESETKSATVSNGSKLSKTARCYKFKPEIHYSYDGPL
                     RGTPTKYKYSPEDNNEFVLAEVELNAPPGIVFQLLFGSNPSFWIEFFISQDSSKFTDF
                     GEFDKVDEDGKKYREFNYAKGLHFPVGPKSTKCVVSEKILDCDYSSFIHVLNTTRTPD
                     VPSGGSFSTKTRYMFKWASKTTCMLKVSYFMDWTASSWIKSMVESGARSGQVSATKDL
                     VKLIHQYLDTYVTEGTVNVSASANKINKKSIKQQTPAAAVAAAASKPSPEARELKEAI
                     NKNTCQLDTSRHSTNQLLFIVIISLVLLIYNEVKLRGEIRELKTLFVQPSLDQNVLKD
                     TIKNQILAEIKQDVSNL"
     gene            <199554..>202718
                     /locus_tag="ZYRO0F02530g"
                     /db_xref="GeneID:8205063"
     mRNA            <199554..>202718
                     /locus_tag="ZYRO0F02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497262.1"
                     /db_xref="GeneID:8205063"
     CDS             199554..202718
                     /locus_tag="ZYRO0F02530g"
                     /note="similar to uniprot|P19263 Saccharomyces cerevisiae
                     YLR071C RGR1 Component of RNA polymerase II
                     holoenzyme/mediator complex affects chromatin structure
                     and transcriptional regulation of diverse genes required
                     for glucose repression HO repression RME1 repression and
                     sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497307.1"
                     /db_xref="GeneID:8205063"
                     /db_xref="GOA:C5DX63"
                     /db_xref="InterPro:IPR013947"
                     /db_xref="UniProtKB/TrEMBL:C5DX63"
                     /translation="MTTESDSVEMYGENGSNTTTAGAATAAVNGSIDTDDSKKGQMTN
                     GMTKDSKIGAATTGTKNLASQPPPAIPHVEINQVSFSLVMRNLTVFTIKEVSQFMKTN
                     VHVNPTEPSTTKKLQFLHMIIFLRNQYLKIYVLVKWCRTIKNNNFHMMIDLLNWFRIT
                     NAVVNNCIWAIKASLVGMANAKLPNVDLVTALEVLSLGRPNLPTHQFKLSGEGDDLYQ
                     LSGGMIKVPPKVVLQKLKDMNLSISIKIALMDVPDAFRNYSFKNGRIYIFVPDEYEIQ
                     LATTDYRASLFFVDMNFSFCKQTLPLDKLKLEKVINEILFKSVKPLVALHKFLRKYVL
                     TLKLYMIYLELVALEESGKFSGGHLVHRYDSKRSIISIRYWLHSKMGKKSKITIGVDR
                     RTENLILKWDNELALQSKRMPVVYTNILDNLESILDEIMFNHSHIIRANLLSKGVFFE
                     DEENLDVLLFQIPTTCISMAPVQLKIDLISGVFYFKNPTPLLLSYVSQINRAENADEL
                     ISVLQRLKRDKISQVLRNMFEKTGWVCSKVIKLDHPIATQVNTAESSNNNGPLSSPTS
                     LLQDDLFIRLPNWPANWYLILTVVSSNASCVVEKRIGKIVSIKGHWKLSYLGNSNVTS
                     AKLESMTYQKVLYLQKTILHRIVNHMIIDSLNQLKISNKISTGDMLSSLPDYVVHGAH
                     QDKANDDNDTNHENDYTSIIILELESFLEGSKALNNILESSMFMHIDYYNSEISLFGK
                     FKRDTTMIKCKCDELLIHFVPGESLAFYLSEKFTNLNMIVDYLIKFRQKLMQLVILTD
                     VVERLHKNFASDDFKIVALKPNEISFKYLKNNTDSQDCTISIVSNEQMVENLTVQLSP
                     SNPQHIIQPFIDNGHMDYHFIFNYLQFTSSLFTVLENIIKQQTNSGSYTMVSLGLHNV
                     CEYQLVYHNPEAGTKITLIIELKNVSHNGAKKVQFYIHFSDEEHISTKSMAYPLVHQV
                     RNQVFMLDPKDSPTNSNKNKKYQGAVRLVDGISCDPTNIEPILLEIHEILRMDSNVQV
                     NNPSPSSNGIQQQTSSAAKIPTAS"
     gene            <203037..>204092
                     /locus_tag="ZYRO0F02552g"
                     /db_xref="GeneID:8205064"
     mRNA            <203037..>204092
                     /locus_tag="ZYRO0F02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497263.1"
                     /db_xref="GeneID:8205064"
     CDS             203037..204092
                     /locus_tag="ZYRO0F02552g"
                     /note="similar to uniprot|Q07786 Saccharomyces cerevisiae
                     YDL246C SOR2 Protein of unknown function computational
                     analysis of large-scale protein-protein interaction data
                     suggests a possible role in fructose or mannose
                     metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497308.1"
                     /db_xref="GeneID:8205064"
                     /db_xref="GOA:C5DX64"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DX64"
                     /translation="MTKQDAIVLQKPGVITVDKRDVPEIKDPHYVKLHIKATGICGSD
                     VHYYTQGAIGQFVVKSPMVLGHESSGIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDET
                     MSGNYNLCPHMVFAATPPYDGTLTKYYLAPEDFVYKMPDHLSFEEGALAEPMSVGVHA
                     NKLAGTRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTV
                     SSSSDEERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKACKAGGHYVQVGMGKDDV
                     NFPISAVGSKEITFHGCFRYKKGDFADSVALLSSGRINGKPLISHRFAFDKAPEAYKF
                     NAEHGNEVVKTIITGPE"
     gene            <204383..>206275
                     /locus_tag="ZYRO0F02574g"
                     /db_xref="GeneID:8205065"
     mRNA            <204383..>206275
                     /locus_tag="ZYRO0F02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497264.1"
                     /db_xref="GeneID:8205065"
     CDS             204383..206275
                     /locus_tag="ZYRO0F02574g"
                     /note="similar to uniprot|P43561 Saccharomyces cerevisiae
                     YFL041W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497309.1"
                     /db_xref="GeneID:8205065"
                     /db_xref="GOA:C5DX65"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:C5DX65"
                     /translation="MLFVAVWLTTILSSAAFANARTHTFNFTAGWVNANPDGFKDKRM
                     IGFNGEWPVPDIHVNKGDRVELYLTNGIDKDIETSLHFHGLFHNTSYGNQNQMDGPVM
                     VTQCPILYGETYLYNFTVDDQVGTYWYHAHAGAQYGDGMRGAFVIHDPDEPFEYSKDL
                     VIQLSDLYRQPYYDVSDAFLSRYNPTGAEPIPQNVLFNNTLNATLDFKPGETYLLRFI
                     NSGLFVSQYIAIESHNMTIVEVDGVYVKPNTTDLIYVATGQRISVLVKAKENNPGRNF
                     ALMQIMDDSMLDVIPPDLQLQWTHQVAYDKGYDWPKTIDVGGLENAAEEFYLQPLDNR
                     ELYDDYDVQITFDVRMKNLGDGVKYAFFNNITYVDPKVPTLTTALTSGKLAKDPRIYG
                     DNINAYVFEKDEIVEIVVNNYDTGKHPFHLHGHNFQLVQKSPAFHEDENFPEEDQDKM
                     TVPYNESAPLMNFPSHPVTRDTILLEPNGHVVLRFKANNPGIWYFHCHVDWHLVQGLA
                     AVFIEDPETLQEREKLGSNYKQVCKAAGIKNEGNAAGHTDDWFNLEGLPRQPAPLPWG
                     FTAKGYVAFMVCTLAALWGIYTISDYGLSETIQNDQEVYNRLKEALNVDDAAISSVPT
                     DSANNQ"
     gene            <206502..>208811
                     /locus_tag="ZYRO0F02596g"
                     /db_xref="GeneID:8205066"
     mRNA            <206502..>208811
                     /locus_tag="ZYRO0F02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497265.1"
                     /db_xref="GeneID:8205066"
     CDS             206502..208811
                     /locus_tag="ZYRO0F02596g"
                     /note="highly similar to uniprot|P25039 Saccharomyces
                     cerevisiae YLR069C MEF1 mitochondrial elongation factor
                     G-like protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497310.1"
                     /db_xref="GeneID:8205066"
                     /db_xref="GOA:C5DX66"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR004540"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DX66"
                     /translation="MNLARSAGALRTGVYLTPRILGASCKSINLTHGVRLFHANKICR
                     DSYEEEKATLDEIHKLMKPQDFQVADKIRNIGISAHIDSGKTTFTERVLYYTGRIKAI
                     HEVRGRDNVGAKMDHMDLEREKGITIQSAATFCSWDKDNKNYHFNLIDTPGHIDFTIE
                     VERALRVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNIPRITFINKMDRMGANPFRAVD
                     QIHSKLKIPAAVLQVPIGLESDLEGVVDIINRVALYNKGEHGEELVPGPVPENLKDVV
                     EERRQILVETLADVDDEMAELFLEEQEPNVDQIKAAIRRATIARKFSPVLMGSALANT
                     GIQPVLDAVVDYLPNPSQVLNTALDVANNEAKVNLVPSVTKPFLGLAFKLEEGQYGQL
                     TYIRVYQGRLRKGTYITNVKSGKKIKVSRLVRMHSNDMEDVDEVGSGEICATFGIDCA
                     SGDTFCDGSVQYSMSSMYVPDAVVSLSVTPNSKDAGNFSKALNRFQKEDPTFRVKFDP
                     ESKQTIVSGMGELHLEIYVERMRREYNVECTTGKPQVSYRESVTIPAEFDYTHKKQSG
                     GAGQYGRVIGTLAPAPEGNSNSNSFETAIVGGRIPDKYLAACGKGFDEACEKGPLIGH
                     RVLGVDMLINDGAIHAVDSNELSFKTATMAAFRDSFLKAQPVILEPIMVVTVTSPNEF
                     QGNVIGTLNKLQAMIQDTENGQDEFTMKAECPLSNMFGYATSLRASTQGKGEFTLEFS
                     HYAPTAPNVQRDLIAEFQKRQQQQQQQKK"
     gene            complement(<208927..>209382)
                     /locus_tag="ZYRO0F02618g"
                     /db_xref="GeneID:8205067"
     mRNA            complement(<208927..>209382)
                     /locus_tag="ZYRO0F02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497266.1"
                     /db_xref="GeneID:8205067"
     CDS             complement(208927..209382)
                     /locus_tag="ZYRO0F02618g"
                     /note="similar to uniprot|Q12247 Saccharomyces cerevisiae
                     YLR068W FYV7 Protein of unknown function required for
                     survival upon exposure to K1 killer toxin involved in
                     processing the 35S rRNA primary transcript to generate the
                     20S and 27SA2 pre-rRNA transcripts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497311.1"
                     /db_xref="GeneID:8205067"
                     /db_xref="InterPro:IPR013730"
                     /db_xref="UniProtKB/TrEMBL:C5DX67"
                     /translation="MPTSKQIRNRDKFTKEYKVKEIQRNLTKKARLRKEYLKALKSEG
                     YEVPDKKPTPVSKDDIKHLKEERALQGKRKLDEKKEIKKQRKRLQAEHAQEAKRKEEE
                     RIKIIEQKAQEREKRKVKMTQKTKTGQPKMGPKIDDMLDKIKNNSLYTE"
     gene            complement(<209802..>212891)
                     /locus_tag="ZYRO0F02640g"
                     /db_xref="GeneID:8205068"
     mRNA            complement(<209802..>212891)
                     /locus_tag="ZYRO0F02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497267.1"
                     /db_xref="GeneID:8205068"
     CDS             complement(209802..212891)
                     /locus_tag="ZYRO0F02640g"
                     /note="weakly similar to uniprot|P47068 Saccharomyces
                     cerevisiae YJL020C BBC1 Protein possibly involved in
                     assembly of actin patches interacts with an actin assembly
                     factor Las17p and with the SH3 domains of Type I myosins
                     Myo3p and Myo5p localized predominantly to cortical actin
                     patches"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497312.1"
                     /db_xref="GeneID:8205068"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DX68"
                     /translation="MNEPSTPFQVIALYPYKSDFEDDLNFDKDQIVTVTNIEDDQWYF
                     GEYVGERGQLLEGIFPKGFVAVHEKPSDKPKAAEPTAEPANSTASVALSHGSDRGVEQ
                     NNWEDPNDPSVSKMKNKVSMFDQGTSEPAPLPRNSTFFGDSKDASVKKTVVADPSHHY
                     TPPTAFAHSEKKQREQPAKVDIPEPVNRGDFTESPKEDLPKMSLKDRIAKLQEQQQQQ
                     LRREQEKKAKKSKKRESITSEGDNAPLDLEKPQQPQHDPLRAGSKNDDALNDLNEGVE
                     GLKLDEKPGTKDFEEPPPVPVSPERYGYESQGLKKEQPEERPQESARESMGFIESREP
                     DGDKEAEEGGEEEEEEEEEARRAALTQKIARMADAGRYGGVPVGFNPFGMPTAVPPSG
                     EPKKRKSTTKSFDSQEKERAPPKVVPIMPFADPNAVSFLNNPPAEHDNNAEDEVEEEI
                     EEFETREPVKNTDEMDDRGVINNAEQESFYSQERNLPLDSGSKPAVSHSSNRQSAFVE
                     PDMAPLDNKSEQKEPPATVEPSAPSVPSAPPVPPISPERYHPDDELRTPVDDHLSQAP
                     KPPVSSLDNFSHSNDYDFSEPQSWGSPPEPQIPPIPNSLDPNSSPTSSRTGVSVPHRP
                     SRGSSLRDSGPGAARPTSTMFHSRGDAPSSPEDFDHPRGAISMTGVPDFPYTPAPPVP
                     AALSGGDTREASSNTPSGVPPIPTSPPGHGGRPSSVYSGDSGSATSHTRGVPSVPRSI
                     PPIPGSPSAPGPHPPVAGQSPSEKLNTMSRTATFSTKDGSGSAEGKTIRFSSEDSWWL
                     EKKFPSHAFGQKVNCLMEVDDHLIKKKLHESYMVRDFYFLFEDYSQLHFSVNFDTSNP
                     HATVQASQEHIPLKNQPQLLEEYAQRYGSYALHRAGSLVGSHTNGLIPAILSHLENEV
                     IHPIEGRTFGASIFAHNAGEAVHTQDVAQIRPGDVLVMRKAKFDVLMKSGSREIISVG
                     TETPHVAIIAGYEFPKGKFQVIEEHSGKVVTSSYKIHRMKAGRLKVFRFVGRDYVGW"
     gene            <213463..>216279
                     /locus_tag="ZYRO0F02662g"
                     /db_xref="GeneID:8205069"
     mRNA            <213463..>216279
                     /locus_tag="ZYRO0F02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497268.1"
                     /db_xref="GeneID:8205069"
     CDS             213463..216279
                     /locus_tag="ZYRO0F02662g"
                     /note="similar to uniprot|P32522 Saccharomyces cerevisiae
                     YLR067C PET309 Specific translational activator for the
                     COX1 mRNA also influences stability of intron-containing
                     COX1 primary transcripts located in the mitochondrial
                     inner membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497313.1"
                     /db_xref="GeneID:8205069"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:C5DX69"
                     /translation="MLKYAAPLVKHYKKVVWNPEVPNRIKNILKDEKPLKSRENAALM
                     NYYINMHNGRLHPSERGYLLRYLYQKKAYGSVVTVGSRLLYGNNNDGIKSVIRDDVSM
                     NELKRYLNSLVRLHKTSQLDSCMGRIIAQFAITRRSFVVDIINSIFVTTYQTFGEDSM
                     EPLIKWVKWMKMLNGHCEFTDYMQYKYIMSSLLFYLRGRRGNDHDNKSFFENVLGDIK
                     RIQGAAAASQFATTLMCLLAYSRRFHSVENIWHYKINQNFSIVSADLTNIMKVFCHFK
                     SFESIPSLYQEHPDAHDDVRQFDYLLIAHSELQDWKSLQDQFNALFNVGDLPNLRHYG
                     IVMYSLATIGELENVERLYAQLLRRKLLPNFAVLQSLLLVHYKCADLNGCFAQFDLFD
                     KYSIPPSSSTYTIMLKAYRNLNDIDGALRLLKKMTESAYHVITERHFSILIHMCSKIT
                     NTMIAEELFQLMVDHYNITPTGLSVAALMDVYIASGVPQESLSLFKKYAQLKPVDEGL
                     ISIYNRAITARIEMGEKIECEKLFDMITQLKLNTDSEFYRVMIRYLATLEKDYETAEN
                     ILDQLIEHPNLQADASHFETMMEAYDSISYRDGVLKLFAKMTKNEVPLNSKILHHLIK
                     STFKIQIRNQENLSQPIELLDRIMKNVSERNLQMTFQFLHPSVLGLPMRCVAKYHGAQ
                     EALQLLNRYSELFYGTTDSSTLQNRFVILRSLLVLTGEIQQWEDFEGYYQKYVARIEK
                     FQNTPSATQPNKRMKSLMVGLFAYKVKHLLWKGAIHEIPQWMQKFEKMGLWLDNDSWN
                     EAVMTMFKDSRTIEFALKVVNEKLIHGYNLIHKYRLLRHNSKQLTSADKLPWLLQHKK
                     LYPESFRHKLYLKSDVATSVMESMDQYLNCCQDLNEEVTRLAKLYPYFMKNYLMHPRN
                     VNGWDEMEKRHSGVFQQLRLTKKL"
     gene            complement(<216318..>216878)
                     /locus_tag="ZYRO0F02684g"
                     /db_xref="GeneID:8205070"
     mRNA            complement(<216318..>216878)
                     /locus_tag="ZYRO0F02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497269.1"
                     /db_xref="GeneID:8205070"
     CDS             complement(216318..216878)
                     /locus_tag="ZYRO0F02684g"
                     /note="similar to uniprot|Q12133 Saccharomyces cerevisiae
                     YLR066W SPC3 Subunit of signal peptidase complex (Spc1p
                     Spc2p Spc3p Sec11p) which catalyzes cleavage of N-terminal
                     signal sequences of proteins targeted to the secretory
                     pathway homologous to mammalian SPC22/23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497314.1"
                     /db_xref="GeneID:8205070"
                     /db_xref="GOA:C5DX70"
                     /db_xref="InterPro:IPR007653"
                     /db_xref="UniProtKB/TrEMBL:C5DX70"
                     /translation="MFSLSQRFQTLGNQAITYGLFISVFIAITSWFQLQSQDADLVPS
                     TIESIKPSLSFRTSRYYGSVNGKPKENAKITFDLETDLTPLFTWNTKQVFAYLTAEYD
                     GKNTHNEVVFWDKIITSKDEAHLKVNGAKSKYNIWDAQDKLSGKELEFKLKWNIQPYV
                     GPLIYGETIGSKDVLVQSAAADDDNK"
     gene            <217664..>219367
                     /locus_tag="ZYRO0F02706g"
                     /db_xref="GeneID:8205071"
     mRNA            <217664..>219367
                     /locus_tag="ZYRO0F02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497270.1"
                     /db_xref="GeneID:8205071"
     CDS             217664..219367
                     /locus_tag="ZYRO0F02706g"
                     /note="similar to gnl|GLV|CAGL0K12716g Candida glabrata
                     CAGL0K12716g and weakly similar to YFL040W uniprot|P43562
                     Saccharomyces cerevisiae YFL040W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497315.1"
                     /db_xref="GeneID:8205071"
                     /db_xref="GOA:C5DX71"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DX71"
                     /translation="MPATYNASRISAILSLCGFIMGMDVTSLAVFLDKPYFNDYFHYP
                     GPLVQGALSGAHPLGGLTGCLVYSLLCDKFGRVGLFRLGSLFWLMGSIIAVGSINTAM
                     VIASRWIKGTNVGILSILLTAYCSEVISPQRKGRTLGFVQFACSFGILSMFCMCILLN
                     HYWQEELTFRLAWSLETLPCLFFVFGSLWLPESPTWLTTVGRYEQAQEVQNHLAVEHN
                     RVCGEKTPQMELLEKLDLAATLDDASDGFSYLDLFTLKYLPFTAMAAILQLLVQFSGI
                     SVLMYYAVYICEMVGLQSTVRSTAAAIPYAINVLLTLLPPLFLDRLRRKDITLAGAYP
                     LALIMISLSLTMLLQGHRVQEPLGGNAALTWTVSSKGAPYVLSLCYLFVSVFSLTLGA
                     APWLYTCEILPVRARSKGLAVSMAVGWATNCVLTLAAPWLFARLQWAIFLLLGSVTLL
                     ISAFICAYFPDTVEIAAATDDAAAASRITKPERANSESPDHGSCTLSGSDDENGADKD
                     PHNTPHYVNDSPSMSPVVGPTFKTATTETGLQKQLRHQHLQHLQLQKPIELSIVDGAS
                     L"
     gene            <220410..>227318
                     /locus_tag="ZYRO0F02728g"
                     /db_xref="GeneID:8205072"
     mRNA            <220410..>227318
                     /locus_tag="ZYRO0F02728g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497271.1"
                     /db_xref="GeneID:8205072"
     CDS             220410..227318
                     /locus_tag="ZYRO0F02728g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019C MUC1 GPI-anchored cell surface
                     glycoprotein required for diploid pseudohyphal formation
                     and haploid invasive growth transcriptionally regulated by
                     the MAPK pathway (via Ste12p and Tec1p) and the cAMP
                     pathway (via Flo8p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497316.1"
                     /db_xref="GeneID:8205072"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:C5DX72"
                     /translation="MIRSLYSLLLLVAPLVLALGGSTTTTVSPVPDRLARRDRIEIQN
                     VQDACAGRSFLNSVSILQQNMDVTDVSYLGNNTYNVTIHVTGSSTIASNLLQSLAITN
                     IDGPENQVTLYSTDSAGLLNTVSPTDYTATFESYGVQQGNEIWLPAFQLTYTYSNGLP
                     DPLAASNSYNLAAGCPAVDSSLAGYHWRNPDSPVSSTTSSSSSSTSSSAPPSGSSIPP
                     STSSSASSTSGSSSAPGTSSTGSTSAPSGSGNSGASGASGASGASSSEASGSGNSATS
                     GASGASGASSSAPTSTSGASSSEASGSGNSATSGATGASSTSSSAPPSGSSASSAPSS
                     GASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAPTSTSGASSS
                     EASGSGNSATSGASGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGA
                     SSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAPSSGASGASSSEASGSGN
                     SATSGIVSASSAPSGNGNSATSGASGASGASGASGASSSAPTSTSGASSSEASGSGNS
                     ATSGATGASSTSSSAPPSGSNVPPSTSSSASSTSTSSSDPSSSSTSSSTEIQDVEDAC
                     PGRSFLNSVSILQQNMDVTDVSYLGNNTYNVTIHVTGSSTIASNLLQSLAITNIDGPE
                     NQVTLYSTDSAGLLNTVSPTDYTATFESYGVQQGNEIWLPAFQLTYTYSNGLPDPLAA
                     SNSYNLAAGCPAVDSSLAGYHWRNPDSPVSSTTSSSSSSTSSSAPPSGSSIPPSTSSS
                     ASSTSGSSSAPGTSSTGSPSAPSGSGNSGASGASGASGASSSEASGSGNSATSGASGA
                     SGASGASGASSAPSSGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASG
                     ASSAPSSGASGASGASSSAPTSTSGASSSEASGSGNSATSGIVSASSAPSGNGNSATS
                     GASGASGASGASSSAPTSTSGASSSEASGSGNSATSGATGASSTSSSAPPSGSSASSA
                     PSSGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAPSSGASG
                     ASSSEASGSGNSATSGIVSASSAPSGNGNSATSGASGASGASSSAPTSTSGASSSEAS
                     GSGNSATSGASGASGASGASSSAPTSTSGASSSEASGSGNSATSGATGASSTSSSAPP
                     SGSSASSAPSSGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSS
                     APTSTSGASSSEASGSGNSATSGASGASGASGASSSAPTSTSGASSSEASGSGNSATS
                     GASGASGASGASSSAPTSTSGASSSEASGSGNSATSGASGASGASGASSSAPTSTSGA
                     SSSEASGSGNSATSGASGASGASGASSSAPTSTSGASSSEASGSGNSATSGIVSASSA
                     PSGNGNSATSGASGASGASGASSSAPSSGASGASSSEASGSGNSATSGASSVPSGSGN
                     SATSGIVSTSSAPSGSGNSATSGASTSAPSSGASGASSASSSGASGAPSSEASGSGNS
                     PTSGTVSASSYGSPGGSNRSTTVLSTSTGAAAGTTSSSSTGPSSGSGSGANSTASGSN
                     GNGSNGNGSNGASSVPNTSTGAANSATSGSNGNGSNGNGSNGASSVPSTSTGAAAGST
                     SGASTGPSSGSGSGANSTASGSNGNGSNGASSVPNTSTGAAAGSTGGASTGPSSGSNG
                     NGSNTNGNGSGSSSGSPSSSNGNGSHGSTSGPIYSANSTTSGSPSGSSGNGSNGSTSV
                     PNTTTGSSGSTSGASSGNGSGSGSNENGSGSNGNGSGSGSNENGSGSGSNGNGSGSNE
                     NGSGSNGNGSGSGSSGNGSGSGSNENGSGSNGNGSGSNSNGSGSNGNGSGSGSNENGS
                     GSNGNGSGSGSGSNGNGSGSGSNGNGSGSNENGSGSGSGSNTVPITTIPGTTIPGSTV
                     PARTVPGTTIPSSTVPASTLPASTVPGTTIPGSIVPGSTIPGTTIPSCTVSGNIVPGT
                     TIPASTVPESTVPGTTIPGSTVPASIVPGSVAPGTTIPSSVIPGSTVPGTTIPAKTVV
                     GGAGAPSTITVSGTAAGANGVTGTSGTGNNNGGNNGGNNNGVNGEQTPQVQTITRTVQ
                     PTGGQTTPQVQTIITTIQPTGGNNAGNGANNNGANGEPTPQVQTITRTAQPTGGSNGN
                     NNGGNTVPVSVSVSVQTVTQVQTQTVTETVSGNCVCPTGTAAAATPLVSNSGYSNNTL
                     PVKREAPIVKPVGKDITALPTVAPQTVFQGSAGRLVNPVNGLLLSLLTLLPFFF"
     gene            <229681..>234465
                     /locus_tag="ZYRO0F02750g"
                     /db_xref="GeneID:8205073"
     mRNA            <229681..>234465
                     /locus_tag="ZYRO0F02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497272.1"
                     /db_xref="GeneID:8205073"
     CDS             229681..234465
                     /locus_tag="ZYRO0F02750g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019C MUC1 GPI-anchored cell surface
                     glycoprotein required for diploid pseudohyphal formation
                     and haploid invasive growth transcriptionally regulated by
                     the MAPK pathway (via Ste12p and Tec1p) and the cAMP
                     pathway (via Flo8p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497317.1"
                     /db_xref="GeneID:8205073"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:C5DX73"
                     /translation="MIRSLYSLLFLAAPLVVALGGSSTTTASPAPYGLTRREEHQVVD
                     LYDACPVRNILNSLGAEKLISFDMEVTDVSYLGGNTYNVTIHVSGKINIASYLFRGLH
                     VSDIDGPDSEVTLYSTTTPNLLNLLCPSDYTANFLVYGVEQGDTVWLPSFRLVYEYSN
                     GLPGVLETVNQLELITGCLEVDSSLSGYYWPTPDDDSSSAPPSGSGLPQSAPSTNSCF
                     QSSTSAPTSSQSDTLQNKDPVGYSTAPISSASSSSSAAQTSAASSGPSAAPVTDASST
                     SSSAPTSGATSGSSAPSNDANSSTSGSSAAQANTVSSSSSAAPATDASSSSSSAPTSG
                     TTSGSSAPSNGANSSTSGSSAAQANTVSSSSSAAPATDASSSSSSAPATDASSTSGSS
                     AAPTNAASSSSSAAPVTDASSTSSSAPTSGATSGSSAPSNDANSSTSGSSAAQANTVS
                     SSSSAAPATDASSSSSSAPATDASSSSSSAPTSGSTSGSSAPSNDANSSTSGSSAAQT
                     NTASSSSSSAPTSGSTSGSSAPSNDANSSTSGSSATQTNGASTGPSSGSGSGVNSTTL
                     RSNGNGSNGNGSNGASSVPSTSTGAAAETTSGASTGPSSGAGSGVNSTTSGSNGNVSN
                     GNGSNGASSVPSTSTGFPAGSTGGANSTASGSNGNGSNGNGSNGASSVPSTSTGAAAG
                     TTSGANSTASGSNGNGSNGNGSNGASSVPNTSTGAANSATSGSNGNGSNGNGSNGASS
                     VPNTSTGFPAGSTGGANSTTSGSNGNGSNGNGSNGASSVPSTSTGAAAGTTSSSSTGP
                     SSGSGSGANSTTSGSNGNGSNGNGSNGASSVPSTSTGFPAGSTSGANSTASGSNGNGS
                     NGNGSNGASSVPNTSTGAANSATSGSNGNGSNGNGSNGASSVPNTSTGFPAGSTGGAN
                     STTSGSNGNGSNGNGSNGASSVPNGNVSNGNGSNGASSVPNTSTGSSSGSSTVASDSA
                     SNSVPPNTSSISSSNSASNSALLNSNSSSPTSSSGVAGNTVPITTISGTTIPGTTIPG
                     STVPGTTIPGSTVPGTTIPGSTIPGTTIAGSSVPGKNVSGNIVPGSTIPASTLPGSIV
                     PGTTIPGSTVSGTTVPSSVIPGSTVPGTTIPAKTVVGGGDSPSTFTASNTAAGASGVT
                     GTSVAGNNNGVNGEQTPQVQTITRTVQPTGGQTTPQVQTIMTTIQPTGGNNAGNGNNG
                     ANNNGANNAGNGDNSGSGNNGNNNNGANNAGNGNNGNNNGGNNSGNGNNSGNGNNNDA
                     NGEQTPQVQTTTRTFQPTGGQTTPQVQTIMTTIQPTGGNNAGNGNNGANNNGSNGANN
                     NGANNAGNGNNGNNNGGNNSRNGNNSGNGNNNDANGEQTPQVQTITRTVLPTGGETTP
                     QVQTIITTIQPTGGNNAGNGNNDANNNGNGDNGANGANNNGASGEQTPQVQTITRTVQ
                     PTSGQTSPQVQTIMTTIQPTGRNNAGNGNNNGGNNNGNGNNNGNGNNNGNGNTVPVSV
                     SVSVQIVTQTQTVTETAAPSDNCVCPTGAAAAAIPSASNSGYSNNTVPVKREAPIVKP
                     VGKDITALPTVAPQTVSQGSAGRLVNPVNGLLLSLLTSLPFF"
     gene            complement(<235322..>236533)
                     /locus_tag="ZYRO0F02772g"
                     /db_xref="GeneID:8205074"
     mRNA            complement(join(<235322..236439,236524..>236533))
                     /locus_tag="ZYRO0F02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497273.1"
                     /db_xref="GeneID:8205074"
     CDS             complement(join(235322..236439,236524..236533))
                     /locus_tag="ZYRO0F02772g"
                     /note="uniprot|Q2HWE7 Zygosaccharomyces rouxii ACT1 Actin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497318.1"
                     /db_xref="GeneID:8205074"
                     /db_xref="GOA:C5DX74"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR004001"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:C5DX74"
                     /translation="MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIM
                     VGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHP
                     VLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVT
                     HVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCY
                     VALDFEQEMQTAAQSSSVEKSYELPDGQVITIGNERFRAPEALFHPSVLSLESSGVDQ
                     TTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPE
                     RKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF"
     gene            <237327..>237848
                     /locus_tag="ZYRO0F02794g"
                     /db_xref="GeneID:8205075"
     mRNA            <237327..>237848
                     /locus_tag="ZYRO0F02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497274.1"
                     /db_xref="GeneID:8205075"
     CDS             237327..237848
                     /locus_tag="ZYRO0F02794g"
                     /note="similar to uniprot|Q6Q5C1 Saccharomyces cerevisiae
                     YLR065C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497319.1"
                     /db_xref="GeneID:8205075"
                     /db_xref="InterPro:IPR008506"
                     /db_xref="UniProtKB/TrEMBL:C5DX75"
                     /translation="MAGKSSKKQAQSNLLVLRNLYVATIPVVLLASTRQWISKRDIVN
                     YIRFILLHLPLLGCIYVLDSSGRPKYDSKNKLIREGLDLSQSGGLTEYMFDVIYLSLF
                     GDLGHILFNTKKFWYALILVPVYAIWKIYGLMPSLPTAKAKDGDDQHQKPGQSKRQAK
                     LAKRQDKVQVKYR"
     gene            complement(<237904..>238533)
                     /locus_tag="ZYRO0F02816g"
                     /db_xref="GeneID:8205076"
     mRNA            complement(<237904..>238533)
                     /locus_tag="ZYRO0F02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497275.1"
                     /db_xref="GeneID:8205076"
     CDS             complement(237904..238533)
                     /locus_tag="ZYRO0F02816g"
                     /note="highly similar to uniprot|P01123 Saccharomyces
                     cerevisiae YFL038C YPT1 Ras-like small GTPase involved in
                     the ER-to-Golgi step of the secretory pathway complex
                     formation with the Rab escort protein Mrs6p is required
                     for prenylation of Ypt1p by protein
                     geranylgeranyltransferase type II (Bet2p-Bet4p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497320.1"
                     /db_xref="GeneID:8205076"
                     /db_xref="GOA:C5DX76"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DX76"
                     /translation="MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVD
                     FKIKTVDLDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMW
                     LQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFIETSALDSTNVEE
                     AFLTMARQIKDSMAQQQRHDGGAANGQNENGNVNLKGQSLTNSSANGCC"
     gene            complement(<238910..>239692)
                     /locus_tag="ZYRO0F02838g"
                     /db_xref="GeneID:8205077"
     mRNA            complement(<238910..>239692)
                     /locus_tag="ZYRO0F02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497276.1"
                     /db_xref="GeneID:8205077"
     CDS             complement(238910..239692)
                     /locus_tag="ZYRO0F02838g"
                     /note="similar to uniprot|Q12144 Saccharomyces cerevisiae
                     YLR064W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497321.1"
                     /db_xref="GeneID:8205077"
                     /db_xref="UniProtKB/TrEMBL:C5DX77"
                     /translation="MAASPFMHMLRFRVRQPQFYWFLGHFMTIWHFIRFHLSFFSSSS
                     QRYHYSRVLFYVTITYGIVLYQFYKSGQLKRQTFLVQLRQLDNLQYFCMVATLYICSW
                     AGSMVNGALYSPVIFALFHCCNYFKENLLPFLPIQPILKNTLNQRITFFIQRYNEKFL
                     QMAQVFEIMCGVRSGLLGLPVEIVLLLTSLNVKRIASVIALLTYVVFFKLRYLHSETL
                     RLLTREYVYKIDTYVHSSLPNFVPKWQGYKQFVSKLFWRLPC"
     gene            <240381..>241797
                     /locus_tag="ZYRO0F02860g"
                     /db_xref="GeneID:8205078"
     mRNA            join(<240381..240392,240460..>241797)
                     /locus_tag="ZYRO0F02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497277.1"
                     /db_xref="GeneID:8205078"
     CDS             join(240381..240392,240460..241797)
                     /locus_tag="ZYRO0F02860g"
                     /note="highly similar to uniprot|P02557 Saccharomyces
                     cerevisiae YFL037W TUB2 Beta-tubulin associates with
                     alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer
                     which polymerizes to form microtubules"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497322.1"
                     /db_xref="GeneID:8205078"
                     /db_xref="GOA:C5DX78"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002453"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:C5DX78"
                     /translation="MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGNYHGTEDIQR
                     ARLGVYFNEASSGKWVPRSVNVDLEPGTIDAVRNSNIGSLFRPDNHICGQSSAGNVWA
                     KGHYTEGAELVDSVMDVVRREAESSDSLQGFQITHSLGGGTGSGMGTLLISKIREEFP
                     DRMMATFSVMPSKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYKICQNTLKLSQ
                     PSYTDLNNLVSGVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAAG
                     SQSFRSLTVPELTQQMFDAKNMMAASDPRTGRYLTVAAFFRGKVSVKEVEDEMHKVQT
                     RNSSYFVEWIPNNVQTAVCSVAPEGLDMAGTFIGNSTSIQELFKRVGDQFSAMFKRKA
                     FLHWYTSEGMDEMEFSEAESNMNDLVSEYQQYQEATVEEDGDIDYAAEDQPVAENFE"
     gene            <242329..>246264
                     /locus_tag="ZYRO0F02882g"
                     /db_xref="GeneID:8205079"
     mRNA            <242329..>246264
                     /locus_tag="ZYRO0F02882g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497278.1"
                     /db_xref="GeneID:8205079"
     CDS             242329..246264
                     /locus_tag="ZYRO0F02882g"
                     /note="similar to uniprot|P13433 Saccharomyces cerevisiae
                     YFL036W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497323.1"
                     /db_xref="GeneID:8205079"
                     /db_xref="GOA:C5DX79"
                     /db_xref="InterPro:IPR002092"
                     /db_xref="InterPro:IPR024075"
                     /db_xref="InterPro:IPR029262"
                     /db_xref="UniProtKB/TrEMBL:C5DX79"
                     /translation="MLRLPTRTIRKSSLIPKRLISLKGSHLHKPASELVSNASSSNSG
                     VGQGLGFMKSSQISMSPGFDPFDRSHAAALNQTTQSRDVMQLWSLLEACLCSKYYNRA
                     FSILQSLYMVGPHRPYFIDDYNMYLESLVENGIMTSISQLDKKLSDDLQNTFRDVDYN
                     DRTLAIMVHHAIKYDHLQSETQNHLKIYFRMSVGGIKSILSHVNVLTVSDYAALHADL
                     KMINLNDVPEAVRPLLENRAQERKKLAQEELATLEENKGSVDGNPLAANDHKVEDDQN
                     KSIFSLDQEVKPLEKDATTLKAVDTLNMRVVRHALLGLSLNETQREQILKFNFDASSN
                     LLNMDDNRSLDFFEIYRSLSNEEDRSKFEKALDDFNQERQRALENRATDAAKERWKHD
                     FEEAKARGDISIEKRLNVKLWQWYSAMLPLVKEEVKLCSQVFDGYANEKKNASKEDAK
                     QERARLDYGPYLSLVDPEKMCVITILELLKLNSTGGIIEGMRTARAVISVGKAIEMEF
                     RSEQLLKSESQAFRDLGKNSHELKKYLQRAKSTFRSMKIEENKIMWPQAARAKIGSIL
                     ISMLIHVSKVEVEGVDPVTKQKVYGEAPAFAHGYQYHNGSKLGVLKIHRSLVHQLNGE
                     RLVASVQPQLLPMLVKPRPWKNWKSGGYYYTQSTLIRSKDSPEQIAYLKAVSDATAIN
                     TVYDGLNVLGETPWTVNRPLFEVMSKVWNSGKPFLDIPGVQEKLTLLPPPPREADPSV
                     HREWKLKNKELANRFSSNRSTRCDSNYKLEIARAFLGEKFYFPHNLDFRGRAYPLSPH
                     FNHLGNDMSRGLLLFWNGKRLGPQGLKWLKVHLSNLFGFDKASLLERVQFADEHIDDI
                     KQSAQDPLKEDAWWMKAEKPWQALATCMELNDAMKLDNPEDFISHQPVHQDGTCNGLQ
                     HYAALGGDIDGATQVNLVPNDRPQDVYAHVAKLVIARLEIAAAKGDEVAMILKDKITR
                     KVVKQTVMTNVYGVTYVGATFQIDKQLSNIFEDRKYSLELSKYLTKHVFGAVRELFQG
                     AHLIQDWLGECAKRISKSIRLDVDEKSFKNGNKPDFMTSVIWTTPLGLPIVQPYRETS
                     KKQVTTNLQTVFISDPFGVNPVNARRQKAGFPPNFIHSLDASHMLLSAAECGRNGLDF
                     ASVHDSYWTHACDVDNMNVFLREQFIRLHEVDLIERLKDEFDERYKNYVQIAKVERTS
                     ELAKQIMAVRAQLSKELGRQATLSDEIFMEKRRIQMLQSEDPNEVAKGENMVTTVSLV
                     EATGSIEDIESKKSDASTLVILTPLRLPQIPPKGNFDVRELKNSKYFFS"
     gene            complement(<246538..>247392)
                     /locus_tag="ZYRO0F02904g"
                     /db_xref="GeneID:8205080"
     mRNA            complement(<246538..>247392)
                     /locus_tag="ZYRO0F02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497279.1"
                     /db_xref="GeneID:8205080"
     CDS             complement(246538..247392)
                     /locus_tag="ZYRO0F02904g"
                     /note="similar to uniprot|P43563 Saccharomyces cerevisiae
                     YFL034C-B MOB2 Component of the RAM signaling network
                     localizes and activates the Ace2p in the daughter cell
                     nucleus to direct daughter cell-specific transcription of
                     several genes involved in cell separation Mob1p-like
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497324.1"
                     /db_xref="GeneID:8205080"
                     /db_xref="InterPro:IPR005301"
                     /db_xref="UniProtKB/TrEMBL:C5DX80"
                     /translation="MSFFNFKGFGRNSKKNKHTNNNMGNTGSPAPMNTIYSSPHSSSS
                     KLSLRKNHSPSRHSQHSLQQSQPQSSLYSGNNNYNNSSSPERPESQQVMFLSEPFVRT
                     ALVKGSFKTIVQLPKYVDIGEWIALNVFEFFTNLNQFYGVIAEYVTPDAYPTMNAGPH
                     TDYLWLDANNRQVSLPASQYIDLALTWIDNKVNDKNLFPTKNNIPFPQMFLRDVQRIM
                     VQMFRIFANIYHHHFDKIIHLSLEAHWNSFFAHFISFSKEFNIIDRKEMYPLLPLIEN
                     MEFQGKII"
     gene            complement(<247606..>248517)
                     /locus_tag="ZYRO0F02926g"
                     /db_xref="GeneID:8205081"
     mRNA            complement(<247606..>248517)
                     /locus_tag="ZYRO0F02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497280.1"
                     /db_xref="GeneID:8205081"
     CDS             complement(247606..248517)
                     /locus_tag="ZYRO0F02926g"
                     /note="similar to uniprot|Q12291 Saccharomyces cerevisiae
                     YLR063W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497325.1"
                     /db_xref="GeneID:8205081"
                     /db_xref="InterPro:IPR021463"
                     /db_xref="UniProtKB/TrEMBL:C5DX81"
                     /translation="MSLPVHHGDTLPPQEVIDLFKRTFSHELYEDLANVRELVQKVKS
                     DLYNRDYTAAFDDNAKRVAYCCRWSPARAVAYTSLFAQLEPINQVVRCQLQGGDQRVL
                     CVGGGAGGELVALASLFTPSRHVRTPSNEGLQIHLVDIYDWTNVVSRLQDQINTNWLY
                     NGQSRFCNMEFTSNDILKMDPGQLQLNQLNLITLLFTTNELFSQDKSGSIKFLQSLTT
                     HCQRGCLLLITESAGSYSHITVGSKKFPIQFLIDTVLLGKRGQDNHGNWTLVDQSDSI
                     WYRGDPDMDYPLKLENMRCFYRLYRKL"
     gene            complement(<248675..>249209)
                     /locus_tag="ZYRO0F02948g"
                     /db_xref="GeneID:8205082"
     mRNA            complement(join(<248675..249022,249198..>249209))
                     /locus_tag="ZYRO0F02948g"
                     /product="60S ribosomal protein L22"
                     /transcript_id="XM_002497281.1"
                     /db_xref="GeneID:8205082"
     CDS             complement(join(248675..249022,249198..249209))
                     /locus_tag="ZYRO0F02948g"
                     /note="highly similar to gnl|GLV|CAGL0F01683g Candida
                     glabrata CAGL0F01683g and highly similar to YLR061W
                     uniprot|P05749 Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="60S ribosomal protein L22"
                     /protein_id="XP_002497326.1"
                     /db_xref="GeneID:8205082"
                     /db_xref="GOA:C5DX82"
                     /db_xref="InterPro:IPR002671"
                     /db_xref="UniProtKB/TrEMBL:C5DX82"
                     /translation="MAPNTSRKQKVTKTFTVDVSSPVENGVFDPASYAKFLIEHIKVE
                     GATGNLGNAVSVEENGSVVTVVSATKFSGKYLKYLTKKYLKKNQLRDWIRFVSVKTNQ
                     YRLAFYQVTPEEEADEE"
     gene            <249643..>252873
                     /locus_tag="ZYRO0F02970g"
                     /db_xref="GeneID:8205083"
     mRNA            <249643..>252873
                     /locus_tag="ZYRO0F02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497282.1"
                     /db_xref="GeneID:8205083"
     CDS             249643..252873
                     /locus_tag="ZYRO0F02970g"
                     /note="similar to uniprot|P43564 Saccharomyces cerevisiae
                     YFL034W Possible integral membrane protein that interacts
                     with Rpp0p which is a component of the ribosomal stalk"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497327.1"
                     /db_xref="GeneID:8205083"
                     /db_xref="InterPro:IPR007941"
                     /db_xref="UniProtKB/TrEMBL:C5DX83"
                     /translation="MTSSGEDLGSNLQGLSISEAMETKCEDGGGMNYDHSSRRDSLDL
                     GAVSFKAFENDEFAEIHYRDAEDGRGAAALESANLPQITSNNGNIENDSDSDSDSGWQ
                     IMPTIASYNIYDEKGQLSIRPYEVRSLQTPSQEELSSKDKSNTKTTFGYTKVAAEEQA
                     QRSFQTNRKTDFLFDHRRLRNDSSRGTLASDEKAKDAMETDHDSDSSEFSQDEKDDEE
                     TFYDEYEDDVEPMDDLNPDTQLDATKNMLTEKEKFAYVGAINVLINQICTELATLCLC
                     VDNITSHRKLARRLQFAQKDTAAWKTDILERIYTHLNVSDEEIIMIEQLSNHGVRLED
                     LCKCLKTHQKVENPFEEHDDSKNDENNEEEKIEKEQKSPNEKESDIRESCESTTSSVT
                     KRNLEDEAEDNKESYGINMPNEVVNPDMIKDKSRIDIDVAWTVICDLFLLLLQDAAYD
                     ARSRILLLRFAEVLNVTGLEVAEFERRITDSLDMEQSTEDQNWDETKLMKDRRKRRRR
                     KKLCYVGLAMVGGSLVLGLSGGLLAPVIGAGIAAGLSTVGITGATGFLTGAGGATAVA
                     VTSTAIGGNIGFKGMKRRMGSVRTFEFCPLHNNRRVNLLISVSGWMIGNVDDVRLPYS
                     TVDPVEGDLYSLNWEPEMLKSIGESITIIANELFATTIQQVLGATVLTAFISAIQWPM
                     WLSKLSYILDNPWNVSLDRAWSAGKILADTLIAKNLGQRPTTLMGFSLGSRVIFSCLV
                     ELCKKKAFGLVENVYLFGTPVIKNKEQLVMARSVVSGRFVNAYSEKDWMLAYLFRAAA
                     GGFSTVMGITPITNVEGIENFDCTDVVDGHLAYRKNMPKLLKRLGISVVSEQFVEIEE
                     DVDFGEIKRKRKLVEDVDAAQKKLSEKKKHNSWVPKWLKPKKSKWRSMVEDTVEEGKE
                     IEIPAQAAKEEDMISDSTRESMKEPSTKAGAEEGTTEKNEEDDEAENPSKKDPVLIDH
                     GALMNELKLIKQAIHEEQRHKKKEMKEDEEEEDKDESEGNTADETPNASISEKNKSSR
                     QSSYGAPQSPGNFQLLGAGRTILPEDDDMFKQRNKSGMTFEFPDDI"
     gene            complement(<253105..>254889)
                     /locus_tag="ZYRO0F02992g"
                     /db_xref="GeneID:8205084"
     mRNA            complement(<253105..>254889)
                     /locus_tag="ZYRO0F02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497283.1"
                     /db_xref="GeneID:8205084"
     CDS             complement(253105..254889)
                     /locus_tag="ZYRO0F02992g"
                     /note="highly similar to uniprot|P15624 Saccharomyces
                     cerevisiae YLR060W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497328.1"
                     /db_xref="GeneID:8205084"
                     /db_xref="GOA:C5DX84"
                     /db_xref="InterPro:IPR004531"
                     /db_xref="InterPro:IPR005146"
                     /db_xref="InterPro:IPR005147"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR020825"
                     /db_xref="UniProtKB/TrEMBL:C5DX84"
                     /translation="MPTVSVNKKQLFQLLGKEYTNEEFDELCFQFGIELDEDTTEEAL
                     KLGEEPELKIEVGANRHDLLCIEGIAQALSVYIGKIEAPKYKLSKPTTKLIIDPSTEK
                     VRPYAAAAILRDIQFDELSYASFIALQDKLHSNIGRNRTLIAMGTHDYDSIQGPFHFY
                     GLPPREIHFAPLGQTKQFYGDELIEFYKQPEQKNNIGRFVHIIENSPIFPVIKDNNGT
                     VCSLPPLINSDHSKISLDTKNIFIEITAVDKTKAEIVLEQLVTMFARYCKEPFSVEPV
                     EIVSEHNGESRITPNLKEKEMDVSVDYINSCLGLELAPNEIAACLKKMSLDVISSGND
                     KTLRVLIPVTRSDILHPSDIMEDAAIGYGYDNLPKGEKLSNANFIATPLPINKVSDIF
                     RIASSQASWAEVLPLTLCSHDENFKCLRLTDDGTQAVKLANPKTLEYQVVRTTLLPGI
                     LKTVKENRKHSLPIKVFETGDIVLKNDKLERKAFNERHWGAIHVGKTSGFELTQGLLG
                     KIMQTFRTDWLADYGASSNGRGYWIEQDESLPTYFPGRGARVMFRSKEGETAKMIGHL
                     GVLHPEVMINFDVPYAASYVELNAEVFL"
     gene            complement(<255189..>260003)
                     /locus_tag="ZYRO0F03014g"
                     /db_xref="GeneID:8205085"
     mRNA            complement(<255189..>260003)
                     /locus_tag="ZYRO0F03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497284.1"
                     /db_xref="GeneID:8205085"
     CDS             complement(255189..260003)
                     /locus_tag="ZYRO0F03014g"
                     /note="similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
                     ACR218Wp and some similarites with YFL033C uniprot|P43565
                     Saccharomyces cerevisiae YFL033C RIM15 Glucose-repressible
                     protein kinase involved in signal transduction during cell
                     proliferation in response to nutrients specifically the
                     establishment of stationary phase originally identified as
                     a regulator of IME2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497329.1"
                     /db_xref="GeneID:8205085"
                     /db_xref="GOA:C5DX85"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DX85"
                     /translation="MSEYCEEGIVTPNRSKSIASSTSESSSNYDKYLQLATEKNPVML
                     LELDQDGTIRYLSDLWEKIVGPRDCSQIADLIVGSIEDKYVFHRAIEMMLINDSVSYT
                     VTFNVVTGDNNDDNTGKDESEEGCGDVSDMNQIMTLEACGILIRDNETQLPTHSMWTV
                     KPYDPEWYHEETLADLPEEFVKRLGFGATIFAEYLRLVDYKHCLDGSDLPAPKMELCR
                     VCETFVPAWWLETHAQSCVCEHRIDSWIHLLHDSLVEQAAMLENDPELSNGYKGLSVS
                     MDSLASKNIMASLKELCEISININPSELRSVKSATAEDLLINPIGLTQERIEGFYDFS
                     PRSKWNIQNVKNWHLSFKEEIDQDQGLALLVHETIDLAKQKVEALLRFDNAMTYSLRI
                     KNEVNNWVIQLIAQRIENNKTNSRLVTEYADSPIADTSMQSQSSQPLRQEALIPSTAL
                     AEGSIIPSENSSAKTNRNSSGNISRCASQTCGSSSQHSTVNSGTSSARSTFSPKIASP
                     QPHRPRSDLFSRSYLMADNLPNPELPPLDTEAGKRETDVCPCSSSSNSNTSATQSANK
                     SQSRSFTPNHKNDDQHQPFSFLRTASSGTLNSNDKPDNNSGLFSSQGPIRIDSKGSAN
                     LPKLKSTISLTPGRCSPLPAALTNSQVSRKNSGSQPRGGTDSSGMSSPYANSRDYLTP
                     EQQPNSSNLPKQPLSPLLLATNQIKSPAPSIKDYTVLKPISKGAYGSVYLARKKLTGE
                     YFAIKVLRKSDMIAKNQVTNVKSERAIMMVQSEKPYVAPLYASFQNRDNLFLVMEYLP
                     GGDLATLIRMMGYLPEEWTKQYISEVIMGVDDMHQNGIIHHDLKPENLLIDCRGHVKL
                     TDFGLSRAGLVRRHKNVHTSKHFSFSNISSSQSPVSPILGSGAGRSNHKRKSSLKHEF
                     SESSSTSSPSADEVTTRGRRYSESSAHSHGDIFALKRSDSQVSFSITNISRSNTPTPP
                     LFDTSHMRTSSNTSDKMMDTGNPIDLALFHPEDSKQDKNFFGTPDYLAPETIEGTGEG
                     DACDWWSVGCILFEMLLGYPPFHEKTPEEVFKNILACNIEWPEFTSPEDQKEFETSYA
                     RDLVSKLLVLDPAKRLGSNGAQEIKEHPYFSDVDWDRVYEEEPSFVPSVEDPEDTEYF
                     DLRGAAIEDFGPDYDGREMTVGEEGEDEGQLTSLSPSIDTSKRSSGATAAGQENTIQT
                     PMNKLSPFALDSESHDNNSTLSSPIMKHIPLAIPPHMRDRRVSKLNESQTEFGSFYYR
                     NLSALDKANKDAINRLKNEHLTDSPGLHRRTSSASHFSSSSDSSGSKIKLGKVSASVC
                     GSPGGNLAGKTSITRAGSPTFRSSSPDRSINTDLMGGHSRKGSGESSNNFSGGYHLQF
                     TEDSPSSSRVKSPVSPNTSIVAAGSGSILPTLISSSSSMGSDRTKAITRSGSQRANSN
                     EYNESDRLQAVSKVQSMRYRRRSGRKSSNTEDVRYYMDVLVCEPISIHRYRVTRELED
                     LGCAVIAVGAGDELIGRATSGIKFDLIMTALKLPKLGAADIVSLLKYTNGTNSTTPVV
                     ALTNYYQEAVSLNLFNDVLEKPVLADSLRKIVAKYALKKSQQQEETIFSDND"
     gene            <260534..>261289
                     /locus_tag="ZYRO0F03036g"
                     /db_xref="GeneID:8205086"
     mRNA            <260534..>261289
                     /locus_tag="ZYRO0F03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497285.1"
                     /db_xref="GeneID:8205086"
     CDS             260534..261289
                     /locus_tag="ZYRO0F03036g"
                     /note="similar to uniprot|P54964 Saccharomyces cerevisiae
                     YLR059C REX2 RNA exonuclease required for U4 snRNA
                     maturation functions redundantly with Rnh70p in 5.8S rRNA
                     maturation and with Rnh70p and Rex3p in processing of U5
                     snRNA and RNase P RNA member of RNase D family of
                     exonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497330.1"
                     /db_xref="GeneID:8205086"
                     /db_xref="GOA:C5DX86"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:C5DX86"
                     /translation="MFSILCGARTVSKRYLGSLYRPFNPYLSKMSEKRSIWKPLVWVD
                     CEMTGLDHNSDRIIEICCIITDGHLSVVDNNCYESVIHCDKSILDQMGPWCVEHHGSS
                     GLTQKVLDSDKTREQVEEELLQFIRKYVPEPRTGVLSGNSIHMDRLFMLKDFPRVLEH
                     LHYRIVDVSTIMEVSYRHNPGLASQQPKKLGAHTAKQDILESIQQLRWYMDNYFKPPE
                     GSDTLDKRTISDANGGDGKQSEGEPDSKRTRQE"
     gene            <261467..>262468
                     /locus_tag="ZYRO0F03058g"
                     /db_xref="GeneID:8205087"
     mRNA            <261467..>262468
                     /locus_tag="ZYRO0F03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497286.1"
                     /db_xref="GeneID:8205087"
     CDS             261467..262468
                     /locus_tag="ZYRO0F03058g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497331.1"
                     /db_xref="GeneID:8205087"
                     /db_xref="GOA:C5DX87"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR026992"
                     /db_xref="InterPro:IPR027443"
                     /db_xref="UniProtKB/TrEMBL:C5DX87"
                     /translation="MKLSVVDISKPEEQILEPLLEAATKQGFLLIDGHAFTQSEVDEL
                     FTISEGFFTGTGQNEKLKYPIDQRNFGYSGFNVENLNPNKSVDYKEGFNFSQINFADG
                     IVNQTPNYELNQFDSTNPLPPFFSERLDFLSKIIIKLHAQARRIIQLLSMAMGVEDVN
                     FFLKRFEPSKPSPSTFRMLHYPLVRSNSSGKADPHVRAGAHTDYGALTLLFQRKGEQG
                     LQLQLDGCSWTDVEFVPTKHKGMAPPLVINFGDMMSYWTNGVLKSTMHRVRFEPGQTR
                     DSDRYSMVFFFEPTVTTKLIPVPCEMVQTQKGQTVARPEMTSLEYLQKKLESTYSYR"
     gene            complement(262499..262570)
                     /locus_tag="ZYRO0F03080r"
                     /db_xref="GeneID:8205088"
     tRNA            complement(262499..262570)
                     /locus_tag="ZYRO0F03080r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (CTG) cove score=69.19"
                     /db_xref="GeneID:8205088"
     gene            <262929..>263600
                     /locus_tag="ZYRO0F03102g"
                     /db_xref="GeneID:8205089"
     mRNA            <262929..>263600
                     /locus_tag="ZYRO0F03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497287.1"
                     /db_xref="GeneID:8205089"
     CDS             262929..263600
                     /locus_tag="ZYRO0F03102g"
                     /note="some similarities with uniprot|P41546 Saccharomyces
                     cerevisiae YFL031W HAC1 bZIP transcription factor
                     (ATF/CREB1 homolog) that regulates the unfolded protein
                     response via UPRE binding and membrane biogenesis ER
                     stress-induced splicing pathway utilizing Ire1p Trl1p and
                     Ada5p facilitates efficient Hac1p synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497332.1"
                     /db_xref="GeneID:8205089"
                     /db_xref="GOA:C5DX88"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C5DX88"
                     /translation="MSEDLVIPSDFKSTLPPRKRARTQEEKEQRKIERILRNRRAAHQ
                     SREKKRVHLQRLEQKCKLMESLLGRIDDLDGLIRDKKGKDLLKQYRSFAASDDEDEYE
                     NENQNGSCDKEETPSSGISSESVSSVKSESEAGLVQLQTPENYKVEEDTGISEFAAPT
                     DLTPVSFVNEDPKSFNLVLTNNGDSDTLAPSQPLQPVWLGVEDDDDGSFEFDDWRNPA
                     VIAVS"
     gene            <264159..>265271
                     /locus_tag="ZYRO0F03124g"
                     /db_xref="GeneID:8205090"
     mRNA            <264159..>265271
                     /locus_tag="ZYRO0F03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497288.1"
                     /db_xref="GeneID:8205090"
     CDS             264159..265271
                     /locus_tag="ZYRO0F03124g"
                     /note="similar to uniprot|P43567 Saccharomyces cerevisiae
                     YFL030W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497333.1"
                     /db_xref="GeneID:8205090"
                     /db_xref="GOA:C5DX89"
                     /db_xref="InterPro:IPR000192"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020578"
                     /db_xref="InterPro:IPR024169"
                     /db_xref="UniProtKB/TrEMBL:C5DX89"
                     /translation="MVDTLLIPGPIVLSANVQKALGTPSLAHTSPEFLTVFSRVLQNT
                     RKVFRADPKKGQPYVLPGSGTLGWDIAASNLICPNEKALVLSTGFFSDSFAECLKLYG
                     ADVDKLDAPIGGIVDPSEVESHLQKNKYRLITITHVDTSTAVLTDVKKITEIVHRVSP
                     ETFIIVDGVCSIGCEEFEFEKWGIDFALTASQKALGAPPGLSVSMISQRALDFAQHPE
                     TPTRSFFGSLKRWSPVMQNNESGKAAYFATPAVQLVNSLDVSLDEILQDTLEKRWEQH
                     KKTSDWFKGKLTNELNLKLVSEPQASASGLTAVYVNEPPKVVSYLKQNGVVIAGGIHS
                     EIGGKYIRVGHMGVSVVDPKLDHIPRAYELIKEAMH"
     gene            <265727..>267136
                     /locus_tag="ZYRO0F03146g"
                     /db_xref="GeneID:8205091"
     mRNA            <265727..>267136
                     /locus_tag="ZYRO0F03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497289.1"
                     /db_xref="GeneID:8205091"
     CDS             265727..267136
                     /locus_tag="ZYRO0F03146g"
                     /note="highly similar to uniprot|P37291 Saccharomyces
                     cerevisiae YLR058C SHM2 serine hydroxymethyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497334.1"
                     /db_xref="GeneID:8205091"
                     /db_xref="GOA:C5DX90"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="UniProtKB/TrEMBL:C5DX90"
                     /translation="MPYALSESHKKLVSSHLSETDPEVEQIIKDEIERQKHSVVLIAS
                     ENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEQIDKMEILCQNRALEAFHLTSDKW
                     GVNVQTLSGSPANLQVYQALMKPHERLMGLYLPDGGHLSHGYATENRKISAVSTYFES
                     FPYRVDQTTGIIDYDTLEKNAILYRPKILVAGTSAYCRLIDYKRMREIADKCGAYLMV
                     DMAHISGLISAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRRGVRNINPKTGNEVL
                     YDLENPINFSVFPGHQGGPHNHTISALATALKQATTPEFKEYQVQVLKNAKALENEFR
                     KLGYRLVSDGTDSHMVLVAIKEKGVDGARLEYVCENINIALNKNSIPGDKSALVPGGV
                     RIGSPAMTTRGMGEEDFAKIADYIHRAFNIALATQKSLPKEANRLKDFKAKINEGSDE
                     ITALRKDIYDWAGEFPLPV"
     gene            complement(<267363..>269849)
                     /locus_tag="ZYRO0F03168g"
                     /db_xref="GeneID:8205092"
     mRNA            complement(<267363..>269849)
                     /locus_tag="ZYRO0F03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497290.1"
                     /db_xref="GeneID:8205092"
     CDS             complement(267363..269849)
                     /locus_tag="ZYRO0F03168g"
                     /note="similar to uniprot|Q7LGY1 Saccharomyces cerevisiae
                     YLR057W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497335.1"
                     /db_xref="GeneID:8205092"
                     /db_xref="GOA:C5DX91"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:C5DX91"
                     /translation="MTLLKLIHIWVKRVQSFLLLGVTISLLFYYTFENEIDMLNSYAE
                     NEYMPPINGALTNHEINSQVDTAVKPVSDSAQGLPSSKPSAEVDVASTVPAAPVTPQA
                     PVDHSPAEPIIIDLRDPKVLKEKNKYFPLLLSSPWRGSTKFQDRWINPEIDDLSSHKD
                     RHAVLNEVSLPLNFQQVPKDYPNVQASSFEDGGHQQNQLLQQVRQLFVKSWDQEELSR
                     PDLAAEPWPLSLIDSLDTLYIMGQMSKFDDAVHLISTVDFTIPPITENSVDIPDVSTR
                     ALGGLISAYELSEEPVLLAKAKDLANFILRAFDTPNRIPILQYFWKTEYGNRFPYQYM
                     NVGSLTNVALEFTRLAQITHSNSYFDAIQKIFGTIALSLDEFAIEHMFPTTVDGSGCR
                     ILTPKEVSTGHHLRNPKVMKSIDQNLEFIHCHQTGKFLISPRDWEKKEQLFKMDYQHQ
                     SVYSNLVKIYHLLNGHDILTISKTYHPMDSGEEVENIGKNTADDMKDEEAEHPDSSEK
                     LQMHSSKQLFSIAMRKIRHLMLYRPLSPVADHNLTLISSFRTKTRISPSTDELQVEIK
                     RLFDMNHEGCSLATTLGLASGLFNNTEYLRLAKKLTHSYYEMIKLFGGIFPEELYLDP
                     CEKETCLFDKNEKIQSILDGQYTNQDALTVGDAKVELDSLQTQKASGGMRKILMFGLT
                     QGIGEFNYGVQDIDRKLGKWKHDPDRPFWVNKIGKRHLLSPNVIESIFYMYRITGESQ
                     WRKMGAELLKMTIENLQKYHSGAKGVWSVREFEDDEDSSIPSSWFSQTLKYYYLLFSD
                     TSDYTLDRYLFTSGGHLMKRDPRNKSNLQQ"
     gene            complement(<270262..>271371)
                     /locus_tag="ZYRO0F03190g"
                     /db_xref="GeneID:8205093"
     mRNA            complement(<270262..>271371)
                     /locus_tag="ZYRO0F03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497291.1"
                     /db_xref="GeneID:8205093"
     CDS             complement(270262..271371)
                     /locus_tag="ZYRO0F03190g"
                     /note="similar to uniprot|P43568 Saccharomyces cerevisiae
                     YFL029C CAK1 Cyclin-dependent kinase-activating kinase
                     required for passage through the cell cycle phosphorylates
                     and activates Cdc28p nucleotide-binding pocket differs
                     significantly from those of most other protein kinases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497336.1"
                     /db_xref="GeneID:8205093"
                     /db_xref="GOA:C5DX92"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DX92"
                     /translation="MVDSNNPEEFHNLKHTRFATISSNGSYVVKSICTDITVPPHDSR
                     SELAILKKLNQGDEGHIVKLLGYECDEEYLKLLLPLYDMDLGEYMRSCYRPPKKNSKK
                     FNPYLSFTGAQTVDDQPQVCENQLDVDRYAYDFFLQLSSALQFIHSHGIIHRDLKPQN
                     VLLNRVENPQLVLTDFGISYDTEDPIQLQREDPNAKITDVSTSIYKAPELLFGVKNYK
                     FAVDVWALLIIISQWFQTEANLSSTTLPAMVDDGSGQLEDGEAGSDIRLIFSIFSNLG
                     IPAIAQWTEVEKYGSSEAFQGMFGSDGDGNYLLNKTRDDQLQTIHKLMPRLKEIQDEA
                     TKRLIENCILGIISFESCQRWSSKRIVHELTKLNL"
     gene            complement(<271599..>272699)
                     /locus_tag="ZYRO0F03212g"
                     /db_xref="GeneID:8205094"
     mRNA            complement(<271599..>272699)
                     /locus_tag="ZYRO0F03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497292.1"
                     /db_xref="GeneID:8205094"
     CDS             complement(271599..272699)
                     /locus_tag="ZYRO0F03212g"
                     /note="highly similar to uniprot|P32353 Saccharomyces
                     cerevisiae YLR056W ERG3 C-5 sterol desaturase catalyzes
                     the introduction of a C-5(6) double bond into episterol a
                     precursor in ergosterol biosynthesis mutants are viable
                     but cannot grow on non-fermentable carbon sources"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497337.1"
                     /db_xref="GeneID:8205094"
                     /db_xref="GOA:C5DX93"
                     /db_xref="InterPro:IPR006694"
                     /db_xref="UniProtKB/TrEMBL:C5DX93"
                     /translation="MDLVLEVCDTFLFDKLYSTVLPASLAAGIPPKWQQKLVLNAGVN
                     NQTLLQDSLFHLNNLPRVNKEVYGQTPFLLAMTKDTFGSLLGRTNLVRQILSLWAVVT
                     VFGWLLYLISASLSYVFVFDKSIFNHPRYLKNQMALEIKLAMSAIPWMSLLTVPWFAL
                     ELHGYSKLYFYADFENHGLRNILLEFLSFIFFTDCGVYFGHRFLHFPPVYKRLHKPHH
                     KWLVCTPFASHAFHPVDGYIQSLPYHIYPMLMPLNKVSYLLLFTFVNCWTVMIHDGNH
                     MANSAVVNGTACHTVHHLYFNYNYGQFTTLWDRIGGSYRRPEDELFDPKLKDEETLKR
                     QINEIESYIKEVDGEDGSYRVYGTEEKLKKVN"
     gene            complement(<273742..>274569)
                     /locus_tag="ZYRO0F03234g"
                     /db_xref="GeneID:8205095"
     mRNA            complement(<273742..>274569)
                     /locus_tag="ZYRO0F03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497293.1"
                     /db_xref="GeneID:8205095"
     CDS             complement(273742..274569)
                     /locus_tag="ZYRO0F03234g"
                     /note="similar to uniprot|P43569 Saccharomyces cerevisiae
                     YFL028C CAF16 Part of the evolutionarily-conserved
                     CCR4-NOT transcriptional regulatory complex involved in
                     controlling mRNA initiation elongation and degradation
                     putative ABC ATPase interacts with Ssn2p Ssn3p and Ssn8p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497338.1"
                     /db_xref="GeneID:8205095"
                     /db_xref="GOA:C5DX94"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DX94"
                     /translation="MSLALEVNGLTYKFSATDEPSLVDINLRIPWNTRTLVVGANGAG
                     KSTLLKVLSGKHLCLDGSVHVNGVDPFSPQSTSEDGELLTNYLGTEWCHMSIINRDIG
                     VLELLESIGLQHYKERGELLCNILDIDVHWRMFKLSDGQKRRVQLAMGLLRPCKVLLI
                     DEVTVDLDVVARQRLLKFLEYETRTRKCSVVYATHIFDGLAQWPNQLIHMRMGRIVDR
                     LDCDKNLSFIEGDEEKLDIKRQDDNSVAVSVPKVGSLYPLAMKWLVKDPQETEETHV"
     gene            <274828..>276807
                     /locus_tag="ZYRO0F03256g"
                     /db_xref="GeneID:8205096"
     mRNA            <274828..>276807
                     /locus_tag="ZYRO0F03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497294.1"
                     /db_xref="GeneID:8205096"
     CDS             274828..276807
                     /locus_tag="ZYRO0F03256g"
                     /note="similar to uniprot|P38915 Saccharomyces cerevisiae
                     YLR055C SPT8 Subunit of the SAGA transcriptional
                     regulatory complex but not present in SAGA-like complex
                     SLIK/SALSA required for SAGA-mediated inhibition at some
                     promoters"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497339.1"
                     /db_xref="GeneID:8205096"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DX95"
                     /translation="MDDVDDILNNGRAAEDDMADEDDMADEDEEGEKEEEEVDAEQND
                     EDDDDDDDDDDDDDGLGLKSGASETGNQDDDDNDNEDEDDDDEDDEDDDDSEGGSDDG
                     NDLNSENLSQQTGPGNSKGQEIEREREREEDRSKNDARQREDEREDMRDSQRFQGAFN
                     GTPETANGEQSDQQDQDVEMKDANGDGENGGEPVGEETSAASKFDNLYNYYTQMLRSA
                     KISDTYNIYPTAAIPIQTDVNALAMSKGLKYLFLGGSDGFIRKYDFLNTMDGKLALTI
                     LQKHSLAESIQNAGILVSYWENEIPQKKSEVKFLKNNKEYEPKVSPVYSLEVQSECLF
                     LLSGLDNGGITLQGVRYMEGSIGHYFKGRDGHNSIVNLLKLNGSEDRFYSGSWDKRLL
                     EWDLQTGGILNEFKGGTSEYSAIEMRPQFSSVNISEVATNLKASSGQDQDEDDDMGSL
                     FGDDEEEDPNVKPDAEDEKPAQNPASALEEISRTTLNVVYDESVFMTSGLNGSVHIWD
                     RRTTNAPVLKLERGPKVPPWCQSACWSMDGDHVYVGRRNAVVEEFDLKNPTQPSNTLK
                     LPGISGPVSCVKAMPNNRQILCASKDNIRIYDTKADFSKGSTIPFLIVPGHHGGSISN
                     LYVDPTCRFLVSTSGSRGWQGNSTDTTFIYEIDLE"
     gene            complement(<276932..>278602)
                     /locus_tag="ZYRO0F03278g"
                     /db_xref="GeneID:8205097"
     mRNA            complement(<276932..>278602)
                     /locus_tag="ZYRO0F03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497295.1"
                     /db_xref="GeneID:8205097"
     CDS             complement(276932..278602)
                     /locus_tag="ZYRO0F03278g"
                     /note="similar to uniprot|P43570 Saccharomyces cerevisiae
                     YFL027C GYP8 GTPase-activating protein for yeast Rab
                     family members Ypt1p is the preferred in vitro substrate
                     but also acts on Sec4p Ypt31p and Ypt32p involved in the
                     regulation of ER to Golgi vesicle transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497340.1"
                     /db_xref="GeneID:8205097"
                     /db_xref="GOA:C5DX96"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5DX96"
                     /translation="MRPPTVIRQPSFTTDQSLHHCELLAESLFDEKSIATFFTHQEQK
                     DFKSRLIANSLENRDITALLKLGVSNFGFVTTDLRKESWYLLLSEQLVLPEEPKNEAD
                     NEFRHRDENQVQLDVNRSFSGIRDPQRKEKLRKLLENVIIHILRKHRQLNYYQGYHDV
                     VSVFIIVFAQGKEYYPQGGVQEDVLCFSDMTNRDNEDISLSTEDVSNSTSSTSTQVFE
                     NEDYDAKKGFLVDEEKLFRCVEAFTLLYLRDFMMDSLDFPIDQLRIIPRLIKSIDTSL
                     YKKLQLDKVEPFFAVSSILTVFSHEMKPTEDKELSTIFCIFDYIISTQSMSVPLLMYA
                     NLVVENKQRLLEEYDANLNNFENFIDLVHGVMQKVLLGVSHDEKLWDKILQKMRTSVK
                     SVDFSYKKLVNKFSVLVTTAAGKATFTSQRDSQTRYDLNYVENLLTNEIQLNTNRKSL
                     NNQRKSEKSSSFALLHRLSSLTCSSSFIYKISIFIGLMALLIKFHRDGSIKQFIPQIK
                     LYIGNLRSSSLAGLYQESKYVWLDPLHGLLQTMATPVSSMNSSFVVNN"
     gene            <279470..>280801
                     /locus_tag="ZYRO0F03300g"
                     /db_xref="GeneID:8205098"
     mRNA            <279470..>280801
                     /locus_tag="ZYRO0F03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497296.1"
                     /db_xref="GeneID:8205098"
     CDS             279470..280801
                     /locus_tag="ZYRO0F03300g"
                     /note="similar to uniprot|P06842 Saccharomyces cerevisiae
                     YFL026W STE2 Receptor for alpha-factor pheromone seven
                     transmembrane-domain protein that interacts with both
                     pheromone and a heterotrimeric G protein to initiate the
                     signaling response that leads to mating between haploid a
                     and alpha cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497341.1"
                     /db_xref="GeneID:8205098"
                     /db_xref="GOA:C5DX97"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="UniProtKB/TrEMBL:C5DX97"
                     /translation="MSEINNSTYNPMNAYVTFTSIYGDDTMVRFKDVELVVNKRVTEA
                     IMFGVKVGAASLTLIIMWMISKKRTTPIFIINQSSLVFTIIHASLYFGYLLSGFGSIV
                     YNMTSFPQLISSNDVRVYAATNIFEVLLVASIEISLVFQVKVMFANNNGRRWTWCLMV
                     VSIGMALATVGLYFATAVELIRAAYSNDTVSRHVFYNVSLILLASSVNLMTLMLVVKL
                     VLAIRSRRFLGLKQFDSFHILLIMSCQTLIAPSILFILGWTLDPHTGNEVLITVGQLL
                     IVLSLPLSSMWATTANNTSSSSSSVSCNDSSFGNDNLCSKSSQFRRTFMNRFRPKSVN
                     GDGNSENTFVTIDDLEKSVFQELSTPVSGESKIDHDHASSISCQKTCNHVHASTVNSD
                     KGSWSSDGSCGSSPLRKTSTVNSEDLPPHILSAYDDDRGIVESKKIILKKL"
     gene            complement(<280917..>284039)
                     /locus_tag="ZYRO0F03322g"
                     /db_xref="GeneID:8205099"
     mRNA            complement(<280917..>284039)
                     /locus_tag="ZYRO0F03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497297.1"
                     /db_xref="GeneID:8205099"
     CDS             complement(280917..284039)
                     /locus_tag="ZYRO0F03322g"
                     /note="similar to uniprot|P43571 Saccharomyces cerevisiae
                     YFL025C BST1 GPI inositol deacylase of the ER that
                     negatively regulates COPII vesicle formation prevents
                     production of vesicles with defective subunits required
                     for proper discrimination between resident ER proteins and
                     Golgi-bound cargo molecules"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497342.1"
                     /db_xref="GeneID:8205099"
                     /db_xref="GOA:C5DX98"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DX98"
                     /translation="MVMGVRRVLSSLARRGYNASPLPLINSIFQDNSDSTRKISRVGG
                     CDQDEAKPEDYGADLTLIDLNQQQTRKCRCRMKVIAAIGMILALVTAYFTVFGTFHGA
                     DSPKCHSVYMYPSYAKIDGFDSKFTSLAQKYHLYLYREQGLDTEPMEDNSIQLDGIPV
                     LFIPGNAGSFKQVRSIAAICSELYFASEGEIKNPYRRNLDFFAADFNEDFTAFHGRTM
                     LDQAEYLNDAIRYILSLYGQNYSYEGPIPTSVIILGHSMGGLVARILPTLQNHVPDSI
                     QSIITLSSPHAASPVTFDGDILKIYQQTNDFWSSQFQDRDSFMSKNVSLISITGGILD
                     STLPADYTAIENIIPLENGFTTFSTGIPDVWTPIDHLAIVWCNQLREVIGRLLLETVN
                     TNSTEKVLPLKERMSISRKLLLSGLEEYASRDFDLADPQHHFKNYEAKDFEGAEVVKL
                     DERFTVSPDNVDVSAKYTKFILPDSDPTAMFYFLTSMSSTSMHFCKEGKFINEKKGSI
                     LECVDAEPNLLHIPASSEYTESPGDSGMDGSSEPFKFLELDGRVLSHYDFVLLKSPNL
                     ADITNEDFMIAGVTSGINMTISPVTPLEVALYGFEIELNSQFSWHEVSLPNLWESLIA
                     YELDVKMDHTGGNPIFEPFIRQWNHDPGETKWHVNVAQKKTDIFMHNVAPFVPLEETH
                     DKALKLKVFQPPNSNLRLRMKINWKMTLQMLFLRYRLSFLALPISVVSIVMAYQFFWY
                     NKTSNFLNFEDALSLILYKYWISITIFLIALSPIVNSEIVQKLLFTLDPIGFNRPFLL
                     GNIHMHANLYFLGIRNNYMLGLGVFFTLMTIGVLVFISHLSRFLDQIIHKLKKIGLFP
                     SPKVDTSMPESQLLGLTRLSTSLLLILAVVLYIPYQLAAAICLVIQIGTCLRITFISE
                     NNRTREYLNLKNYNFCVFLLLTLIVAVDSPIIIVFLHNIAIRWETPFKSHHNFVAVAP
                     MILLVGMNSRLNIPQYSKFDGIIILGLLSYMGFFSLIYGTRNLYWTHHLCNITCAWLL
                     YGMKQIIGQT"
     gene            complement(<284536..>287238)
                     /locus_tag="ZYRO0F03344g"
                     /db_xref="GeneID:8205100"
     mRNA            complement(<284536..>287238)
                     /locus_tag="ZYRO0F03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497298.1"
                     /db_xref="GeneID:8205100"
     CDS             complement(284536..287238)
                     /locus_tag="ZYRO0F03344g"
                     /note="similar to uniprot|P43572 Saccharomyces cerevisiae
                     YFL024C EPL1 Component of NuA4 which is an essential
                     histone H4/H2A acetyltransferase complex homologous to
                     Drosophila Enhancer of Polycomb"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497343.1"
                     /db_xref="GeneID:8205100"
                     /db_xref="GOA:C5DX99"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR024943"
                     /db_xref="UniProtKB/TrEMBL:C5DX99"
                     /translation="MPTPTNSSSNGTKNRIKDHSPGSPATTPNVAAAGSAGSSAEIAA
                     NASRFRHRKISVKQRLKIYRPNDLKSLNQNELQEREMMEIETGMEKNEEKEVHLNRIL
                     QKGANLSDESRKREYIPTPKATATWTDFDKFYQGRFKEPSSYIKFSATLEECCGAPYS
                     MDEKDEEFLEGKINAGKEKEDEKLSEDEFEILCSSFESAIHERQPFLSMDPETILSFE
                     ELKPTLLKADLLNQQLKQQLGKEIGYKEDQIFTTQLESIDCQSGIRPLSQVIEKFGVQ
                     VYEYWKQRKINSSNTEIFPQLRFERPDEKDDSNPYVCFRRRDVRQPRKTRRVDILNSQ
                     KLRLLHQELEHAKDMALLVARREKVTLDLLEQNMRIFDQRSNVKRLKRSLGIRGEDED
                     LVNHKRKRLNVVAQSQMKQNAGAAGAAEAAVSSPASSSTNAVTTSDSSVKRGLKGRIL
                     KKNLEHLAKSGQKLTKQQLQQLQAQNLAIASGKHAGHMHAQQVQQAQQAQQALQAQQA
                     QQAQQQQQQEQPQVQQSQQAQQGQSIQSHVYVRLPSSKVPDITLDDVDHLLTNKERNA
                     RKFVHDRMEKRKLEDKDLFNLTDDPYNPVFDITLPKDVLPNNSPFSSIASSKYEINRS
                     YYCGNLPAYLNGNTDDITAYNHEGEKLPSNNFKVKKLEVYDPFQTNNEIHSKEYPVKF
                     RKRVGRCGIQYIDRKPNHMEKSVDSVLNQFLDFDAIESQEQNPQETINVYDSKWDEFS
                     RLYDKWQHDSPRNEYGLKVLEEPSRLNQISNETQVIRFGTMLGSKSYEQLRDVTIKYR
                     QEYVARMRQQKLNQKQLQLQQQQQQQIQQEQEQEQELQQQEQEQQQQSQHARSPSLSA
                     TSSLSQPSSKMESSPAMPKKVNGISNQHHTKPHQGVPVTQKKSS"
     gene            <288271..>290865
                     /locus_tag="ZYRO0F03366g"
                     /db_xref="GeneID:8205101"
     mRNA            <288271..>290865
                     /locus_tag="ZYRO0F03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497299.1"
                     /db_xref="GeneID:8205101"
     CDS             288271..290865
                     /locus_tag="ZYRO0F03366g"
                     /note="similar to uniprot|P43573 Saccharomyces cerevisiae
                     YFL023W BUD27 Protein involved in bud-site selection
                     nutrient signaling and gene expression controlled by the
                     TOR kinase diploid mutants display a random budding
                     pattern instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497344.1"
                     /db_xref="GeneID:8205101"
                     /db_xref="GOA:C5DXA0"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:C5DXA0"
                     /translation="MNNLNVLGDSVRGTLGRLRDKHAFLHQQKRYYLDVRSRLLELNT
                     RKNGEDDDDDDDDNHDNTEEKIAETGLEFNDIIISTKRRIFISIGYEYFVERNEEEAV
                     AFADDKLSLISEAIVQFDDKIQEAELTERRIKELAEKGDDFEDEFQGDEEEGLPAMDI
                     REELDEDGNVISSSVTPSANQKTRKELEKTLLGEQHENNEQNGLSDFEKNLKGKLVKK
                     EEEKKKKERQEIEKREREEREKREQEEREKREQEERQREYDSRPPIDMDMENMYTFED
                     LVREMDERDELEDQLGEDEYLQSEDEDDEDEDEDDAFGYSVIPGSMAQSSFMEQIKKL
                     RRDRLPPPKSILKSRSKDSKPKKSVGFAENADVHEVENLKDANKGNHHNPLLQIDDDG
                     TVLSSEEFDSDLFAKLIGVQGPDEIHERYKEEVETKERQEEERAHSKKRVSRFKLERT
                     SKEENHVEREPAENGSDAAVSDVVEKEDPVAEDPASIEPRFQRSERSGVVSDIVEKED
                     PVTEEPAYTDPRFQRSGRNEAVSDIVEKEDPVTEKPTSIDPLFQRSGRNEAVSDIVEK
                     EDPVAEKPASIDPLFQRSRRNEAVSDIVENDVDDEGPVFERKLDIDHDLELELDPPHH
                     QKKFILRKPLRSLHKPKRKPQQRPKIEQLDSDEEDDKEIDEAKPLPNENNDDSSTDFP
                     PEVQKAARGPQKPVVIPNVDYKSLGENLDDMARAYALGVYDDDLHDDPGTLVEKLDDF
                     KNYNKQVEQLEDDIKEFRLNNPAQEEVNEDDDDDDNGPLMTDVVEKDLPSNYDEQYDE
                     DEDLSLHPDKLSESVAIDYLRFKESLMKDRFAEYRTDEEKQLEPIDEWGNPVKRSRFK
                     SQRFGLGN"
     gene            <291239..>292441
                     /locus_tag="ZYRO0F03388g"
                     /db_xref="GeneID:8205102"
     mRNA            <291239..>292441
                     /locus_tag="ZYRO0F03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497300.1"
                     /db_xref="GeneID:8205102"
     CDS             291239..292441
                     /locus_tag="ZYRO0F03388g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497345.1"
                     /db_xref="GeneID:8205102"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5DXA1"
                     /translation="MKSTAVEEKMDSSPTSSSRSRKNGFEELVRSMHESSNEVNLKEA
                     DLTSQEYIQKLVGDSLRTDFVSPFDKVADDSEFHYTSSFKARPQAEYFDFDEKYMYRP
                     EKRQERNDDHDEFETQYHESEYEDEDVDMEEVAEEVGDEVGDEADLQSVIDAVSLCKT
                     IFGDMIGKIDKVALTSMTYKTTKMGVSHMDREMSDILDTVRDLVPHSESTLSSTATQQ
                     LQQDHVEIQPSSHSALGAHSNVFQGPYNAIRSDPCARLPNFGVILIKSPASVSQLWDE
                     YTKIPAEWPVKDLFTFTLLQQGGPNNVSDIELITKRRTSIKQLEENLGSSWRNAEKNF
                     SRQINRRKKIWKPIEEGLSDGLPLQVCFSILENYAKNKGKGLSWYYNGVPFKLSDVYE
                     KLPASKKK"
     gene            <292952..>295480
                     /locus_tag="ZYRO0F03410g"
                     /db_xref="GeneID:8205103"
     mRNA            <292952..>295480
                     /locus_tag="ZYRO0F03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497301.1"
                     /db_xref="GeneID:8205103"
     CDS             292952..295480
                     /locus_tag="ZYRO0F03410g"
                     /note="some similarities with uniprot|Q12202 Saccharomyces
                     cerevisiae YLR054C OSW2 Protein of unknown function
                     proposed to be involved in the assembly of the spore wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497346.1"
                     /db_xref="GeneID:8205103"
                     /db_xref="UniProtKB/TrEMBL:C5DXA2"
                     /translation="MQGQGQISCIIVGETPDIQFLGWRLSLGSAFIVLVSQYVSSDGL
                     VGWKSSRLGANFYTPNVFAKEVGELSPKLLNPDNGKCKYPIDVIIISGISIGQFAENC
                     KAVSRFANPQTTVLVNASFGCELEEVALNVFDKNCKCVMSIACDIECRQLSLGSYALV
                     NDNNCKVYLGLTYTSQNDSDKALLSKNEASVREELDIQTDTNTNKLIKQLTVTKWVKV
                     QSYKNPQEMAVKIWEMIIPKISLNILSVIYEQFDYDTLLKNKSNEIVFRDLVKELFDI
                     CYAQCNAKVETFMSETNTSISSNKSTGAIDFNKIVDHCKSKRKELIKTTVNEYPEYLS
                     LPFESYCFYHRFEYPAHILLYQPILLAKKYNAQCSNLNFLYGFYSRLLSLSGLSIYGG
                     RSESHISVFDKRVAEASNNSNNSGNGHKRKTKKSSNRKKDKSKQVKKEKNQALVKVAK
                     PHPLWSGCRSNNELGLWAVAPPSGNELLLPDDLGNLYLAAENLNGPSSASVLSRSSNG
                     NNGYSIGKPKSMDSDDHYSTAESNDGGVVVGIDSDDERLKTRNSGRNSGSGGKRGGYL
                     DGSSGSMDVDDDEAETGSYYDQRAASTGTPSVNDSDDDYEEDDDDDYDYQEDDDDALE
                     IKMSSRSGKFKNRELINKIRKKKGGALENMGVIAVPHFIKRFSPKTPNNSNTSLAVFD
                     PATANDPSHAIKRPYTTTSLELQLRTGEHLIAKEYDDLHQQLTGPETDPSQVRQAHDN
                     RRRTFANVEKQFWKLQRRHNMYNRNISRPKTGPYEDLLDHMDILRRSNANEILDFTTS
                     RYGNAESCAKMQNDKNLILSLHESKLRASNKNKRKLRIGASSTS"
     gene            <296018..>296512
                     /locus_tag="ZYRO0F03432g"
                     /db_xref="GeneID:8205104"
     mRNA            <296018..>296512
                     /locus_tag="ZYRO0F03432g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497302.1"
                     /db_xref="GeneID:8205104"
     CDS             296018..296512
                     /locus_tag="ZYRO0F03432g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497347.1"
                     /db_xref="GeneID:8205104"
                     /db_xref="UniProtKB/TrEMBL:C5DXA3"
                     /translation="MMSVMSATESNAGRLAYDDQFDEMHNLGGLFTPQELPLDDSFEQ
                     DFDHLSGFLDLHGLQGAGGTGDNGTPNTQASTPIPSSEKRPPLARRARSNPFYCPSRQ
                     IMNLVQKKKISKKIKKENSDAFISMLSLSQSDSQSQQVMPREFEEKVKDAGSSYNTQT
                     EGSP"
     gene            complement(<296658..>298145)
                     /locus_tag="ZYRO0F03454g"
                     /db_xref="GeneID:8205105"
     mRNA            complement(<296658..>298145)
                     /locus_tag="ZYRO0F03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497303.1"
                     /db_xref="GeneID:8205105"
     CDS             complement(296658..298145)
                     /locus_tag="ZYRO0F03454g"
                     /note="highly similar to uniprot|P15625 Saccharomyces
                     cerevisiae YFL022C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497348.1"
                     /db_xref="GeneID:8205105"
                     /db_xref="GOA:C5DXA4"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:C5DXA4"
                     /translation="MSDFQLQILRKLGDLGEIPSTLQVFPDVDPQDVLSALNSLKAHG
                     KLEFKRYDSILYTATDEGKEIVAHGSHEIKLLQLINELGKLQIKDVPAKLGSTGKVGQ
                     ARAFKNGWIVKTKENELEPSEKVKGQLPADETQLAITKAVNGEKVDDKVVTDLKKRKL
                     ITPKKQTDFSVSKGADFSLEVAKPETDITADMIVSGSYKNADFKPYNFNSQGITVNCG
                     SLHPLSKVREEFRQIFFGMGFTEMPSNQYVETGFWNFDALYVPQQHPARDLQDTFYIK
                     DPLTSDLPSDKAYLNDVKAVHENGKFDSVGYRYTWKEQECQRLVLRTHTTPTSANMLH
                     KLAANPGPARLFSIDRVFRNEAVDVTHLAEFHQVEGVLADYNITLGDLIKFMEDFFAK
                     MGVTGLRFKPTYNPYTEPSMEIFSWHEGLKKWVEIGNSGMFRAEMLEPMGLPRDLRVL
                     GWGLSLERPTMIKYKVQNIRELLGHKVSLDFIESNPAARLDEELY"
     gene            complement(<298291..>299046)
                     /locus_tag="ZYRO0F03476g"
                     /db_xref="GeneID:8205106"
     mRNA            complement(<298291..>299046)
                     /locus_tag="ZYRO0F03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497304.1"
                     /db_xref="GeneID:8205106"
     CDS             complement(298291..299046)
                     /locus_tag="ZYRO0F03476g"
                     /note="similar to uniprot|Q12345 Saccharomyces cerevisiae
                     YLR052W IES3 Subunit of the INO80 chromatin remodeling
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497349.1"
                     /db_xref="GeneID:8205106"
                     /db_xref="UniProtKB/TrEMBL:C5DXA5"
                     /translation="MSTFEELLAQDKQLQYALQAVRHYHSEKVPEFLEKDSHNRRPTP
                     SSTPQGSTSTTPASTAGTAANANAQSQLNAGNNKRHIVNVDDISKINYEMIKNTPGNL
                     PDIDEKLDPKSNNSDGEISGLKTKLYKNRLYDLNDDFLEIISHRMPTEEKSSEPPLLP
                     LQDQVNLLSQIQRNLIGDYEDLLNTERKWFILKEILLDANAELDLFSTQEERKKTIKL
                     GATTVPPNANANALVFNRPKRQKAHGSRPDDIL"
     gene            <299249..>299866
                     /locus_tag="ZYRO0F03498g"
                     /db_xref="GeneID:8205107"
     mRNA            <299249..>299866
                     /locus_tag="ZYRO0F03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497305.1"
                     /db_xref="GeneID:8205107"
     CDS             299249..299866
                     /locus_tag="ZYRO0F03498g"
                     /note="similar to uniprot|Q12035 Saccharomyces cerevisiae
                     YLR051C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497350.1"
                     /db_xref="GeneID:8205107"
                     /db_xref="InterPro:IPR014810"
                     /db_xref="UniProtKB/TrEMBL:C5DXA6"
                     /translation="MDEVESLFRQLEQVNARPESNPSAKENGLQENQDLVKLDDEHAH
                     DGFESIEKSLKQLPKLQNGFDKLDAPKAVESKSYAVGKEKKNQHEGPTNEEWFTLPTP
                     TGEFAHRVQRDLQLIKHRASLDPKRHYKKEKWNAPERFAVGTIIEDKSEYFSGRLPRR
                     QRGETMLSTLLKDVDSRSYLKRKYGEIQTEKRGKRFGKNKKKGKR"
     gene            <300351..>301334
                     /locus_tag="ZYRO0F03520g"
                     /db_xref="GeneID:8205108"
     mRNA            <300351..>301334
                     /locus_tag="ZYRO0F03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497306.1"
                     /db_xref="GeneID:8205108"
     CDS             300351..301334
                     /locus_tag="ZYRO0F03520g"
                     /note="uniprot|P87016 Zygosaccharomyces rouxii SAT1
                     DNA-binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497351.1"
                     /db_xref="GeneID:8205108"
                     /db_xref="GOA:C5DXA7"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:C5DXA7"
                     /translation="MDYRIKLMETIDDSSTEAIWKMYSVAKASLPYKDRMSNLTWRML
                     GMRMAKERNKVESTSSISVPNSYSNSNDDESFSLVNVLEQDRELDHEQEHEQEHGQEQ
                     EQLHPQKQVDFDGDVDIWDPEILFKDMDIEGTSPTIQSETSDLLVNPLFDVTMLPQEP
                     PLTGGDSQTFLGQFLPPPTPSQDLLISNVDNDSSRRRKAPPAPAAVRQRRSSGVQKKK
                     PVPVRNNSTTSLMSMDEKMDSPPKDTKCTHCHTRTTPLWRRDPMGNPLCNACGLFLKL
                     HGVVRPLSLKTDVIKKRQRNTNGNKVKGVNRVRRQEKEGEEANWEWLSLSL"
     gene            complement(<301644..>303128)
                     /locus_tag="ZYRO0F03542g"
                     /db_xref="GeneID:8205109"
     mRNA            complement(<301644..>303128)
                     /locus_tag="ZYRO0F03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497307.1"
                     /db_xref="GeneID:8205109"
     CDS             complement(301644..303128)
                     /locus_tag="ZYRO0F03542g"
                     /note="highly similar to uniprot|P09624 Saccharomyces
                     cerevisiae YFL018C LPD1 Dihydrolipoamide dehydrogenase the
                     lipoamide dehydrogenase component (E3) of the pyruvate
                     dehydrogenase and 2-oxoglutarate dehydrogenase
                     multi-enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497352.1"
                     /db_xref="GeneID:8205109"
                     /db_xref="GOA:C5DXA8"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C5DXA8"
                     /translation="MLRSFVTKRTFSSSAVWLAAKKQHDVVVVGGGPGGYIAAIKAAQ
                     LGLDTACVEKRGRLGGTCLNVGCIPSKALLNNSQMYHQMKTDSKNRGIDIKGEVALNV
                     EQFQKAKDTVVKQLTGGIEMLFKKNKVAYYKGLGTFENENSIKVKPVEGLEGSVNEET
                     ILEAKNIIVATGSEVTPFPGIKIDEERIVSSTGALSLKEIPKRFVILGGGIIGLEMGS
                     VYSRLGSKVTVVEFQPQIGASMDNEVASTTQKFLKKQGLDFKLGTKVVSAERNGDVVN
                     IVVEDVKSGKQDKLEADAFLVAVGRRPYIQGLEAEKIGLEVDKRGRLVIDDQFSSKFP
                     HIKVIGDVTFGPMLAHKAEEEGIAAVEYIKEGVGHVNYNNIPSVMYSHPEVAWVGKTE
                     EQLKEAGINYKVGKFPFIANSRAKTNLDTEGFVKVLIDSETERLLGAHIIGPNAGEMI
                     AEAGLALEYGASAEDIARVCHAHPTLSEAFKEANLAAFDKPLNF"
     gene            <304068..>304298
                     /locus_tag="ZYRO0F03564g"
                     /db_xref="GeneID:8205110"
     mRNA            <304068..>304298
                     /locus_tag="ZYRO0F03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497308.1"
                     /db_xref="GeneID:8205110"
     CDS             304068..304298
                     /locus_tag="ZYRO0F03564g"
                     /note="highly similar to uniprot|P40204 Saccharomyces
                     cerevisiae YFL017W-A SMX2 snRNP G protein (the homologue
                     of the human Sm-G)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497353.1"
                     /db_xref="GeneID:8205110"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5DXA9"
                     /translation="MVSTPELKRYVDKKVLLQLNGARKVAGVLRGYDLFLNVVLDDAV
                     EVGKDGSHHNLGSQSVVRGNSIVSLEALDTVM"
     gene            complement(<304364..>304816)
                     /locus_tag="ZYRO0F03586g"
                     /db_xref="GeneID:8205111"
     mRNA            complement(<304364..>304816)
                     /locus_tag="ZYRO0F03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497309.1"
                     /db_xref="GeneID:8205111"
     CDS             complement(304364..304816)
                     /locus_tag="ZYRO0F03586g"
                     /note="similar to uniprot|P43577 Saccharomyces cerevisiae
                     YFL017C GNA1 Evolutionarily conserved
                     glucosamine-6-phosphate acetyltransferase required for
                     multiple cell cycle events including passage through START
                     DNA synthesis and mitosis involved in
                     UDP-N-acetylglucosamine synthesis forms GlcNAc6P from
                     AcCoA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497354.1"
                     /db_xref="GeneID:8205111"
                     /db_xref="GOA:C5DXB0"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DXB0"
                     /translation="MVPGYSIRRVEKQDYEGVLQALNALTTVGSVSKAQFEETVNHWN
                     NVKVSSGPDLLQYHPYVILHGEEVAATGMMFIERKLIHECGLVGHIEDIAVSPHHQGK
                     QLGRALIDHLTDLGLKHCYKVILDCDDSNVKFYEKCGYSRAGVEMQHR"
     gene            complement(<304940..>305986)
                     /locus_tag="ZYRO0F03608g"
                     /db_xref="GeneID:8205112"
     mRNA            complement(<304940..>305986)
                     /locus_tag="ZYRO0F03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497310.1"
                     /db_xref="GeneID:8205112"
     CDS             complement(304940..305986)
                     /locus_tag="ZYRO0F03608g"
                     /note="weakly similar to uniprot|Q12110 Saccharomyces
                     cerevisiae YLR049C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497355.1"
                     /db_xref="GeneID:8205112"
                     /db_xref="UniProtKB/TrEMBL:C5DXB1"
                     /translation="MQYIPPSQRLFNARHKVTRKDLVEDWDQLLDVDVDYGLYGVPLI
                     GSRRRTGSSSESDTSSIFSDLSGDSSIMDVYSRMQDNLSIEYVIQDNKKKILREEEAL
                     SLLKQSGGGRSRAKHELQRLKEENRSLLRRRDLLDARWNQIRFSPYLLMEAKRDGLYW
                     FGLPSDLRIHIYECCLDDVPVPAPDRFLNALKDCVPNEPLALQVFANLQNRQSLSSHA
                     AIPNAKIQSKFPGLHFHLQNTLKLNVFEDFIKPLIFHSLCHALEQHAADGVALELLDI
                     LVLSMPHQELDTVLLDDFLMNVLAQTHHKFFGDESAQVRRQVVEIKFDLIELLESMRQ
                     TKADSLQPVRPLPT"
     gene            complement(<306073..>306522)
                     /locus_tag="ZYRO0F03630g"
                     /db_xref="GeneID:8205113"
     mRNA            complement(<306073..>306522)
                     /locus_tag="ZYRO0F03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497311.1"
                     /db_xref="GeneID:8205113"
     CDS             complement(306073..306522)
                     /locus_tag="ZYRO0F03630g"
                     /note="similar to uniprot|Q12155 Saccharomyces cerevisiae
                     YLR050C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497356.1"
                     /db_xref="GeneID:8205113"
                     /db_xref="InterPro:IPR016964"
                     /db_xref="UniProtKB/TrEMBL:C5DXB2"
                     /translation="MAGLSSFQINFFYYYFLLHIPITLLIDSAVVLPPKFHVAGWLLS
                     KQIEDNNDFLLWDKPLWLQAFVTLELVVQLPLFFQFAKQLRQNQVDSGSLRLYGVLAS
                     TTTLVCIGAILEGHYPGTIVPLSAADKFKLVGIYFPTFIIPFRLVLL"
     gene            complement(<306692..>308080)
                     /locus_tag="ZYRO0F03652g"
                     /db_xref="GeneID:8205114"
     mRNA            complement(<306692..>308080)
                     /locus_tag="ZYRO0F03652g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497312.1"
                     /db_xref="GeneID:8205114"
     CDS             complement(306692..308080)
                     /locus_tag="ZYRO0F03652g"
                     /note="similar to uniprot|Q752R6 Ashbya gossypii AFR507W
                     AFR507Wp and some similarites with YFL016C uniprot|P35191
                     Saccharomyces cerevisiae YFL016C MDJ1 Protein involved in
                     folding of mitochondrially synthesized proteins in the
                     mitochondrial matrix localizes to the mitochondrial inner
                     membrane member of the DnaJ family of molecular
                     chaperones"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497357.1"
                     /db_xref="GeneID:8205114"
                     /db_xref="GOA:C5DXB3"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DXB3"
                     /translation="MFQALKNASRLGVQPSIYRQFHTTRRILQEFKDPYDTLGVGKSA
                     SPSEIKKAYYKLAKKYHPDINKEQGAGDKFHDLQNAYEILSDADKKSQYDQFGAAAFG
                     QGGAGGGPGGPGAGYGGFSDFSGFGNFGGINFEDLFGAAFGGGGGRSSRGSPFGSSMF
                     REYRGDPIEVSYRMPFKDAVFGAKDVNLKFRALDPCHTCDGSGMKTGAKPQSCPSCHG
                     TGTTVHVRAGFQMATTCQQCGGEGTTTKREDLCGSCHGDGVEWTKDKSVRVDLPQGLQ
                     DGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGDVLVRIRVDKDPRFSIRDKWDIWFIQD
                     IPITTAALGGTVQVPTVDGSHVRLRVQPGTQHDQIISIPNMGVPRVAGTRGSMKVQYK
                     IQVKKPQSKAERCLWEALANITNDSNAKRTENLEATEKATEAATTNPDNPSALGRLEN
                     FISNTFKKIKGE"
     gene            complement(<308753..>309331)
                     /locus_tag="ZYRO0F03674g"
                     /db_xref="GeneID:8205115"
     mRNA            complement(<308753..>309331)
                     /locus_tag="ZYRO0F03674g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497313.1"
                     /db_xref="GeneID:8205115"
     CDS             complement(308753..309331)
                     /locus_tag="ZYRO0F03674g"
                     /note="weakly similar to uniprot|P38276 Saccharomyces
                     cerevisiae YBR137W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497358.1"
                     /db_xref="GeneID:8205115"
                     /db_xref="UniProtKB/TrEMBL:C5DXB4"
                     /translation="MKQQLIDNLQAYKLHYCNHLGFTNYSCFRKVYLASFNSCEAFIL
                     GSLARQMAVGYFKDKCAIIDITLADGQCLFHCVVNDVTTPFSQLSVERKRKTAMKFGC
                     SSMQVQHIYFPFERSPAGDATQESLERHKIAYDMGENDAMAGSIPIFLTSLIGPPVAC
                     ITIDGLEPYENHWLAFESLTALVQEQRNATQA"
     gene            <310101..>310439
                     /locus_tag="ZYRO0F03696g"
                     /db_xref="GeneID:8205116"
     mRNA            <310101..>310439
                     /locus_tag="ZYRO0F03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497314.1"
                     /db_xref="GeneID:8205116"
     CDS             310101..310439
                     /locus_tag="ZYRO0F03696g"
                     /note="similar to uniprot|P22943 Saccharomyces cerevisiae
                     YFL014W HSP12 Plasma membrane localized protein that
                     protects membranes from desiccation induced by heat shock
                     oxidative stress osmostress stationary phase entry glucose
                     depletion oleate and alcohol regulated by the HOG and
                     Ras-Pka pathways"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497359.1"
                     /db_xref="GeneID:8205116"
                     /db_xref="GOA:C5DXB5"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="UniProtKB/TrEMBL:C5DXB5"
                     /translation="MSDPTRKGFTEKVSENVKPQEQKSYLEQGKEYLTDSADKVQSKI
                     HPEQDKSATQKVGDTLEGKSGGKQESWSETAQRYGEHAKEYAEQAREKINDTINSHTG
                     GSSGGTHGPK"
     gene            <310486..>311367
                     /locus_tag="ZYRO0F03718g"
                     /db_xref="GeneID:8205117"
     mRNA            <310486..>311367
                     /locus_tag="ZYRO0F03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497315.1"
                     /db_xref="GeneID:8205117"
     CDS             310486..311367
                     /locus_tag="ZYRO0F03718g"
                     /note="weakly similar to uniprot|Q02732 Saccharomyces
                     cerevisiae YPL018W CTF19 Outer kinetochore protein
                     required for accurate mitotic chromosome segregation forms
                     a complex with Mcm21p and Okp1p that binds to centromeres
                     via the CBF3 complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497360.1"
                     /db_xref="GeneID:8205117"
                     /db_xref="UniProtKB/TrEMBL:C5DXB6"
                     /translation="MDFTSDSRVGSQSGVVQEDAASSSSSSELNPEHERLLRLQDVKD
                     SLLAKRNALVKEMETLQSKEPPVEFKRTALLDLAELVPTSGKEIKSSVGFQDGSTAVP
                     DELRYKHDCLPLLNMDLRLSYLRDTYPYASLMLIDSSNLHVEFTRRPNDYFQLDLQLP
                     QGPALLSTNVRWPLRKLENCSNPTAILQGCYEFDRLRCRRDEIFQQIWSSLQSKGVFH
                     RISGSLLSLSRNDLLLQLRLEIEIKDLFPQTHLNVRLFKNEIPLSSPDVQDILQGLMQ
                     EYGVMRGVLELCKSCFI"
     gene            complement(<311378..>313429)
                     /locus_tag="ZYRO0F03740g"
                     /db_xref="GeneID:8205118"
     mRNA            complement(<311378..>313429)
                     /locus_tag="ZYRO0F03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497316.1"
                     /db_xref="GeneID:8205118"
     CDS             complement(311378..313429)
                     /locus_tag="ZYRO0F03740g"
                     /note="similar to uniprot|P43579 Saccharomyces cerevisiae
                     YFL013C IES1 Subunit of the INO80 chromatin remodeling
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497361.1"
                     /db_xref="GeneID:8205118"
                     /db_xref="GOA:C5DXB7"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:C5DXB7"
                     /translation="MIKALIQDGYTCTSNNHIAKDCDSKAMTMGKVYDPVHDVFQDQA
                     DADMKPGLEDSDSKAPAAGGNVSDGRIVGEEVNAESGDDSTESEDNTNILSNFGPSMV
                     PSVTTNKKKMKESSKYNRHLKKPDGEFFSRGDLQFCFLRELLADERKLFRNIYKDVFA
                     KSIVPVPPPIPGKTLNVTDPEYDAKTFVFDDHLTFSQLYVLTLASSTKCSKVLRDKLL
                     FDQQVAFSTCILGILVNIGRLNTTINFYLEMTSQLRTFHSVPCLQYHSTDSKSLQDTP
                     RLKSILKSLPVGNKPLDLSRMYETPEASKTVEDPLNLVNLLFTMCDNVTLVNLKLIHR
                     WVETRGEPISLFNILDCPGYEPKDRCNVILWLIYIHLETDMSEESVANAVKVFTPNER
                     IPLEPTDKDYDEDPQDEYQFGLDQKAKRKVFLQRIRSGEMPLQQEGHEQGEQESQQTQ
                     SQTHAQTHAQASSKKQQRDLKSPTMETVKSESQLPETAASTEVQDAQGELQEPTQDPS
                     DENTAPNNTSDTKQDTTKRRKPRPRKRPNSASNVKKESKAPAPKRRKTEPPEDRRNHN
                     DQPESEDRIDQMISADKAKLVGIPNGESKTQDQFITDLRNAHMPVANKRHDLGLVKIF
                     SEYEDIPMASVIGIRGKKRRKFRDGMLGFETDYLRNFAAAKKIMLHKDPKNYLFEPFH
                     L"
     gene            complement(<313500..>314177)
                     /locus_tag="ZYRO0F03762g"
                     /db_xref="GeneID:8205119"
     mRNA            complement(<313500..>314177)
                     /locus_tag="ZYRO0F03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497317.1"
                     /db_xref="GeneID:8205119"
     CDS             complement(313500..314177)
                     /locus_tag="ZYRO0F03762g"
                     /note="weakly similar to uniprot|P43582 Saccharomyces
                     cerevisiae YFL010C WWM1 WW domain containing protein
                     interacting with Metacaspase (MCA1)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497362.1"
                     /db_xref="GeneID:8205119"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:C5DXB8"
                     /translation="MPQSRNNVPEVPKGWKAVFDEEYKTWFYVDLGTNKSQWEPPAGT
                     TFPSDHKAQRPAASPPATGSRGYGASPAPQHASYGSQPQQQYPQAGYGGGYGGGYGGA
                     PPMGGYGAPPMGGYGAPPMGGYGAPPMGGYDVPPMGAYGGGSRFGGAPMGQPMYAQQP
                     QKKSHGMRNGMLGAGAGVLGGLMLGDMIEHHDDRIYDQGMDQGYDQGFDQGYDDGGGF
                     DDGGGDF"
     gene            <314914..>317247
                     /locus_tag="ZYRO0F03784g"
                     /db_xref="GeneID:8205120"
     mRNA            <314914..>317247
                     /locus_tag="ZYRO0F03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497318.1"
                     /db_xref="GeneID:8205120"
     CDS             314914..317247
                     /locus_tag="ZYRO0F03784g"
                     /note="similar to uniprot|P07834 Saccharomyces cerevisiae
                     YFL009W CDC4 F-box protein required for G1/S and G2/M
                     transition associates with Skp1p and Cdc53p to form a
                     complex SCFCdc4 which acts as ubiquitin-protein ligase
                     directing ubiquitination of the phosphorylated CDK
                     inhibitor Sic1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497363.1"
                     /db_xref="GeneID:8205120"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DXB9"
                     /translation="MRFTHPLLEINVPFQYQIHDGETDSKLNISATTNVRNDNDGVVN
                     KGYGKRRISGQSEERDGRKRYRMSDLSAGQKYVGSGAMVVTPSDTAAHENVQGSSDGG
                     YSLQSLRSPGEDGGNDTEDSEEKETGTQPVILLSAAQQVLGGGHGCEGTDQAASAPMT
                     VPAAASQPQPQPQPQQQQQQCEANGSDVSAVEETLPLSPLASPGLSASCEQEDQVEEV
                     VKDNNINSHSGNNIAVYQAYTNEVFSMVRNELPPQCYKNLLFQLVSNLSRNELSDLGT
                     LIKDNLKRDFITSLPLEVSLKILTKLPFADIVQCLRTCKSWNKLIDTTPYLWKQMLIS
                     ESFVSKDRFTKYSQTLLTKYPHIKKEEDGYQLDFLENCRELKNWYNPSFMPQRTTLRG
                     HMINVVTCLQFEDDYVITGADDKVIRVYDANKKQFLLELTGHDGGVWALKYDEGGILV
                     SGSTDRSVRVWDIKRRCCTHVFKGHTSTVRCLDIVEYKGVKYIVTGSRDHTLHVWKLP
                     REPAVSDQTYPIIHNTPEENPYFVGVLRGHMDSVRTVSGHGNIVISGSYDNNLMVWDI
                     AQMHCLYVLSGHSNRIYSTIYDHKRSRCISASMDSTIKVWDLQNIWNNGTCTVIRNSI
                     TPCTKITGSMSTLQGHTALVGLLRLSDKFLVSGGADGFLRCWDSNDYSRRFAYHNMSA
                     ITTFYLSDNLLVSGSESQFNVYNLRSGKLVHTNILGDADQIWSVNFKGRILVAAVEKD
                     GQSYVEILDFGAPQSTNITTTPRSATATVSSDDASPW"
     gene            <317513..>318004
                     /locus_tag="ZYRO0F03806g"
                     /db_xref="GeneID:8205121"
     mRNA            <317513..>318004
                     /locus_tag="ZYRO0F03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497319.1"
                     /db_xref="GeneID:8205121"
     CDS             317513..318004
                     /locus_tag="ZYRO0F03806g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497364.1"
                     /db_xref="GeneID:8205121"
                     /db_xref="UniProtKB/TrEMBL:C5DXC0"
                     /translation="MSFRRPWSSLNSTMQVMEESGAPSLVSATRSKGITGNLDKRTPE
                     ERVFGKGLFASYPNHQATQTHGIPLYIFTCGVCIVISCLLVILLATNILIQLRTIVPD
                     NIFETAVKAFYVVISLVGIYALIVGNSWLFRKLSSKQKRNSANAQYSSLNRLEENYEM
                     DSL"
     gene            <318190..>321843
                     /locus_tag="ZYRO0F03828g"
                     /db_xref="GeneID:8205122"
     mRNA            <318190..>321843
                     /locus_tag="ZYRO0F03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497320.1"
                     /db_xref="GeneID:8205122"
     CDS             318190..321843
                     /locus_tag="ZYRO0F03828g"
                     /note="similar to uniprot|P32908 Saccharomyces cerevisiae
                     YFL008W SMC1 Subunit of the multiprotein cohesin complex
                     essential protein involved in chromosome segregation and
                     in double-strand DNA break repair SMC chromosomal ATPase
                     family member binds DNA with a preference for DNA with
                     secondary structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497365.1"
                     /db_xref="GeneID:8205122"
                     /db_xref="GOA:C5DXC1"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:C5DXC1"
                     /translation="MGRLVGLELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMD
                     AISFVLGVKSSHLRSQILKDLIYRGVEGEEDEEDGEGRTAYVKAFYLKSDSTVELSRS
                     ISRNGDTQYKMNGKNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIASQSATDLTKL
                     FEEISGSIQYKKEYDSLKGKVDSLNQSAAESIKNRRRIHGELKSYREGIDKNQEFYHQ
                     VEKRKELQRHYALWQLYHLETQRHELEDKLANLKNSIKTIRGKETSQEQILQRSRASF
                     ARESASILKQRSKMESKSREKEKINQQLLPIKLSQRSAAKRIANVQKRISSLQRDIDR
                     QREYVERFENQLNVVTKAKSDFEKEIKESSKDHDKYKLNEDDTKLYASLNEKYLNQGG
                     FSLESQKQLTLNDKQELMDEMETLKKRNDISRSRVTDELSVIAEKLESQLSEISSTLN
                     ERNSTHSDKVKELQKLHSQIESSSNKEYDLNYKLREVLVKIEELSASQRETVKERKLR
                     ENIATLKRFFPGVRGLVCDLCQPKKDKYALAISTILGKNFDSVIVDNVMVAQECIAYL
                     KKQRAGIASFIPLDTIDVEIPTLTLSDSQGCTLAINAIDYEQEYERALQYVCSDSIIC
                     DDMNIAKDLKWNKGVRSKLVTLEGALIHKAGLMTGGISKNTSNRWDKEEYQSLMTLKD
                     KLLQQVEEAALEGKNASLMARELESTLSLLNTEISELRTQLTLTQRTLKENTVERDYH
                     EKLIKEEYEPELLNLEERIQNFNFALQELDSQKEKLQNEIFEEFTNRVGFTVKDYESH
                     SGEIMRQQSKELQQLQRQILNVENKLQFEKDRLSTTERRFGKAHEDMAKIEFELTQLE
                     RQEKETESRINQIDQELADQKKELEQFQKKLDAKHGDIDSTEDALHEVTANLQALKRH
                     KDELKEDVEKVDMEKVCVLKNCKLSNITIPVLSDTDLDQLPIDRIDEETIAIAHEIEI
                     DFHELPAKYKESGAETIREDFEKSIKHAEDILNDLQPNAKANERFSEAQNKFEAIDYE
                     TEELKSEEKRVIAQFLKIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGS
                     ASLTLEDEDEPFNAGIRYHATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFF
                     VLDEVDAALDSTNVDRIAAYISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENS
                     SKIVTLNLKNYAS"
     gene            <322303..>328734
                     /locus_tag="ZYRO0F03850g"
                     /db_xref="GeneID:8205123"
     mRNA            <322303..>328734
                     /locus_tag="ZYRO0F03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497321.1"
                     /db_xref="GeneID:8205123"
     CDS             322303..328734
                     /locus_tag="ZYRO0F03850g"
                     /note="similar to uniprot|P43583 Saccharomyces cerevisiae
                     YFL007W BLM3 Protein involved in assembly of proteasomal
                     core particles in the nucleus required for normal
                     resistance to bleomycin may be involved in protection
                     against oxidative damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497366.1"
                     /db_xref="GeneID:8205123"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:C5DXC2"
                     /translation="MSDNEIRAPIPLKNRTLSQLKLQDMKNTRSSSSMAGDGTKRPRL
                     HSPEGNQQWRPRSATPNMNSPRLLNGMDSKQIFNDMLKYYGLDYVDDRDEHLNQIHDP
                     KSKWFSRAVRQQYMIEDTLPYKTESHKDQAKYLCHVLINLYIAIRSLDIQGLISISSK
                     DLADLKGEVDNLALNTDLFRLTTDAIDAEVLNNDIADFDEDEDEDDMFDDNEYIDLVG
                     PDFNATGKITAKSASIINVNHWTNEFKNCMHFDFPLSLRKSLAVVYYYLSLVQGQKVY
                     RQMHVEMFELLVATDDDGTNFTDLLYESGLRLDHKIMLRFLSDFLPYPEPDYVRYDLS
                     IKEDLQLFRLLLKLANNSKAFFDDKSATILIDTMGCLLSSLAPSTISTIMPMITSLVP
                     YQYHQDGRITDYFPFCFGFWTCKTADASVDTHMYDFMGTVAEDAHWKLIRDSESNPLV
                     EYGDYLLFTDDQMSFMFNRLQVHLRADGQIHSYSRTVRPLIYSLNGSHSEPFFDRLVN
                     LAKSIETFVHPSNTGFWTKPISKFVHGFIKMYHGRVQKEKKQRELGIEHPIYLDSKCN
                     SKMVEVFLSLLVSGAQNKSSDVANYYISCLAYLLDLRPDNSNIVFDRILIDVYEALAG
                     EYVNSTHRLIASLKQFNRVVRFMVMDKLYRVHVTNVLLMFVDKIDMNDINLTSNLING
                     IVSIASFIPFQNFVGPDEYLTFESHTLPFIQQHYYHLRDSNGQEQFIYDEALLETAFR
                     ASTTVFENVLRVYIDKLFQLVDVDLEDGFVTKVNQTTMIMQESMDDATFEIFAQLLQK
                     RFWDNDSFKEKDPQYDLVIIPLAALTRRNKAIAQPLFDDLTFHVKEQIERGAGSVRAS
                     SEIQQRDVKLVLYLSAVNEVLRQSHNAIFEFSGKLKEFMKYVFESITNPPLDVITSIM
                     IHSACASLTSTELIDYSLFPEQSKVPWYERWGGLQFDERKYEKENLNFIWHVPNSAEI
                     TLAIDLLKSTMNYCITNMENMMADPHNDFTYSDKIQKYILIITHALSGSSLLFDPDFN
                     KNNSQQVTDSQSYKEKLVLLKNIRENNFDNQEMDIDIEQIRSEKGGGEYIDDKDASDL
                     QASENEGVIEMKETTGEDFLIEDEAEMSEIPSGIATPEPGAHLSGDFNSFMNSRLAFR
                     DLDIYTCNYFFGNTVMEKVKHPQYVEVHCLRANIGRFFHKLYKFLMEHFENNTSMFQI
                     LLHGMKVWFTDVGQETVFIEDPCAFFDLDFMENIQILANSGEPFTRTCLAVRSNDIHQ
                     MRVLLHSTNRYPSKLEAQLLRNIISLASSLYPDIHKPAQGTLVHCMKQLIGSYSIIIK
                     KSITALKEVMETHDYMKMQIILKLLMIKKIHRKLMSDYNNITELTMILIECCKVNELE
                     ISMYADKILSDIVAGMKIPSSTCVLDERAYAPLAPPDKFMDLQVEAVKNAKDKKRSRY
                     LSLLIELQNKLVGVLESEKTVGWKLPMLIIRFVVKIQSHLETEVEPKALETIFKHSQT
                     NHPDMIHLAIKSFLGIFNKIFSLSDYDYDISKAYNSAFDPGFITDVDTSQDGFPEEFK
                     QEMNNFESPSYFIDSRMFVGWLCWGRSMKVVKAEPIEVNFRQNEIEAFQRFGNVVNYE
                     WIQNIVDNLIQDNETHGVFSSGNVSFFVLLIFLISHNFTKLKLEDLFSLCESRYDRND
                     KASMIMSTEIFAALICGSKFMYPESLQLRDAFVAKFLPSCIDSELNQDAFGIWATLCW
                     WLPTVVDLRRCKPFYQNFSSIQNLLDKKSDDPAHQASKLLMLRSVLLSMEYSSPDLLV
                     VLNSLVTDHPYDQVREAVAKVLATLMQSSCCASLPSVKELMHKESNCGGGLGSPVMVT
                     SKTVDEFVKRQFQDIVKESANITGLAPQQILKTRYYYLTSTMVYWVKEMIKGTNRVLL
                     VPYIVDYVAPFLLDLLTHRDVCKLAGLDPTILYVTLSYMPLRKEALGEVIQLMCHDEN
                     TLSSYQIRVKLGFVQHFFSSQLLQLAPEQRDSILSFVVSHLYNERYVEVRMRASDVLS
                     DIVHNLGEDDERLKKLVQSFSSRLGNHKWEEKQKLSKADVKIHGSILGLGAVIQAFPY
                     VFPLPRWIPSQLSNLASWSRTSGVAGTAAKSYISEFKKVRTDTWKFDRLSFTQDELED
                     LEGVLWSSYYA"
     gene            <329213..>329866
                     /locus_tag="ZYRO0F03872g"
                     /db_xref="GeneID:8205124"
     mRNA            <329213..>329866
                     /locus_tag="ZYRO0F03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497322.1"
                     /db_xref="GeneID:8205124"
     CDS             329213..329866
                     /locus_tag="ZYRO0F03872g"
                     /note="highly similar to uniprot|P07560 Saccharomyces
                     cerevisiae YFL005W SEC4 Secretory vesicle-associated Rab
                     GTPase essential for exocytosis associates with the
                     exocyst component Sec15p and may regulate polarized
                     delivery of transport vesicles to the exocyst at the
                     plasma membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497367.1"
                     /db_xref="GeneID:8205124"
                     /db_xref="GOA:C5DXC3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXC3"
                     /translation="MSGLRTVSASSGNGKSYDSIMKILLIGDSGVGKSCLLVRFVDDK
                     FNPSFITTIGIDFKIKTVDINGKKIKLQLWDTAGQERFRTITTAYYRGAMGIILVYDV
                     TDERTFSNIRQWFKTVNEHANDDAQLLLVGNKSDMDTRTVTYEQGEALAKELGIPFIE
                     SSAKNDDNVNEIFFTLAKLIQEKIDNDKLAGGSGAGKEGNININSGNNASSKNACCN"
     gene            <330357..>332930
                     /locus_tag="ZYRO0F03894g"
                     /db_xref="GeneID:8205125"
     mRNA            <330357..>332930
                     /locus_tag="ZYRO0F03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497323.1"
                     /db_xref="GeneID:8205125"
     CDS             330357..332930
                     /locus_tag="ZYRO0F03894g"
                     /note="similar to uniprot|P43585 Saccharomyces cerevisiae
                     YFL004W VTC2 Phosphate metabolism transcription and
                     similar to uniprot|Q02725 Saccharomyces cerevisiae YPL019C
                     VTC3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497368.1"
                     /db_xref="GeneID:8205125"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:C5DXC4"
                     /translation="MLFGVKLANDIYPPWKSSYLDYERLKKLLKEALISDKSAGATAR
                     GDDPWSENDESRFVEALDKELEKVYGFLVSKYDSLMGKLNRLEEQTTSEDKIAELNFD
                     TFQKVLEEVLSEAQQLDGFYRLNYTGFFKIVKKHDKLHPKYPSVKSLLEVRLKELPFH
                     SEELSPLLYRTSFLYNVLRSNFTNFSQSLTDASKLSAVGDHTSSSTNFKSFKFWIHKD
                     NLMEVKTRILRHLPALVYASAPTENDVLPNRLESDVMDADGGIVSSNSSNELLVENGF
                     GNTKSYDPLLTALYFDNEQFELYNNKLLKTQSAPTVRLRWTGRLADKPDIFLEKRTVV
                     ENPESGNTELEEIRLKMKQKFINGFVFDGDSKYKTRTVNKLKESGTGDEEIAKVERNF
                     DTMQRFILDEDLEPVLRTMYRRTAFQIPGDDRVRVTIDSDILFVREDDFDKMRPIRNP
                     KDWHRNDLDANVSKPTKFLRTGEYSKFPYSVMEIKVQHEGEPSDGTDDNVSTDGPRLP
                     RKHGQWITELTNSHLVKEVPRFSLYVQAVASLFAEEEKLDVLPFWLPELEGDIRKDPK
                     QAYEEEKIKAKKQKETQAKINDMRRLSRVSNLSFPRAEEPHRDSKQVSEQVIQQMNDS
                     LQPQNQQRAARGPDLEDHESSEEEYEGQKKKKAKAPRRIKVGDTFLNILAGRESALTG
                     VEEEEDEIELPPGVKKPKNYIKNAGPVKVEAKVWLANERTFNRWLNVTTLMSVLTFSI
                     YNSVKRAQFPQLANIMAYIFFGLTVFCGIWSYFTYLRRLNVIKERSGCHLDAPLGPIL
                     VAVVLIIALVLNFIVAFRETARRRNQQVLTQSMDDLPEKLRPIQEYIFKIVGAETIPE
                     N"
     gene            <333165..>334949
                     /locus_tag="ZYRO0F03916g"
                     /db_xref="GeneID:8205126"
     mRNA            <333165..>334949
                     /locus_tag="ZYRO0F03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497324.1"
                     /db_xref="GeneID:8205126"
     CDS             333165..334949
                     /locus_tag="ZYRO0F03916g"
                     /note="similar to uniprot|Q02724 Saccharomyces cerevisiae
                     YPL020C ULP1 Ubl (ubiquitin-like protein)-specific
                     protease that cleaves Smt3p protein conjugates
                     specifically required for cell cycle progression
                     associates with nucleoporins and may interact with septin
                     rings during telophase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497369.1"
                     /db_xref="GeneID:8205126"
                     /db_xref="GOA:C5DXC5"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:C5DXC5"
                     /translation="MSLDIYKRIKTENSYSPLFSPISTHSSHNVQPPSLSLFNPKRTM
                     SSSYLNTSPAAGIYVLPQRAISLDAHRLQQTKLGEDGGRGQFLKDITNTLVDTGKFFW
                     HKLLRNGEYQNDHEVQTDKKITTPGNTNKRKMGDLSDYYLIPRKHRKISRGNEAIPAI
                     EKSRFTSEGSDGSLHRAYDTLSFSKDPFNWNDWKTDVIKPKDNENSNVSNFYPRYGTS
                     FARRSKLARQSTNKKQPLGTQWDELGYLRTVFNGEYTVPKMIQDERENQLKMLQKDKN
                     NTIKVRKYIVDLTERIKNIILEKSNEEKENKDDDLVILKEQRVSTLEKKRKEHQSRCQ
                     RFDQSKVDFEGEFKMYRQLLDERKHIQEEVRKKKESSKKKKLVPSIGQQDINQVEKNL
                     RRQDNAVLTNKDNIEVTTRDFRTLAPRRWLNDTVIEFFMHFIERETPRSVAFNSYFYT
                     NLSERGYQGVRRWMRRKKVQIGDLEKIFVPVNLNESHWALGMIDIPSKSIYYVDSLSN
                     GPNALSFAILNDLQNYVIEESKNTMGSDFMLKNLSCPQQPNGFDCGIYLCLNTLYLSH
                     ESPLTFDHNDAVRMRQYIAHLILLQGSK"
     gene            complement(<334991..>337345)
                     /locus_tag="ZYRO0F03938g"
                     /db_xref="GeneID:8205127"
     mRNA            complement(<334991..>337345)
                     /locus_tag="ZYRO0F03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497325.1"
                     /db_xref="GeneID:8205127"
     CDS             complement(334991..337345)
                     /locus_tag="ZYRO0F03938g"
                     /note="similar to uniprot|P40965 Saccharomyces cerevisiae
                     YFL003C MSH4 Protein involved in meiotic recombination
                     required for normal levels of crossing over colocalizes
                     with Zip2p to discrete foci on meiotic chromosomes has
                     homology to bacterial MutS protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497370.1"
                     /db_xref="GeneID:8205127"
                     /db_xref="GOA:C5DXC6"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXC6"
                     /translation="MVNNGPERVLCSIFELSRDIGTKVGICVIKYHTGEMILSDYMDS
                     QIYIRTVHNIQVYQPTEILLPSSSLSPVVSKLATIIKFNVDESVRITETSAKYFNSQD
                     GLTAIDKYMIENDKKQLLMDEFTDKAFALNATAAAMYYTGEIVSTASNSCLTRYENFR
                     IKYEGTENTMLIDPKTIRGLELVENNVVKQGLSFWKFMDNTCTKMGQRSLRNNILQPL
                     TDKANIDMRLQTVKELLGQHELLDGLRTQMRKLQDLDKLFAKLLSVDQTAVKSEQKIN
                     YSILLKDSIAVTKNLRELLSQVALESTLLTEARDVFCHESIDQIEQLIHSYINEDCVW
                     ASSPLELENQRCYAVKCGANGLLDVSRQIYKNVMDEIIHEVEELSVTHDLIFDYNYDS
                     SHGFFLRVKRQLVGSASSLPPIFINRVTKKNYIECNTLKIVKYNARLKEVLSEISIIS
                     EQVVDKLLTGIVKNISVLFMVSEAVSILDLMCCFAFNSRERNYCIPVFSNQMILQNSR
                     HPVVETLIKDFIPNNISNTASNSLQIITGCNMSGKSVYLRQVVLLCIMAQMGCPIPAD
                     CAYCKIYTKIHARICNDSMELSTSTFAFEMKEMAYFLDDIDSSTLLVLDELGRGSSIG
                     DGFCISLAVAEHLLKIGATIFLSTHFQDIPSILKYKPSVVHLNMLTDMKGDSSLEMHY
                     RLSSDPATAIENPGIKAVQKLFSPTIIEEAYRICERLQISKSRCVGGFQTEEDRQHNL
                     QMVRQMKKIFSLVELLGSQLDNEDQFSLPSLKSLQDLFVDSFEN"
     gene            complement(<337543..>338607)
                     /locus_tag="ZYRO0F03960g"
                     /db_xref="GeneID:8205128"
     mRNA            complement(<337543..>338607)
                     /locus_tag="ZYRO0F03960g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497326.1"
                     /db_xref="GeneID:8205128"
     CDS             complement(337543..338607)
                     /locus_tag="ZYRO0F03960g"
                     /note="similar to uniprot|P53686 Saccharomyces cerevisiae
                     YPL015C HST2 Cytoplasmic member of the silencing
                     information regulator 2 (Sir2) family of NAD()-dependent
                     protein deacetylases modulates nucleolar (rDNA) and
                     telomeric silencing possesses NAD()-dependent histone
                     deacetylase activity in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497371.1"
                     /db_xref="GeneID:8205128"
                     /db_xref="GOA:C5DXC7"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DXC7"
                     /translation="MRLLRDELPRNYNSPTDKNTWRLLSSFIMDKSTIRSVSKHLQEN
                     PDAKVIFMVGAGISTPCGIPDFRSPKTGLYSNLSKLGLPFPEAVFDVDYFEENPKPFY
                     TLAKELYPGNFKPSKFHYLMKLFEDKGRLRRIYTQNIDTLEREAKIHDKYIVEAHGSF
                     ASNVCIGCSQRFPVETFKAHLEPVKLEHKKDKGKKDEIEFDYARCDKCDSLIKPSIVF
                     FGEGLPNNFFDTWDEDLEWLKKNKKGKHLVIVAGTSLSVYPFASLPSEVPLGFKRVLW
                     NYEVVGEFRSNPRGGDLVFKGGSDEAAQELAKELNWLEELQELAGEEKEYKAKDAAEE
                     VAAIANELENLDIGTETKKE"
     gene            complement(338656..338729)
                     /locus_tag="ZYRO0F03982r"
                     /db_xref="GeneID:8205129"
     tRNA            complement(338656..338729)
                     /locus_tag="ZYRO0F03982r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=73.16"
                     /db_xref="GeneID:8205129"
     gene            <339323..>342397
                     /locus_tag="ZYRO0F04004g"
                     /db_xref="GeneID:8205130"
     mRNA            <339323..>342397
                     /locus_tag="ZYRO0F04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497327.1"
                     /db_xref="GeneID:8205130"
     CDS             339323..342397
                     /locus_tag="ZYRO0F04004g"
                     /note="similar to uniprot|Q12532 Saccharomyces cerevisiae
                     YPL009C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497372.1"
                     /db_xref="GeneID:8205130"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:C5DXC8"
                     /translation="MKQRISALDLQLLAEELRENLESYRLNNIYNIADSNRQFLLKFN
                     KPDSKFSVVVDCGLRIHLTDYDRPTPPGPSGFVIKLRKHLKSKRLTALRQVHDDRILV
                     LQFADGLYYLVLEFFSAGNVILLDENKKILSLQRIVQEHENKVGEQYTMFDDSIFSNN
                     EKTNAREPETYNEETVKQWLREAQTKFETESKILNEVVPSGKKKDGQRKKIKVMAIHR
                     LLLSREPHLSSDLLSKNLQMQGFSPSASCLDFVGQESAIVDLLNNTEKEYQSLLSDSE
                     RSGYILAKRNVNFNSERDEKDLEFVYETFHPFEPFVAPQNVGDTRTIKIEGGYNKVLD
                     SFFSTIESSKYALRIQQQEQQATKRLEAARLDNQKKIQALVDAQSFNEEKGHSIIANA
                     DLVEQTKSAVQGYVDQQMDWSTIEKLIQVEQKRGNKIAQLIQLPLNLQENKIAIRLPD
                     PSEEDEEDGSGSDSGSGSDSSSEAEDEDGSDSDHSSDSDVSDFETEETIENRPKKSLK
                     SKKQEEKGLKVSIDLGLSAYANASYYFNIKKNNAEKQKKVEKNVEKAFKNIEEKVGRQ
                     LKQKLKETHNVLRKVRTPYFFEKHHWFISSEGFLVLMGKSDSETDLIYSKYIEDDDVY
                     LFNTFGTQVWIKNPDSTEVPPNTLMQAGILCMSASEAWSKKISSSPWWCFAKNISKFE
                     PSDNSVLPPGRFLLKNENNKNFMPPAQLVMGFGFLWKVKTEENANEDLEEVPAEEVEE
                     HGENEEEGAPKEHDGPEDHEESGIQEEEKQDEQENQGEEPEEEEAKPQEADTKSEDEK
                     DHDENASTNAGPGEQNMNKKVRGKKGKLKKMQRKYGDQDEEERQMRLNMLGTLKGMKK
                     QQLKEQEDLQRQQNRDFRKAKLKKQQEAQAFKFTKNEKVKVNYKKFHNELKPTLDPRD
                     EILDIIPVCAPWPALLKYKYKVKIQPGNAKKTKTMHEILHHFTTRPVDTEMVDKEADW
                     PPERETIKQLKEQDLILTLSMDKLKVSIPGKLNGASKKDLPKKGKANKNKKK"
     gene            complement(<342419..>342988)
                     /locus_tag="ZYRO0F04026g"
                     /db_xref="GeneID:8205131"
     mRNA            complement(<342419..>342988)
                     /locus_tag="ZYRO0F04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497328.1"
                     /db_xref="GeneID:8205131"
     CDS             complement(342419..342988)
                     /locus_tag="ZYRO0F04026g"
                     /note="highly similar to uniprot|P53600 Saccharomyces
                     cerevisiae YPL010W RET3 Zeta subunit of the coatomer
                     complex (COPI) which coats Golgi-derived transport
                     vesicles involved in retrograde transport between Golgi
                     and ER"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497373.1"
                     /db_xref="GeneID:8205131"
                     /db_xref="GOA:C5DXC9"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:C5DXC9"
                     /translation="MTDLSLYSVQAILILDGSGNRVYANYYRPPHQPEEQLSVLSQSV
                     KKQKEFEKQLFAKTHKHDSEILIFEDHLVLYKEYLDVTLYLIGSIEENEMVLQLAFTA
                     FKDSLDLILNSGIDKKNIQEHYDTVLLAIDETIDHGVILETDPAAIASRVTKPPVNEP
                     QISLDLDKGLLGAWGFAKSRLQEKLQQGI"
     gene            <343247..>344305
                     /locus_tag="ZYRO0F04048g"
                     /db_xref="GeneID:8205132"
     mRNA            <343247..>344305
                     /locus_tag="ZYRO0F04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497329.1"
                     /db_xref="GeneID:8205132"
     CDS             343247..344305
                     /locus_tag="ZYRO0F04048g"
                     /note="similar to uniprot|Q12297 Saccharomyces cerevisiae
                     YPL011C TAF3 TFIID subunit (47 kDa) involved in promoter
                     binding and RNA polymerase II transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497374.1"
                     /db_xref="GeneID:8205132"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="UniProtKB/TrEMBL:C5DXD0"
                     /translation="MASTNDFYFGLLRVSMIQLLKSQGFDRARPTTVDVITDLYMRYL
                     GLLTGEIMKLAESRCDLDDTISLQDITLAFQNLGVIKPVDVLDVYDENPELPSDKGIK
                     KFKEWCLNDMQPRESRMVALPTADLLKSKPKSSKPLSLIPEYINQLQQKQDPTQDDKG
                     DEEDELIEELINNGDLDDWIKFVLARQRINLAKRVSGKEPQHINNLPSIGGLKYSLLE
                     QSSVNNDPLPTPLDSAEEDDPQSKPKIDELIQRLPIMRPECRLENINLSFENEAYDPS
                     SDENEPDVPPQGSLDFAIDKDSKRNGMETDINEFDLDPDIDTNFEELEDMDSNFQRRD
                     YLDLDEHPQDFQFDIDGF"
     gene            complement(<344386..>348030)
                     /locus_tag="ZYRO0F04070g"
                     /db_xref="GeneID:8205133"
     mRNA            complement(<344386..>348030)
                     /locus_tag="ZYRO0F04070g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497330.1"
                     /db_xref="GeneID:8205133"
     CDS             complement(344386..348030)
                     /locus_tag="ZYRO0F04070g"
                     /note="similar to uniprot|Q7LH12 Saccharomyces cerevisiae
                     YPL012W RRP12 Protein required for normal pre-rRNA
                     Processing member of a group of seven genes whose
                     expression is repressed during growth on glucose before
                     and during the diauxic shift"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497375.1"
                     /db_xref="GeneID:8205133"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012978"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DXD1"
                     /translation="MSNDSVGLEMGMQEKFDKIRRQINSNLDNQKHVAIVLSAVEENL
                     QNGQSQNTSPVNYTVAFISLLDQAADPVTRAIGDLQLATSACYLLDISLRSTPAPLLR
                     EKFAELLTKVAPCITDESADAPLIRSAIGCLEILLISQHSQSWGNSQELNITPRRGLN
                     GLLELSLDPRPKVRKRSQEAVHSVVSHAAPGSVAGRVISATVANFTLQALRSTVQEAL
                     SKKKNPQDNELTTKLIHILRLASSVLSTGQWPSSQIEPLCDLLLEVTKSSDQYLVSTT
                     FECFENLFKALAEKSDDSQEPDGKSLRILDIILSLKPSTSDTHLAGSWIAVIVKGMSA
                     YAAHKPLQCFVKVPELFKVMSQFLASETPEVYFSASQCLMAVLSEIVNDQILLFPPAV
                     DGTTFETVDEVITELAEIFTELLSVRYSHCAKDILKVLAVAFRKFRFRANPEFLRPLE
                     IVGEWRTNEENFLEFRNEAEEAIGAAISSMGTDVVLGCLPLNLENPSDQRPGRAWLLP
                     LIRDNTRNTKLSTFIRDLVPVSQSFESKFEKLPKESVQLKIFQTVVDQIWSTLPHFCE
                     LPTDLRDAFTGGFGSELSSIMYAKVQSRTTICNALKVLVESNLLYAGGALKEDVMLQQ
                     QFPVTEAQKNLEYLGTMASNLLAVLFNVYTQTASNARAFILETIESYLKVTTKEDLEK
                     TFNNVCGLLKNAMDEEFKKSGKGKPELTATLLDIVVCMTKYLPPSSYPALFTIFGSTV
                     VSQDALIQKRAYRIITRLAELESGSEALSNFMSDIENVVLNNSSSVQTSSKASRLGAI
                     RSLVNLIPSNHMDFIVRVAAEVILSTKDVNEKSREAGFECLITMAKRMEEPGSIIRLS
                     QVPGYEEGAPDQPSSTSEFFKIIAAGLIGQSQHMVSSTIQAFACLIFEFRDVVEESVL
                     LDVYDTVALYLTSNSREIVKSAIGFAKVAVLSLPTELVRPKVPELIPNLLRWSHEHTG
                     HFKAKVKHIIERLIRKFGYDFIAANFPQEDLRLLANIRKVKNRSKRGKSVEDEAAPAT
                     DGMASAKGSRFMNAFDEAVYNSSDDEGNESDEEQGNLKNRSKQFIMESGENPLDLLDS
                     QTLAHISSTRPKKFNKNERRAPLEDGMFSFDAEGKLVVNDREKQVEEDPLQSVTSGID
                     AYMDAVKQGPIRGQRNRLKFKKGARSGANGSDDEVDDDLKLPKKTADSKNKIGKGPKR
                     GGKYKSKKKL"
     gene            <348227..>348586
                     /locus_tag="ZYRO0F04092g"
                     /db_xref="GeneID:8205134"
     mRNA            <348227..>348586
                     /locus_tag="ZYRO0F04092g"
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /transcript_id="XM_002497331.1"
                     /db_xref="GeneID:8205134"
     CDS             348227..348586
                     /locus_tag="ZYRO0F04092g"
                     /note="highly similar to gnl|GLV|KLLA0F27247g
                     Kluyveromyces lactis KLLA0F27247g and similar to YPL013C
                     uniprot|Q02608 Saccharomyces cerevisiae YPL013C MRPS16
                     Mitochondrial ribosomal protein of the small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /protein_id="XP_002497376.1"
                     /db_xref="GeneID:8205134"
                     /db_xref="GOA:C5DXD2"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR020592"
                     /db_xref="InterPro:IPR023803"
                     /db_xref="UniProtKB/TrEMBL:C5DXD2"
                     /translation="MSRGLVRIRLARFGRVNNPVYNIVVARAFKARDTKPIEVLGTYN
                     PVPKPLTVQQKKSGILPTKDIQLDFDRAKYWIGVGAQPSDTVTSLLRKCGILDENWGH
                     DYQSQKPLVSPMKEVTE"
     gene            complement(<348830..>350005)
                     /locus_tag="ZYRO0F04114g"
                     /db_xref="GeneID:8205135"
     mRNA            complement(<348830..>350005)
                     /locus_tag="ZYRO0F04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497332.1"
                     /db_xref="GeneID:8205135"
     CDS             complement(348830..350005)
                     /locus_tag="ZYRO0F04114g"
                     /note="weakly similar to uniprot|Q02606 Saccharomyces
                     cerevisiae YPL014W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497377.1"
                     /db_xref="GeneID:8205135"
                     /db_xref="UniProtKB/TrEMBL:C5DXD3"
                     /translation="MLLDRFPRFHTKNKRKEQLELQVDGNNNTEVGMESGIDSYEVLQ
                     QPQPLMFNSGVDEKMMDNDDDVISMDPFVRTPISTPMDTQPQFNGSGLGGPTGVGQPQ
                     PPFPPYLRTRGRQNTTSSLSSSISDFHAGANSGSGWNSVSSHSGVSGSGSFTPQFLAL
                     MLEVYQNVCSDPTVTPFDSNNPPSGILDRVAKIAVEESENKGVEIGYERNSWLLTLIR
                     HRLLEEVHKDSYLSRSGSAVSIPQLPPHWMDSAAPFEAPSRPDGLRRQPSQDYFNGWN
                     FTSARPGSNGGGNLIRTRSNSSQLLLNQPGLVRTRSDTNNSGMCGLTPTNSETNLSSS
                     GFGGVLNGFPTRQRSIGLGGPQVCNGMNSPINPPPMASMEDPGITLRRKRESLRFKR"
     gene            <351070..>353481
                     /locus_tag="ZYRO0F04136g"
                     /db_xref="GeneID:8205136"
     mRNA            <351070..>353481
                     /locus_tag="ZYRO0F04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497333.1"
                     /db_xref="GeneID:8205136"
     CDS             351070..353481
                     /locus_tag="ZYRO0F04136g"
                     /note="similar to uniprot|P22516 Saccharomyces cerevisiae
                     YPL008W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497378.1"
                     /db_xref="GeneID:8205136"
                     /db_xref="GOA:C5DXD4"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006554"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXD4"
                     /translation="MSVTFNHPYDPYDIQLELMRCVYDALSHGKKLCIVESPTGTGKT
                     LSLICSVLTWLRDNKADLLMGKDGEGQEDEDEDEPDWVNQSYVGSVLSDQIQLTQDYE
                     AYLEQLRNKKIIVRDQELRDTKRRKLNRVDVKIDNNRDDEFLPQEYYSDDEEQGTDGV
                     TLGREVKDMLAKLNGVAKNEQDKFDIDHLNPIKVYFASRTHSQLRQFASQLRLPIFPP
                     SLPNVKNESIKHLPLGSRKQLCINPQVSRLKSTDAINDACKELQQNGKNGCKFKQNIN
                     NQLEQEFRDRSFTSIHDIEDLAALGQSLDICPYYASRDSLTSAEIITLPYQFLLFQST
                     RESLGLDLKNSVVVIDEAHNLIDTVNAIHSSEISLQDLQSVKTGLTNYLSKFKSRLGP
                     GNRVNLMKLIKLIDVLIIFTRQNYKKPGQVIDPIEILSGNADTLNIHKINKYIKISKI
                     SYKIQSYMQSVEKDQGINNPGQPLLFKIASFITCLTYPTQEGKFFFEKGPSIKYMLLQ
                     PDKCFQSVLEDSRCVILAGGTMQPVSDVLENLFPTVSNNQLVNFSCDHVIPDDNLGTY
                     VLQEPQIELTFEKREQPQVLRQMGEFYLQLSKAVPLTGGIVGFFPSYQYLQFVIDHWK
                     KTGLWSQLTKLRKVNYETKSGEDPLPEYTEAVDKGEGAMLFAVVGGRLSEGINFQDNL
                     CRAIVMTGLPFPNVFSGEMMVKRSHLENKILQKGGTRQDAMSATKLFFETICLKAVNQ
                     SVGRAIRHANDYANIYLLDKRYGNPHTQEKLSHWVSKRLQPQSDLDSIMDSTRRFFAN
                     KEEVK"
     gene            complement(<353489..>355234)
                     /locus_tag="ZYRO0F04158g"
                     /db_xref="GeneID:8205137"
     mRNA            complement(<353489..>355234)
                     /locus_tag="ZYRO0F04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497334.1"
                     /db_xref="GeneID:8205137"
     CDS             complement(353489..355234)
                     /locus_tag="ZYRO0F04158g"
                     /note="similar to uniprot|Q12308 Saccharomyces cerevisiae
                     YPL007C TFC8 One of six subunits of RNA polymerase III
                     transcription initiation factor complex (TFIIIC) part of
                     TFIIIC TauB domain that binds BoxB promoter sites of tRNA
                     and other genes linker between TauB and TauA domains human
                     homolog is TFIIIC-90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497379.1"
                     /db_xref="GeneID:8205137"
                     /db_xref="InterPro:IPR011044"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR024764"
                     /db_xref="UniProtKB/TrEMBL:C5DXD5"
                     /translation="MKLLRDLVINRREFQDWHHNLHWGRDGSLYMTTYPEICIGQPIF
                     RKDVENTSKNLFHVKDHALEYSNKFEFDHATMNSLLNSQPVSHAKLCKPSPVDSLLAI
                     LTNNLNVLIFKDQRLLASLDEGDKSVERRSYHSLQWSPDGNYIVVGNEASELVVFKLE
                     RTNDEELSYCVTQCVQLNEGENWVTHICWEQDAIVAALDDNSAYAVDVAKGYEVTQVK
                     SPCRFKIVDVKIVGVCVLITAAGHFYCLEPVTQKSCSLKLGPGDEFYIIPLLQEPNCV
                     ILISDRTSCKVKFDDELTIVPDHRVSPHLERKFKKWSTISNEFGKYEATMLIHGVELS
                     PDGYSVAIAYSMERISTRYRIVSERQFNITFIPLFESWQISKKAIGLAWYQTYQIYRC
                     TLPVVTNDTSDSILNKQVYDLHMDFKTYLSVFMNDNQLNKLRFFNFIEDKPSIDLFRR
                     AIFEFAITRKLDLENPLDKACVQSLANVLGTESPVEVGALEMQSDFITESFDFNQNND
                     PTVIVSEQNHAWRRCAVTLLPILTTKVKVCPISNQRVIDIKRDTFNNYGWFTKTLLEA
                     LNNESVYTGTTMQTC"
     gene            <355401..>358943
                     /locus_tag="ZYRO0F04180g"
                     /db_xref="GeneID:8205138"
     mRNA            <355401..>358943
                     /locus_tag="ZYRO0F04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497335.1"
                     /db_xref="GeneID:8205138"
     CDS             355401..358943
                     /locus_tag="ZYRO0F04180g"
                     /note="similar to uniprot|Q12200 Saccharomyces cerevisiae
                     YPL006W NCR1 Vacuolar membrane protein that transits
                     through the biosynthetic vacuolar protein sorting pathway
                     involved in sphingolipid metabolism glycoprotein
                     homologous to human Niemann Pick C1 (NPC) protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497380.1"
                     /db_xref="GeneID:8205138"
                     /db_xref="GOA:C5DXD6"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/TrEMBL:C5DXD6"
                     /translation="MWFIAILAYIPIFIQLSFVGATGVSTAQCAIYGNCGKKSLFGTE
                     LPCPVQQDFQPEPASDELKELVVSVCGEEWQDIDTLCCTKDQVVNLRNNLKKAQNIIA
                     SCPACTKNFNNLFCHFTCSPEQRNFINVTKTQESMDHKEVVSELDFFVNSTWASAFYD
                     SCKEVKFSATNGYAMDLIGGGANDYQHFLKFLGDEKPLIGGSPFQINYLYNSNYPFRE
                     FNDAVYACDDPQYKCACADCDSSCPRLDPLKKGTCKVGKLNCFSFSVLMVYAALFAAI
                     GIFHIYLFKFKGRKSPIIDEDHSAINSRMTSRDRLFEMYDTKSYNINSKISSALGGVS
                     RYAVNNPYFILALTAGIVAVLGLSLYEFGELETDPINLWVNKNDPKYQEKLYFDEKFG
                     EFYRVEQVFVVNETGSVLSYDTMKWWFDVEKHITESIKSVDGVSYQDLCFRPTDESTC
                     VVESFTQYFQGELPPEIGWKDQLKACTDSPVNCLPTFQQPLPENLLFSEDNVFASHAF
                     VVTLLVDDHSNAAVLWEEELERYLLNLDIPEGLRISFNTDMSLEKELNGNNDVWIVCA
                     SYFVMFLYASWALRKNGVESRWLLGFAGITVVAFSVVCAAGLLSLLGLKSTLIIAEVI
                     PFLILAIGIDNIFLITHEYDRIADECPAMATGDRIVKAVQRIAPSILASLVCQAGCFL
                     IAAFVSMPAVHNFALYSALAVFFNVVLQLTAYVAVLALYEREFSVRLPVGVEKESTIF
                     GPKYFNFVSKKMKVLGLFVSYALISLIFVPGIEFGLDQTLAVPQNSYLVDYFKDVYQY
                     LNVGPPVFFVVKDLDLTRRENQQKLCGKFTTCDAISLNNVLEQERKRSTVTEPVANWL
                     DDFLMFLNPQLDQCCRFKKGSHDVCPPTFPTRRCETCYEEGQWNYDMSGLPEGQKFLD
                     FMDIWINSPSDPCPLGGKAPYSRAIAYNGTSIEASTFRSSHKPLTSQNDFIQAYDDAI
                     RISQSFEDLDVFAYSPFYIFFVQYKSLLSSTLKLIGGALGLIFVVSAALLGSIQTAVI
                     LTITVLMVLVDIAAFMAWFQIPLNAVSLVNFIICVGLAVEFCIHIARAFTIVPYGTKK
                     DRDSRIKYAMTTVGDSVFKGITMTKFIGVCVLAFAKSKIFQVFYFRMWFSLIILASVH
                     ALVFLPILLSLAGGKSYVDESMDVEPRDGNSENN"
     gene            <359133..>360938
                     /locus_tag="ZYRO0F04202g"
                     /db_xref="GeneID:8205139"
     mRNA            <359133..>360938
                     /locus_tag="ZYRO0F04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497336.1"
                     /db_xref="GeneID:8205139"
     CDS             359133..360938
                     /locus_tag="ZYRO0F04202g"
                     /note="similar to uniprot|Q12089 Saccharomyces cerevisiae
                     YPL005W AEP3 Peripheral mitochondrial inner membrane
                     protein located on the matrix face of the membrane
                     stabilizes the bicistronic AAP1-ATP6 mRNA encoding
                     subunits 6 and 8 of the ATP synthase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497381.1"
                     /db_xref="GeneID:8205139"
                     /db_xref="UniProtKB/TrEMBL:C5DXD7"
                     /translation="MNVLQRLSDILAKDGVKTSVLLREDVLPSMFESAKSTVKVNKRN
                     NVVKEIPSKDVTIKENIHLVGRGSNLSKKVSREYLSPLQGHSIARHNILNNYDDAKAS
                     RMHSWIETVEKSPNSQEVLFTKFRQFTGDMLAALIACSPPRVKINSQNLTRNYLKYST
                     GEVPRIPNFQENPGLFEDYIGLLTHTRFLHKNSSSTNGIVPKILRNLMHPANIKTLHL
                     RTTKCYNDMMYYFSEKFDFATCRELFVQMKVENVPPNTVTYNLLLRSVLKNSHIRKNK
                     FPDEEVLFYLKSMKNRGIEADSVTWTTCYNFLKEDVSRLLFVEQLQGRGVPLTRDFIY
                     TVLRNGDYNSTECLKFLTNNKIPLDCKSFKLCVSRLLQEDRVDVAWVFLEYTLKNSGR
                     AFKLGADILNEFLRVFSAKGRLDLCLMTFNTCVQDRGLKPDVHTFDMLFKSLVRNGYH
                     KNFCVMLTFLQNLKKKYGFEKRTNYWFIKAQSMAKFNIEPQWRHVTPEQLQRAQRWVA
                     LLRWGVDTNTFSTKVWSTHGTQFRNALRFIGCIPLSYRNSIQQDTAHLTRRKSEYRRR
                     IRHIALQNALLKRVPYAKDWYGTLRKELKERGVVA"
     gene            complement(<361246..>362241)
                     /locus_tag="ZYRO0F04224g"
                     /db_xref="GeneID:8205140"
     mRNA            complement(<361246..>362241)
                     /locus_tag="ZYRO0F04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497337.1"
                     /db_xref="GeneID:8205140"
     CDS             complement(361246..362241)
                     /locus_tag="ZYRO0F04224g"
                     /note="highly similar to uniprot|Q12230 Saccharomyces
                     cerevisiae YPL004C LSP1 Long chain base-responsive
                     inhibitor of protein kinases Phk1p and Phk2p acts along
                     with Pil1p to down-regulate heat stress resistance via
                     regulation of the Pkc1p and Ypk1p pathways phosphorylated
                     by Phk1p and Phk2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497382.1"
                     /db_xref="GeneID:8205140"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:C5DXD8"
                     /translation="MHRTYSLRNQRVPTASQIQSPPPPPSSTKSKFFGKASIASTFRK
                     NAAGNFGPDLARKLSQLVSTEKGVLRSLEVVAYERRAAARQLSLWGVDNDDDVSDVTD
                     KLGVLIFELGELQDQFIDKYDQYRVTLKSIRNIEASVQPTRNRKEKITDEIAHLKYKD
                     PHSPKIPVLEQELVRAEAESLVAEAQLSNITRERMKAAYNYQFDSMRELAEKFALIAG
                     YGKALLELLDDSPVTPGETRSAYDGYDASKQIIMDAEAALESWTLDSAAVKPTLSFHQ
                     TVDDVYDEVDDEEGVVPEEEWAEEEVVEEVPEHAHEEGHGVAGQHADHYGHHHTE"
     gene            <362897..>363574
                     /locus_tag="ZYRO0F04246g"
                     /db_xref="GeneID:8205141"
     mRNA            <362897..>363574
                     /locus_tag="ZYRO0F04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497338.1"
                     /db_xref="GeneID:8205141"
     CDS             362897..363574
                     /locus_tag="ZYRO0F04246g"
                     /note="highly similar to uniprot|P13298 Saccharomyces
                     cerevisiae YML106W URA5 Fifth step in pyrimidine
                     biosynthesis pathway Orotate phosphoribosyltransferase 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497383.1"
                     /db_xref="GeneID:8205141"
                     /db_xref="GOA:C5DXD9"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR004467"
                     /db_xref="InterPro:IPR023031"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DXD9"
                     /translation="MPVILEDYQRNFLELAIESEALKFGQFVLNSGRKSPYFFNLGQF
                     NTGKLLTNLATFYAIAIIQSHIKFDVIFGPAYKGIPLASVVCMKLAEIGGSNYQDVHY
                     AFNRNETKDHGEGGNIVGASLTNKRVFIIDDVMTAGKAINEAFELISANGGWAIGCIV
                     ALDRQEVVDLSDRNELSATQAVSSRYEIPVLSIVTLLHMMEFFKDKISVEQRQSMEDY
                     YIQYGLG"
     gene            <363960..>365069
                     /locus_tag="ZYRO0F04268g"
                     /db_xref="GeneID:8205142"
     mRNA            <363960..>365069
                     /locus_tag="ZYRO0F04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497339.1"
                     /db_xref="GeneID:8205142"
     CDS             363960..365069
                     /locus_tag="ZYRO0F04268g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497384.1"
                     /db_xref="GeneID:8205142"
                     /db_xref="UniProtKB/TrEMBL:C5DXE0"
                     /translation="MEGLSPLESIDSNADLFSNVALKLTATPAVTGYDCNSTVSTGIK
                     RRSITSKIPAWFQKWDNSDFNKQSTNSGSRSHKFRFWLNEKDDLDPSEDQLFSSPEDI
                     SINTQASIYNDRISLDLFPDDEHDENVEEIGKTSSSQASIYEFDYKELEFLNVPSTDA
                     TFTSQVSIYQLGGAADAEPSIRKANLGHSSILHAPIYGFDEPDLIFETPREDDHLLKE
                     CKHTVGSDITLNTRTALYELSDEKYYLESLQDVLMFGKGMNDVVNAPVGNPSSIYGTR
                     MGHNSGTAFEVFLESCLDTDSSWEAYEAEYNKTSDAKFGSSVAKRKSRLRTLLHYLKN
                     KFSNKRIVSEMQLLKTLWHSILISRKNAYEYYHYC"
     gene            <365461..>366849
                     /locus_tag="ZYRO0F04290g"
                     /db_xref="GeneID:8205143"
     mRNA            <365461..>366849
                     /locus_tag="ZYRO0F04290g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497340.1"
                     /db_xref="GeneID:8205143"
     CDS             365461..366849
                     /locus_tag="ZYRO0F04290g"
                     /note="similar to uniprot|Q12059 Saccharomyces cerevisiae
                     YPL003W ULA1 Protein that acts together with Uba3p to
                     activate Rub1p before its conjugation to proteins
                     (neddylation) which may play a role in protein
                     degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497385.1"
                     /db_xref="GeneID:8205143"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DXE1"
                     /translation="MDRFDRQLRLWGGFGHELLTNGQICFIVERRDDPLLLEVQRHLL
                     LAGISSYLVLHSDKQHTPAKDAFAFIDENQELQALNPEIKPQWNFLPWSRIQTQSFKD
                     ISVIVLINCRDAHMLQELSIRREHSINFPPVLVAAVNYPLAYMYLWLKEIHFVVTTNP
                     EYVVPDLRINEPWDEVLQYTESLDFGKLREEELAEIPYPLILSSALRATSQDERPLHQ
                     KLDDFYLKYSQQALNDSNYRQAKRYARQVSRSSELGRQRVKQLLNRLQIYQRSNWHDS
                     FNGKFMTLCQALGQFLDQYHQLPLPSEFPDMEAGTQIYNDLKMIYQKKAREDCETMEA
                     IVARLGFPDFPRMLVKKFCDNINYWTLLEPIVNESSVPGIYSSTELTRYLNEQEVTIS
                     THEKKLLENLLSLAEDSYDSHTLVSSFPATAFLGGAVAQEVVKLVTHQYVPIDNTFVY
                     DLISDESSTIKL"
     gene            complement(<366863..>368671)
                     /locus_tag="ZYRO0F04312g"
                     /db_xref="GeneID:8205144"
     mRNA            complement(<366863..>368671)
                     /locus_tag="ZYRO0F04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497341.1"
                     /db_xref="GeneID:8205144"
     CDS             complement(366863..368671)
                     /locus_tag="ZYRO0F04312g"
                     /note="highly similar to uniprot|P25808 Saccharomyces
                     cerevisiae YFL002C SPB4 involved in the maturation of 25S
                     ribosomal RNA ATP-dependent RNA helicase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497386.1"
                     /db_xref="GeneID:8205144"
                     /db_xref="GOA:C5DXE2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXE2"
                     /translation="MSKTLSWDDCNYQVQPWIKAAIDVMGFDTMTPVQTSTIPMFARN
                     KDVVVESVTGSGKTVAFVIPILEKIIAEEANTPNLKKGHFHSLIVTPTRELSNQIQSV
                     IQSFLEHYPDDEHPIRSQLLVGTNQSSVRDDLANFLQNRPQILVGTPGRVLDFLQMSA
                     VQTKSCSVLVLDEADRLLDLSFFGDIEKILKTLPKQRRTGLFSATIGSAGSQIFKTGL
                     RNPVKITVSSKTKAPTSLGLFYTVIEPEAKIQQLLSIMNNYKFKKCIVYFPTCISVTY
                     FYSFMQYLQRDKKLLDEEVEFFSLHGKLQTSSRQKTLDSFGKSFGKAVLFTTDVAARG
                     IDIPDVDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITFLNKGREEDYIPFLEVKNV
                     ELKEMPLKIIDLPTKEPFYEIFKNWVLQDRARYDLGVRSYVAFIKNYMKHSASSIFRL
                     QSLDYVGLAKMYGLFRLPRMPEINNYFQNDTIKDGWIIDQPIDMDKFAYMDKKRENKR
                     LELLKNSNQINEKKREKMEAKQRNTSWSNKLQSKEEKSTRKAKMAMKREEIERQIADG
                     SDSDEDVQEDWKETVMQNKRRKKNQSTAVTGSFDDL"
     gene            <369069..>370364
                     /locus_tag="ZYRO0F04334g"
                     /db_xref="GeneID:8205145"
     mRNA            <369069..>370364
                     /locus_tag="ZYRO0F04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497342.1"
                     /db_xref="GeneID:8205145"
     CDS             369069..370364
                     /locus_tag="ZYRO0F04334g"
                     /note="similar to uniprot|P31115 Saccharomyces cerevisiae
                     YFL001W DEG1 Non-essential tRNA:pseudouridine synthase
                     introduces pseudouridines at position 38 or 39 in tRNA
                     important for maintenance of translation efficiency and
                     normal cell growth localizes to both the nucleus and
                     cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497387.1"
                     /db_xref="GeneID:8205145"
                     /db_xref="GOA:C5DXE3"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DXE3"
                     /translation="MGVLQRLFRLINKPGLRSGEMSLPTASNYSAWTKEQLIEKIVEL
                     ENHQDVQNSKKHKKASPELPKTKRRREFDFSKYNTRFIALKFSYLGWNYNGLAVQKDV
                     TPLPTVEGVIIDALMKCRLVASSNVQDFRFSRCGRTDKGVSAMNQVISLEVRSNLSDE
                     EQKDPSNDTRELQYAQILNHLLPEDIKISAMCLRPPEGFDARYSCEYRHYKYLFSGKG
                     LMLDRMQKAAALYHGEHDFRNFCKLDGSKQITNYTRNILGSEIQHISDNMYCFDLVGS
                     AFLWHQVRCMMAILFLVGQGLEEPSVITNLLDVDKTPQKPIYEMASDLPLILYDCKFP
                     EMEWIQPTSADYKAIKYSKVIESLNLHYQFKATVANMFAECLALQPDSNADFSNKTRI
                     NVGDGVGKVVSKYEKMVNRQVMDSAETVNEKYRNRKNTK"
     gene            complement(<370432..>371142)
                     /locus_tag="ZYRO0F04356g"
                     /db_xref="GeneID:8205146"
     mRNA            complement(<370432..>371142)
                     /locus_tag="ZYRO0F04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497343.1"
                     /db_xref="GeneID:8205146"
     CDS             complement(370432..371142)
                     /locus_tag="ZYRO0F04356g"
                     /note="highly similar to uniprot|Q12483 Saccharomyces
                     cerevisiae YPL002C SNF8 Component of the ESCRT-II complex
                     which is involved in ubiquitin-dependent sorting of
                     proteins into the endosome appears to be functionally
                     related to SNF7 involved in glucose derepression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497388.1"
                     /db_xref="GeneID:8205146"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016689"
                     /db_xref="UniProtKB/TrEMBL:C5DXE4"
                     /translation="MKRFGLAAFDDQQDDKEYEGISSAVLQRQNNELKEQLAVFQERL
                     VGFAKKHNSEIQANPEFRSKFVRMCLSIGIDPLSLFDKDKHLFNVNDFYYEICVKVIE
                     ICRKTKDMNGGVLSFDELEKGYFRRLNVDMGDLEKSIDMLQSLDGGFEIFEIRGKKFL
                     RSVPNELTGDQTKILEICSILGYSSISLLHANLNWKPFRSRAVLNEMVANGLLWIDEQ
                     ADAEALYWDPSWINVLHE"
     gene            <371432..>372604
                     /locus_tag="ZYRO0F04378g"
                     /db_xref="GeneID:8205147"
     mRNA            <371432..>372604
                     /locus_tag="ZYRO0F04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497344.1"
                     /db_xref="GeneID:8205147"
     CDS             371432..372604
                     /locus_tag="ZYRO0F04378g"
                     /note="similar to uniprot|Q12341 Saccharomyces cerevisiae
                     YPL001W HAT1 Catalytic subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex that uses the cofactor acetyl
                     coenzyme A to acetylate free nuclear and cytoplasmic
                     histone H4 involved in telomeric silencing and DNA
                     double-strand break repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497389.1"
                     /db_xref="GeneID:8205147"
                     /db_xref="GOA:C5DXE5"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="UniProtKB/TrEMBL:C5DXE5"
                     /translation="MSVLDFKPEIWTCSANEALKISLVSENAIQFPPAFTYPIYGDAE
                     QIFGYKDLIIHLVFDSVTFKPFVNVKYSDKLKDDAEDVERKLLNFLPKGDVITKDEAK
                     WVDAFHEEQQSFSLPSDEFKVSEYENEGTQFVVYKQSIKEDFTKKLHRRVQIFTLLFI
                     EAASYIDETDDNWEIYWVFNNDTKQCIGFVTTYKYWKYLGAAQFDDSEDIKFRAKISQ
                     FLIFPPYQHKGHGSLLYKTLVDSWHQNDDILEITVEDPNESFDDLRDRNDLERLYKEK
                     FFDLVPEQGEISEQWIEAERRKYKLEKRQFHRLIEMILAYKNSENYRLQVKKRLYTKN
                     FDALYDMGEDDRKDALQKSFILLSDDYKRIISSCSFLKHGLESPSDGQDTKKPKRV"
     misc_feature    372701..372867
                     /note="Centromere Zyro0F"
     gene            <373261..>373881
                     /locus_tag="ZYRO0F04422g"
                     /db_xref="GeneID:8205148"
     mRNA            <373261..>373881
                     /locus_tag="ZYRO0F04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497345.1"
                     /db_xref="GeneID:8205148"
     CDS             373261..373881
                     /locus_tag="ZYRO0F04422g"
                     /note="similar to uniprot|P43586 Saccharomyces cerevisiae
                     YFR001W LOC1 Nuclear protein involved in asymmetric
                     localization of ASH1 mRNA binds double-stranded RNA in
                     vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497390.1"
                     /db_xref="GeneID:8205148"
                     /db_xref="UniProtKB/TrEMBL:C5DXE6"
                     /translation="MAPKKSSGKKNAPSKKVVTPEVFSDSQARNQLANVPKLTEKSKV
                     KKPSKLAEKKEQSKARLYGGRKKTKTYDEKDLDLPSLNKAIIPGVKIKKGKKGKKFID
                     DHDHLKLNLLLKTIGDKYDDIDESKLEKARRLEEIREMRRQEIEKKESSKNEVLQDKK
                     AELKRKASVARTQRRKQKRESERTVEATETKQNTDVPKKKKKVSFA"
     gene            <374392..>375864
                     /locus_tag="ZYRO0F04444g"
                     /db_xref="GeneID:8205149"
     mRNA            <374392..>375864
                     /locus_tag="ZYRO0F04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497346.1"
                     /db_xref="GeneID:8205149"
     CDS             374392..375864
                     /locus_tag="ZYRO0F04444g"
                     /note="similar to uniprot|P43635 Saccharomyces cerevisiae
                     YPR001W CIT3 Citrate synthase catalyzes the condensation
                     of acetyl coenzyme A and oxaloacetate to form citrate
                     mitochondrial isozyme involved in the TCA cycle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497391.1"
                     /db_xref="GeneID:8205149"
                     /db_xref="GOA:C5DXE7"
                     /db_xref="InterPro:IPR002020"
                     /db_xref="InterPro:IPR016141"
                     /db_xref="InterPro:IPR016142"
                     /db_xref="InterPro:IPR019810"
                     /db_xref="UniProtKB/TrEMBL:C5DXE7"
                     /translation="MCKIGHSKLSRIEKMLLSLTTRRSLYSTKVHGSSSLELKTVLKE
                     LIPQRKQEILELKKNYGDVKVGDITIGSVIGGMRGNNSMFWQSTSLDPYEGIRFQGKT
                     IQDCQRLLPKDPKDPDEKRNFLPEGMFWLLVTGQIATQEQASHLSRELGIRGRKLPDD
                     TEKLMSTLPSDIHPMTQLAIGLASMNQTSKFAKKYERGDIGKNEYWEYAFDDVLNLIA
                     ALPQLSGKIYSKIAAKGKPLGQFKEDRDWSYNICSLLGMTSEDSCNRQNLTAKQSGDF
                     VNLMRLYTGIHVDHEGGNVSAHTTHLVGSALSDPYLSYSSGIMGLAGPLHGLAAQEVV
                     RFLIEMNSCITSPQNEIEIKKYLWKLLESKRVVPGYGHAVLRKTDPRFVAMLDFVKAR
                     PEEFSQDENVILMEKLSKIAPKVLKEHGKCKNPYPNVDSASGILFYHYGIKELLFFTV
                     IFGCSRSMGPLTQLVWDRALGLPIERPKSLDFNSLRSLCR"
     gene            <376244..>377815
                     /locus_tag="ZYRO0F04466g"
                     /db_xref="GeneID:8205150"
     mRNA            <376244..>377815
                     /locus_tag="ZYRO0F04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497347.1"
                     /db_xref="GeneID:8205150"
     CDS             376244..377815
                     /locus_tag="ZYRO0F04466g"
                     /note="similar to uniprot|Q12428 Saccharomyces cerevisiae
                     YPR002W PDH1 Mitochondrial protein that participates in
                     respiration induced by diauxic shift homologous to E. coli
                     PrpD may take part in the conversion of 2-methylcitrate to
                     2-methylisocitrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497392.1"
                     /db_xref="GeneID:8205150"
                     /db_xref="GOA:C5DXE8"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="InterPro:IPR012705"
                     /db_xref="UniProtKB/TrEMBL:C5DXE8"
                     /translation="MLSTRTKGAICLGRKTHIGAKTLTLGQNYTTSSHAHTTTNQRPE
                     PDKILKDIADYVHQAKITSQVALETAKLCLLDTLGCGLAALKHQQARDIITPIVPDTI
                     IPNGTKVLGTNYKLGPVEGAFAIGTLIRWLDYNDCWLAAEWGHPSDNLGGILAVADYL
                     TRLSRATSGKEGKVFTVGDVLEGMIKAHEIQGVIALENSFNSVGLDHVVLVKVATTAV
                     VSKMLGLDEQQTIAAISQAFVDGQSLRTYRHAPNTGSRKSWAAGDAVSRAVNLAYLIK
                     KADVGLIPSVLTAPTWGFYDVLFKSKPFSFKQRNQFGSYVMENILFKISFPAEFHAQT
                     AAEAAMKAHVTLKQMGKTFRDVKSVRIRTQEAAVRIIDKSGPLYNYADRDHCIQYMTA
                     VPLIYGRLTAEDYTDAIAKYPEIDELRSKMYCIKDDQFTLDYHNPAKRSIGNALLIEL
                     NDDTKLDEIVVEYPIGHRLRRKEGIPLLLNKFKTHLNEHFSNSPGRAEEIYIKSQKSD
                     LESTPIDSYMDLYWG"
     gene            <378017..>380578
                     /locus_tag="ZYRO0F04488g"
                     /db_xref="GeneID:8205151"
     mRNA            <378017..>380578
                     /locus_tag="ZYRO0F04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497348.1"
                     /db_xref="GeneID:8205151"
     CDS             378017..380578
                     /locus_tag="ZYRO0F04488g"
                     /note="similar to uniprot|P34077 Saccharomyces cerevisiae
                     YFR002W NIC96 Component of the nuclear pore complex
                     required for nuclear pore formation forms a subcomplex
                     with Nsp1p Nup57p and Nup49p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497393.1"
                     /db_xref="GeneID:8205151"
                     /db_xref="GOA:C5DXE9"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:C5DXE9"
                     /translation="MSLKVDSMSSKTNKTQDVSLKGSAKVLNELIETSKNLPTTSSEL
                     GSIQLSVNEIRKRTHDLRQKKDISSDHTKAHYLLAGSGLAIEDVDLSLKNLQSKQLLE
                     QPVSKKQVEGELDTYLETKKDENILSSIENLLSVAAKDFDNFVNQNLSLDWDQRKEEV
                     RENFGILIQGKNHTDSTKNVAPLNPKLPTWGNQGSSILNSGETRLNVNENYAVREKFE
                     KYAKIIYRFNNARQANQDFPLLKELSQALANGGDLKNRQLLESSKILEGLKSNSDVVQ
                     NAKSYLQNQFLEYVDHLYKKNLSEGLPTNINKIKSFIDSKLKNPNNTWKFNNLTFING
                     TPIWALIFYLLRAGLLQEALEVAVNNKASFKKVEQSFLTYLKAYVSSKDHTLPVEFSA
                     RLHTEYSQHIKSSLDGDPFRLAVYKIIGRCDLTRRNISFITLSVEDWLWIHFMLIKDD
                     IADSDPVYERYSLSDFQNIIVSYGHTRFTNYYSQVLILSGLYELAVEYAYSISEIDAV
                     HLAIVMANQGLLKVDNDRSSSSGTDFITVKSNQRKINFAKVLGNYTRSFKYSDPRIAA
                     EYLILIALVATPEQVELCHEALRELVLETKEFTILLGKINRDGTRIPGVLEERQSLLH
                     LKDEKEFLRKITEHAALKADEDGRVYDCLLLYQLSEEYNIVITIVNSLLSDLLSNTDL
                     DQPLVTMDENNETNPVLIAKKIVCIYIENLEISQKVQTKNKETCIILLKLADARRAYQ
                     AKQWETTLAQIEELDLLPFSDEVSARRKAQDFTALNENIVKNIPTLLVMVMSCISQLI
                     AGLNQSDYQSVTKAQQVEALKNVSRNCMMYAGMVQYKMPRETYSALIRLDIDCKV"
     gene            complement(<380670..>381164)
                     /locus_tag="ZYRO0F04510g"
                     /db_xref="GeneID:8205152"
     mRNA            complement(<380670..>381164)
                     /locus_tag="ZYRO0F04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497349.1"
                     /db_xref="GeneID:8205152"
     CDS             complement(380670..381164)
                     /locus_tag="ZYRO0F04510g"
                     /note="weakly similar to uniprot|P43587 Saccharomyces
                     cerevisiae YFR003C YPI1 Inhibitor of the type I protein
                     phosphatase Glc7p which is involved in regulation of a
                     variety of metabolic processes overproduction causes
                     decreased cellular content of glycogen"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497394.1"
                     /db_xref="GeneID:8205152"
                     /db_xref="InterPro:IPR011107"
                     /db_xref="UniProtKB/TrEMBL:C5DXF0"
                     /translation="MNGDRRDQQCRSIQTQTQTQTQTVNVESGPPLLQLRASHEQQQR
                     VQRGSETSRGNSSRPSVRWESDVIDNENMNKKKTKICCIFHPQEEPDEECECPSDHEE
                     PSQPSSSSSSSSESDEDRGLNFEERRARRVARRHRKLNQKRSESPNAYEVQPDYTKHQ
                     AHNH"
     gene            <381449..>382369
                     /locus_tag="ZYRO0F04532g"
                     /db_xref="GeneID:8205153"
     mRNA            <381449..>382369
                     /locus_tag="ZYRO0F04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497350.1"
                     /db_xref="GeneID:8205153"
     CDS             381449..382369
                     /locus_tag="ZYRO0F04532g"
                     /note="highly similar to uniprot|P43588 Saccharomyces
                     cerevisiae YFR004W RPN11 Metalloprotease subunit of the
                     19S regulatory particle of the 26S proteasome lid couples
                     the deubiquitination and degradation of proteasome
                     substrates"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497395.1"
                     /db_xref="GeneID:8205153"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:C5DXF1"
                     /translation="MERLQRLMMNSKVGMADTNRDDTKETVYISSIALLKMLKHGRAG
                     VPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDIFQARMMDMLKQTGRDQ
                     MVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVIDAFRLID
                     TGALINNQEPRQTTSNAGLLNKANIQALIHGLNRHYYSLNIDYHKNSKDTQMLMNLHK
                     EKWQSGLKMYDYKEKETENLEATQNLVRIAKQYSKRIEEEKELSEEELKTRYVGKQDP
                     KKHLVETSDAALENNIVSVLTAGVNSVAIK"
     gene            complement(<382457..>383836)
                     /locus_tag="ZYRO0F04554g"
                     /db_xref="GeneID:8205154"
     mRNA            complement(<382457..>383836)
                     /locus_tag="ZYRO0F04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497351.1"
                     /db_xref="GeneID:8205154"
     CDS             complement(382457..383836)
                     /locus_tag="ZYRO0F04554g"
                     /note="similar to uniprot|P43589 Saccharomyces cerevisiae
                     YFR005C SAD1 Conserved zinc-finger domain protein involved
                     in pre-mRNA splicing required for assembly of U4 snRNA
                     into the U4/U6 particle"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497396.1"
                     /db_xref="GeneID:8205154"
                     /db_xref="GOA:C5DXF2"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DXF2"
                     /translation="MSSSGVKRNDEHVPTVNKRAKLDEPSYAFLETIDERKLDFDLEK
                     RCSVTLSPLNCYCCLVCGKYLRGRSENTPAFLHSVNEDHHVFVNFNSLKVYLLPDNVE
                     VEDKGRIQILARIRNAIRPSFSREEIDNSPHECFDLNNQQYTNGFVGFNNNASGNDSI
                     NVILSLLSHIIPLRDHFLLQDYLEEDEIVQRLGIIIRKLWSPKLFKPYVSSEEFLAYI
                     SVVDPNISSKVNDPRQIFIWLVNNLIKKSSELSRILSDSFQGNVQVVTIPIKPVLDAK
                     GDVVKFQRETAHEKHSTVPFWSLTLDLPPTPLFKDNRNANDLPQVRIEELLKKFDGKQ
                     EQQFAQGLRKYKLIRLPRYLILHFNRFDKKNPLTVKGRNQTLVEFSQKIEFQNSRYTL
                     VANVVHDTIGTTAFDNDDKSVWRIQLLNPTNDQWVELDGTLNRLKERELLFLQETYMQ
                     VWRREDSIE"
     gene            <384123..>385712
                     /locus_tag="ZYRO0F04576g"
                     /db_xref="GeneID:8205155"
     mRNA            <384123..>385712
                     /locus_tag="ZYRO0F04576g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497352.1"
                     /db_xref="GeneID:8205155"
     CDS             384123..385712
                     /locus_tag="ZYRO0F04576g"
                     /note="similar to uniprot|P43590 Saccharomyces cerevisiae
                     YFR006W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497397.1"
                     /db_xref="GeneID:8205155"
                     /db_xref="GOA:C5DXF3"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C5DXF3"
                     /translation="MLFACLLAVVASSLFTFTVLKRRLFRQRLPLLTEKSFTNVEKPL
                     KMVNKKLADPNDVPVALRGHKYPAKTHNLNVKKHLLKKNPHLSAQNTAVFIAGGEVEG
                     NKYCDTEKPFRQNRYFYYLSGVDIPGSTILFDFKKDHLTLFLPNVEWDDVIWSGLPMS
                     IEQATKEFDVDEVLYYDQVRSNLHRLEGYTIFTTDLDNVHDEKIKSALVPNEKDFFYA
                     LDESRMIKDWYEIEVLKKAAEISDNCHLAVMSALPIELNEVHIQAEFTYHAIRQGART
                     MGYDPICCSGPACGTLHYVKNTEDLAGKASVLIDCGAEWKNYTSDVTRCFPISGKFTK
                     EHRQIYEAVRDMQTQVMTKIRPGVDWDELHTLSHRVLIKHLLKLGIFKSQFSEDEIFK
                     RRASCAFYPHGLGHFMGLDVHDVAGRPDPHDSDPYFKYLRIRRPLQENMIITNEPGCY
                     FNNFLIAEFLDKVPERKEVVDKEVLKKYLYVGGVRIEDDVLITKGGCEVLSKITSDPD
                     EIERIVSDGLSKSRSDFHVIV"
     gene            complement(385829..385919)
                     /locus_tag="ZYRO0F04598r"
                     /db_xref="GeneID:8205156"
     tRNA            complement(join(385829..385864,385883..385919))
                     /locus_tag="ZYRO0F04598r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8205156"
     gene            complement(<387385..>387543)
                     /locus_tag="ZYRO0F04620g"
                     /db_xref="GeneID:8205157"
     mRNA            complement(<387385..>387543)
                     /locus_tag="ZYRO0F04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497353.1"
                     /db_xref="GeneID:8205157"
     CDS             complement(387385..387543)
                     /locus_tag="ZYRO0F04620g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497398.1"
                     /db_xref="GeneID:8205157"
                     /db_xref="UniProtKB/TrEMBL:C5DXF4"
                     /translation="MLSDINFNPKCKLINMGHLNLHMSKRMDKVMFLTSLDLSGRIKR
                     NREEYIIA"
     gene            <388032..>389681
                     /locus_tag="ZYRO0F04642g"
                     /db_xref="GeneID:8205158"
     mRNA            <388032..>389681
                     /locus_tag="ZYRO0F04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497354.1"
                     /db_xref="GeneID:8205158"
     CDS             388032..389681
                     /locus_tag="ZYRO0F04642g"
                     /note="similar to uniprot|P38124 Saccharomyces cerevisiae
                     YBR008C FLR1 Plasma membrane multidrug transporter member
                     of the major facilitator superfamily involved in efflux of
                     fluconazole diazaborine benomyl methotrexate and other
                     drugs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497399.1"
                     /db_xref="GeneID:8205158"
                     /db_xref="GOA:C5DXF5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DXF5"
                     /translation="MYTETFRNTFVLDLLEYFNIVRILQEPTAASISDDSQRTLHEAP
                     YSDLEANGSNGSIDHDEREKRETGGNIELGGVPQQKDPFLVEYTGPDDPERPVNWPLS
                     KKAIVAFQVQLLTCVTYMGTAIYTPGQEEIQKAFGVGHVVATLNLSMYILGFGLGPMF
                     FSPLSEFAIFGRQQLYIITLFLFSMLQIGCALVDNIAGLVILRFITGILCSPSLSTGA
                     ATISEIVTPPFVPVMIGMWSIGAVAAPAIGPILGAAMLVAKNWRFMFWLLMWITSGAL
                     IILSLFFPETYEENVLYRRCKRIQKTTGDNRYFTAKSKEESKLSIKDITINALWRPIE
                     IIVKEPIVLALDTYLALAYGTFYLFFEAFPIVFLRIYHFTPVELGLSYLGFVVSSFIA
                     YGVSLSFFRLFLPRIIKKGEFRPEKLLILAMWVCWCGPAALFIFGWTASVHWILPIMS
                     ELFWGLFLFNLFQAIFSYLAMSYPKYTASVFAGNGLFRSGFACSFPLFGQAMYDNLAI
                     KGYPVAWGSSLLGFITIGLGFLPFILYKTGPYLRSKSSFTG"
     gene            complement(<390676..>391362)
                     /locus_tag="ZYRO0F04664g"
                     /db_xref="GeneID:8205159"
     mRNA            complement(<390676..>391362)
                     /locus_tag="ZYRO0F04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497355.1"
                     /db_xref="GeneID:8205159"
     CDS             complement(390676..391362)
                     /locus_tag="ZYRO0F04664g"
                     /note="similar to uniprot|P43592 Saccharomyces cerevisiae
                     YFR008W FAR7 Protein involved in G1 cell cycle arrest in
                     response to pheromone in a pathway different from the
                     Far1p-dependent pathway interacts with Far3p Far8p Far9p
                     Far10p and Far11p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497400.1"
                     /db_xref="GeneID:8205159"
                     /db_xref="UniProtKB/TrEMBL:C5DXF6"
                     /translation="MGSDVRQQEQQQVGQSGQVTQQQQPQQLYMSPQTENLSYMYSLV
                     ERLMDQLQTNKQRKEQLLWDVDVLSKQLSQKFNKSEVKGKDDLDVVIFQNFLNERDNL
                     LDDGDNDNDDDKQGSDAGGNRLTILKRQNEQLKKIFESKTRLNGDTLSLLYYHEDALN
                     EIVRHLRSDVLKSHEVFIERVRSKFNNEMIPKEDAEFSFYLENVKEIQKLIDFSQAYR
                     SLLRLNDSEM"
     gene            <391673..>393778
                     /locus_tag="ZYRO0F04686g"
                     /db_xref="GeneID:8205160"
     mRNA            <391673..>393778
                     /locus_tag="ZYRO0F04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497356.1"
                     /db_xref="GeneID:8205160"
     CDS             391673..393778
                     /locus_tag="ZYRO0F04686g"
                     /note="similar to uniprot|Q12188 Saccharomyces cerevisiae
                     YPR007C REC8 Meiosis-specific component of sister
                     chromatid cohesion complex maintains cohesion between
                     sister chromatids during meiosis I maintains cohesion
                     between centromeres of sister chromatids until meiosis II
                     homolog of S. pombe Rec8p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497401.1"
                     /db_xref="GeneID:8205160"
                     /db_xref="InterPro:IPR006910"
                     /db_xref="UniProtKB/TrEMBL:C5DXF7"
                     /translation="MSASINFSNFSLNQIDRGGQFPEGVATVWLLSTLGNSTTRGSNA
                     RAVSSSTISNTSSVKKKDIINVSIPDTCMIIQSNEMQLPLRYVSNLLYGVTICYNRKT
                     EYVLSDLTSLLTQLQKRIYGGQGGTGQKKYSKSNSKVINNTILNFDENDGGNGLLSDD
                     PLFDISQIGDFEQMLGTVPRDNISEAITIRKQDYLRELTNWNAFEKPAHLEQSSSLEH
                     WNRSMTLDDIPIDVDFNLDIEDVMSQQGTVTGSSVDSNALRNGNDLNVNFDNQDFTLN
                     FEEDEDEANQGDIQGGPRAEPNIPLGLPEEEEEDKEETSFETEHRENGPPLKKFKKGN
                     APDTAATTIRLIQFDERTGLSTEVLKSNHNNYCESMDGRRRREESKSNLNSWQQVMDL
                     EKQPEFLQKCWNFVLNDKGETDLTFVHGRVGFDSASIERGRNHSRSNSTSQRSSSNVP
                     SEEMGRRMVVSRDNSVDYNTNENLLLNLDQINEELEDDSSRDTSTHPHDFMQVNLELP
                     PSSFGRTYTRTGTGNDTFSGSSSTSGERDAIDVLYQRTKGSTHKRRTHRESSNTFESR
                     ELSEIPPVYDHDFTRLPFQVVLDYQARKFYDYIRERSLFVGKTTRSNPPFKRKLLFED
                     IVPSKLTTDGDDADVDNYNLDEQSEERPTISKRIAASAFLSLLNLASKELIDIREYQD
                     QDADDGFKVMKGDDIVVYA"
     gene            <394053..>395756
                     /locus_tag="ZYRO0F04708g"
                     /db_xref="GeneID:8205161"
     mRNA            <394053..>395756
                     /locus_tag="ZYRO0F04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497357.1"
                     /db_xref="GeneID:8205161"
     CDS             394053..395756
                     /locus_tag="ZYRO0F04708g"
                     /note="similar to uniprot|Q12031 Saccharomyces cerevisiae
                     YPR006C ICL2 2-methylisocitrate lyase of the mitochondrial
                     matrix functions in the methylcitrate cycle to catalyze
                     the conversion of 2-methylisocitrate to succinate and
                     pyruvate ICL2 transcription is repressed by glucose and
                     induced by ethanol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497402.1"
                     /db_xref="GeneID:8205161"
                     /db_xref="GOA:C5DXF8"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:C5DXF8"
                     /translation="MINHVTIKGTMYNGTRSLSSSTSNSSSVLNLKSFVAEEVRKIED
                     WWGQPRYKDVERPYSSLDVVKHRGSLPVECNRYASSFQAQKLFRLLEDKFEKKLPLHT
                     LGVIDPVQMTQLARSKEIEVAYLSGWACSSTLVGSTNEVSPDFGDYPYNTVPNQVERI
                     FKAQQMHDRKLFLEKVEGLTNDDTTDYLKPIIADADMGHGGNTTVMKLAKLFAEKGAA
                     AIHLEDQMVGGKRCGHLGGAVIVPSSTQLSRLIATRLQWDIMGTENLILARTDSCNGE
                     LLSSSSDPRDHKFIKGTIEPGITPWSDRLAGLESQPMVTSDQIAIEEAEWYDKHHVFT
                     FDEALQKQVSQTEYERYLELKNKHLKEKPFVSLKEMKALASQASPATTIEFDWDAPRT
                     KEGYYLYNGGMEAAIERSLYFAPYADMIWLETKTPDLKQAISFSSRIHEVYPHVKLVY
                     NLSPSFNWSAHGYTEENLKGFIWDLAKHGFVLQLVSLAGLHVNGLSFWQLVKSFGQNG
                     MKAYVEQVQRLEKLENSDVLTHQKWSGAEYVDSIIKVLQNGSSSQTLSTSGDSFTENQ
                     F"
     gene            <396093..>396578
                     /locus_tag="ZYRO0F04730g"
                     /db_xref="GeneID:8205162"
     mRNA            <396093..>396578
                     /locus_tag="ZYRO0F04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497358.1"
                     /db_xref="GeneID:8205162"
     CDS             396093..396578
                     /locus_tag="ZYRO0F04730g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497403.1"
                     /db_xref="GeneID:8205162"
                     /db_xref="UniProtKB/TrEMBL:C5DXF9"
                     /translation="MPDVWQDQNSQDETLQETGSDYFDALSGEESGLENESSDWSDDE
                     SLIDLQSCSIAGSDPKVMPILIHSHVKEEEERQETKEGHVHVQIQTPTRNFSGCRRKI
                     PRTPIPGHTDPLTEKLQLNLQSAFEELEIERRERLGQKCPLQLGNSSLLKKRETRSMA
                     I"
     gene            complement(<396614..>397741)
                     /locus_tag="ZYRO0F04752g"
                     /db_xref="GeneID:8205163"
     mRNA            complement(<396614..>397741)
                     /locus_tag="ZYRO0F04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497359.1"
                     /db_xref="GeneID:8205163"
     CDS             complement(396614..397741)
                     /locus_tag="ZYRO0F04752g"
                     /note="similar to uniprot|P43591 Saccharomyces cerevisiae
                     YFR007W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497404.1"
                     /db_xref="GeneID:8205163"
                     /db_xref="GOA:C5DXG0"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLGCFFFFFIQYKVQVEIFVFKVHYLREDTPFPKMVVDVDALAN
                     EAIGLLDQCKDDNYRVCILIVGPPGSGKSTVAQDLSRQINHRFDEYRLQGNQKSAHGG
                     TRSRASDVALASDVPEITTPLSEELAFNGGILPKYVEDVNFQPVKRRLENGDLQILGR
                     GGLPNAFTISNDVEPDEESSFAQIVPMDGFHLSRQCLSSFQNPQEAHKRRGSPPTFDS
                     NNFAQLCKTLAQTCTIKPGSCDAKSCFEFMAKTYDPHFPCIKIPGFDHSLKDPTPDQF
                     CLNGHTRIVILEGLYLLYDKENWQRVHEILQNTGSLLVWYIDIEDHVIEERVAKRHFN
                     SGLADSVEQGRLKFQGNDLLNARLIRKNLVQSGKVVTLRND"
     gene            <397842..>398879
                     /locus_tag="ZYRO0F04774g"
                     /db_xref="GeneID:8205164"
     mRNA            <397842..>398879
                     /locus_tag="ZYRO0F04774g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497360.1"
                     /db_xref="GeneID:8205164"
     CDS             397842..398879
                     /locus_tag="ZYRO0F04774g"
                     /note="similar to uniprot|Q12480 Saccharomyces cerevisiae
                     YPR004C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497405.1"
                     /db_xref="GeneID:8205164"
                     /db_xref="GOA:C5DXG1"
                     /db_xref="InterPro:IPR001308"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="InterPro:IPR018206"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DXG1"
                     /translation="MLRTLRFRIPTAGPFIKSHRFASTLTFIETSKDGSVVSSSLNAL
                     TAAQQLGNPIHAVILGSQASAAANALKSSVKCEKLAKILVSNNVGFDHYLPEKVAPVL
                     ARLLQNEEYSHFVAASSTVGKSNLPRLGALLDLQPISDITKIVDAKTFVRPIYAGNAI
                     ATVECSQPKKLISVRASAFEPIAQGSTDSALIEEVQGLEPESSIDIKWEGETLVKSER
                     PDLGSASIVVAGGRALKDKETFDKILVPLADALHAGIGATRAAVDNGFCDNSLQVGQT
                     GKVVAPDLYIAVGVSGAIQHLAGMKDSKVIVAINNDPEAPIFKVADYGLEGDVYEIVP
                     ELTQKLKEVQN"
     gene            <399222..>401429
                     /locus_tag="ZYRO0F04796g"
                     /db_xref="GeneID:8205165"
     mRNA            <399222..>401429
                     /locus_tag="ZYRO0F04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497361.1"
                     /db_xref="GeneID:8205165"
     CDS             399222..401429
                     /locus_tag="ZYRO0F04796g"
                     /note="similar to uniprot|P53394 Saccharomyces cerevisiae
                     YPR003C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497406.1"
                     /db_xref="GeneID:8205165"
                     /db_xref="GOA:C5DXG2"
                     /db_xref="InterPro:IPR002645"
                     /db_xref="InterPro:IPR011547"
                     /db_xref="InterPro:IPR018045"
                     /db_xref="UniProtKB/TrEMBL:C5DXG2"
                     /translation="MSPSSSSLLRDGPHSSERDYGSNGCTSCGPKPNRCPCQRDSLQS
                     CKSFRPLVPITESSVSSPLNSVNHKKLSPNEIEIRPSIWDVLPYYLPFFSWLPNYNIS
                     KCIGDLIAGVSLASFQIPLALSFATSVAHVEPLCGLYSLAFTPFIYAILGSVPQMIVG
                     PESAISLVVGQAVEKMISHNPDLHTLQLSAVITFISGGFLFFFGLCRLGFLGNVLSRA
                     LLRGFISSVGLVMIINSMISEFKLDKILKDLPVHYHTPFEKILFLVTYAPNNYHGPTT
                     ALSLSCFFILIMTKIIKKKLMPRCRWIVFVPDILLLIIGTIFLSIKYRFKHNYSISTV
                     GDFNTKGLDKLLNPLSAENRGLIPQLLSAGFITAMLGFFESTTASKSLGSSYDLAISS
                     NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLL
                     PMIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVE
                     VGICIGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELEE
                     LEGCLIVKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHG
                     MTHMDSSAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVEDNVPMSA
                     TNVNQEIYASSYFLTIEDALTAMEDHESANFSSDLVADNLSLVSPSLTDSGIV"
     gene            <402003..>405878
                     /locus_tag="ZYRO0F04818g"
                     /db_xref="GeneID:8205166"
     mRNA            <402003..>405878
                     /locus_tag="ZYRO0F04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497362.1"
                     /db_xref="GeneID:8205166"
     CDS             402003..405878
                     /locus_tag="ZYRO0F04818g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497407.1"
                     /db_xref="GeneID:8205166"
                     /db_xref="UniProtKB/TrEMBL:C5DXG3"
                     /translation="MVQINFKSWFKPIKATEKEKKVTINPSSIASVPPVALAATSLAA
                     AESNETEGTLTTPQSIGTNTGDGTDGKRINSAHDKNGSEYSSSSKNNATAEAVSNSLV
                     AVSTVTGAKVSKKDPAYPGVYHGTSSHRVSRTIRKFFKKAWWNKEKGNAEGENGGSET
                     SVSDTTSFSSASEWEDPYGNPILRKRDYMLMILKEAAGKEGFISSIDIEKQIGFANRY
                     HKIRRWKNKDFKFPNSHSTEGVYKPWELVPGFCEKSEDQPTVGRELTCASNGVVISSQ
                     KSEPRISLPRSSPIAGCSTELRERDIVSVSSNPVFSTDIVPVEPVAAVSSVKGTPVVP
                     TVLPATAESTASDSVATEAPLLPSDFISRFAPIQPAAQEDLQELARVFETNEPRSIIE
                     NDSSRFAPRNRTPQQNLEDAVKLFVSYNGDETKVDPPLPQDVEYSSFGEQQQNLYDSE
                     VVHDDVTVVSPNLDDDCPHSLRFFPDDPPPERISVSRHNDNGDVSISSCVELGASVPS
                     NGVRNYPYYHSTNGIEASVSSQSAVMLPLTFEQSPVEPTTFVFDVNMQQNIEAIVSSR
                     DNSICLPLDDVCKKSSTISSSGFVYDINVHKNIEAIIGSEHFEEYVPKSADWHDYEVV
                     LPKRGCAGANDIKEKGPIISHYPSLQSTLSTEELSEVKSPDYYDAENEPISMDPDGKE
                     RRRSFETIIHYSLKPVAIDTASPQFDEDFDVSDLKIDDDEQESPLSNVCADTFLQKKD
                     LGSLFDAAAKIQNSNHVNTDNTAVLPIPGHAVIMNTLLAADVPAQIESNNVRPIITVH
                     DDDLEPCVPLSEDDDDEDEDGDSVAIAYHEGRIGEPIAELKNTHLSAPVQQLAPTPKN
                     QANFDKLDVDLFSKVENLMSPHNGIGASINQEVPGLGAYRNNNHIEQELNYDEIIRLI
                     FREDSLQEDVYHPETATEIGDDDYDVSMSTEEEFEDEDEDSEEEDEDESSWNLTSSFC
                     SHRVPSFVDGLFGDLEYGSERPNHILDAPVENGLQQVSRHGDNFEISPQIELKQQSPM
                     PLPVELKEEPPALIVSTERESVATHSPLESLCFVHWPIVKENWVAKTLGEYCPLNFRN
                     NIRFNYDSSEFKIRQYYMTTKAILQEQYNTRRKLIFSPKPGKWLNFEWETDILDVVDD
                     FIRINRNLYPMFKGPRIVQRKHLIRRWKNRERDRLIVLEQLLDYWREDPAAIDQLKLE
                     KQSTRPLQQHSPSISNVEAPERPPLKLVLSKIFERMTMDVAHKRLGRPPRDGSSVVLL
                     KKGPPLGIDYFGYKRDKAREWVNNILLKL"
     gene            <406288..>407427
                     /locus_tag="ZYRO0F04840g"
                     /db_xref="GeneID:8205167"
     mRNA            <406288..>407427
                     /locus_tag="ZYRO0F04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497363.1"
                     /db_xref="GeneID:8205167"
     CDS             406288..407427
                     /locus_tag="ZYRO0F04840g"
                     /note="highly similar to uniprot|Q02895 Saccharomyces
                     cerevisiae YPL088W Putative aryl alcohol dehydrogenase
                     transcription is activated by paralogous transcription
                     factors Yrm1p and Yrr1p along with genes involved in
                     multidrug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497408.1"
                     /db_xref="GeneID:8205167"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DXG4"
                     /translation="MKKIYKGNPRAAHITLDGPPHERSSRRTSKVKYTEIIMSIAQQV
                     RFGNTGLKISPIVVGCMSFGSKEWADWLIEDKEEVFKILKRAYDRGLRTYDTADVYSN
                     GLSERILGEFLRHYNINRETVVILTKVFFPTDESIHVTSKFDFSEQELLTLTNQRGLS
                     RKHILAGVKASIERLGTYIDVLQIHRLDHETPMEEIMRALNDVVTQGDVRYIGASSML
                     ATEFAELNFIAERHDWFKFVSSQSYYSLLYREDERELIPFAKRHGIALIPWSPLSGGA
                     LTRPLGGTSNRSQTDNFKGILGVDNLKDNEKEIVNRLEKVANEKGQSMAAVATAWVLH
                     KGCNPIIGFNSIKRVDQALDALEVKLSEQEISYLEEPYLPRNLVM"
     gene            <408394..>410550
                     /locus_tag="ZYRO0F04862g"
                     /db_xref="GeneID:8205168"
     mRNA            <408394..>410550
                     /locus_tag="ZYRO0F04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497364.1"
                     /db_xref="GeneID:8205168"
     CDS             408394..410550
                     /locus_tag="ZYRO0F04862g"
                     /note="weakly similar to uniprot|Q12753 Saccharomyces
                     cerevisiae YPR008W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497409.1"
                     /db_xref="GeneID:8205168"
                     /db_xref="GOA:C5DXG5"
                     /db_xref="InterPro:IPR001083"
                     /db_xref="UniProtKB/TrEMBL:C5DXG5"
                     /translation="MVLINGVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCD
                     HCKELRKNKNANPSGMCTCGRLEKKRLAQKAKEEARAKAKEEKKLHECRCGSDEPCKC
                     HSNRRSRTSHTRKLKNTNVGGSRPSSQHLDSASIGGMGHVMSPVSMDSNSSIQNGSAG
                     TSNINISGIGKAEPSSLFPSGFLDTGESNGKISKDYHQVPSLASISSLHSGQSPSFDQ
                     KLGLPQSPLLNGLSRNSGGNFFNWADDVGSLYPAKSDSGVNLLENDKPNSNVSGNTNT
                     SSMNNFPGDLGVGIYFGVNNGSTNGNENGNGDGNDNVNGSKSMNTNLKMKNPNAKVPF
                     DEYGVPPEINTNQSNDPSGNNMSAPLNDWNTDKSPDVGNMTNFAQNNGLLDIFMDSTT
                     VAALSKDSLMGQQDNFDFLNENNRTQGKINSNINPSYSHNGTNNHNDINKTNGNFINN
                     GNANHNQYRNRIWASPFGTDRSDTVSVDGESMRSVEGASLAPSFMDTPERASSLHSAH
                     SVLYQQPHPHNQAQKQIKRTTSANRGYRSQPSGRPAVPITINPSMVSSIDDTISVTSL
                     QSPASSLIDNNGFSTSLGNSGDFGTSNPLFERSKSPQLGLEELTNTTIPTTPQFSKQR
                     SNVIPSTNSKFELDRLLGLDTGNTSGLPDNSAISESNNNDNLVFQNDTATLSSPADKG
                     VFEEASLMNGNQTTSPPSQLFTEKGFADLDNFMSTL"
     gene            complement(<411043..>412254)
                     /locus_tag="ZYRO0F04884g"
                     /db_xref="GeneID:8205169"
     mRNA            complement(<411043..>412254)
                     /locus_tag="ZYRO0F04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497365.1"
                     /db_xref="GeneID:8205169"
     CDS             complement(411043..412254)
                     /locus_tag="ZYRO0F04884g"
                     /note="similar to uniprot|P53107 Saccharomyces cerevisiae
                     YGL164C YRB30 Competes with yeast RanBP1 (Yrb1p) for
                     binding to the GTP-bound form of yeast Ran (Gsp1p) able to
                     form trimeric complexes with RanGTP and some of the
                     karyopherins inhibits RanGAP1(Rna1p)-mediated GTP
                     hydrolysis on Ran."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497410.1"
                     /db_xref="GeneID:8205169"
                     /db_xref="InterPro:IPR008812"
                     /db_xref="UniProtKB/TrEMBL:C5DXG6"
                     /translation="MDELLSKAGSQAVTFAIKSGISIASTYALKTITTFVTQIPKDDA
                     RRIDKLKTQLQNRVDIVSSAIDLIKLVAARGNTNLESTLKLTKDLKDELDRFDENMQE
                     LTTLVESSKSPKAQKDAINAVEKYIKDLLQRIEGVTPYLNLSLTTSGATISSVLPQQI
                     SPGLLLQASNHINVNNSKGYGKVGPKFQVTVFSVFYQVDKDKFNRVTWKEDMKRAFVQ
                     VIKNEKEFKYELKIDQSFDDERYHNVEDGEKPQSMTIDLCQITKLFFSVSGNLLKLEE
                     QDAPVLVLKIDKNIQGRHHHENSSTEDVIWLALGGYEETETDGEESEEEEESQDEDED
                     QEKIEASSSITLLEYVIRLASLQETDKKSILEVTDERLSTYLNDENPNSIREQNADVK
                     VVTKNMEKIKL"
     gene            complement(<412364..>414910)
                     /locus_tag="ZYRO0F04906g"
                     /db_xref="GeneID:8205170"
     mRNA            complement(<412364..>414910)
                     /locus_tag="ZYRO0F04906g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497366.1"
                     /db_xref="GeneID:8205170"
     CDS             complement(412364..414910)
                     /locus_tag="ZYRO0F04906g"
                     /note="highly similar to uniprot|P32863 Saccharomyces
                     cerevisiae YGL163C RAD54 DNA-dependent ATPase stimulates
                     strand exchange by modifying the topology of
                     double-stranded DNA involved in the recombinational repair
                     of double-strand breaks in DNA during vegetative growth
                     and meiosis member of the SWI/SNF family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497411.1"
                     /db_xref="GeneID:8205170"
                     /db_xref="GOA:C5DXG7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR013967"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXG7"
                     /translation="MVKARLHSPPNGIGAGENPKLVPRSLNIQGSFAELTKPFKVPYK
                     NNNKRNVENDNSVRRTRRRTGISYAGMDVDVDMSMNNVEEEEEEEERRVRADALSAHR
                     LAQDPQRLSKIENTLRRSFTVPIKGYTQRHSLPLTLGTKKKVIPEPRPLHDPTDEFAI
                     VLYDPTVDGDMERNDSLPVAPPSSSDSNSQTQINRVQLMTNGVRNKSLKELLGETETQ
                     SKKFPNIPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDKELVTKGVENTTQE
                     VNRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLIDKCIIVCPSSLVNNWANE
                     LDKWLGPGTLSPLAIDGKKSSLNNGSVSGAIHSWAQAQGRNIVKPVLIISYETLRRNT
                     DQLKNCNVGLMLADEGHRLKNADSLTFTSLDSIDCSRRVILSGTPIQNDLSEYFALLN
                     FSNPGLLGSRSEFRKNFEIPILKSRDADATDEDVRKGQEKLSQLSYVVSKFIIRRTND
                     ILAKYLPCKYEHVIFVNLTPFQRELYKKNVESRDVKKLVKGVGGTQPLKAIGLLKKLC
                     NHPDLVDFNEEIENLDEISIPDDYEWNSKRKDLQVKYSSKFSILERFLAKIRSESDDK
                     IVIISNYTQTLDLIEKLCRQKRYGSVRLDGTMGINKRQKLVDRFNDPEGQEFVFLLSS
                     KAGGCGINLIGANRLILLDPDWNPAADQQALARVWRDGQKKDCFIYRFISTGSIEEKI
                     YQRQSMKLSLSSCVVDAKEDVERLFSADNLKQLFQFNDKTICETHETYHCKRCNKDGK
                     QMARSQAMLYGDATTWNHLIHKDLEKTNDHLLRNEFNHKDISYVFQYISH"
     gene            <416178..>417164
                     /locus_tag="ZYRO0F04928g"
                     /db_xref="GeneID:8205171"
     mRNA            <416178..>417164
                     /locus_tag="ZYRO0F04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497367.1"
                     /db_xref="GeneID:8205171"
     CDS             416178..417164
                     /locus_tag="ZYRO0F04928g"
                     /note="some similarities with uniprot|Q12286 Saccharomyces
                     cerevisiae YPR009W SUT2 Involved in sterol uptake
                     homologous to SUT1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497412.1"
                     /db_xref="GeneID:8205171"
                     /db_xref="GOA:C5DXG8"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DXG8"
                     /translation="MSTSIPVLNRNHSLPPLLLPASRPVSGVGSSAETRQDPFSTGSN
                     GKRSGSLEGLTQLATKRARIDATGGSDDGSNSVPLPLLFASPIPLVGSSAPKSGSVSS
                     VSSMSSFSDSSASPHVGVMFGDYGIRDGVRRNSDYATATERKSSKLTPPPTAPCMTRE
                     RNSPRSSASGPSSGSGSNSSKRQRVGPSCDGCRLKKIKCDAHVEIVLQDPRVVSQISN
                     KLHQVVSRDQVSQMDLKVDISNIPMDSVLVKHIDKIVMFKPCTSCNKRRASLDGSQGP
                     LDGRNDNVTGGVCVFSKGFTRADINVFVKICKKVGGKPVQEMTVEDYHEAGF"
     gene            complement(<417273..>418010)
                     /locus_tag="ZYRO0F04950g"
                     /db_xref="GeneID:8205172"
     mRNA            complement(<417273..>418010)
                     /locus_tag="ZYRO0F04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497368.1"
                     /db_xref="GeneID:8205172"
     CDS             complement(417273..418010)
                     /locus_tag="ZYRO0F04950g"
                     /note="weakly similar to uniprot|P53108 Saccharomyces
                     cerevisiae YGL161C YIP5 Protein that interacts with Rab
                     GTPases computational analysis of large-scale
                     protein-protein interaction data suggests a possible role
                     in vesicle-mediated transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497413.1"
                     /db_xref="GeneID:8205172"
                     /db_xref="UniProtKB/TrEMBL:C5DXG9"
                     /translation="MSDGLDGVDDFGVNPFEETLPDTPLEEVPPEPIRNIEPEIAPKP
                     IEEERPLAPGLLNYYSRYFQLTTADFRKRVLGSLSLRNEASPPDLYGPLWITATVVMS
                     RFLGSGLFTLCIDGVFGGISTEVKDSSRQSWKLVHSAWLFYAYTLLTPFIAQKLLATN
                     FIPLVSTYGYSNVTWIAGCLLLSVVDEFRRLGKNFVITIIEWVIVSLIALKRSYSLYN
                     ELEAGRKSLPLLVVDVAFCVAAKILLF"
     gene            complement(418156..418226)
                     /locus_tag="ZYRO0F04972r"
                     /db_xref="GeneID:8205173"
     tRNA            complement(418156..418226)
                     /locus_tag="ZYRO0F04972r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.96"
                     /db_xref="GeneID:8205173"
     gene            <418416..>419336
                     /locus_tag="ZYRO0F04994g"
                     /db_xref="GeneID:8205174"
     mRNA            <418416..>419336
                     /locus_tag="ZYRO0F04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497369.1"
                     /db_xref="GeneID:8205174"
     CDS             418416..419336
                     /locus_tag="ZYRO0F04994g"
                     /note="similar to uniprot|P39988 Saccharomyces cerevisiae
                     YEL029C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497414.1"
                     /db_xref="GeneID:8205174"
                     /db_xref="GOA:C5DXH0"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DXH0"
                     /translation="MRLLATQSHVVHGYVGNKAATFPLQCLGWDVDCCNSVQFSNHTG
                     YGLDKVRGNATTESQLDNTLQGVIQNFPHDYDALLSGYLPHAESIRLMGCHYAEYKRQ
                     NPHALWLLDPVMGDEGELYVSESVVPEYKRLIFGPDVGIDIITPNQFELELLHGSPVT
                     TLSELNDVLHGMHRFIPIIVVSSLDTRLFNDPNNIFIAASQAGKPPVILRVPLIDSYF
                     TGIGDIFSALLIDRIYKQRDELNLVSCVNDTLNVVQDVLKVTRDHSPRGVTMGSTLMK
                     ESELKIIECRDLYEGPGEEQGLQFKYKVLY"
     gene            complement(<419333..>419749)
                     /locus_tag="ZYRO0F05016g"
                     /db_xref="GeneID:8205175"
     mRNA            complement(<419333..>419749)
                     /locus_tag="ZYRO0F05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497370.1"
                     /db_xref="GeneID:8205175"
     CDS             complement(419333..419749)
                     /locus_tag="ZYRO0F05016g"
                     /note="similar to uniprot|P47111 Saccharomyces cerevisiae
                     YJR044C VPS55 Vacuolar Protein Sorting YJR044c"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497415.1"
                     /db_xref="GeneID:8205175"
                     /db_xref="InterPro:IPR007262"
                     /db_xref="UniProtKB/TrEMBL:C5DXH1"
                     /translation="MELKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLLDVLIF
                     LLAPLPNSLFGKGSLDGADFMSENAGDAQDLGHFLTGLFVTSGVALPTVFYHCRLIGL
                     MSCVMCTTGGLVIYSSIVVFSWFFRSSWEQDDALFS"
     gene            complement(<420011..>421960)
                     /locus_tag="ZYRO0F05038g"
                     /db_xref="GeneID:8205176"
     mRNA            complement(<420011..>421960)
                     /locus_tag="ZYRO0F05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497371.1"
                     /db_xref="GeneID:8205176"
     CDS             complement(420011..421960)
                     /locus_tag="ZYRO0F05038g"
                     /note="highly similar to uniprot|P12398 Saccharomyces
                     cerevisiae YJR045C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497416.1"
                     /db_xref="GeneID:8205176"
                     /db_xref="GOA:C5DXH2"
                     /db_xref="InterPro:IPR012725"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DXH2"
                     /translation="MLAARNVLRNVATPIRVATRSQSNKVGGSVIGIDLGTTNSAVAV
                     MEGKLPKIIENAEGSRTTPSVVAFSKDGERLVGIPAKRQAVVNPENTLFATKRLIGRR
                     FEDAEVKRDIDQVPYKIVKHTNGDAWVEARGQAYSPSQIGGFILNKMKETAEAYLGKN
                     VKNAVVTVPAYFNDSQRQSTKDAGQIVGLNVLRVVNEPTAAALAYGLEKSESKVVAVF
                     DLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYMLKEIVARFKQESGIDLSGD
                     RMAIQRIREAAEKAKIELSSTIATEVNLPFITADQTGPKHINMKFTRAQFETLTEPLV
                     KKTVDPVKKALKDASLSTSDISDVILVGGMSRMPKVMETVKQLFGREPSKAVNPDEAV
                     AIGAAIQGAVLAGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIFSTA
                     AAGQTSVEIRVFQGERELVRDNKLIGNFTLSGIPPAPKGVPQIEVTFDLDADGIINVS
                     ARDKASNKDASITVAGSSGLSEGEIEQMVQDAEKYKSQDEAKRQSIEAANRADQLAND
                     TESSLKEFEGKLDKVEAQKVQDQITSLRETVARVQAGEDVGPEDLKNKTDELQQASMK
                     LFEQMYKNDSSSQGQGQGQGEEPKQ"
     gene            <422386..>424170
                     /locus_tag="ZYRO0F05060g"
                     /db_xref="GeneID:8205177"
     mRNA            <422386..>424170
                     /locus_tag="ZYRO0F05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497372.1"
                     /db_xref="GeneID:8205177"
     CDS             422386..424170
                     /locus_tag="ZYRO0F05060g"
                     /note="similar to uniprot|P47112 Saccharomyces cerevisiae
                     YJR046W TAH11 (DNA replication)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497417.1"
                     /db_xref="GeneID:8205177"
                     /db_xref="InterPro:IPR014939"
                     /db_xref="UniProtKB/TrEMBL:C5DXH3"
                     /translation="MASHKLPVIDLNEISDEQELLPAVKSILLNDDTFLLRNYANIKQ
                     LDGLLYNLNHSELPDEQQGIDPNFTGVSNLGDNLFLEQYIANTDDQLQFNRQCNNASL
                     NNLYTRLFKIGIFFANLCIRSVVLDDENQKNANISQNQYFTKITRYFYQDQTSQELPS
                     GEIFEYPLNHDYVSHSPVGIITIFPQATNIKYKPSTISSDDNVWISIDEPDCLLLHTG
                     SLLANLSNGIHTTSPLKICPQSNTVHLTIGPPLNTVVDSARGDTLAKCLLKQQIEDFP
                     QIAQKFYPKEMAQLQLSKSLQFYKNLFSACETVLSLFVMSRSLGSPIELYSIFPQLSN
                     MMRKKITQDDFLKMVSLWPECYSLKSNSRGELIIGLPERNVLATLVNKSRRLEYSERA
                     DAWFQKAVNQQTVITDVPAVKMGKRRGSDNIGTDGSMIRQKLTSMALPREKRYLANPK
                     ERFMNPEKNTDSQSNLLERLRERERKSSALLSQRQRHYQQFLTVKMKQVFGILHSLPW
                     NRPYTVTYLTGLVVDSLQDSNNPIGISEAEEILEKLQSLLCDEISFQIVDGGLKVYRW
                     TQLDKDSLSAKIDTMSREELTNNVDTGL"
     gene            complement(<424225..>427857)
                     /locus_tag="ZYRO0F05082g"
                     /db_xref="GeneID:8205178"
     mRNA            complement(<424225..>427857)
                     /locus_tag="ZYRO0F05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497373.1"
                     /db_xref="GeneID:8205178"
     CDS             complement(424225..427857)
                     /locus_tag="ZYRO0F05082g"
                     /note="highly similar to uniprot|P39986 Saccharomyces
                     cerevisiae YEL031W SPF1 Sensitivity to a killer toxin (SMK
                     toxin) produced by Pichia Farinosa P-type ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497418.1"
                     /db_xref="GeneID:8205178"
                     /db_xref="GOA:C5DXH4"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006544"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DXH4"
                     /translation="MAPTPLVSSPIVRESRLLVSKPLLSRPYTSFFFPLYATFAHIYY
                     RQYDKYIKGPEWTFVYLGAIVSLNILVALLPEWNVGIEAGFKYNAAGDLHEATHILIK
                     TTENNGSDGIVEIQRVEEDGTVQIYFQFQKKRFLWNSDEQEFASPKFLIDEPPKLGYL
                     QEWKGHSGDLVHLRRLYGDNLFDIPIPTFLELFKEHAVAPLFVFQIFCVALWLLDEFW
                     YYALFNMFTVVSMEAASVFQRLVTLKEFRTMGVKPFPIYVFREGEWLYLETDKLLPMD
                     IVSMTRTAEDSAVPCDMLLLDGSCIVNEAMLSGESTPLLKESIKLRPKDEPLQADGLD
                     KNSILHGGTKILQVTPPEGKSRLPAAPDQGTPALVTKTGFETSQGSLVRVMIYSAERV
                     GVDNREALFFILFLLIFAIAASWYVWVEGSKMGRVQSKLILDCILIITSVVPPELPIE
                     LTMAVNSSLAALSKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGLSKD
                     PEDIRHMFSAAEAPESTALAIGAAHALVKLNDGDVVGDPMEKATLNALGWTVEHKNVT
                     SKEGFGKVTIQRRFQFSSALKRSSSIASHGGKLFAAVKGAPETIRQRLVSVPKNYDSI
                     YKSFTRSGSRVLALASKSLPKMNQSHIDDLDREEVEQKLNFEGFLIFHCPLKIDAIET
                     IKMLNESAHRSVMITGDNPLTAVHVAKEVGILDREALILDYAENAESNKLVFRNVLET
                     ISIPFDPESENFDTEKILGQYDIAATGHALNALKDHDQLRTLIRHTWVYARVSPTQKE
                     FILNTLKDMGYQTLMCGDGTNDVGALKQAHVGIALLNGSEEGMKKMADQRKIDSLKAV
                     YEKQCDLLQRWGQPKPLVPEQIAHFYPPGPKNPHYLTSLEKTGVTITPEMRKAVAEAN
                     SKPEQPVAAVAGNSRPSGEDFATLFSGAGGGGEEDVPTLKLGDASCAAPFTSKLANVS
                     AVTNIIRQGRCALINTIQMYKILALNCLISAYSLSVMYLAGVKFGDGQATTCGILLSV
                     CFLSISRGKPLHKLAKERPQAGIFNVYIMGSILTQFAVHILVLVYITGEIYKLEPREP
                     QVDLEKEFTPSLLNTGIFLIQLVQQVSTFAVNYQGEPFRENIRNNKGMYYGLIGVTLL
                     ALCGATEFIPELNEAMKFVPMEDDFKFKLTLSLALDYVGSWAGEHYFKYFFMNDKAAD
                     ITQRLN"
     gene            complement(<428088..>430919)
                     /locus_tag="ZYRO0F05104g"
                     /db_xref="GeneID:8205179"
     mRNA            complement(<428088..>430919)
                     /locus_tag="ZYRO0F05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497374.1"
                     /db_xref="GeneID:8205179"
     CDS             complement(428088..430919)
                     /locus_tag="ZYRO0F05104g"
                     /note="similar to uniprot|P24279 Saccharomyces cerevisiae
                     YEL032W MCM3 Protein involved in DNA replication component
                     of the Mcm2-7 hexameric complex that binds chromatin as a
                     part of the pre-replicative complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497419.1"
                     /db_xref="GeneID:8205179"
                     /db_xref="GOA:C5DXH5"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008046"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5DXH5"
                     /translation="MDSDTAALAPDALFSDRVRRFQEFLDTFTSYRDTVRALQLTQDD
                     NEGPLHQRVTISLDELREFDRSYWSGILNNPAQFIPPAERALTELAQSIGDLPSSHRA
                     RTAPVAQRPWKISFKGSFGSHSLSPRTLTSHHLNKLISLQGIVTRTSLVRPKILRSVH
                     FAEKTGRFHYRDYTDSTTTLTTRIPTPAIYPTEDQEGNKLTTEYGYCTYMDHQRVSVQ
                     EMPESAPAGQLPRSIDVILDDDLVDKTKPGDRIQIVGVFKSMGAGGLTQNDSGNLGGF
                     RTLIVGNTVYPLHARSTGVSATQTLTDSDIRNINKLSKRADIFDILSQSLAPSIFGHE
                     YVKRAVLLMLLGGVEKNLDNGSHLRGDINILMVGDPSTAKSQMLRFVLNTAPLAIATT
                     GRGSSGVGLTAAVNTDRETGERRLEAGAMVLADRGIVCIDEFDKMSDVDRVAIHEVME
                     QQTVTIAKAGIHTTLNARCSVIAAANPLYGQYDVNRDPHQNIALPDSLLSRFDLLFVV
                     TDDINEIKDRSISEHVLRTHRYLPPGYLEGEPIRESLNLSLSVGTQEEDEAGQDAVNS
                     GNTNEDEDEEEHVFEKFNPLLQGAAGAARAAAGGGIVKPIVTIPFLRKYIQYAKERIV
                     PQLTQEAIDVIVRNYSDLRNDQNTKKSPITARTLETLIRLSTSHAKVRLSKTVNKRDA
                     IIAAKLLRFSLLGEDVGSDLYDLDDSEDDITLKRSPHKSPKKRQRVRGTPSKPSTPSK
                     PIPENLAETPIRRKLQFDPVSGEQSHQQQYEEGDGTNDSDNDYDEVMSPLPSDEEHDL
                     QDRLQRGLRVSPRRRRQVSSTGDAPPPTTTTGPLSEVHGAPRIPNLPPTSHEEYEPQE
                     RTISYENVAPGTISTGRLSLISGIVARIMQSPIYEDECYPLAALLDRINEQVPDEDEF
                     SFPEYLAALEVMEKRNNLMVAGDKVWRVS"
     gene            complement(431057..431138)
                     /locus_tag="ZYRO0F05126r"
                     /db_xref="GeneID:8205180"
     tRNA            complement(431057..431138)
                     /locus_tag="ZYRO0F05126r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=83.48"
                     /db_xref="GeneID:8205180"
     gene            complement(<431373..>431846)
                     /locus_tag="ZYRO0F05148g"
                     /db_xref="GeneID:8205181"
     mRNA            complement(<431373..>431846)
                     /locus_tag="ZYRO0F05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497375.1"
                     /db_xref="GeneID:8205181"
     CDS             complement(431373..431846)
                     /locus_tag="ZYRO0F05148g"
                     /note="highly similar to uniprot|P19211 Saccharomyces
                     cerevisiae ANB1 Translation initiation factor eIF-5A, and
                     to YEL034W uniprot|P23301 Saccharomyces cerevisiae YEL034W
                     HYP2 Translation initiation factor eIF-5A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497420.1"
                     /db_xref="GeneID:8205181"
                     /db_xref="GOA:C5DXH6"
                     /db_xref="InterPro:IPR001884"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR014722"
                     /db_xref="InterPro:IPR019769"
                     /db_xref="InterPro:IPR020189"
                     /db_xref="UniProtKB/TrEMBL:C5DXH6"
                     /translation="MAEEEHTFETVDAGSSLTYPQQCSALRKNGFVVIKGRPCKIVDM
                     STSKTGKHGHAKVHLVALDIFTGKKLEDLSPSTHNMEVPFVKRSEYQLLDIDDGYLSL
                     MTMDGETKDDVRLPDGELGDALQSSFDEGKDLNVTIITAMGEECAISFKEAPKSD"
     gene            <432802..>434628
                     /locus_tag="ZYRO0F05170g"
                     /db_xref="GeneID:8205182"
     mRNA            <432802..>434628
                     /locus_tag="ZYRO0F05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497376.1"
                     /db_xref="GeneID:8205182"
     CDS             432802..434628
                     /locus_tag="ZYRO0F05170g"
                     /note="similar to uniprot|P32629 Saccharomyces cerevisiae
                     YEL036C ANP1 Mannan 8 Protein of the endoplasmic reticulum
                     with a role in retention of glycosyltransferases in the
                     Golgi also involved in osmotic sensitivity and resistance
                     to aminonitrophenyl propanediol subunit of
                     mannosyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497421.1"
                     /db_xref="GeneID:8205182"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DXH7"
                     /translation="MKVSLTRPTAISIVGTVITVLLLARLLLSAPSISRQLNYFFTSL
                     ASASLFKPYVPNFRNVPNVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFN
                     HMDKMTYPHNLIDFSFLVSDSSDDTMGALLSHLEKAQSNKDKTRRFGNIEIYEKDFGQ
                     AIGQSFSDRHGFDAQGPRRKLMARARNWLGTVALKAYHSWVYWRDVDVELCPQSIMED
                     LMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESEVGVQLADSLPDDDAVIVEGYPD
                     YSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGKVFRTGSHFPAFSFEKHAETEA
                     FGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMAWMAEEERRRVEEDRLREFYDRIW
                     DTGFQDVRDDWGDERLAIFKNIDHTKAHGHEIFVDWSDGSEIKEQPSLQQQQQVQQPQ
                     KPSIQDPQQQVQQQQVQQQVQQPQKPLIDEQQQQVQQQQQLQQQQVQQPQNQLIDNPQ
                     QPVQQHQLQQLPQQQQQQQQQLQQPQNQLIDEQQQLQQQNQLVQEPQQPAQQQQQQEQ
                     QQLQQQQLQQQQLQQQQLQQQQLQQQQQPQNDMRLEFDPDAK"
     gene            <434982..>436136
                     /locus_tag="ZYRO0F05192g"
                     /db_xref="GeneID:8205183"
     mRNA            <434982..>436136
                     /locus_tag="ZYRO0F05192g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497377.1"
                     /db_xref="GeneID:8205183"
     CDS             434982..436136
                     /locus_tag="ZYRO0F05192g"
                     /note="similar to uniprot|P32628 Saccharomyces cerevisiae
                     YEL037C RAD23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497422.1"
                     /db_xref="GeneID:8205183"
                     /db_xref="GOA:C5DXH8"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR004806"
                     /db_xref="InterPro:IPR006636"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015360"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DXH8"
                     /translation="MINIIFKDFKKEKISLELDPSSSVKDAKVRLATEKSCEESQIKL
                     IYSGKVLQDAKNLQESGLKDGDQVIFMISKKKAATPSAAAATPASASVTEPSQSATTN
                     TETQAAGSAAETTATAPAQPSTTQAPVSTPDFVVGQQRNETVDRIMEMGYERDQVERA
                     LRAAFNNPDRAVEYLLMGIPENLQRAGARQQQPEQQAQQESQPQQESQPQQATEPQEG
                     EDLFAQAEQRTQGNTASAEGAAAADGAQGGVPGSIGLTMEDLLALRQVVSGNPEALAP
                     LLESLSSRYPQLREQIMSNPEVFVSMLLEAVGDNLQDAMTDLETGDDPEGAAAAAEGA
                     FQVELTESDEQAITRLCELGFERAVAIQVYFACGKNEEIAANMLLNDYVD"
     gene            complement(<436282..>437307)
                     /locus_tag="ZYRO0F05214g"
                     /db_xref="GeneID:8205184"
     mRNA            complement(<436282..>437307)
                     /locus_tag="ZYRO0F05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497378.1"
                     /db_xref="GeneID:8205184"
     CDS             complement(436282..437307)
                     /locus_tag="ZYRO0F05214g"
                     /note="similar to uniprot|Q12068 Saccharomyces cerevisiae
                     YOL151W and similar to uniprot|Q03049 Saccharomyces
                     cerevisiae YDR541C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497423.1"
                     /db_xref="GeneID:8205184"
                     /db_xref="GOA:C5DXH9"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DXH9"
                     /translation="MAVLVTGATGFIALWVVDYLLKEGYEVIGTVRSQEKADKLTKQF
                     GSSGKLSFEIVPDISDINSFDHVFEKRAKEIDIVIHTASPFHYNTTEYETDLLIPAVN
                     GTKGILNSIKKYGSQTVKRLVITSSFAAILDPSKLADKDAVFTEKSWNPTTWEGAQSD
                     VSNAYRGSKKFAEKTAWEFLEENKDSVNFKLTTVNPVLVFGPQKFEEDVKSQLNTSNQ
                     VINIPLHSKPGDKLNNSQGNYIDVRDVAKAHVLAFQKDDLIGERLGLSNGPVNTQGVL
                     EVLNEKFPQLKGKLADGPTPGEVNKTSGASFDNSYTKKILGFPFISLEQSVYDTAAQV
                     LKKEGKL"
     gene            complement(<437887..>438567)
                     /locus_tag="ZYRO0F05236g"
                     /db_xref="GeneID:8205185"
     mRNA            complement(<437887..>438567)
                     /locus_tag="ZYRO0F05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497379.1"
                     /db_xref="GeneID:8205185"
     CDS             complement(437887..438567)
                     /locus_tag="ZYRO0F05236g"
                     /note="similar to uniprot|P32626 Saccharomyces cerevisiae
                     YEL038W UTR4 Protein of unknown function found in both the
                     cytoplasm and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497424.1"
                     /db_xref="GeneID:8205185"
                     /db_xref="GOA:C5DXI0"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023943"
                     /db_xref="InterPro:IPR027511"
                     /translation="MSVSVYLLDIEGTVCPISFVKETLFPYFSAKLPSLVKSDDVSIK
                     SVLAQFPQHGDSQALQTHIQSLVSNDVKDPTLKQLQGTVWSQGYTSGEIKAPVYKDAI
                     EFMKRKENVYIYSSGSVQAQKLLFGHVANPDNSGSNESSLDLNPLIKGYFDINTSGKK
                     LESSSYEKIVTQIGVAAEQVLFISDNVKELEAAHAAGVKTLLAIRPGNPPVQENHGFR
                     TVEKFDSL"
     gene            <439058..>439393
                     /locus_tag="ZYRO0F05258g"
                     /db_xref="GeneID:8205186"
     mRNA            <439058..>439393
                     /locus_tag="ZYRO0F05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497380.1"
                     /db_xref="GeneID:8205186"
     CDS             439058..439393
                     /locus_tag="ZYRO0F05258g"
                     /note="highly similar to uniprot|P00044 Saccharomyces
                     cerevisiae CYC1 Cytochrome c isoform 1 and to YEL039C
                     uniprot|P00045 Saccharomyces cerevisiae CYC7 Cytochrome c
                     isoform 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497425.1"
                     /db_xref="GeneID:8205186"
                     /db_xref="GOA:C5DXI1"
                     /db_xref="InterPro:IPR002327"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="UniProtKB/TrEMBL:C5DXI1"
                     /translation="MPAPYQKGSAKKGATLFKTRCLQCHTVENGGPHKVGPNLHGVFG
                     RHSGQAPGYSYTDANIKKGVVWEEQSMSDYLENPKKYIPGTKMAFGGLKKEKDRNDLV
                     TYLKSATSK"
     gene            complement(<439569..>440804)
                     /locus_tag="ZYRO0F05280g"
                     /db_xref="GeneID:8205187"
     mRNA            complement(<439569..>440804)
                     /locus_tag="ZYRO0F05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497381.1"
                     /db_xref="GeneID:8205187"
     CDS             complement(439569..440804)
                     /locus_tag="ZYRO0F05280g"
                     /note="similar to uniprot|P32623 Saccharomyces cerevisiae
                     YEL040W UTR2 Putative glycosidase
                     glycosylphosphatidylinositol (GPI)-anchored protein
                     localized to the bud neck has a role in cell wall
                     maintenance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497426.1"
                     /db_xref="GeneID:8205187"
                     /db_xref="GOA:C5DXI2"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:C5DXI2"
                     /translation="MQLVQSIWLALILLWAHVKADEVIQCNSTTSCPQDMPCCSQFGE
                     CGTGDYCLGGCNPSFSYSLNACMAMPICKDSSFNFGDNYTSKVLKKEKYMGNASQGDW
                     AYTGYLMDYNDEDSMVIAMPKYTGGTVLSSTRYIWYGKVSAKLKTSRGKGVVSAFILF
                     SDVQDEIDNEWIGSNLGQLQTNYYFEGVLNYTHGHRINTSDTFDNYHTYEIDWQEDKL
                     TWSVDGVVGRTLHKNDTYNHTTNKYMYPQTPSRVQISLWPGGNATSSDSVKEWAGGEI
                     DWDSADMKDPGYYYMLLNEINVTCYDPPANTERSGSSAYSYINSDRYLSKDVAITDNE
                     TMLYSYKGSGLEPKLGKQNHTGKSSSSQSSTALPPGASTAFYQNIKSTNSKTVNKNAG
                     TVRRPGALAVVALILSHII"
     gene            complement(<441286..>442851)
                     /locus_tag="ZYRO0F05302g"
                     /db_xref="GeneID:8205188"
     mRNA            complement(<441286..>442851)
                     /locus_tag="ZYRO0F05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497382.1"
                     /db_xref="GeneID:8205188"
     CDS             complement(441286..442851)
                     /locus_tag="ZYRO0F05302g"
                     /note="similar to uniprot|P21373 Saccharomyces cerevisiae
                     YJR049C UTR1 NAD kinase active as a hexamer enhances the
                     activity of ferric reductase (Fre1p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497427.1"
                     /db_xref="GeneID:8205188"
                     /db_xref="GOA:C5DXI3"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:C5DXI3"
                     /translation="MGSLSNSSNMDSIDDTLESERSSSNSVSIPMSQCRSLQDIRRDN
                     RENTVKSDSSIRFFPDQHVLDEGNERIRNINDAKEMIKQLNIGGKRLTSAKSQLKLSS
                     TAYGVRMLSKDIFNTKVELQVENLLIVTKSQDRSLVYLTRELVEWLLINSPDITVYVE
                     KILQGSEQFGAEDIYKDSRCKEQRIKYWDKEFVAQHDGFFDMIITLGGDGTVLFVSSI
                     FQRHVPPVLSFSLGSLGFLANYQFERFREDLPKILDNKIKTNLRMRLECKVYRCHPPM
                     VDSRTGEKVAVAELVMQRQILNELTIDRGPSPFISNLEVYGDNSLLTVAQADGIIIAT
                     PTGSTAYSLSAGGPLVYPSVNAVCVTPICPHTLSFRPIMLPDSMNIKIRVSQGSRATA
                     WAAFDGKDRIELQKGDYITVQSSPYAFPTVESHSTEFIESISRSLNWNVRREQKSFTH
                     MLSRKNQEKYVTDKEGEDDLHEGDHREVVVLQAEDKDQAQKMIEERTLAEQKAEKDSV
                     CANGGAAKTNFTV"
     gene            complement(<443076..>444647)
                     /locus_tag="ZYRO0F05324g"
                     /db_xref="GeneID:8205189"
     mRNA            complement(<443076..>444647)
                     /locus_tag="ZYRO0F05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497383.1"
                     /db_xref="GeneID:8205189"
     CDS             complement(443076..444647)
                     /locus_tag="ZYRO0F05324g"
                     /note="highly similar to uniprot|P32621 Saccharomyces
                     cerevisiae YEL042W GDA1 Guanosine diphosphatase located in
                     the Golgi involved in the transport of GDP-mannose into
                     the Golgi lumen by converting GDP to GMP after mannose is
                     transferred its substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497428.1"
                     /db_xref="GeneID:8205189"
                     /db_xref="GOA:C5DXI4"
                     /db_xref="InterPro:IPR000407"
                     /db_xref="UniProtKB/TrEMBL:C5DXI4"
                     /translation="MPRNYRIVIGAFAAIMLLLLIRSSTTVKPALDIVKTASQDISAS
                     EEVDILPVNERPGYIDDAKTEEGNSDVAQAVKAQDTSLGSTYSTGFECNKDHQYVIMI
                     DAGSTGSRVHVYEFDVCTEPPTLINETFKMLKPGLSSFNTDSAGAARSLDPLLERALE
                     VVPEKKRSCTPVSVKATAGLRLLGVNKSDKILAAVREHLEQDYPFPVVDGKGVSIMSG
                     EEEGVFAWVTTNYLLGNIGGSQRTSTAAVFDLGGGSTQIVFEPTFPPNEKMLEGEHKY
                     ELKFGDEVYTLYQFSHLGYGLMEGRNKINAQLVETAIKEGVIPKGDTKSVHELISPCL
                     PPKAQVNNQKVTLANEDTYLVNFSGPVIPTGAQCRFLADKVLNKDAKCTKPPCSFNGV
                     HQPSLVRTFKETNDLYVFSYFYDKTQPLGLPLSFKLDELVELAKMVCNGEEVWKSVFS
                     GIEGSVKELKKEPQWCQDLSFQVSLLHTGYDIPLHREVKTAKTIADNELGWCLGASLP
                     LINSDQWNCRLDQLG"
     gene            <444870..>445553
                     /locus_tag="ZYRO0F05346g"
                     /db_xref="GeneID:8205190"
     mRNA            <444870..>445553
                     /locus_tag="ZYRO0F05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497384.1"
                     /db_xref="GeneID:8205190"
     CDS             444870..445553
                     /locus_tag="ZYRO0F05346g"
                     /note="similar to uniprot|P21374 Saccharomyces cerevisiae
                     YJR050W ISY1 Component of the spliceosome complex involved
                     in pre-mRNA splicing auxiliary splicing factor that may
                     modulate Syf1p activity and help optimize splicing isy1
                     syf2 double mutation activates the spindle checkpoint
                     causing cell cycle arrest"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497429.1"
                     /db_xref="GeneID:8205190"
                     /db_xref="InterPro:IPR009360"
                     /db_xref="UniProtKB/TrEMBL:C5DXI5"
                     /translation="MSRNAEKSSSVLVRYQELQAEESGGFKDFSRYRRPRRVASVRNL
                     KDALEWRAQVAKEISDKITRIYDPSLNEWQVEELNDQLNELVKERNRWDWHIQKGLGG
                     AKPRKNGTVSGKLIAGKRYFGRALELPEVQKILKEQEESKKSNRELVNTRLIPNDYND
                     DYYGTIEDTTELKQFESSWTPVLRKHYGKKDAGADQLENDTHIPDQKEMERWLVERRK
                     QKLLKELRF"
     gene            complement(<446808..>447668)
                     /locus_tag="ZYRO0F05368g"
                     /db_xref="GeneID:8205191"
     mRNA            complement(<446808..>447668)
                     /locus_tag="ZYRO0F05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497385.1"
                     /db_xref="GeneID:8205191"
     CDS             complement(446808..447668)
                     /locus_tag="ZYRO0F05368g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497430.1"
                     /db_xref="GeneID:8205191"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DXI6"
                     /translation="MSMISDESEMDLEKCVQMYEEEEIELPEDSSGGKLTYFLAPYFF
                     EKTWISDIILPLSAAYSSSFVLLAYSSLRGFYDDQLETKLSDIFSPLWMIIHYFLCFT
                     VFFMNFIYHRKKIDIETKVLQKLLKEVGEMDLTGDPVAWRRIASRVNHFSEEKGYHYS
                     VFYGGGHCMRFFVRELVKPIERQTYDIRCYCEGKMYRNFWKNPSNKVLVERAVANYDE
                     SVENFGELSYTAEEDGCRDDIFEKSRSIFNTSMLYLGTIEVASFMIMALALLVLLISR
                     AIFNSFPTPQ"
     gene            complement(<450645..>451505)
                     /locus_tag="ZYRO0F05412g"
                     /db_xref="GeneID:8205192"
     mRNA            complement(<450645..>451505)
                     /locus_tag="ZYRO0F05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497386.1"
                     /db_xref="GeneID:8205192"
     CDS             complement(450645..451505)
                     /locus_tag="ZYRO0F05412g"
                     /note="some similarities with uniprot|P38723 Saccharomyces
                     cerevisiae YHL048W COS8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497431.1"
                     /db_xref="GeneID:8205192"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DXI7"
                     /translation="MSMISDESEMDLEKCVQTYEEEEIELPEDSSGGKLTYFLAPYFF
                     EKTWITDITLPLIIVLLPSSIRLAYFSIRDYFDTQLEMKFLDVFSPLWMIIHYFLFFT
                     VFFVNFIYDKKKVNIETKVLQKLLEEVAEMDLTGDPVAWRRIASRVNHFSEEKGYHYS
                     VFYGGGHCMRFFVRELVKPIERQTYDIRCYYEGERYRNFWKNPSNKALVERAIANYNK
                     SVENFGELSHTAEKDECRGGIFEKFRNTFNTSMIYLVVIEVALSVVMTLAFIISMISC
                     AIFYSFASPQ"
     gene            <451823..>452521
                     /locus_tag="ZYRO0F05434g"
                     /db_xref="GeneID:8205193"
     mRNA            <451823..>452521
                     /locus_tag="ZYRO0F05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497387.1"
                     /db_xref="GeneID:8205193"
     CDS             451823..452521
                     /locus_tag="ZYRO0F05434g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497432.1"
                     /db_xref="GeneID:8205193"
                     /db_xref="UniProtKB/TrEMBL:C5DXI8"
                     /translation="MSNKKKSKSKASESHKSGGNKNSPRGKHNSPSLQRDNSISDQQR
                     SENGGTGSRTYGIKLAARLFHNPLFSKRGFKHAKEGLKIKSSDNSISKLRFTGSICLF
                     LYPVWMIAYSIDGFSSGDINNSMHAFVYGSPLLIAVPYCIRYLDDVDTLLLSIFEIGE
                     KSLLGYFADPGIREFLLTVFEIAGFIYQCVEGRQTRSIFIWGILGFTCYLLGNALLIL
                     KRKKRPKPVVVDSA"
     gene            complement(<453348..>455801)
                     /locus_tag="ZYRO0F05456g"
                     /db_xref="GeneID:8205194"
     mRNA            complement(<453348..>455801)
                     /locus_tag="ZYRO0F05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497388.1"
                     /db_xref="GeneID:8205194"
     CDS             complement(453348..455801)
                     /locus_tag="ZYRO0F05456g"
                     /note="weakly similar to uniprot|P32618 Saccharomyces
                     cerevisiae YEL043W member vGLC.2184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497433.1"
                     /db_xref="GeneID:8205194"
                     /db_xref="InterPro:IPR003961"
                     /db_xref="InterPro:IPR013783"
                     /db_xref="UniProtKB/TrEMBL:C5DXI9"
                     /translation="MLYTFCILSAILWLCYRLYKFLGIPVSKIVLTLKIRTPPATKVS
                     IDRVNVDSITIHWENEPVRGGSSPSSSSSISHYLLYLNNLQVAVFPNSPNSLYTCCSI
                     TGLKPETEHQLDFITVNRMGFMNKLPSIYCMTKSNNTHQTVKKSGEWRKNTLTTLSQV
                     DSPSLSNSQVTESNQSTVQPAYANLTTLKDLESFSIEDLKKILICAQEDLHDVLSQQS
                     SLLQDFQESKLQWELELENLKTHWSHEIDLRKSLKSTIKSLENSKLLYDLKLEKLKKN
                     IDQSKSKIAKMKKDMQSWSLEESQQLNGDTFRRDFSHAMKRVQSNIEDLTGKIKSMQG
                     DISVKEEDNKRLNTLKKSSTSNASMDNTTLTPQVASAAMEAPAPSDVSLTAKEVVSLQ
                     GLLKKINEQTVERTGQLTPVGEEMLGRINSNSQLVNLIREQIKLDQELDNKWKVSRTR
                     MVKRLETLEAMFTDISLSNRQMRASLMVQPYAQKNSDSRNSNSNAASTITLNEQSPAL
                     SSPPMTHLSVPNDVPVAAQPPTPSSSNPHHLVLHNPSTYASEDPHITGRAATVSPVTV
                     AVNATASTTRPTLGNPSLVNGSLLSPQISGSQAYADPSLLMSSPTPVQSFSWATEPTQ
                     NELHAPAPLQGQSPQRQLQSELDQPFEYDNASHLISGLRDMIYDETDSPDSISGYSKG
                     FTTDQLDNYWTNQTTRTSARKDTKPTAPSLLSYGGGSLGPSSPSMAGTGFSDSTPMGH
                     SDSFSSVNNNLGATLMSHPDDPMRARTNPPQSQGRFASRFNFLWHSGHATSPEPSSTI
                     NNMSGNNNEDGSTNGVAST"
     gene            complement(<456056..>456550)
                     /locus_tag="ZYRO0F05478g"
                     /db_xref="GeneID:8205195"
     mRNA            complement(<456056..>456550)
                     /locus_tag="ZYRO0F05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497389.1"
                     /db_xref="GeneID:8205195"
     CDS             complement(456056..456550)
                     /locus_tag="ZYRO0F05478g"
                     /note="similar to uniprot|P32617 Saccharomyces cerevisiae
                     YEL044W IES6 Protein that associates with the INO80
                     chromatin remodeling complex under low-salt conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497434.1"
                     /db_xref="GeneID:8205195"
                     /db_xref="GOA:C5DXJ0"
                     /db_xref="InterPro:IPR013272"
                     /db_xref="InterPro:IPR029525"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ0"
                     /translation="MQHSSSPLSRRDIKMTMSKPVNNSGVERLEFLRSVHNRNLVSVP
                     SPFKKSSYRKPSRRHKSSRQLFTDESKRINAVLQQQQQQEQQDGKPRPIPKVTHFNVN
                     APPSLRPCKKYCDITGLKGLYRSPVNNLRYCNSEVYRLVVKPMPPGVDQEYLKLRGDH
                     FVLK"
     gene            <457621..>458787
                     /locus_tag="ZYRO0F05500g"
                     /db_xref="GeneID:8205196"
     mRNA            <457621..>458787
                     /locus_tag="ZYRO0F05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497390.1"
                     /db_xref="GeneID:8205196"
     CDS             457621..458787
                     /locus_tag="ZYRO0F05500g"
                     /note="highly similar to uniprot|P37303 Saccharomyces
                     cerevisiae YEL046C GLY1 Threonine aldolase catalyzes the
                     cleavage of L-allo-threonine and L-threonine to glycine
                     involved in glycine biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497435.1"
                     /db_xref="GeneID:8205196"
                     /db_xref="GOA:C5DXJ1"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR023603"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ1"
                     /translation="MADFELPPSYTTASNDLRSDTFTTPTPEMVQAGLGASIGDAVYQ
                     EDIDTIRLEKTVAQLSGKEAGLYCVSGTLSNQIGVRTHLTQPPYSILCDYRSHIYTHE
                     AAGLAILSQAMVVPVIPRNGNYLTLEDIKRHFVPDDGDIHGAPTRVISLENTLHGIVY
                     PLEELVRVRAWCLENDVKLHCDGARIWNASVAGNVPMKQYGELFDSISICMSKSMGAP
                     MGSVLVGDLKFIKKANHFRKQQGGGVRQSGMMCAMALWTINNNWKAKLLHSHQLAHEL
                     AEFCIEKGIPLESPADTNFVFISLSQAKMDPDVLVKKGLKYGVKLMGGRIAFHYQINR
                     DTLEKAKQAIWETFEYAKENPFNSEGETKIYRSESTERVDIDGKPIHDIKTYKY"
     gene            <459363..>460844
                     /locus_tag="ZYRO0F05522g"
                     /db_xref="GeneID:8205197"
     mRNA            <459363..>460844
                     /locus_tag="ZYRO0F05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497391.1"
                     /db_xref="GeneID:8205197"
     CDS             459363..460844
                     /locus_tag="ZYRO0F05522g"
                     /note="similar to uniprot|P32614 Saccharomyces cerevisiae
                     YEL047C Fumurate ReDuctase Soluble"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497436.1"
                     /db_xref="GeneID:8205197"
                     /db_xref="GOA:C5DXJ2"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR010960"
                     /db_xref="InterPro:IPR027477"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ2"
                     /translation="MFSIRKRQTVVWVLLFSLVIYWKHLLMATTRPVVIVGTGLAGLS
                     AGNQLVKHKIPVILLDKASSIGGNSIKASSGINGAWTETQKRLNVQDSPELFLQDTIR
                     SAKGKGVEPLMEKLTTDAASAIHWLQDEFKLKLDLLMQIGGQSAPRTHRSSGKLPPGF
                     EIIQSMSKALQAQAEKDPSLVKILLESKVVDVSVDGRGKISGVAYEDSKGNTQKIETD
                     NVIFCSGGFSRSKEMLEEYVPQYTKIPTTNGEATTGDGQRILSKLGADLIDMDQVQLH
                     PTGFIDPNNRDSAWKFLAAEGLRGLGGILINPATGRRFVDELQTRDYVTNVIRSECPK
                     DDNKAYLVMSEATYQEFKNNMDFYMSKNLLRKVTIEQLVKENNLPVTVAEFVQELKEY
                     STAKQDKFGRSLVINTFGDQVNPSTEVYLGEVTPVVHFTMGGAKINQQAQVVGKDNKP
                     LAQGLYAAGEVSGGVHGGNRLGGSSLLECVVYGRAAAKDIAGK"
     gene            <460999..>461502
                     /locus_tag="ZYRO0F05544g"
                     /db_xref="GeneID:8205198"
     mRNA            <460999..>461502
                     /locus_tag="ZYRO0F05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497392.1"
                     /db_xref="GeneID:8205198"
     CDS             460999..461502
                     /locus_tag="ZYRO0F05544g"
                     /note="similar to uniprot|P32613 Saccharomyces cerevisiae
                     YEL048C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497437.1"
                     /db_xref="GeneID:8205198"
                     /db_xref="GOA:C5DXJ3"
                     /db_xref="InterPro:IPR006722"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ3"
                     /translation="MEKESEPLEGESVGSEPTVALKPCFISLIDEFDKPLLVYAPGQD
                     EKEVNEVLKYNVFSNISLDYFDSPLFDWVSLESQPTVKLFFQLEGVAVFGMLIKPTGL
                     KIIIGFPQESYNSEVHEQQIREIFQKVHKIYLKVKLNPFINLSSGSSTSREEIIQKLE
                     AKFNVEF"
     gene            complement(<461520..>463178)
                     /locus_tag="ZYRO0F05566g"
                     /db_xref="GeneID:8205199"
     mRNA            complement(<461520..>463178)
                     /locus_tag="ZYRO0F05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497393.1"
                     /db_xref="GeneID:8205199"
     CDS             complement(461520..463178)
                     /locus_tag="ZYRO0F05566g"
                     /note="weakly similar to uniprot|O00022 Saccharomyces
                     cerevisiae YOR059C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497438.1"
                     /db_xref="GeneID:8205199"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ4"
                     /translation="MTQYHLVVLVHGLWGNTSHFDYIVDVLQEHADRHWCDEKNQLLV
                     YTTTLNEGFRTYDGIDVCGFRVAEEIAHKIDSFEGSSRISKFSLVGYSLGGLIARYAL
                     GLLYKRGFFEKRGIQLINFTTFCTPHVGVLAPGKNFAVNVFNGVVPWLLGNSGRQIFL
                     KDSVRNHGLKAKDEPLIYLMSHEDSVFFKGLQSFKNKTLYANVINDKRTAWWTAGISL
                     NDPFFDINEFNGANVFRYIPGYETVIVDRDQPIVISKIQSPNNGDDEMVKSSGSDSNE
                     DEQLQDFFFLNYWFAKLCRWIVVICNLCIIAPLILVWKIAQSSMEMTISAVRVTRFLN
                     NYSTQLLQDFFAISNPVPLSPREDAIETPRNDFDDTDDVDAGDVSHRDNNLINIRPSL
                     SGSSSLRSIQTQNPNNYNMLGESLNDQADHLMESIYDAIERKNIHAGFLQESPLGEGV
                     SRSNDNSLVVSIRELEDQTIEQLNSRHGPDMGELIDNLHLDISPRQVDIIKSLNKIHW
                     CKYPVYIRKTPCTHACAVVRQQEPLFDEGKIVVKHWIEKGFQIA"
     gene            complement(<463405..>464109)
                     /locus_tag="ZYRO0F05588g"
                     /db_xref="GeneID:8205200"
     mRNA            complement(<463405..>464109)
                     /locus_tag="ZYRO0F05588g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497394.1"
                     /db_xref="GeneID:8205200"
     CDS             complement(463405..464109)
                     /locus_tag="ZYRO0F05588g"
                     /note="weakly similar to uniprot|P48568 Saccharomyces
                     cerevisiae YDL186W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497439.1"
                     /db_xref="GeneID:8205200"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ5"
                     /translation="MPLDLRPCELPSYEPTFDLTKQNFLPARNIPTVRELVKAKQDER
                     VLPPKNEFVNRMEDSLIRWKPPGSSYRGTTMAIEGSHPYQLETSKLQDQSKGYGYGYG
                     GGTYVMDSFVNWWKGSNVDNAADRGEDTVSNGGDDDFSLNYEPDCAESIATGTARTTY
                     AVIPPKTPRPVTLVERTPDDTVYQLYYGKPIPPDYLSGRYYNFNTLQQQQQQQHQNGQ
                     DPSEWLKNCFSSCTNM"
     gene            <464819..>465985
                     /locus_tag="ZYRO0F05610g"
                     /db_xref="GeneID:8205201"
     mRNA            <464819..>465985
                     /locus_tag="ZYRO0F05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497395.1"
                     /db_xref="GeneID:8205201"
     CDS             464819..465985
                     /locus_tag="ZYRO0F05610g"
                     /note="highly similar to uniprot|P23595 Saccharomyces
                     cerevisiae YDL188C PPH22 Catalytic subunit of protein
                     phosphatase 2A functionally redundant with Pph21p
                     methylated at C terminus forms alternate complexes with
                     several regulatory subunits involved in signal
                     transduction and regulation of mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497440.1"
                     /db_xref="GeneID:8205201"
                     /db_xref="GOA:C5DXJ6"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ6"
                     /translation="MDMDLDVPMHDAIEDQQLGPTLDEDRETNSADNSAGSTNAGNVG
                     QTPGSLEIDEVEDLHDPDFKPGSSGIADQKSAKPLELTNSTIDQLDKWIEYLSKCQVL
                     SEEEVARLCKMAVDVLQFEENVQPINVPVTICGDVHGQFHDLIELFKIGGPCPDTNYL
                     FMGDYVDRGYYSVETVSLLVAMKVRYPRRITILRGNHESRQITQVYGFYDECLRKYGS
                     ATVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMVETVDQVRELNRIQEVPHEGPMCD
                     LLWSDPDDRGGWGISPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMEGYAWSHQQN
                     VVTIFSAPNYCYRCGNQAAIMEVDENHNRQFLQYEPSVRPGEPTVSRKTPDYFL"
     gene            complement(<466218..>466802)
                     /locus_tag="ZYRO0F05632g"
                     /db_xref="GeneID:8205202"
     mRNA            complement(<466218..>466802)
                     /locus_tag="ZYRO0F05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497396.1"
                     /db_xref="GeneID:8205202"
     CDS             complement(466218..466802)
                     /locus_tag="ZYRO0F05632g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497441.1"
                     /db_xref="GeneID:8205202"
                     /db_xref="InterPro:IPR018020"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ7"
                     /translation="MMQYQNFVHASKDHQLVVMNELFEPCQGLIRLTVDDDGFMPRAR
                     ELDNYKEFIELVRSTLIQVCLEVEMEASSSSSSTGNRRKLLEDVVNAHPRLGETKKQL
                     STHSMLEQKNLQSSQDSPEIQKKLLELNHEYEKVYPGLRFVVFVNGRTRLEIIRIMES
                     RITSGNDWFKEVRTAMQELCNIAQDRYRKNSSRL"
     gene            <467028..>467630
                     /locus_tag="ZYRO0F05654g"
                     /db_xref="GeneID:8205203"
     mRNA            <467028..>467630
                     /locus_tag="ZYRO0F05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497397.1"
                     /db_xref="GeneID:8205203"
     CDS             467028..467630
                     /locus_tag="ZYRO0F05654g"
                     /note="highly similar to uniprot|Q12434 Saccharomyces
                     cerevisiae YDL135C RDI1 Rho GDP dissociation inhibitor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497442.1"
                     /db_xref="GeneID:8205203"
                     /db_xref="GOA:C5DXJ8"
                     /db_xref="InterPro:IPR000406"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="InterPro:IPR024792"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ8"
                     /translation="MDESEFQGVSDEPTNDQYKVSAKKTLEEYKNLDAEDESLAKWKE
                     SLGLSADVLPLEYPGDKRKLVIQKIMLLVDTEPEPIVFDLTNETTIKELASKRYKIKE
                     KSNYKLRIQFKVQHEIITGIRYVQYIKKAGIAIDKIDDHLGSYAPNTKTKPFYEVELP
                     ESEAPSGFLARGNYSAVSKFIDDDNTNHLTLNWGVEITKR"
     gene            complement(<467786..>469258)
                     /locus_tag="ZYRO0F05676g"
                     /db_xref="GeneID:8205204"
     mRNA            complement(<467786..>469258)
                     /locus_tag="ZYRO0F05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497398.1"
                     /db_xref="GeneID:8205204"
     CDS             complement(467786..469258)
                     /locus_tag="ZYRO0F05676g"
                     /note="some similarities with uniprot|Q870H2 Saccharomyces
                     cerevisiae YDL189W RBS1 Protein of unknown function
                     identified as a high copy suppressor of psk1 psk2
                     mutations that confer temperature-sensitivity for
                     galactose utilization proposed to bind single-stranded
                     nucleic acids via its R3H domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497443.1"
                     /db_xref="GeneID:8205204"
                     /db_xref="GOA:C5DXJ9"
                     /db_xref="InterPro:IPR001374"
                     /db_xref="UniProtKB/TrEMBL:C5DXJ9"
                     /translation="MMGSIAGSGFNDLTGLGLTPAMITALFHKPHDRQFVVELENSVA
                     SFVASNAESYELRPMNSYYRLLSHQVAEYHNLKHALARTQDNCVIIFKGDGFENIQGK
                     PLLQNLQPMGLGPYGCTNTNASNTTNNKRYRILKRRDGQSQSDKIGDTNTDTPNNNNN
                     NVIKPEAGQQGADNKENDEDTNASLEQQRLEKEKQYEQRKQEIFSTPKKNSDDDDDND
                     NDNEEENGTSDNNSPQPYQFETSRYRFNDQATTQQNEPNSQTVPHRQQDYVSGYASGY
                     TNGNTNGYTNGYTNGHINGNANGNGRRHRKHHPFDNDPRRNSSNTTPQYHMPYFMYPT
                     PPMAAANTSQPPSQFPIMYPAPFPVDGANGYMAPVMYQPIPGFGPMGPKASVTPTSAP
                     APGPYMTYPFPYHYGQPQAPPPTPPSSTMYRQFSTPQRSHGPRYQKYSRNSSRSSFSR
                     RSSKKQNSQDDTIVGHSSTSTMESGATEIDELSENMQKLI"
     gene            <469672..>472542
                     /locus_tag="ZYRO0F05698g"
                     /db_xref="GeneID:8205205"
     mRNA            <469672..>472542
                     /locus_tag="ZYRO0F05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497399.1"
                     /db_xref="GeneID:8205205"
     CDS             469672..472542
                     /locus_tag="ZYRO0F05698g"
                     /note="similar to uniprot|Q06096 Saccharomyces cerevisiae
                     YPR105C COG4 component of oligomeric Golgi complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497444.1"
                     /db_xref="GeneID:8205205"
                     /db_xref="GOA:C5DXK0"
                     /db_xref="InterPro:IPR003613"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019474"
                     /db_xref="UniProtKB/TrEMBL:C5DXK0"
                     /translation="MSSIEDILQVTCNNQDTRGYSLVQTEDISGDGAGSLRVEDVDAV
                     LLYQLMENESLTEPFAYLNSCFQRCQQQKRLNKNGSPSLGAVFQEIDRLVVGYGLVTL
                     QVECFSPNGDFMSYVKQIVSDVDRYIDFLSQLIQRSIVEGTVMELLEGFFPTLLRFMS
                     QELQYFDLNDSSIYNAVLTLFEMFVTFKPIAAVFTQVTGFFGDYDCKPNDFEKTTILG
                     PILTLSPLNPNVALRNYGENLERTQQQKNIIHESLQTEHKVVVERLFFILDKLVRGSS
                     TSREDIMGYFSRIVNKNHLRRGEHANQNTLASNAFMTNITLILIKFSEPFLDVSFKRI
                     DKIDVNYFNNLNLFIDLSSETRVNSDFKEADEFYDKNKKDEDCKPNFISDCFFLTMTY
                     LHYGIGGTLLYDEKITPQVKRLKQEIDRIKKVSQSQDMFATFASVQLKQMEKSLKITQ
                     SIKDALQGFFSHRYLQLEVFDFICGASVFLMRAIDPEHLFPSKYFKLPLIPDQVGVEN
                     VDNADYLRANAPIPFKYYPEFVIEGPINYSLYISQYNTSPIFRNPRLSSFVELATAIL
                     RCPELVSNPHLKGKLVQLLSVGAMPLTDDSPGFMMDVFENDTFVSDHLLYAFLDFYVI
                     VEKTGSSSQFYDKFNSRYSISIILEQLYYRIPKYKAQLIWQANNNADFFVRFVARMLN
                     DLTFLLDEGLGNLAEVHNISIELENRAKGLPPTREEDDRELRSKYASAERQAKSSCGL
                     ADKSITLFELYSKDIPNAFVTPEIVDRLASMLDHNLGSLVGPKCGKLKVKDPQKFSFN
                     PKRLLKSLTTVYIHLADQQSFVSAVAKDGRSFSKELFERAVHILAMKIGLVSDEFCHK
                     LLEFAQRAEEQKAAEEAEDFGFDEVPDEFLDPLMFTIMNDPVILPASKMSIDRSTIKA
                     HLLSDSTDPFNRMPLKLEQVTPNHELKRQIEEFKRQRKGNNV"
     gene            complement(<472606..>473046)
                     /locus_tag="ZYRO0F05720g"
                     /db_xref="GeneID:8205206"
     mRNA            complement(join(<472606..472965,473044..>473046))
                     /locus_tag="ZYRO0F05720g"
                     /product="60S ribosomal protein L35"
                     /transcript_id="XM_002497400.1"
                     /db_xref="GeneID:8205206"
     CDS             complement(join(472606..472965,473044..473046))
                     /locus_tag="ZYRO0F05720g"
                     /note="highly similar to uniprot|P39741 Saccharomyces
                     cerevisiae YDL191W RPL35A and YDL136W RPL35B, proteins
                     component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L35"
                     /protein_id="XP_002497445.1"
                     /db_xref="GeneID:8205206"
                     /db_xref="GOA:C5DXK1"
                     /db_xref="InterPro:IPR001854"
                     /db_xref="InterPro:IPR018254"
                     /db_xref="UniProtKB/TrEMBL:C5DXK1"
                     /translation="MAGVKPYELRTKNKEQLQSQLVDLKKELAELKVQKLSRPSLPKI
                     KTVRRDIARVLTIINEQQREAVRQLYKGKKFQPKDLRPKKTRALRRALTKHEASQVTL
                     KQRKREINFPQRKFAIKA"
     gene            complement(<473659..>474204)
                     /locus_tag="ZYRO0F05742g"
                     /db_xref="GeneID:8205207"
     mRNA            complement(<473659..>474204)
                     /locus_tag="ZYRO0F05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497401.1"
                     /db_xref="GeneID:8205207"
     CDS             complement(473659..474204)
                     /locus_tag="ZYRO0F05742g"
                     /note="highly similar to uniprot|P11076 Saccharomyces
                     cerevisiae YDL192W ARF1 ADP-ribosylation factor GTPase of
                     the Ras superfamily involved in regulation of coated
                     formation vesicles in intracellular trafficking within the
                     Golgi functionally interchangeable with Arf2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497446.1"
                     /db_xref="GeneID:8205207"
                     /db_xref="GOA:C5DXK2"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXK2"
                     /translation="MGIFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVIT
                     TIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRITE
                     AREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCA
                     TSGEGLYEGLEWLSNNLKNQS"
     gene            complement(<475141..>476154)
                     /locus_tag="ZYRO0F05764g"
                     /db_xref="GeneID:8205208"
     mRNA            complement(<475141..>476154)
                     /locus_tag="ZYRO0F05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497402.1"
                     /db_xref="GeneID:8205208"
     CDS             complement(475141..476154)
                     /locus_tag="ZYRO0F05764g"
                     /note="similar to uniprot|Q12063 Saccharomyces cerevisiae
                     YDL193W NUS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497447.1"
                     /db_xref="GeneID:8205208"
                     /db_xref="GOA:C5DXK3"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="UniProtKB/TrEMBL:C5DXK3"
                     /translation="MSSEKIAENARLLGGEDVDVSNNRVPPPEASVLKGPSRLKALQA
                     VAHSVAFDEDQNIKTPKNNAFWNQEMGRIQYFICKILLVGMYLVFGSFRYLQYEYNAM
                     KLRVWNVIYNPSNTPQLIRQDVTKLDKIPHRLAAILEMKSAGSVGGGAKGLMNDGSEV
                     VCWTVSAGIKHLILYDFDGILKKNVLEFREEIRAKLSKYFGPSNVPKFALRIPHKNKV
                     YFSNDDSDKVSLEISLLSNRDGRQTIVDLTKTMAELTKSKELKAEDITMRLMDKELTQ
                     LVGPEPDLLLYFGPSLDLQGFPPWHLRLTEFHWEQDNNQVAYSIFIRGLHKYSNCKIN
                     VGK"
     gene            complement(<476413..>478560)
                     /locus_tag="ZYRO0F05786g"
                     /db_xref="GeneID:8205209"
     mRNA            complement(<476413..>478560)
                     /locus_tag="ZYRO0F05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497403.1"
                     /db_xref="GeneID:8205209"
     CDS             complement(476413..478560)
                     /locus_tag="ZYRO0F05786g"
                     /note="similar to uniprot|P10870 Saccharomyces cerevisiae
                     YDL194W SNF3 glucose sensor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497448.1"
                     /db_xref="GeneID:8205209"
                     /db_xref="GOA:C5DXK4"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DXK4"
                     /translation="MSDEVNTQAELLDSEKRGFLRNAVCKVSKGLSGHREDNGLELGT
                     SGSTTREEEQEDEEYQMNNLPVADNCDIPGDVVGEDDEVCSTLFISPPQPQSKFMSIL
                     VGVFVAVGGFLFGYDTGLINSLLDMKYVVHHLSPNHSYFTTKEQSIIVSFLSLGTVVG
                     ALAAPLLSDSCGRKMTIILSVVSVFFVGNSLQIAATNMQLLVAGRVISGVGLGLISAV
                     VPLYQSEAAHKYLRGAIISTYQWAITWGLLVSSAVSQGTNQIDAPASYRVPIGLQYVW
                     TSILATGMIFFPESPRFYVLKDKLDKAAKSLSFLRGVPQTDSGLLEELVEIKATYDYE
                     KSFGTSTLLDCFKSSKTRPKQTLRMLSGISLQASQQFSGINFLFYYGVNFFNKTGVHR
                     AYLVSFITYAVNVAFNIPGLFLVEYYGRRKVLIFGGIMMTMCNFIIAIVGTSTNSIIG
                     NKVMIAFICLFIASFSATWGGCVWVISAELYPLGIRSKCTAICAASNWLVNFICSLIT
                     PYIVDTGNHTSSMGPKIFFIWGSLNALAVILVHFAIYETKGLTLEEIDELYAKSPSSF
                     QSTKWNKIIRERSSSDFLNSTSKSESQLHSEQYSDSPYEHEHMHIPEPVHMNEHASTI
                     MNTKQEATVTNESPHTEFNDLSQNYVDLGNGLGLNTYKRGPPSIPSDSSDEEDTEGGP
                     SSHRSIDKNMSSINEYMAHLMESHTNSTDQAGH"
     gene            complement(<479060..>482908)
                     /locus_tag="ZYRO0F05808g"
                     /db_xref="GeneID:8205210"
     mRNA            complement(<479060..>482908)
                     /locus_tag="ZYRO0F05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497404.1"
                     /db_xref="GeneID:8205210"
     CDS             complement(479060..482908)
                     /locus_tag="ZYRO0F05808g"
                     /note="similar to uniprot|P38968 Saccharomyces cerevisiae
                     YDL195W SEC31 involved in protein transport from
                     endoplasmic reticulum to Golgi Component (p150) of COPII
                     coat of secretory pathway vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497449.1"
                     /db_xref="GeneID:8205210"
                     /db_xref="GOA:C5DXK5"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="InterPro:IPR009917"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR021614"
                     /db_xref="UniProtKB/TrEMBL:C5DXK5"
                     /translation="MVKLADYSRTATFAWSHDKIPSLVTGTASGTVDADFSSESSLEL
                     WSLLSPDATNPKTSLSVDAKFNDLDWSHDNKIIAGALDNGSVELFSYNADSLKSEAKF
                     QRHKTTAKVARFNAKQFNVLATGGTKGEIFIWDVNKCLENPNDYTPLTPGNSMTPVEE
                     ITSLAWNQSLAHVFASAGSTSYASIWDLKAKKEVIHLSYTSPNTGLKAPLSVVEWHPK
                     NSTRVATATGSDNDPSILVWDLRNANTPLQVLSQGHSKGVLSLDWCNQDENLLLSSGR
                     DNTVVLWNPQEGQELTQFPTRSNWVFKTKFASQAPDIFASASFDNKVQVQTLQNLVNT
                     LDQEQTASKQRESELDFWNHVSQEDSNEKPTLFQLQAPSWYVNKSPAAQWAFGGKLVN
                     ITADGKGVTISKPSLPGLQENTALGEAIKSKNYTPLINQRLAKAVDSTSEEDWNLLDK
                     LAMDGKAEFLKETFAFDDEEEEKEKKSEDQDDGSNFFANIEAAFTPEGSFQLSTEVDQ
                     QIGRNLVEGDTKSAVRTSLDKDLLQEALLIALDSNDEALKDTVRGAYFAKHGKQSALS
                     RFLFSISKKDSEDLVENLDVSQWKYAARTVMRFYDNDIEKKNQKLCTLGDRLLEAGDR
                     QNSLVLYLAASSLDKVASVWLKEFQTIETKVQKNKPSLYEAHSEALTEFVERFTVFST
                     FVGNETAITNEELVSKFLEYVNLACASGSFELAHSILETLPGNNEDVKMEKERVLLAS
                     GKSTRTTTTRKPAYGVPPAINNVALSQQNYAFGAGPTVPPTAAFTGTNSTAASAYAPP
                     AAATPAPVTAAPPAAANITKPNPYAPPPTIPAAVGSRYAPVTPSSGQTNFNLPTNPYA
                     SPYTPMNVKPTPDFVSSPQTALGSTPGAAVANPPPTNIKTGQAPHLNKKANDGWNDLP
                     LNVKEKPQRAKAPSVAPLNMAAPAAGAVPGVAGAGTPYVPPPRSARSSSRGPSVSSPL
                     PPPPPKGSRMASISSTGSVGNMSPKASAINPYAPQAQAANGPSTPRTSAYTAPVTQPP
                     TAPFTAYAPGGTAPSPVLRQNPYAPPPQQITPVGTIPPARTSSTSSTATPAPAVVPPP
                     PTNLKKKNHPTATLENASNLLESVQRTTELGSAAPLSNGNAAAAAPVATAATAPPTGL
                     APPKSTAPPPSSTNSTTPESVPTPAPASIPADQQAIVEYFKEELARVTPLTPKEYSKQ
                     IKDCDKRLNILFNHLAKQDLLTQPTIDKLHTIVGQLKSKDYSSAMQVFVDISTNNATE
                     AGNWLTGVKRLIALAEATSN"
     gene            <483835..>484110
                     /locus_tag="ZYRO0F05830g"
                     /db_xref="GeneID:8205211"
     mRNA            <483835..>484110
                     /locus_tag="ZYRO0F05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497405.1"
                     /db_xref="GeneID:8205211"
     CDS             483835..484110
                     /locus_tag="ZYRO0F05830g"
                     /note="similar to uniprot|Q05809 Saccharomyces cerevisiae
                     YLR218C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497450.1"
                     /db_xref="GeneID:8205211"
                     /db_xref="UniProtKB/TrEMBL:C5DXK6"
                     /translation="MYYQPDKQSITKMSTSKYHQEALEEYKEAKADPDAWDQRIVDTG
                     CYVENMALQLCHADTGDWKQCTQEMNLFRKCWEQHGNRERVKTVDRK"
     gene            <484240..>484911
                     /locus_tag="ZYRO0F05852g"
                     /db_xref="GeneID:8205212"
     mRNA            <484240..>484911
                     /locus_tag="ZYRO0F05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497406.1"
                     /db_xref="GeneID:8205212"
     CDS             484240..484911
                     /locus_tag="ZYRO0F05852g"
                     /note="weakly similar to uniprot|Q12334 Saccharomyces
                     cerevisiae YDL139C SCM3 Suppressor of chromosome
                     missegregation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497451.1"
                     /db_xref="GeneID:8205212"
                     /db_xref="GOA:C5DXK7"
                     /db_xref="InterPro:IPR018465"
                     /db_xref="UniProtKB/TrEMBL:C5DXK7"
                     /translation="MRVGKKPSKKAVKKLHGAIKGILKRESAQPTENRKDEETNDKRP
                     LIPDITESVEEESTQLDKFKGHRNRASGKLKGNNTFEEKNGILYIMSKENQLIPRLTD
                     DEVMKLHKKADENMKQVWNDIIAKYEAVENQGDVIDLQTGELIEDNGHIRGISHENSE
                     TRYASSLKGLIDVEEDGDGYSIWQDEGEEDEDNEEDDFDYKEESAESSPESESIGQQE
                     EEATG"
     gene            <485184..>486296
                     /locus_tag="ZYRO0F05874g"
                     /db_xref="GeneID:8205213"
     mRNA            <485184..>486296
                     /locus_tag="ZYRO0F05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497407.1"
                     /db_xref="GeneID:8205213"
     CDS             485184..486296
                     /locus_tag="ZYRO0F05874g"
                     /note="highly similar to uniprot|P53691 Saccharomyces
                     cerevisiae YLR216C CPR6 Peptidyl-prolyl cis-trans
                     isomerase (cyclophilin) catalyzes the cis-trans
                     isomerization of peptide bonds N-terminal to proline
                     residues binds to Hsp82p and contributes to chaperone
                     activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497452.1"
                     /db_xref="GeneID:8205213"
                     /db_xref="GOA:C5DXK8"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DXK8"
                     /translation="MSRSKTYFDISIGGVPKGRMVFELFNDVVPKTAENFLKLCEGNS
                     GMTKSKPDVPLSYKGSVFHRVIKDFMLQFGDFTNFNGTGGESIYGEKFEDENFALKHD
                     KPFLLSMANAGPNTNGSQAFITCTPTPHLDGKHVVFGELIQGKRIARLIENQQTDVDD
                     KPMREVKIDDCGLLPNNYVVPADAEKTPTDEFGDNYEEFIKYDEKVDKTNYESVITAL
                     NKVKAIGTEQYKKANYKVALSKYEKCDKFLKEYAPQGLTEEQSTTIEELRVSVPLNIA
                     LTALKVKEFGTAMVAGSEVLYQKSADEKAKAKALYRRGQAYTGMNDLDNALNDFEMAK
                     SFQPNDQGIVKQLNDTKAKIKELDNKQKKSLSKMFS"
     gene            complement(<486393..>486608)
                     /locus_tag="ZYRO0F05896g"
                     /db_xref="GeneID:8205214"
     mRNA            complement(<486393..>486608)
                     /locus_tag="ZYRO0F05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497408.1"
                     /db_xref="GeneID:8205214"
     CDS             complement(486393..486608)
                     /locus_tag="ZYRO0F05896g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497453.1"
                     /db_xref="GeneID:8205214"
                     /db_xref="UniProtKB/TrEMBL:C5DXK9"
                     /translation="MSPSRSLSALEDPTIRRVGPSLGIMVGMYYLLPLGCYFEKFSFV
                     KRDCHAFWVMRVIPILKLTSEKIWLGG"
     gene            <487056..>492290
                     /locus_tag="ZYRO0F05918g"
                     /db_xref="GeneID:8205215"
     mRNA            <487056..>492290
                     /locus_tag="ZYRO0F05918g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497409.1"
                     /db_xref="GeneID:8205215"
     CDS             487056..492290
                     /locus_tag="ZYRO0F05918g"
                     /note="highly similar to uniprot|P04050 Saccharomyces
                     cerevisiae YDL140C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497454.1"
                     /db_xref="GeneID:8205215"
                     /db_xref="GOA:C5DXL0"
                     /db_xref="InterPro:IPR000684"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007073"
                     /db_xref="InterPro:IPR007075"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="UniProtKB/TrEMBL:C5DXL0"
                     /translation="MVGQQYSSAPLRTVKEVQFGLFSPEEICAISVAKIKFPETMDET
                     QTRAKIGGLNDPRLGSIDRSLKCQTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKV
                     CECVCMHCGKLLLDEHNEQMRQAIKIKDSKKRFNAVWSLCKAKMICDTDVPSDEDPTQ
                     LISRGGCGNAQPTIRRDGLKLVGSWKKDKNSGDNEEPEQRVLNMEEILNIFKHISPED
                     SWKLGFNEEFARPEWMILTVLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISL
                     ETLEHNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLV
                     RNGPNEHPGAKYVIRDNGDRIDLRYSKRAGDIQLQYGWKVERHVIDNDPVLFNRQPSL
                     HKMSMMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     QQIVSPQSNKPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGVIPTPAIL
                     KPKPLWTGKQLLSVAIPKGIHLQRFDEGTTLLSPKDNGMLVIDGQIIFGVVDKKTVGS
                     SSGGLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIADGQTMRQITEA
                     IAEAKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRLAEVNLNDT
                     NFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTT
                     RNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDYSLDPSLLE
                     SGSEIIGDLKLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQNAQQTFR
                     IDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLASRR
                     VIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSV
                     TVASEIYYDPDPRSTAIPEDEEIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAMND
                     KDLTMGQVGEKIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMDLETEAEEDHMLKK
                     IENTMLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTVP
                     GVDASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQ
                     GGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPI
                     GTGAFDVMIDEESLVKYMPEQKITELVDGQDGGATPYSNENGLINTEVDVKDELMFSP
                     LVDSGSTDAMAGGFTAYGGGSASFGSYGDAPISPGFGGVSSPGFSPSSPTYSPTSPSY
                     SPTSPSYSPPSPNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
                     TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTS
                     PNYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPGSPT
                     YSPSSPKQDDREKDGNHS"
     gene            complement(<492455..>494527)
                     /locus_tag="ZYRO0F05940g"
                     /db_xref="GeneID:8205216"
     mRNA            complement(<492455..>494527)
                     /locus_tag="ZYRO0F05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497410.1"
                     /db_xref="GeneID:8205216"
     CDS             complement(492455..494527)
                     /locus_tag="ZYRO0F05940g"
                     /note="similar to uniprot|P48445 Saccharomyces cerevisiae
                     YDL141W BPL1 Biotin:apoprotein ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497455.1"
                     /db_xref="GeneID:8205216"
                     /db_xref="GOA:C5DXL1"
                     /db_xref="InterPro:IPR003142"
                     /db_xref="InterPro:IPR004143"
                     /db_xref="InterPro:IPR004408"
                     /db_xref="InterPro:IPR019197"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DXL1"
                     /translation="MNVLVYNGPGTTLGSVKHAVETLRDLLEPYYAVSTIGSRALQTE
                     PWDTKVSALVFPGGADLPYIKECQSIFPRFKRFVRNRGGIFVGFCAGAYFGSGRVEFA
                     QGNPSLEVTGDRDLQFFPGIARGPAFDGFQYNSEKGAKAVTLRLPDGSEFRTYFNGGS
                     LFVDADEYDNVEVLARYVEEPSVAYYDASTKTRDNGPAAALLCSVGKGKALLTGPHPE
                     FIPRLLNKTDDPGFLKNVVEVLCQYEEQRLLFLRDIFTKAGFNCNNDFSQARAPNLTP
                     LLVSSVPHRQDIVNQFKDSLISNASNKTAFTECTEIECEQDKFQVYNGYQNHYETAAG
                     ILRHEEPDEAIKTIIFPGEDEVLPPVEMTSNYDVAKYFRYLDPNNTVGSLLLYGEVVT
                     STSTLLEQNKTLLRSVPSCSLLHVGTIQVSGRGRGGNVWVNPKGVSALTVAVDLPLQS
                     PLTQRKISVVFVQYLSMLAYCNAIFQYGPGYEDLPVRIKWPNDLYAMSPAYYRKYNIK
                     LLGRGSDKFLVPLSEIDPAYVKIAGILVNTQFMVDKYMVLLGCGLNLNHDGPTTSLNS
                     WIKLLNEEREAVRLEHLEPIEVEKLQALYMNNLQLLLKKFVDYGPGPILPEYYNLWLH
                     SNQVITLNNHNNARAKIVGITEDYGLLIAKELVSGSNSEFTGSTYHLQPDGNSLDVFK
                     GLISKKAS"
     gene            <494943..>495752
                     /locus_tag="ZYRO0F05962g"
                     /db_xref="GeneID:8205217"
     mRNA            <494943..>495752
                     /locus_tag="ZYRO0F05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497411.1"
                     /db_xref="GeneID:8205217"
     CDS             494943..495752
                     /locus_tag="ZYRO0F05962g"
                     /note="similar to uniprot|Q07560 Saccharomyces cerevisiae
                     YDL142C CRD1 Cardiolipin synthase produces cardiolipin
                     which is an important constituent of mitochondrial
                     membranes required for normal mitochondrial membrane
                     potential and function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497456.1"
                     /db_xref="GeneID:8205217"
                     /db_xref="GOA:C5DXL2"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="UniProtKB/TrEMBL:C5DXL2"
                     /translation="MLPFHARGIRFLNPLQCLKRYPLASRSASIPLSLQCKVRFASSS
                     NEPINASVFTIPNLLTMSRIACTPLIGYYIMMNELTPAMSLFAYSCVTDYLDGFIARK
                     WKLKSVAGTILDPIADKLLMIVTTISLAFAPGPQIIPLSIAGIILGRDMLLGISALFI
                     RFASMKKKYGKVTWNSYWDFFHFPSVEVKPTQVSKYNTFFQMIYLGYGVLLLIMGELT
                     KKSDKEEEQTSDSGAHEILRQGFLWMGYLVGTTTCLSGASYVLSKSTLRFL"
     gene            complement(<495857..>497443)
                     /locus_tag="ZYRO0F05984g"
                     /db_xref="GeneID:8205218"
     mRNA            complement(<495857..>497443)
                     /locus_tag="ZYRO0F05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497412.1"
                     /db_xref="GeneID:8205218"
     CDS             complement(495857..497443)
                     /locus_tag="ZYRO0F05984g"
                     /note="highly similar to uniprot|P39078 Saccharomyces
                     cerevisiae YDL143W CCT4 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497457.1"
                     /db_xref="GeneID:8205218"
                     /db_xref="GOA:C5DXL3"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012717"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DXL3"
                     /translation="MASRGPSNATFRDREKPQEVRKANIIAARAVSDAIRTSLGPKGM
                     DKMIKSSRGQIIISNDGHTILKQMAILHPVAKMLVEVSAAQDTEAGDGTTSVVILAGA
                     LLGAAERLLSKGIHPAIIAESFQKAAKRSVEILLEMSHKISLEDKDDLIRAASTSLSS
                     KIVSQFSSFLAPLAVNSVLQISNNDSKNVDLNDIRLIKKIGGTIDDTETVDGVVLTQN
                     VVKSAGGPTRIEKARIGLVQFQISPPKPDTENNIVVSDYRQMDKILKEERSYLLNICK
                     KIKKAKCNVLLIQKSILRDAVNELALHFLSKLGIMVIKDIERDEIEFLSKSLGCKPIS
                     DVDLFTEDRLGAVDLVEEAESDGSRIVKLIGVKGHNAKPTVSVIIRGANQMILDETER
                     SLHDALCVIRCLVKERGLISGGGAPEIEVSRRLNKESRSMEGVEAFIWEEFAQALEVI
                     PTTLAENAGLNSIKVVTELRSRHEAGEINEGISVRRSGTANTYEEHILQPVLVSTSSI
                     TLASECVKSILRIDDITFSR"
     gene            <497691..>498716
                     /locus_tag="ZYRO0F06006g"
                     /db_xref="GeneID:8205219"
     mRNA            <497691..>498716
                     /locus_tag="ZYRO0F06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497413.1"
                     /db_xref="GeneID:8205219"
     CDS             497691..498716
                     /locus_tag="ZYRO0F06006g"
                     /note="similar to uniprot|Q05791 Saccharomyces cerevisiae
                     YLR215C CDC123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497458.1"
                     /db_xref="GeneID:8205219"
                     /db_xref="InterPro:IPR009772"
                     /db_xref="InterPro:IPR016525"
                     /db_xref="UniProtKB/TrEMBL:C5DXL4"
                     /translation="MSSSYSALSEIPCSKEQVENCIFSRWYPKFKSYVPMTRIIKPLP
                     SEFIRYLEQDGIKLPPVDQELSIYTSDPVGNQANDYSDGEDAQEEEQQEDEIKPLIHF
                     PELHNQIKQVIAELGPVTPKLNWSSPRDAVWILPNNTTKCTEVNEIYLLLNASNYIVH
                     DLEIGQQQGNEFELVLRQWFALNPALEFRVFVRDSKIVGASQRDLNYYKYLESLKDQF
                     KDVFDEFVEETAIPNFPDKSFVLDLYVPRPFNKVYLIDINPFARKTDPLLFSWNELAT
                     IENQDDYELRLVPENNVGRFASKEHSENQVPKDVVDASLDPRAIKELTEQWTQLLRRQ
                     QEESDSE"
     gene            <498893..>499975
                     /locus_tag="ZYRO0F06028g"
                     /db_xref="GeneID:8205220"
     mRNA            <498893..>499975
                     /locus_tag="ZYRO0F06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497414.1"
                     /db_xref="GeneID:8205220"
     CDS             498893..499975
                     /locus_tag="ZYRO0F06028g"
                     /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
                     YDL144C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497459.1"
                     /db_xref="GeneID:8205220"
                     /db_xref="GOA:C5DXL5"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DXL5"
                     /translation="MGDSCQLPKVIVIGAGGVGIIGALSLCYKGLSNVSLAIRSDYEI
                     VQKKGYKISSCDYGQFESWKPNHVYRTVEDASQSGQFFDYIVVATKNIPDGPAHSRVP
                     KVIQPLVESNHALSEGRQTNVLLIQNGIDIEKEIWNAFDRKKYHLNVLSGIQLIGSTK
                     VAPGVIDHVGKDQLQVGAFESENEDAVKAAKRFVELYHNEGKNYAEFDASVRYSRWKK
                     LLYNAAINTTTSLVNLDVPRCLEFGVDRKSTEENVFRPAMREIVAIATTENIVLDESL
                     VTFFVEITRHIMFKPSMCVDHEKGQLMELEVILGNPLKIARENGVQTPVLSMLYYLLV
                     MVQGHLREKNGLLKFDESKAELVETK"
     gene            <500380..>501810
                     /locus_tag="ZYRO0F06050g"
                     /db_xref="GeneID:8205221"
     mRNA            <500380..>501810
                     /locus_tag="ZYRO0F06050g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497415.1"
                     /db_xref="GeneID:8205221"
     CDS             500380..501810
                     /locus_tag="ZYRO0F06050g"
                     /note="similar to uniprot|Q05790 Saccharomyces cerevisiae
                     YLR213C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497460.1"
                     /db_xref="GeneID:8205221"
                     /db_xref="GOA:C5DXL6"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DXL6"
                     /translation="MPLYILWAWVTSFLLLGCPLITRAEPYEPSKPIKCQKEQQCPQE
                     WPCCSPYGYCGAGPICLGGCNPKYSFDKLSCAPMPALLPPLNDHFAAKPNNMPESSVI
                     SPEEKLKQSGIAHFTDYLVTKDKGDAEKMLDSYNFVYSGPADVDTPTGDILLTMPPKT
                     TGSLIAGSQSFLYGKAVVRLKTSRSRGVITAIVLISAVGDEVDYECLGSQRDEVQTNY
                     FSKGELDYTKMRRIPLSSDSWANYHNYEIDWNEERIQWIIDGKVVRTLSKHETWNEKL
                     QIFKYPQTPMRLEVALWPGGAAQNHPGTIEWAGGPVDWENSPELVEKGAFTAHVSQID
                     VVPHPNKFLPAMSNCLEEGNKIAYAYGSSPGHHFNQNILEWYCNIVPNVPDYKSSGAS
                     IPRTEQLPAAIRKKEMIPVKVEENFIPDIRRLSVRPNGTLLFNTTRNDTWSKQSPSSS
                     SASDTWRHNNPLWRIFHQLRQWRELI"
     gene            <502106..>503380
                     /locus_tag="ZYRO0F06072g"
                     /db_xref="GeneID:8205222"
     mRNA            <502106..>503380
                     /locus_tag="ZYRO0F06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497416.1"
                     /db_xref="GeneID:8205222"
     CDS             502106..503380
                     /locus_tag="ZYRO0F06072g"
                     /note="similar to uniprot|Q02933 Saccharomyces cerevisiae
                     YPL123C RNY1 RNAse member of the T(2) family of
                     endoribonucleases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497461.1"
                     /db_xref="GeneID:8205222"
                     /db_xref="GOA:C5DXL7"
                     /db_xref="InterPro:IPR001568"
                     /db_xref="InterPro:IPR018188"
                     /db_xref="UniProtKB/TrEMBL:C5DXL7"
                     /translation="MHLQDLWSVFGPASELLANIKDDNPYSPHCPISLPLSCQNHTGI
                     SDSCCFEYPGGIFLQTQFWDYEPSSADLDDDQLERELGPLNSLTIHGLWPDNCGGGYQ
                     QFCDSSALISDVPSILNSDQFNGDEHGLEYSGSELLEIMQRYWKGLRGHDESLWIHEY
                     NKHGTCVKTIRPNCYSRWDNQQIKQSDQDYHRQSVYDYYRISYNLYKKLNTSELLAEK
                     GIIPSTEKTYSREEIENALSDGFHGRQVQLVCDRNQAINEVWYYHQLKGSLLGEQFIP
                     IDSFGKGNSCPEEGIHFFPKGYKAPSRDPKLSGYVKLSGQSGHLIKNGHWMVRGTPAT
                     FQLLDHPFGDYYLKSRGGYCGFNDVGQLQCNKGRERGAQFGYDETHGGLLTYGDSSDW
                     NAESLPSGMRQSPIYQGDSGDITFKLKFQKRH"
     gene            complement(<503466..>505265)
                     /locus_tag="ZYRO0F06094g"
                     /db_xref="GeneID:8205223"
     mRNA            complement(<503466..>505265)
                     /locus_tag="ZYRO0F06094g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497417.1"
                     /db_xref="GeneID:8205223"
     CDS             complement(503466..505265)
                     /locus_tag="ZYRO0F06094g"
                     /note="similar to uniprot|Q08579 Saccharomyces cerevisiae
                     YOR192C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497462.1"
                     /db_xref="GeneID:8205223"
                     /db_xref="GOA:C5DXL8"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="UniProtKB/TrEMBL:C5DXL8"
                     /translation="MQDSKDANRVEIVASALSNGSVSRRSTWGKIAEKLQVPHGNKSI
                     SVLRNPDLDPIPANERTWGFWSYFAFWGLPNFGAPSLSFGSAVLSLGLNIQQSIGALV
                     ISNTLIVLYTIANSNPGIKYHVGYTIDQRMIFGVYGSYFGIIIRVGLSVVQYASGAWL
                     GGLYMNMIFSAFSKNYYYMKNTFPESVPMSRRDCIGFLCFQLIQMPLSWLKPRHTNIP
                     AMVACCMSGLAMIGMLAYLITKNGGPGPFWYEKVTLSTSQRSWMWLYSMAIWYSGVSA
                     AVVNQSDFSRFAKSKWSCYSGLFWGISIPGTFVPFAGMLYASASKQLYGTAYWRPDEI
                     IGQWFEIDYNAKARAASFFIGLAFTSCQVFMNMTQNGYPCGMDLAGIFPKYINITRGT
                     LAMQLLSWVVQPWTFYNTSNQFLNATSSFGMFTTPIIAINVIEFYWYRKQNLTLIDFY
                     STSEKGAYWYYYGVNWKPFLPVLASVALCVPGLYYSVNAQVKPNNNIFNYYYGYMFFI
                     PITSVGLYAIILFFFPDKHERKGVTDPVDYFNCFSEREREELGMLPCSENYIDGDVFE
                     LLDAEEGRNSSEEVRSEEIKVPATKISLRDGEV"
     gene            complement(<505562..>506143)
                     /locus_tag="ZYRO0F06116g"
                     /db_xref="GeneID:8205224"
     mRNA            complement(<505562..>506143)
                     /locus_tag="ZYRO0F06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497418.1"
                     /db_xref="GeneID:8205224"
     CDS             complement(505562..506143)
                     /locus_tag="ZYRO0F06116g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497463.1"
                     /db_xref="GeneID:8205224"
                     /db_xref="UniProtKB/TrEMBL:C5DXL9"
                     /translation="MADLTREFFDRPENDDTLQNIRRQYLESKRNLQDLMMKQNQNGD
                     ADADDAVGVGIGVGIGGGVNDQSAKIRRGFKSPLKPKEVMMENRPTSDNLIMMNEVRS
                     LKSLVYEQQAQIRRLQADLQFQKNSEFEFQRSILQFQSQLKNLRDEFAEFKLSKSYNI
                     DNNQDHYNRNVSFESPPFDDSTTRLIQISGQKR"
     gene            <506859..>509567
                     /locus_tag="ZYRO0F06138g"
                     /db_xref="GeneID:8205225"
     mRNA            <506859..>509567
                     /locus_tag="ZYRO0F06138g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497419.1"
                     /db_xref="GeneID:8205225"
     CDS             506859..509567
                     /locus_tag="ZYRO0F06138g"
                     /note="some similarities with uniprot|P29461 Saccharomyces
                     cerevisiae YOR208W PTP2 Phosphotyrosine-specific protein
                     phosphatase involved in the inactivation of
                     mitogen-activated protein kinase (MAPK) during osmolarity
                     sensing dephosporylates Hog1p MAPK and regulates its
                     localization localized to the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497464.1"
                     /db_xref="GeneID:8205225"
                     /db_xref="GOA:C5DXM0"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DXM0"
                     /translation="MTVVAFDSQRMTENNINDTADVSSSSSSANDTSSNSTTATATTT
                     TMHTDNPSMNIYSANNVIRSTGNGTVTNGGGIPRITPKDGRGPFISIGSKGKETVDLL
                     TSKDHQIDELQSCHNINEVKVDSDVSDKTVLIFDLTTNGFLLSPAAARQQPNFDETVD
                     ENCACVNGEVYRIHLSLPSTLVRRPKFDFEKLLQTVIDDSKRSKLINLIENCSTFLFY
                     DGSSTISSCSTPTFYLIKKFSVFLREKLGKNQVRLYILEKMDKSGVKNLGNNGPSNST
                     SDDKKAASTKASPPKKLNLSIKILPKTTDKMFIQSIKKDTVHYSPNSLRRFFKFNIPN
                     EIEHNDEILPTWLKPFSDKNSADSILQKLLSNFEFLENLELQRLEKGLTTETRNGNGQ
                     SFKNLQDSKSYHKIYSLSNLQREFNKQKKLTSSRQNNGLSSSSNSSQIEPTSDLKVCI
                     PLASSNGTTPTNNKIDNSHLSPYVDTDSSESLLTPMDSYEMSQGIQAFTKNRYSNILP
                     YEHSRVKLQPSPIGGPNGGISYSNTNNNNDSTHQHHSLNQHPHPQLHYNDNDTKNNNT
                     FPSITVKPPRQEASEKISSNNNNRKRRSSSISYFSQKPDVSNGKAQDTNDTNKENFSD
                     YFNANYLKIPQVNSDFNYIATQAPLPATVDDFWKVVSINQVKVIISLNSTDELYMRKW
                     DIYWNNNRSDKKYNIDIVDTFENACNVDGCILRIFKFYKNGDDVDESAKSTVFQLQYT
                     KWLDSCGIVMEDIVSLCRIKNMLLHNPSELLTDLRNGNSKDTEKYSNKAWAKELKSSE
                     DPDPLGPFRKSPVLVHCSAGCGRTGVFITLDFILNVLTEPTNSRNSIDVWNMQQDLIF
                     IAVNELRKQRISMVQNLTQYITCYESLLDYFALERRKERGSVEQSV"
     gene            complement(<509916..>513005)
                     /locus_tag="ZYRO0F06160g"
                     /db_xref="GeneID:8205226"
     mRNA            complement(<509916..>513005)
                     /locus_tag="ZYRO0F06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497420.1"
                     /db_xref="GeneID:8205226"
     CDS             complement(509916..513005)
                     /locus_tag="ZYRO0F06160g"
                     /note="highly similar to uniprot|Q02932 Saccharomyces
                     cerevisiae YPL125W KAP120 Karyopherin with a role in the
                     assembly or export of 60S ribosomal subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497465.1"
                     /db_xref="GeneID:8205226"
                     /db_xref="GOA:C5DXM1"
                     /db_xref="InterPro:IPR001494"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DXM1"
                     /translation="MTSSVTLNELTLVETLEQASNPQHAGSEVQRLAERQLSEWQTQP
                     GFHYTLQSIYLDLSNSLQIRWLSVIQFKNGVDKYWRSTRLHAISKEEKSSIRARLFDL
                     IDEQNNQLCIQNAQATARIARYDFPVEWPNLFEQLEQLFANEQLMNSTIKVYNSLMHV
                     NQIIKILGSARIGRCKPAMQSKVPLIFSLIVSIYLKSFNVWTESLGSDEDSLASQQVS
                     YLALKVLRRIVADGYERPQKDEAVCEFMKVTVTHFDLLISHQDDFKRSDIYDKFVRCY
                     GKLYYNVITNSPANFILLPCSTQILIAYTKLLFDRASDVYNENPEITGDFWEQTAIRG
                     FLILKRIINFIHKRGAVVLKARSDRLSIDAAMQRTATEFLNENLVTKLLDILMSWYLK
                     LRPSELESWFMDPEEWINEQLSSSYEYQIRACAENFFQDLINSFPELLVPYLLRKIEN
                     DAANLPNTLEGFLSKDAIYASFQLSVSAVSDMVDFDRLLTQVFLPEANSRTSTENEAK
                     VVRRRVCLIINEWSTVKCSEDSKKLCYEYFTKLLAKESDTVVLLTCVQALRTMIDDWN
                     FEKNTFEPYLNGVMTLLLRKVLPSVALTETRLYILNTMSDIIIQTKPLISKELLIEIL
                     QIVPELWQVSISNVSEYILSNGLLRLIKNLVTSLGSHSHLTWSTALPIVAQSCDPSSP
                     IYQLVNEDGYELWGALLQNYSVLEANLDPKFVELLPSLEFGVDSHTEILPTLLEIVKS
                     YSLILNSQEFFSCPTFIKIFSQLTRYFLKLRDDSFELLLEIWENLTLVSSTDTEGSLF
                     ESFHESGILKAILDSVFKEESLSNYQCAQVIQIAARIAYLNPQVLIDFIAVYHQGSLS
                     LAENQDLPISERKVVIKEMSLDEIVNKFLSIWIVCFREIYDPKVKKVHILGISSLLRT
                     GLYPVLSEFQVIVAMWVEMLEEINETNDGDCEKYHLNDLVTEMSPEYPLTSEQIRYHE
                     LCRKNDPAHNVGLKSFITQTLQFLETQMGTQYQELLNSVNVSLMENLQLFLGIPSQK"
     gene            complement(<513327..>514613)
                     /locus_tag="ZYRO0F06182g"
                     /db_xref="GeneID:8205227"
     mRNA            complement(<513327..>514613)
                     /locus_tag="ZYRO0F06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497421.1"
                     /db_xref="GeneID:8205227"
     CDS             complement(513327..514613)
                     /locus_tag="ZYRO0F06182g"
                     /note="highly similar to uniprot|P39683 Saccharomyces
                     cerevisiae YOR209C NPT1 Nicotinate
                     phosphoribosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497466.1"
                     /db_xref="GeneID:8205227"
                     /db_xref="GOA:C5DXM2"
                     /db_xref="InterPro:IPR002638"
                     /db_xref="InterPro:IPR006406"
                     /db_xref="InterPro:IPR007229"
                     /db_xref="UniProtKB/TrEMBL:C5DXM2"
                     /translation="MSSPAIVSLLDTDLYKLTMHAAVFSNFPEANVVYKYTNRSSQFL
                     FNQNAIDWIREQLELMGNLRFTEDEISYLKKAVPYLPQNYLDFLRGFQLRPKDQVIFT
                     SERSSDASDRFSLDLLVKGKWSETILYEIPILSIVSEAYFKFVDDDWDYTGQMKQAKD
                     KADELFQNQISFSEFGTRRRRSSKAQNIVMEGILQSIQESPEERHKLFLGTSNVMFAK
                     KYGVKPVGTVAHEWVMGIAAITDDYVHANKNSMDYWINTFGPENAGLALTDTFGSDNF
                     LESFKPPYSDHYVGVRQDSGDPIEYAEKISKHYHDKLKLPKFSKSICFSDSLNVKKVL
                     NYSDASLKMGLKPTFGIGTNFTNDFRKKSDPATKSEPLNIVIKLLEVNGNHAVKISDN
                     LGKNMGDPAVVERVKKELGYIERSWEGGDEAHRWSN"
     gene            complement(<514984..>517572)
                     /locus_tag="ZYRO0F06204g"
                     /db_xref="GeneID:8205228"
     mRNA            complement(<514984..>517572)
                     /locus_tag="ZYRO0F06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497422.1"
                     /db_xref="GeneID:8205228"
     CDS             complement(514984..517572)
                     /locus_tag="ZYRO0F06204g"
                     /note="similar to Q02931 YPL126W uniprot|Q02931
                     Saccharomyces cerevisiae NAN1 U3 snoRNP protein component
                     of the small (ribosomal) subunit (SSU) processosome
                     containing U3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497467.1"
                     /db_xref="GeneID:8205228"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DXM3"
                     /translation="MTQAGVYQQYKLSVVSGGKITLPRASNPSHSSKGTACLTADLLN
                     YIVPFNNQIKIYSTETRQCVKTLKFSNSPQLSEIFEKENAQLADISLKLSSEENDLTL
                     LTNDGRIISLNYKGKLTSNPKILRLNLEEGESVSKIFENSDNSFKILTSQIGSHGSAF
                     TYKIYDLQIKGDLVETNLEYILDDVILSTWSNNSEFIACLFQKSNQRHIQIYSIWDKQ
                     VVKEFSLKSISTSHSAASPSSRYVSSMAIDSSGTQLALGFASGVVNVLNVSDLQGRLL
                     KWHIDSVLSLGFTDDGAYLLSGGWEKVLSFWQLSTNSQQFLPRLPGIVVDCQSLGGGK
                     FYSLALQMTQNLNSTDYQLILLNAADLTSKVSVNGPLPTFNSPVDIGSMPVSAVSTKA
                     STTVSTSSVSKKKQKNKLKKGTRQDFTTTAGVNPVTKQIFFPHASAVQTYDFYKNEQV
                     HYQYVASGVNNTMGKVRFELNIQDPVVLDVVFTKDGEWMITYEVQFPPENLLSSKDLG
                     YDLKFWTKNDNETDWSLITKVIDPHGVNIPVTKILPAPTTVNDAQGILTADNEGGLKY
                     WEYDDYQKNWCLRKLTLPNFNHFSNSVSLAWSQDGSLIFHGFDDKLQILDFETFKNFE
                     SSSGNSAIQNEFTLDSEIQAMRLVDDTNLVVATRFTLSAINLLKGTIVNSFDIYPFVN
                     GVYKNGHLERLISCDEKTGRIALVVNQRLKDAQHEDNDTPQYKARVIVFEPSLSQRVG
                     SFVHPNYISWIGWNHDTDFIFLDISSKLGIVGTTVNSEMLEGINSEASMETNFSSQLQ
                     KLSQQQGASAAVDDVDNEDDIALDFINGDNNNKVLNMNSFVGMFENIQNVQMDTFFDC
                     VMKVVT"
     gene            <518165..>518377
                     /locus_tag="ZYRO0F06226g"
                     /db_xref="GeneID:8205229"
     mRNA            <518165..>518377
                     /locus_tag="ZYRO0F06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497423.1"
                     /db_xref="GeneID:8205229"
     CDS             518165..518377
                     /locus_tag="ZYRO0F06226g"
                     /note="highly similar to uniprot|P22139 Saccharomyces
                     cerevisiae YOR210W RPB10 RNA polymerase subunit ABC10-beta
                     common to RNA polymerases I II and III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497468.1"
                     /db_xref="GeneID:8205229"
                     /db_xref="GOA:C5DXM4"
                     /db_xref="InterPro:IPR000268"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR020789"
                     /db_xref="InterPro:IPR023580"
                     /db_xref="UniProtKB/TrEMBL:C5DXM4"
                     /translation="MIVPVRCFSCGKVVGDKWESYLNMLQEDELDEGTALTKLGLKRY
                     CCRRMILTHVDLIEKFLRYNPLERRD"
     gene            complement(<518541..>521228)
                     /locus_tag="ZYRO0F06248g"
                     /db_xref="GeneID:8205230"
     mRNA            complement(<518541..>521228)
                     /locus_tag="ZYRO0F06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497424.1"
                     /db_xref="GeneID:8205230"
     CDS             complement(518541..521228)
                     /locus_tag="ZYRO0F06248g"
                     /note="similar to uniprot|P32266 YOR211C Saccharomyces
                     cerevisiae MGM1 Mitochondrial GTPase related to dynamin
                     present in a complex containing Ugo1p and Fzo1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497469.1"
                     /db_xref="GeneID:8205230"
                     /db_xref="GOA:C5DXM5"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXM5"
                     /translation="MVKVLQNQLPKRCIGLVSSPIVSPSILVLNRCRNSQRWLSIRTN
                     SSLPTSNNNRLFYHSYARPSPFKFQFQFYNTLNSSSKRFASMFPNIISKVVKFPTYVG
                     GGMAAAGSYFAYKANEAHSFMSDKWDQFRDFAGNVRDKFGNILPDSAATGSGAGGNNN
                     NNDGGGGGGDSMAAASLFSDNDSEKTKVAGEDEDEDEDDGLDEDNTQDEMLNLMKQMI
                     EIRSILNKIDSNSAHLSLPSIVVIGSQSSGKSSVLESIVGREFLPKGSNMVTRRPIEL
                     TLVNTPNTKEITADFPLLRLYNLTDFKEVKKILMESNMAVPTTEAISEEPIQLTIKSS
                     RVPDLSLVDLPGYIQIEAADQPMELKGKIRQLCNKYLADPNIILAISAADVDLANSAA
                     LRAAKAADPQGLRTIGVITKLDLVPPEVGHSILTNKRYPLKMGYVGVITRAPGLGRSH
                     LGLFGNRGGSEGKIPQSAAIEPQQVAVREFEKSYLREHKKQFSDCQVSTKKLREKLIK
                     ILEISMSNALEPTSMLIQQELDDTSYLFKVEFNDRQLTPKSYLLNNVDVLKLGIKEFQ
                     EKFNRNELKSILKADLDQKVLDFLATRYWKDENLQELSSKMNNDDEILYWHKKLELAS
                     SSLTKVGVGRLSTMLVTNAILKELENVLQETQLKNHDLIKELVTNTAVNVLNAKYYAT
                     ADQVENCIKPFKYEIDLDSRDWNIAREHSVLLMKEEIRQCNDRFQAIKNSIGGKKLQQ
                     VMAYLHNDPGKTETLGMSKLLLERGSEALFLNKRLQVLGFRLQLLKNKCNSVLEKDQC
                     PEVFLNAVSDKLTSTAVLFLNVELLSDFFYNFPIELDKKLNGLTEEQVEMFAKEDPRI
                     ARHIELQKRKELLDLAIEKIDSILVFKKSYKGVSKKISL"
     gene            <522614..>523408
                     /locus_tag="ZYRO0F06270g"
                     /db_xref="GeneID:8205231"
     mRNA            <522614..>523408
                     /locus_tag="ZYRO0F06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497425.1"
                     /db_xref="GeneID:8205231"
     CDS             522614..523408
                     /locus_tag="ZYRO0F06270g"
                     /note="similar to uniprot|P53551 Saccharomyces cerevisiae
                     YPL127C HHO1 Histone H1 a linker histone required for
                     nucleosome packaging at restricted sites suppresses DNA
                     repair involving homologous recombination not required for
                     telomeric silencing basal transcriptional repression or
                     efficient sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497470.1"
                     /db_xref="GeneID:8205231"
                     /db_xref="GOA:C5DXM6"
                     /db_xref="InterPro:IPR005818"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5DXM6"
                     /translation="MAIKRSTKSNPNKESAQNSEVEDLRKKTTTAKKNEPAKSYKELV
                     VEALISLDDRRGSSRPAVKKYIKEKYPSVGSVAAFDSYFNNAIKKGVELKEFELPKGP
                     SGTLKLVKKIDSSDENGKVEIRRSSRQAKSEEAKKLSTNSNSTANEKSRGRPKPNNNN
                     NKVKVEKPQPKTKSKVVPSPTYKEMIISGILQLNDGKGSSRSALKKFVKDQYKNEIKA
                     SSNFDHLFNSALRKGIESGDLHQPKGPSGIVKVLKKKKASTAIKTA"
     gene            <523928..>525670
                     /locus_tag="ZYRO0F06292g"
                     /db_xref="GeneID:8205232"
     mRNA            <523928..>525670
                     /locus_tag="ZYRO0F06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497426.1"
                     /db_xref="GeneID:8205232"
     CDS             523928..525670
                     /locus_tag="ZYRO0F06292g"
                     /note="similar to uniprot|Q02457 YPL128C Saccharomyces
                     cerevisiae TBF1 TTAGGG repeat binding factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497471.1"
                     /db_xref="GeneID:8205232"
                     /db_xref="GOA:C5DXM7"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR013867"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C5DXM7"
                     /translation="MSELYSENLNRFNGIIESLPLKLRLNISSLCLLDNVATQMLRLL
                     LLNSTSPQVIEVISDPTAYLSSGETEMFQTLLKLFTHIRMIYDSKTPLLTVHDVVPGL
                     WFPNCPAPLILRGHEAYIVTAIRKSNLLTFLLTILNCFNYGFELLQESFLDVFCPNTI
                     FTGNTTIDQNGKFLKSQAILYLELKTQAFISALKSFENGSDRIPTAKQQEFLDIFFSN
                     NLSDQLVLRRRGNRHNITEEIMTPSQREFVERCERRRENLLNYTSFKNLIQDYDWNHF
                     VKELLDYCNKNLGLIIWGHKGKGKSPLYCFDITEFDTQVLYASGAAASDENVALVNTN
                     ANTSGGVHQNLLGGDPGSGSFDSPDLASTVTQQVMLSAGGGVDGGSSSHDKDAIKDVH
                     GNRLTKSLADAAVAVTSSSQLGHPITGAGTTAGGGGGRGGMLKKLNSKRTWSREEQDA
                     LAEGLRDVGPSWAKILDLYGPGGKINESLKNRSQVQLKDKARNWKLQYLKTGRPLPEY
                     LLKVTGTLERTFRSKKKIGSSATSPAAAAAAAAAASSVGGGNHERESSAASELFGPSA
                     TDTSGFDPNLEANI"
     gene            <526555..>527850
                     /locus_tag="ZYRO0F06314g"
                     /db_xref="GeneID:8205233"
     mRNA            <526555..>527850
                     /locus_tag="ZYRO0F06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497427.1"
                     /db_xref="GeneID:8205233"
     CDS             526555..527850
                     /locus_tag="ZYRO0F06314g"
                     /note="similar to uniprot|P18851 YOR212W Saccharomyces
                     cerevisiae STE4 G protein beta subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497472.1"
                     /db_xref="GeneID:8205233"
                     /db_xref="InterPro:IPR001632"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016346"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DXM8"
                     /translation="MSMNQAEDSLASIYGTNDNQTQNQFIHFQPQEAVALEEELQRKI
                     DLSRQETKHLYNQIDKVKSRAHDANLLDMAKSVSPLKTDKINLTPTLVLKGHNNKVSD
                     FRWSSDSKSILSASQDGFMLIWDTDTGLKKNAIPLDSQWVLTCGISPSGNLAVSGGLN
                     NNCTIYRVPRDSKVQQSVVSIFKGHTGYISDTAFTDNAHVVTASGDMTCAYWDIPKTK
                     RVREYADHLGDVLSLSLPPPNTNSNLFASCGSDGYAFVWDTRSTNVAQTFFISDSDVN
                     AIQFFKDGNSIATGSDDGVIRMLDLRADCPVATYSLAKSMRKPKSQPTFTTGSSPTKP
                     GYEGDISRKTSHKSIISPSYLDNQGVSSLDFSGSGRLMYACYTDFGCVVWDVLKAGIV
                     GKLEGHSNRESGVRASPDGLAVCTGSWDSTMKIWSPAYI"
     gene            complement(<528025..>528717)
                     /locus_tag="ZYRO0F06336g"
                     /db_xref="GeneID:8205234"
     mRNA            complement(<528025..>528717)
                     /locus_tag="ZYRO0F06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497428.1"
                     /db_xref="GeneID:8205234"
     CDS             complement(528025..528717)
                     /locus_tag="ZYRO0F06336g"
                     /note="similar to uniprot|Q99314 Saccharomyces cerevisiae
                     YOR213C SAS5 Subunit of the SAS complex (Sas2p Sas4p
                     Sas5p) which acetylates free histones and nucleosomes and
                     regulates transcriptional silencing stimulates Sas2p HAT
                     activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497473.1"
                     /db_xref="GeneID:8205234"
                     /db_xref="GOA:C5DXM9"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:C5DXM9"
                     /translation="MGNGMDIPTIDVNIRVKTQQVIKEDQSSCMGELPVRRWRVELCM
                     LNEKDEEVVLDIVSICIFYLHPTFKEPVRKFRQPPFVLEEEGWGEFDMEIVCHFIENV
                     GKFTINHLLSFEHSAVAIDYAIKVPCHTPLIREYLSRNFTLPDANFDKKQEKTISQSQ
                     LRNWINLIPKLDEDSVTEIVQLILRHPAVQAEVNKQERHDDFLMGLYQLPNELLQTIG
                     DYILHGNDEKEF"
     gene            complement(<528920..>529555)
                     /locus_tag="ZYRO0F06358g"
                     /db_xref="GeneID:8205235"
     mRNA            complement(<528920..>529555)
                     /locus_tag="ZYRO0F06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497429.1"
                     /db_xref="GeneID:8205235"
     CDS             complement(528920..529555)
                     /locus_tag="ZYRO0F06358g"
                     /note="highly similar to uniprot|P35189 Saccharomyces
                     cerevisiae YPL129W TAF14 Subunit (30 kDa) of TFIID TFIIF
                     and SWI/SNF complexes involved in RNA polymerase II
                     transcription initiation and in chromatin modification
                     contains a YEATS domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497474.1"
                     /db_xref="GeneID:8205235"
                     /db_xref="GOA:C5DXN0"
                     /db_xref="InterPro:IPR005033"
                     /db_xref="InterPro:IPR016665"
                     /db_xref="UniProtKB/TrEMBL:C5DXN0"
                     /translation="MRQWSIEIVLLDEEGKEIPATIFDKVVYHLHPTFANPNRTFTER
                     PFKIVEQGWGGFPLDISVFLLEKAGERKITHDLNFLQESYEIDHVIQAPTNKPTLAAE
                     LAKSGSLDDTSGSSKRKAAATNGEPKVKKAKAASASTVKGNVDIEKLAFGLTKLNEDD
                     LVGVVQMVTDNRTPEMNVTNNVEEGEFIIDLYSLPDGLLKSLWDYVKKNTE"
     gene            complement(<530006..>530929)
                     /locus_tag="ZYRO0F06380g"
                     /db_xref="GeneID:8205236"
     mRNA            complement(<530006..>530929)
                     /locus_tag="ZYRO0F06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497430.1"
                     /db_xref="GeneID:8205236"
     CDS             complement(530006..530929)
                     /locus_tag="ZYRO0F06380g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497475.1"
                     /db_xref="GeneID:8205236"
                     /db_xref="UniProtKB/TrEMBL:C5DXN1"
                     /translation="MFKKFNLASSLVGLYLFVKTASSSPYEVTVFEQEDVSMLSEEQP
                     LSIHVSPEALSPEVVEKLGTSSNIIFTDLPNSPQFVSIKDYESMMFATNELLDELLQQ
                     NRSNDNNNQIEDSLNQQDRENYESVHKIYDGTLHEGDQPEEHKEHEEEKEEPPTEKFT
                     STSTIMETQPEPTVTETESTCHESDSSSTYSSPTSTFAESTPCSTSTEMSSECSHCSS
                     IHTSEKNHHKTSANVTVFRNSTESSTHPTFTSKSFGKHRNYTKIQHPKLNHTNYTNQT
                     TIGFHNASSSIMPTTMFFAFLISILVFAQMC"
     gene            complement(<531285..>531830)
                     /locus_tag="ZYRO0F06402g"
                     /db_xref="GeneID:8205237"
     mRNA            complement(<531285..>531830)
                     /locus_tag="ZYRO0F06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497431.1"
                     /db_xref="GeneID:8205237"
     CDS             complement(531285..531830)
                     /locus_tag="ZYRO0F06402g"
                     /note="similar to Q12032 YOR215C uniprot|Q12032
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497476.1"
                     /db_xref="GeneID:8205237"
                     /db_xref="GOA:C5DXN2"
                     /db_xref="InterPro:IPR003789"
                     /db_xref="InterPro:IPR019004"
                     /translation="MFRRAAFIKPRLTGFIRFNSTESYNAALGGLKKDLKQAMLAKDE
                     LKKTTIRGLLSTIKNKEIDNKDKTLDEFTLFDLYSKLISQRKDSITEFLANKREDLVA
                     KEQHEMGIIEQYRSALPVASKEEIDSKVLQLLKNLKEKEPTLQMKQAFGKIDWKTVNS
                     EWKASPNAVKASIVQQFKNVF"
     gene            complement(<532056..>533414)
                     /locus_tag="ZYRO0F06424g"
                     /db_xref="GeneID:8205238"
     mRNA            complement(<532056..>533414)
                     /locus_tag="ZYRO0F06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497432.1"
                     /db_xref="GeneID:8205238"
     CDS             complement(532056..533414)
                     /locus_tag="ZYRO0F06424g"
                     /note="similar to Q12234 YOR216C uniprot|Q12234
                     Saccharomyces cerevisiae RUD3 Golgi matrix protein that is
                     involved in the structural organization of the cis-Golgi"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497477.1"
                     /db_xref="GeneID:8205238"
                     /db_xref="GOA:C5DXN3"
                     /db_xref="InterPro:IPR000237"
                     /db_xref="InterPro:IPR019459"
                     /db_xref="UniProtKB/TrEMBL:C5DXN3"
                     /translation="MAKGKKKGGKKLGSQVVSEDSSKQETPIELDKSVASGGDSEELN
                     GNGAKEEVSGPSEVSNDQVESLNQQIRELKLELEKKNKAEGNEDESELSKVRAERDEF
                     QSQYNNLLSRISSMKNVFNKMKESQNELESVQEQLTAYESQNMKLKQKLDSVTKEKSE
                     LQQTVVTLNKELSSIEEERETVHEESQEYKKTIDDLQRQLETFNTSHSHELEFQKTQN
                     SQLNTQLQELLLILDNNKQDISALHQEREDLQFNLENLTKENSILKDSLKEMEAELER
                     TEQRFNDQLTQRNIEVNSLKAELERSKESTKSHVDTIDTLRGEVERMKDAVEQKEKLE
                     KECKDRVLQIGKLRHEAIILNEHLTKALAMLKQSSDSESVDKELMSNLLISFVAIPRA
                     DPRKFEVLELLSSFLNWDDDKKRQAGLILNSQTSGKRSKSGSRTENFVSMWTDYLEKE
                     SE"
     gene            <533651..>536176
                     /locus_tag="ZYRO0F06446g"
                     /db_xref="GeneID:8205239"
     mRNA            <533651..>536176
                     /locus_tag="ZYRO0F06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497433.1"
                     /db_xref="GeneID:8205239"
     CDS             533651..536176
                     /locus_tag="ZYRO0F06446g"
                     /note="similar to uniprot|P38630 Saccharomyces cerevisiae
                     YOR217W RFC1 Subunit of heteropentameric Replication
                     factor C (RF-C) which is a DNA binding protein and ATPase
                     that acts as a clamp loader of the proliferating cell
                     nuclear antigen (PCNA) processivity factor for DNA
                     polymerases delta and epsilon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497478.1"
                     /db_xref="GeneID:8205239"
                     /db_xref="GOA:C5DXN4"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR012178"
                     /db_xref="InterPro:IPR013725"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXN4"
                     /translation="MVNITDFFGKDKKTGGGRRLRPSSSTSSSTAAKKTEPEVIDLDE
                     PESEATVKKEEKKKSSEPVKPKANSKPASSGSTGSTNPVTAQDVLAKIPAVDLSNVHV
                     KENVQFDFRNNNNGNDQDVPMGSADDFPEGKPNCLLGLTLVFTGTLPNIERGVAESIA
                     KRYGARITKSISSKTSAVVLGEEAGPKKVDTIKKLGIKAIDEEGFKQLILGMPAEGGD
                     GALAEKARKKIEEQEKQAQKEADEMAKKEKERVQRIEAAQKSGESAKQNDLVHEQNKL
                     WTVKYAPTNLQQICGNKGAVTKLKSWLTNWDESKKNGFKKSGRDGSGVFRAAMLYGPP
                     GIGKTTAAHLVANELGYDVLEKNASDVRSKSLLNVGVKNALDNMSVMGFFENKHNAQD
                     DNSKKFVIVMDEVDGMSGGDRGGVGQLAQFCRKTLTPMILICNERNIPKMRPFDRTCL
                     DIQFRRPDANSIKARLMTIAVRERFKLDPNIVDKLVQATRGDIRQIINLLSTVSKTTK
                     TINHENITEISQAWEKEIALKPFDIAHKLLDGRIYTDAGSQTFNLNDKIALYFDDFDF
                     APLMVQENYVNTRPSLLQSGETHLEAIAKAADSISMSNLVETKIRSSEQLWSLLPLHA
                     VLSSVYPASKIAGQMAGRINFTSWLGQNSKTNKYYRLLQELQYHTRLSTSTNKVGLRL
                     EYLPALKKRLLDPISKEGSEGIDAVIKVMDDYYLTKEDWDTIMEFLIGPASTDAALKK
                     IPTPVKTAFTRKYNSTTHPVAIYRAGTTTMASSASADQKPDFEDIIDADDAAPPAENE
                     EPDEDADLKKDKLIKQKAKPSKRKATKPASGKESAPKRRRTKT"
     gene            complement(<536276..>538927)
                     /locus_tag="ZYRO0F06468g"
                     /db_xref="GeneID:8205240"
     mRNA            complement(<536276..>538927)
                     /locus_tag="ZYRO0F06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497434.1"
                     /db_xref="GeneID:8205240"
     CDS             complement(536276..538927)
                     /locus_tag="ZYRO0F06468g"
                     /note="similar to uniprot|P33894 Saccharomyces cerevisiae
                     YOR219C STE13 Dipeptidyl aminopeptidase Golgi integral
                     membrane protein that cleaves on the carboxyl side of
                     repeating -X-Ala- sequences required for maturation of
                     alpha factor transcription is induced by a-factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497479.1"
                     /db_xref="GeneID:8205240"
                     /db_xref="GOA:C5DXN5"
                     /db_xref="InterPro:IPR001375"
                     /db_xref="InterPro:IPR002469"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DXN5"
                     /translation="MSSSHKRKNSHLFLQRKNSSSFNMEDIELDQFPNDMNHIDNARI
                     VVDPPPSPSTQENGNAANISLRSRGIMGSWKRYRVRLMLFLGILITLLLFLVPFYIVK
                     STADLQKNAENRFRTRSFDIDNVLNGDFSYFEKSFHFIQPPPETVKYHEEDPGLYLSL
                     QEDDNNDYTILAKQLYDSNFAEPLGTNKFEYESKEYVVQKVKVSYRLDRTIFATDLKA
                     EFRHSSHGLYWIHDVETGQILPISPHPSLLLTPVSYAHFSPNFNFVYFVHDNDLYIQS
                     LYTKNPARRLTHGGSFNILHGKPDWIYEEEVLADEKAVWWCPDDSKLIFAKFDDSEVN
                     TYSFPKYINNGNMFPQLEEIKYPKPGSFNPKVELYMLDLNSGLIALINAMESAEGNWG
                     EDYILYDASWVGPNAFLFKISDRSSQKLIVRIYDTKNNTIKTMYTLDFKKFDGWVEKA
                     RNVVPVPPMEEKGRPEYGYLDILPDENGFNHIFYFARFSDTKGQQITKGNWEVRNQGI
                     VGYEYETHSVFFLSNMVGTMAQHLYTVTINSGSPGEIKTLQNPDKKEDFYEFELSPSC
                     RYALARKLGSSVPVTIAGDLFDVLDADTAKDNNVIRLTDDNDLQKSLKRYDLPVTSYK
                     SMVLDDGTEVNYVEIKPPFLDSKKKYPVLVESYAGPGSQSYFTKFNVFFQQAVSSGLH
                     AIVLLVEPRGTGGKGWKFKSWAKNKIGYWEPRDITEVTRQFITLNHQFVDKERVAIWG
                     WSYGGFAALKTIEYDAGQTFNYAMAVAPVTNWTYYDSIYTERYMGLPKENIQGYSDRA
                     SIRDFKSFEKIEKLLVIHGTADDNVHIQNSYEFVDHLNSLGIKNYDMHIFPDSDHTIH
                     FHNAQKVVFTKLYQWLKDAFAGHFKPR"
     gene            complement(<539115..>540011)
                     /locus_tag="ZYRO0F06490g"
                     /db_xref="GeneID:8205241"
     mRNA            complement(<539115..>540011)
                     /locus_tag="ZYRO0F06490g"
                     /product="60S ribosomal protein L5"
                     /transcript_id="XM_002497435.1"
                     /db_xref="GeneID:8205241"
     CDS             complement(539115..540011)
                     /locus_tag="ZYRO0F06490g"
                     /note="highly similar to uniprot|P26321 Saccharomyces
                     cerevisiae YPL131W RPL5 component of the large (60S)
                     ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L5"
                     /protein_id="XP_002497480.1"
                     /db_xref="GeneID:8205241"
                     /db_xref="GOA:C5DXN6"
                     /db_xref="InterPro:IPR005484"
                     /db_xref="InterPro:IPR005485"
                     /db_xref="InterPro:IPR025607"
                     /db_xref="UniProtKB/TrEMBL:C5DXN6"
                     /translation="MFFKNLKNNAYQSRFQTPFRRRREGKTDYYQRRKLVTQHKAKYA
                     SPKYRLVVRFTNKDIICQIVSSQITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGL
                     LVARRVLQKLGLDKVYPGVEEVEGEYNLTEAVEDGPRPFKVFLDIGLQRTTTGARVFG
                     ALKGASDGGLYVPHSPKRFPGFDFESEELDADLLRSYIFGGHVSQYMEELADDDEERY
                     QELFRGYIADDIDAESVEEIYQQAHEAIRADPSFKPTEKKFSKDQYAAESKKYKQRKL
                     SKEQKRERVAAKINLLAAASQQ"
     gene            <540870..>541442
                     /locus_tag="ZYRO0F06512g"
                     /db_xref="GeneID:8205242"
     mRNA            <540870..>541442
                     /locus_tag="ZYRO0F06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497436.1"
                     /db_xref="GeneID:8205242"
     CDS             540870..541442
                     /locus_tag="ZYRO0F06512g"
                     /note="similar to gnl|GLV|CAGL0J04158g Candida glabrata
                     CAGL0J04158g and weakly similar to YOR220W uniprot|Q12044
                     Saccharomyces cerevisiae YOR220W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497481.1"
                     /db_xref="GeneID:8205242"
                     /db_xref="UniProtKB/TrEMBL:C5DXN7"
                     /translation="MISMARVQIILTNVDKKLFKQGWPRDLESELFSTKFPQLKPQLS
                     YFSPLPFLNRIVIIFADEASASQVYNYLVENHPDDVKVYLSESLLSQRSNSENDTDRI
                     SRSKNGAGERPILSLNTAQEANVSSPTLSPDRTGSPTLLRFDDNSEFHLYQEPLPKNQ
                     KQPLQVGTKCLWQDQGQPMSPSITLDEFTH"
     gene            complement(<541512..>542270)
                     /locus_tag="ZYRO0F06534g"
                     /db_xref="GeneID:8205243"
     mRNA            complement(<541512..>542270)
                     /locus_tag="ZYRO0F06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497437.1"
                     /db_xref="GeneID:8205243"
     CDS             complement(541512..542270)
                     /locus_tag="ZYRO0F06534g"
                     /note="similar to uniprot|P19516 YPL132W Saccharomyces
                     cerevisiae COX11 Mitochondrial membrane protein required
                     for assembly of active cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497482.1"
                     /db_xref="GeneID:8205243"
                     /db_xref="GOA:C5DXN8"
                     /db_xref="InterPro:IPR007533"
                     /db_xref="InterPro:IPR023471"
                     /db_xref="UniProtKB/TrEMBL:C5DXN8"
                     /translation="MTMKMIMPQCLWYGNRLSLRLINPIRRIHHTTIPFRKAVNVTDL
                     NLTRDQMVQLRNMKSSQERKFRNRTVAFYFSSVAVIFLGLAYAAVPLYRAICARTGFG
                     GIPITDKRKFTSDKLVPVDTEKRIRIGFTSEVSQILPWKFTPEQREVYVQPGETALAF
                     YRAKNTSDKDIIGMATYSITPGDAAQYFNKIQCFCFEEQRLAAGEEVDMPVFFFIDPD
                     FASDPNMRNIDDMMLHYTFFKAHYDRHEVVDTRS"
     gene            <542397..>543476
                     /locus_tag="ZYRO0F06556g"
                     /db_xref="GeneID:8205244"
     mRNA            <542397..>543476
                     /locus_tag="ZYRO0F06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497438.1"
                     /db_xref="GeneID:8205244"
     CDS             542397..543476
                     /locus_tag="ZYRO0F06556g"
                     /note="similar to uniprot|P19541 Saccharomyces cerevisiae
                     YPL133C RDS2 Regulator of drug sensitivity Transcriptional
                     regulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497483.1"
                     /db_xref="GeneID:8205244"
                     /db_xref="GOA:C5DXN9"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DXN9"
                     /translation="MSTKRKKVSKSCVFCRRSHLICDEQRPCSRCIRRDIAHLCTDSL
                     GSNNPGNADLDVGNSIAASANENSKMASFLAQQPTFVSEHVGSEFSSLNEFLSMLEDP
                     LLVNNNSNNSSNNNTNTHNNNNNYNPTLHVDNVERELDTATTSKEHFFLTAADPSTEM
                     TPEDRLKLVINAKLEAGLLQPYNYAQGYTRLQNYMDKYMNQSSKQRILKPLSTIRPAF
                     RAIARSLKDVDLILVEEGFERMLLSYDRVFTSMSMPACLWRRTGEIYRANKEFASLVD
                     CGVEDLIEGKLAIYELMTEESAVNFWEKYGSIAFDKGQKAVLTSCNLRTRDGRRKRPC
                     CFSFTIRRDRYNIPICIVGNFIPIS"
     gene            complement(<543473..>544426)
                     /locus_tag="ZYRO0F06578g"
                     /db_xref="GeneID:8205245"
     mRNA            complement(<543473..>544426)
                     /locus_tag="ZYRO0F06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497439.1"
                     /db_xref="GeneID:8205245"
     CDS             complement(543473..544426)
                     /locus_tag="ZYRO0F06578g"
                     /note="similar to uniprot|Q12283 Saccharomyces cerevisiae
                     YOR221C MCT1 Predicted malonyl-CoA:ACP transferase
                     putative component of a type-II mitochondrial fatty acid
                     synthase that produces intermediates for phospholipid
                     remodeling"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497484.1"
                     /db_xref="GeneID:8205245"
                     /db_xref="GOA:C5DXP0"
                     /db_xref="InterPro:IPR001227"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="UniProtKB/TrEMBL:C5DXP0"
                     /translation="MKLCTFPGQGTPISIPTLRSVVSRRPVQCPESLLRYVYAHPSNP
                     GSIAVSSALFYQLFAAPLQQQQLLLLGHSLGELTCFWANGMFDIENLFHIANYRNDLM
                     VQCTKRYLQARGINQRFALWALSSPRAQNLPKEVEQLLQELQIDSVSIANANSVKQCV
                     VTGLVSELESLRIELHLKFPRLRITELTNPDGIPFHNSAVLRPTHELLYDYIWKIMKD
                     KGTNLNMQLDHPILCNLDGQLSTVAHRALEKFVRCSSNTVQFTECYDTINNDMSGELD
                     EAICMGPGSVVYNLVRRNCQLKAWEFDSLESIQKYEMSHNT"
     gene            <544959..>545852
                     /locus_tag="ZYRO0F06600g"
                     /db_xref="GeneID:8205246"
     mRNA            <544959..>545852
                     /locus_tag="ZYRO0F06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497440.1"
                     /db_xref="GeneID:8205246"
     CDS             544959..545852
                     /locus_tag="ZYRO0F06600g"
                     /note="similar to uniprot|Q03028 Saccharomyces cerevisiae
                     YPL134C ODC1 Mitochondrial inner membrane transporter
                     exports 2-oxoadipate and 2-oxoglutarate from the
                     mitochondrial matrix to the cytosol for use in lysine and
                     glutamate biosynthesis and in lysine catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497485.1"
                     /db_xref="GeneID:8205246"
                     /db_xref="GOA:C5DXP1"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR002113"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DXP1"
                     /translation="MSDPAPLPFALQFVAGAVAGISEILVMYPLDVVKTRMQLQLNTV
                     SADERYNGVVDCFRKIIKKEGFSRLYKGITSPVLMEAPKRATKFACNDEFQKFYKRSF
                     GVEKLTQPLSILSGASAGICESLVVVPFELVKIRLQDQNTTFKGPADVVRHICKEEGV
                     LAMYNGLESTMWRHGVWNAGYFGIIFQIRSLLPAAQNKSQKTRNDLLAGAVGGTFGSF
                     CSTPFDVVKSRIQNTAVVPGQMRKYNWTWPSLFTIYAEEGFLALYKGFLPKVLRLGPG
                     GGILLVVFTEVSDMLRNVTNK"
     gene            <546310..>547146
                     /locus_tag="ZYRO0F06622g"
                     /db_xref="GeneID:8205247"
     mRNA            <546310..>547146
                     /locus_tag="ZYRO0F06622g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497441.1"
                     /db_xref="GeneID:8205247"
     CDS             546310..547146
                     /locus_tag="ZYRO0F06622g"
                     /note="similar to uniprot|Q12015 Saccharomyces cerevisiae
                     YOR223W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497486.1"
                     /db_xref="GeneID:8205247"
                     /db_xref="InterPro:IPR019413"
                     /db_xref="InterPro:IPR025390"
                     /db_xref="UniProtKB/TrEMBL:C5DXP2"
                     /translation="MSQEPLLPLYRTAPNSPNRRVIVIRFSDVNIRDLEIDITDVPYR
                     EVTTRWLRQKCRELRPQETDSRRLKFIRSGALLNSHADLSSELSRHFIRQDAASNGND
                     SNRDQSRSKFYIHCIVGTERLERDQLLNEDAMDDAGPSREGVTTQAVGFDRLRAVGFT
                     DEEIELLRQQFRATYGDLETEPNRDGDDNDIRQLEEQWMESGTERPGEAVYEDERFNA
                     MPTSNFRHNRDLLVGICVGFFLGLFGLLLMKTEGLFSKRQKMAIVAGVMVNVMFNAVR
                     GF"
     gene            complement(<547177..>547614)
                     /locus_tag="ZYRO0F06644g"
                     /db_xref="GeneID:8205248"
     mRNA            complement(<547177..>547614)
                     /locus_tag="ZYRO0F06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497442.1"
                     /db_xref="GeneID:8205248"
     CDS             complement(547177..547614)
                     /locus_tag="ZYRO0F06644g"
                     /note="highly similar to gnl|GLV|CAGL0J04070g Candida
                     glabrata CAGL0J04070g and similar to YOR224C
                     uniprot|P20436 Saccharomyces cerevisiae RPB8 RNA
                     polymerase subunit ABC14.5 common to RNA polymerases I II
                     and III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497487.1"
                     /db_xref="GeneID:8205248"
                     /db_xref="GOA:C5DXP3"
                     /db_xref="InterPro:IPR005570"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5DXP3"
                     /translation="MSNTLFDDVFLVADVDPGKYNRVARIEATSTTQEHCKLALDVNT
                     DLFPVQTGEQVTATIASSLELEKNVNDPSATRSWRPPQPGERSLADDYDYVMHGTAYR
                     FEEVSNDLIAVYYSFGGLLMRLEGNYRSLNNLKQENAFLLLRR"
     gene            complement(547855..547950)
                     /locus_tag="ZYRO0F06666r"
                     /db_xref="GeneID:8205249"
     tRNA            complement(join(547855..547899,547914..547950))
                     /locus_tag="ZYRO0F06666r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (TGA) cove"
                     /db_xref="GeneID:8205249"
     gene            complement(<548627..>549175)
                     /locus_tag="ZYRO0F06688g"
                     /db_xref="GeneID:8205250"
     mRNA            complement(<548627..>549175)
                     /locus_tag="ZYRO0F06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497443.1"
                     /db_xref="GeneID:8205250"
     CDS             complement(548627..549175)
                     /locus_tag="ZYRO0F06688g"
                     /note="similar to uniprot|Q03020 Saccharomyces cerevisiae
                     YPL135W ISU1 Conserved protein of the mitochondrial
                     matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497488.1"
                     /db_xref="GeneID:8205250"
                     /db_xref="GOA:C5DXP4"
                     /db_xref="InterPro:IPR002871"
                     /db_xref="InterPro:IPR011339"
                     /db_xref="UniProtKB/TrEMBL:C5DXP4"
                     /translation="MFKTGFTTGLRTINASTLRTARAINAPRLTPAFSAVTTRFYHPK
                     VIDHYTNPRNVGSMDKTLETVGTGLVGAPACGDVMKLQIQVGEDGTIEDVRFKTFGCG
                     SAIASSSYMTELVRGKSLEEAAKIRNTEIAKELSLPPVKLHCSMLAEDAIKAAIKDYH
                     SKRTKGTVLGGGAKSQETVATA"
     gene            <549938..>553300
                     /locus_tag="ZYRO0F06710g"
                     /db_xref="GeneID:8205251"
     mRNA            <549938..>553300
                     /locus_tag="ZYRO0F06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497444.1"
                     /db_xref="GeneID:8205251"
     CDS             549938..553300
                     /locus_tag="ZYRO0F06710g"
                     /note="similar to uniprot|Q03016 Saccharomyces cerevisiae
                     YPL137C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497489.1"
                     /db_xref="GeneID:8205251"
                     /db_xref="UniProtKB/TrEMBL:C5DXP5"
                     /translation="MEGLKPYSGVDVPVDWLYRGKKLSTKPSLSRSNSNPVVSQRTRS
                     NGSVKDTTHEDDALDFEGGPPASAPMPKRRTKQDEQRQIQGQQQQQQQQQQQRRGRSV
                     SVSSNDFRKNEVLGERSKKSLFGSIFHRGSHTSGSVPNSRMSSPNSSAVGSPELKPQV
                     ARTTPDKMSLAPPPKAKPVDPLEKLSKVPMKRVSFAVDKFSNDPPQQLPSRRPRPGNV
                     MVPEDMVSEAPAISLGITNNGASAAREPRYTKDSREYKLALENQKRLLKESAKHQQEA
                     HMAAKHMEHEVTSLKNGHPFHSGLSFFGNGARPKTHEKEKDTETELDARVAKLSIDKP
                     IHVNEHPFQSEGEGTGYISDEDKEITLDVVYTRCCHLREILPIPSTLRQVTGKSAPLQ
                     VLKFLNPRPTLIDILSFCDFISVVPINTVVFDKVSLTPEMFQVVMVSLVHSKALEKLS
                     LRNVVINREGWRLLCKFLMINKSITKLNISQTRIRSASDESKNRDQMDWPLFSQVLRK
                     RRGRPLEELLLNGVRFDKLPSEHFCQLITAFAEQPGLQTGIRLGVAASEINLECMKFL
                     LSWMSKYNVQGVDLGYNDLSAFVKVIANKLSSLNYDRLEYFTLNSSCLSSGNDLGLLL
                     KYLATLPRLKFLDISNLPQCFPEALTFLHKYLPKFPQLSRIHVDSDNLSFKNLSLLCT
                     IFPKCRSLNHVSIQGQALTEPKDPESSEEVSQFTKNALAANLLALVKNSPNLVNLDVD
                     YDEVPDAIRSRIALTLMHNMNKNMDSNFQIDDLSKQDELLFDGSLLAETAETILDRLD
                     KKSYVETDATKRYLTKKYFEQTQHVHSKVQTTIDKMFDRKKYGELPLKEKENLLRLVL
                     LEKNLANVLDIFAGLPDLSKLAKSQNLKLQIPQPYLKHVGSEDILESPVAAFENPENA
                     IRPHLMASDSGKTIDVATGKPVLFKKSSTTSLHSKRQEQEEGELHKWGFYVQQRNAIY
                     PESDLSHEARNGANANEPPVVPTPAPSARPGFSSPAKRRVLPKIPSGSELREAIIKAK
                     GIDSINDLINDVEEDRSTLENIYGRPFDIGDPNNPSNGAADSKNVVTPSAAPSTNSHG
                     PPHDVNMASEDDTVQETYEKLLNNYSKERTPK"
     gene            complement(<553521..>554426)
                     /locus_tag="ZYRO0F06732g"
                     /db_xref="GeneID:8205252"
     mRNA            complement(<553521..>554426)
                     /locus_tag="ZYRO0F06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497445.1"
                     /db_xref="GeneID:8205252"
     CDS             complement(553521..554426)
                     /locus_tag="ZYRO0F06732g"
                     /note="similar to Q12106 YOR228C uniprot|Q12106
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497490.1"
                     /db_xref="GeneID:8205252"
                     /db_xref="InterPro:IPR012472"
                     /db_xref="UniProtKB/TrEMBL:C5DXP6"
                     /translation="MTLQSVSPEPIDSSSLNDDALKSQDEPVGIPLFPISKKWVSVSL
                     RKVQYFSTFPMSLYFPLHGINTLLVPPISAGSAPDDVLMMVRELLPSFTTKLLVTSLC
                     LHFGSGLILRIWHWINNYYAKPRSKSKKHSPTKTDVHFQLQDESERVSQRVIGLTGGL
                     SGYFTGFKKSFSLPPQILSGYILAPLLTYHLYVMKLIPDELKTDVDFNYVKWILQNPN
                     WQVKWIGGIIPITLLIGSGTYHIFAGMCQYMGVKKLSSRRKWSNVITVVIASGIFGLY
                     RLGKHLAPFVGSAEYEKVFQKIYLL"
     gene            <554576..>555628
                     /locus_tag="ZYRO0F06754g"
                     /db_xref="GeneID:8205253"
     mRNA            <554576..>555628
                     /locus_tag="ZYRO0F06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497446.1"
                     /db_xref="GeneID:8205253"
     CDS             554576..555628
                     /locus_tag="ZYRO0F06754g"
                     /note="similar to uniprot|Q03012 Saccharomyces cerevisiae
                     YPL138C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497491.1"
                     /db_xref="GeneID:8205253"
                     /db_xref="GOA:C5DXP7"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DXP7"
                     /translation="MSLPSWCPPYSSRKTGVNGEDVYCICKNPDNGDLMVGCDGCDDW
                     FHFKCLKIPETYRKLVYSFHCPYCEAGITGPASQGANDLPKTIWKRKCRLDYCYNPCQ
                     SNSKYCSGEHGEEYMRTMLAKVEIPGLQHDAQLQLFKDMANYHKNDSTAEQFQQIGNE
                     EFIHDEPKDQDSLYAEIVRDDKRLMELQDNVKELGEKTIPATKAGLDTLSKYLKWLEE
                     INVKLALRGDLNLGEDATNGTSTNARGKNKKKFNKAKAKQRNCICGYDPDFQIPCGVD
                     EFVSEYSPDLPHVKGICVKVRCSKHSSWATMQLEEQEQQLSSLESYQTRLELLIRMRK
                     EQLHIHYYEQLLRRKD"
     gene            <555965..>557263
                     /locus_tag="ZYRO0F06776g"
                     /db_xref="GeneID:8205254"
     mRNA            <555965..>557263
                     /locus_tag="ZYRO0F06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497447.1"
                     /db_xref="GeneID:8205254"
     CDS             555965..557263
                     /locus_tag="ZYRO0F06776g"
                     /note="similar to uniprot|Q12206 Saccharomyces cerevisiae
                     YOR229W WTM2 WD repeat containing transcriptional
                     modulator 2 Transcriptional modulator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497492.1"
                     /db_xref="GeneID:8205254"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DXP8"
                     /translation="MSKDTKVNKLKNEEFKIWKKSVPSLYQHVSFFKPQLDARLGDVL
                     QFEKRFTFNNEVIPDQKRGVLNTGLFYSVGSNIYKLDCSLPLGLQHGGNEQELPDPQY
                     NEVFKQVGGDTFPSPHWILPGETIIKMSPLESGENTLLALTSTASLAWFKEGSRNPTH
                     IMQEIMGPSTSFSSIHSIRNSECLAVCDFDLSRDKKELVKCQADRKEGQSTIKIVDNS
                     DKVGTPLRRFNVEASVIHSVSFLDNNLYVTCSDENVVSFWDKRSDSQLWSFTDSQDGN
                     ITSLSSSSQLDGFFATGTDAGVIKLWDLRAIMSQQQEMVSFYHSNEDPVVDLQFSPTN
                     STEFLSVGKSGNVYQWDTDFFFTNEEVDEEDLHLQCLKFLHTGGSRRSIGANDKRNMV
                     NWHPAIDQLVGTIDNDCSIAAYKAFTGREEEQQDEEDEQE"
     gene            <558198..>559676
                     /locus_tag="ZYRO0F06798g"
                     /db_xref="GeneID:8205255"
     mRNA            <558198..>559676
                     /locus_tag="ZYRO0F06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497448.1"
                     /db_xref="GeneID:8205255"
     CDS             558198..559676
                     /locus_tag="ZYRO0F06798g"
                     /note="similar to uniprot|P32491 Saccharomyces cerevisiae
                     YPL140C MKK2 Mitogen-activated kinase kinase involved in
                     protein kinase C signaling pathway that controls cell
                     integrity upon activation by Bck1p phosphorylates
                     downstream target Slt2p functionally redundant with Mkk1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497493.1"
                     /db_xref="GeneID:8205255"
                     /db_xref="GOA:C5DXP9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DXP9"
                     /translation="MASLFKPPESARRNAKSPKLTLPPSLRNNHAELNHDDIINGAGI
                     ARPSNGSSPSLDHLRGVTPLYSSSEITIPRSDQTPPTTSSSSIYSMTSSKPMKKRPVP
                     PPIPTSVLSNLKESSSSQSTPKVDKMANSLSKLQIGGDSTLPYSSQDLNNSTDTYPSA
                     VLSAYDSNGNSPTALETKIAGKDIDQLDEEVWEHQMLKHQIETVGILGEGAGGAVAKC
                     RLKTNSGGKIFALKTINTLNTDPEYQKQIFRELQFNKSFESDYIVKYYGMFADQQNST
                     IYIAMEYMGGKSLDAVYKNLIRRGGRISEKVLGKIAEAVLRGLSYLHERKIIHRDIKP
                     QNILLNLQGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIKGQPYSVTCDVWSLGL
                     TLLEVAQGRFPFGSDKMAANVAPIELLTIILTFTPELKDEPELDIYWSKAFKSFIEYC
                     LKKETRERPSPRQMINHPWIQGQMKKKTNMEKFINKCWEDEA"
     gene            <559908..>560561
                     /locus_tag="ZYRO0F06820g"
                     /db_xref="GeneID:8205256"
     mRNA            <559908..>560561
                     /locus_tag="ZYRO0F06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497449.1"
                     /db_xref="GeneID:8205256"
     CDS             559908..560561
                     /locus_tag="ZYRO0F06820g"
                     /note="some similarities with uniprot|P38523 YOR232W
                     Saccharomyces cerevisiae MGE1 Protein of the mitochondrial
                     matrix involved in protein import into mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497494.1"
                     /db_xref="GeneID:8205256"
                     /db_xref="GOA:C5DXQ0"
                     /db_xref="InterPro:IPR000740"
                     /db_xref="InterPro:IPR009012"
                     /db_xref="InterPro:IPR013805"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ0"
                     /translation="MIRALSYMVPRTGALPVRPVYRSVANARFYSQAKNENAQEEPKQ
                     EQENKKEEQGSELQELQQKLQNKDKEAAEYKDRLVRCVADFRNLQEVTKKDVQKAKDF
                     ALQKFAKDLLESVDNFGHALNAFDAADSKHSSEVKELYTGVKMTRDVFEKTLYKYGIE
                     KIEPLGQQFDPNQHEATFELDQPDKEPGTVFFVQQVGFSLNSRVIRPAKVGIVKARE"
     gene            <561269..>563800
                     /locus_tag="ZYRO0F06842g"
                     /db_xref="GeneID:8205257"
     mRNA            <561269..>563800
                     /locus_tag="ZYRO0F06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497450.1"
                     /db_xref="GeneID:8205257"
     CDS             561269..563800
                     /locus_tag="ZYRO0F06842g"
                     /note="similar to Saccharomyces cerevisiae YPL141C and to
                     YOR233W uniprot|Q01919 Saccharomyces cerevisiae YOR233W
                     KIN4 Nonessential protein kinase with unknown cellular
                     role"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497495.1"
                     /db_xref="GeneID:8205257"
                     /db_xref="GOA:C5DXQ1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ1"
                     /translation="MSAMTSLPQRHTYYGGEVGVHTHEISAKPRKRHVTFGPYIVGST
                     LGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIPKNSEKEVKIYREINALKHLS
                     HPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKEAIACRLFAQLVSGVNYM
                     HSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHNELMKTSCGSPCYAAPELVVS
                     TKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFPEYI
                     TPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPHAAFISITPEEWDKAMSSKDVFRLP
                     HPAHTRPKRPQSSCSTSSTGSKGEKRDSLIMDYTLVPLPAPPHQSQSHVITKPSPPSP
                     EIRTSPVRNQLSRHTRSNSAASVALQAVVDAERDSNSMLSHPHGNGVNAVNGGTVSGN
                     KLIPRSNTMSGNVSSLLNKDSVIVETSPSKSRLIEPMDENSIMRPPLNSISNVAASRT
                     VHGKPRPTSYHPGSMATNTDNKDPPPTLSGVPNLSPTRPLSFIEPSPLDSTPSLVPDA
                     GASSQEHSPKMLPRRSFSVSKPLLDLQSVNGDLIKSHGDAQPMARRLHEQVEDGDYKQ
                     RRQSRRYSSLFNSVTEEGEDMDQKSIAPQSRATSHTRSRTSSKTHSRQPSGNTNTVGG
                     SEPVEPVKSRTTTTAGANTRDKDKKLDKKRFSFLSFYSSYNTSRSSIASEKIPSVPAP
                     TSQPQQHRRVDSQSSRQNSISRMGTRNSLRVVGQTPLQQQQQQRQAPAQQQPPAQQQQ
                     PFTRTKIKKNRQSMMEPSQPQVRPQGEQSTAKKVMDFFKRRSMRV"
     gene            complement(<564055..>564454)
                     /locus_tag="ZYRO0F06864g"
                     /db_xref="GeneID:8205258"
     mRNA            complement(join(<564055..564359,564436..>564454))
                     /locus_tag="ZYRO0F06864g"
                     /product="60S ribosomal protein L33"
                     /transcript_id="XM_002497451.1"
                     /db_xref="GeneID:8205258"
     CDS             complement(join(564055..564359,564436..564454))
                     /locus_tag="ZYRO0F06864g"
                     /note="highly similar to uniprot|P05744 Saccharomyces
                     cerevisiae YPL143W, RPL33A Ribosomal Protein of the Large
                     subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L33"
                     /protein_id="XP_002497496.1"
                     /db_xref="GeneID:8205258"
                     /db_xref="GOA:C5DXQ2"
                     /db_xref="InterPro:IPR001780"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR018266"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ2"
                     /translation="MAQSHRLYVKGKHLSYTRTRKHNNPSVSLVKIEGVSTPQDAQFY
                     LGKRVAYVYRTSKEVRGSKIRVIWGKLTRTHGNSGVVRANFRNNLPAKTFGASVRIFL
                     YPSNI"
     gene            564951..565328
                     /gene="SNR17"
                     /locus_tag="ZYRO0F06886r"
                     /db_xref="GeneID:8205259"
     ncRNA           564951..565328
                     /ncRNA_class="snoRNA"
                     /gene="SNR17"
                     /locus_tag="ZYRO0F06886r"
                     /product="U3 RNA"
                     /note="C/D snoRNA SNR17 (U3 RNA)"
                     /transcript_id="XR_002648425.1"
                     /db_xref="GeneID:8205259"
     gene            complement(<565420..>565767)
                     /locus_tag="ZYRO0F06908g"
                     /db_xref="GeneID:8205791"
     mRNA            complement(<565420..>565767)
                     /locus_tag="ZYRO0F06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497452.1"
                     /db_xref="GeneID:8205791"
     CDS             complement(565420..565767)
                     /locus_tag="ZYRO0F06908g"
                     /note="similar to uniprot|Q6Q5F7 Saccharomyces cerevisiae
                     YPL144W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497497.1"
                     /db_xref="GeneID:8205791"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ3"
                     /translation="MQTKTVSHTIETPLEPIQLLATLPVNDSKKTPISITISGSAGLA
                     CYHYAIPYRDDVVGSLMVDDANDSKRDITRQLATLVAKKYQRPCYVAYACNNTEDQLL
                     IIRQCIEFLKLNI"
     gene            <565878..>566495
                     /locus_tag="ZYRO0F06930g"
                     /db_xref="GeneID:8205260"
     mRNA            <565878..>566495
                     /locus_tag="ZYRO0F06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497453.1"
                     /db_xref="GeneID:8205260"
     CDS             565878..566495
                     /locus_tag="ZYRO0F06930g"
                     /note="similar to uniprot|P07807 Saccharomyces cerevisiae
                     YOR236W DFR1 Dihydrofolate reductase part of the dTTP
                     biosynthetic pathway involved in folate metabolism
                     possibly required for mitochondrial function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497498.1"
                     /db_xref="GeneID:8205260"
                     /db_xref="GOA:C5DXQ4"
                     /db_xref="InterPro:IPR001796"
                     /db_xref="InterPro:IPR012259"
                     /db_xref="InterPro:IPR017925"
                     /db_xref="InterPro:IPR024072"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ4"
                     /translation="MGKPIVCIVAALCPHMGIGYRGGLPWKLSQEMKYFRQVTTSTFT
                     EGKSNAVIMGRRTWESIPAKFRPLKGRINVVLSRQFPSFQREDDRFLSNDLSHAIKSL
                     QDLPVERIYIIGGAQLYTESIDIATHWLVTNIHFNSQNEQPPPVDTFLPRLTHHEEVS
                     PEQLAEFLPSQVELPPLQALQYGNHHYSMQDNFTYWYTLYESQNT"
     gene            <567121..>568416
                     /locus_tag="ZYRO0F06952g"
                     /db_xref="GeneID:8205261"
     mRNA            <567121..>568416
                     /locus_tag="ZYRO0F06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497454.1"
                     /db_xref="GeneID:8205261"
     CDS             567121..568416
                     /locus_tag="ZYRO0F06952g"
                     /note="highly similar to gnl|GLV|KLLA0D07480g
                     Kluyveromyces lactis KLLA0D07480g and similar to YPL145C
                     uniprot|P35844 Saccharomyces cerevisiae YPL145C KES1
                     Member of the oxysterol binding protein family which
                     includes seven yeast homologs involved in negative
                     regulation of Sec14p-dependent Golgi complex secretory
                     functions peripheral membrane protein that localizes to
                     the Golgi complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497499.1"
                     /db_xref="GeneID:8205261"
                     /db_xref="InterPro:IPR000648"
                     /db_xref="InterPro:IPR018494"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ5"
                     /translation="MTTYANSSTWTSFLKSITSFNGDLSSLSAPPFILSPTSLSEFSQ
                     YWAEHPDLFLGPAFIKNESDASKICPGIDVESPEVARMLAVVKWFISTLKSQYCSRSE
                     SMGTEKKPLNPFLGELFVGKWDNKNHPDFGETVLLSEQVSHHPPITAYSIFNDKNDVS
                     LQGYNQIKSSFSKSLTLSVKQYGHALLSVGKESYLITLPPLHVEGILVASPFAELEGK
                     SYIQSSTGLLCVLEYSGRGYFSGKKNSFKARIFKDSKDSKDKDKALYTISGQWSGLSK
                     ISQSNKHKDDGVLFYDASKNPTELLNVKDIKDQHPLESRRAWKDVAESIKQGDYENIT
                     KAKTELEESQRSRRKEEVSKGIQWQQRWFKGVDYSQAQEDDFSLLSGLANLSVKNLFS
                     GTTTEDKDEKKDVPSLHWRFQRAAWDNEKEIRLSGASSS"
     gene            <568852..>570165
                     /locus_tag="ZYRO0F06974g"
                     /db_xref="GeneID:8205262"
     mRNA            <568852..>570165
                     /locus_tag="ZYRO0F06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497455.1"
                     /db_xref="GeneID:8205262"
     CDS             568852..570165
                     /locus_tag="ZYRO0F06974g"
                     /note="similar to uniprot|Q12080 Saccharomyces cerevisiae
                     YPL146C NOP53 Nucleolar protein involved in biogenesis of
                     the 60S subunit of the ribosome interacts with rRNA
                     processing factors Cbf5p and Nop2p null mutant is viable
                     but growth is severely impaired"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497500.1"
                     /db_xref="GeneID:8205262"
                     /db_xref="InterPro:IPR011211"
                     /db_xref="InterPro:IPR011687"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ6"
                     /translation="MSAIHRPAQYKQSSRKGKKAWRKNIDVSDVEKGLQDKNELEITH
                     GTPDLSQLQDDKLFQVDDQGDLDLKSKLIKRKQIKKNIRSREILDAVKTNSKVDIVKH
                     PKTSEQPKDKIQNVSKKELQRLLNLAGKTVGESKWKNRVAKEGLIKSGSFDLWNQDSG
                     KKMTTRAGIQVEVDPSKEIPKELVELSTTSWSLPSTRPSTLERAPEKVQEYEELPHAG
                     KSYNPNEKDWNQLIMAEYTSEKAREDNRIAQREYSAKIAHLIEVLGDSEEEDSDSSEE
                     EEENEQEEEGSSNEDTRLSMNEVVKNKKKTKYQRNKAKKHEERVKMQEELKRLKSHLR
                     ELEKLQDLEKEVEKKKPAKVQKTKKNKKHKLGTKYSAREANLEVKFSDELSDSLRKLR
                     PEGNLLYDQMRKLQSSGKVETRIPVSRSKGNKPKVTEKWTYKDFK"
     gene            <570370..>571257
                     /locus_tag="ZYRO0F06996g"
                     /db_xref="GeneID:8205263"
     mRNA            <570370..>571257
                     /locus_tag="ZYRO0F06996g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497456.1"
                     /db_xref="GeneID:8205263"
     CDS             570370..571257
                     /locus_tag="ZYRO0F06996g"
                     /note="similar to uniprot|Q08634 Saccharomyces cerevisiae
                     YOR238W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497501.1"
                     /db_xref="GeneID:8205263"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ7"
                     /translation="MSKSHLIIVPCHSIWNPFRHSQVPNGKSNLGQNPEHWYLKPFQL
                     QGNDHLAFIKHGLQAIITLLKDEKDESFLVFSGSQTILAAGALSESQSYYLLMRQLLR
                     ASDGQDPPNFDGIAKFINEIKQLLAKREIDIETLFNTRVTTEEYALDSFDNLIYSIYR
                     FKQMNDSWPQEITIVGFGFKKKRFLELHAKAIDFPKERMNYISIDPSPKGYIINETNQ
                     YFQHLAEMELKNAVSLFEKDWFATRDPLLTKKQSRNPFKRSNDYEDVRLFNLKSPIDH
                     DKLFFDIYIRDKMPWSKKE"
     gene            complement(<571276..>573861)
                     /locus_tag="ZYRO0F07018g"
                     /db_xref="GeneID:8205264"
     mRNA            complement(<571276..>573861)
                     /locus_tag="ZYRO0F07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497457.1"
                     /db_xref="GeneID:8205264"
     CDS             complement(571276..573861)
                     /locus_tag="ZYRO0F07018g"
                     /note="similar to uniprot|P41909 Saccharomyces cerevisiae
                     YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
                     peroxisomal ATP-binding cassette transporter necessary for
                     transport of long-chain fatty acids into peroxisomes ABC
                     family long-chain fatty acid transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497502.1"
                     /db_xref="GeneID:8205264"
                     /db_xref="GOA:C5DXQ8"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR010509"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ8"
                     /translation="MTAAEVRHRVLQVTDARKRLLDLIQYAQRNSIGLRLHGGDISDY
                     FKVLVRHLLRLSKSLTHPHRKRARILLFSLVTAVGTVFLTGSYYMRKTYKRLRSYSQS
                     KPPLLRRTRSQTRLESGARIMYISEDKVSEEDQDDRSGAPVRHLDGVSSERLGRTKKI
                     FIPKRDGDVFERDKYLFKSVETSYEPHSQLFYSKFLNQMSALIKILIPSWLDKNVALL
                     SLQVFFLIMRTWLSLFVARLDGQIVKDVIAGRGKGFLADLACWFIIALPASYTNGAIK
                     FLQRKLSLNFRVYLTRYIHDMYLDERLAFYKLIFDTQSDSSVIKNIDNSITNDVTKFC
                     DAFCSVFADIAKPVIDLVFFAVYLRDNLGTFGVVGIFANYFLTGYILRKYTPPLGTLA
                     SHKSSAEGDFYNYLLNMSSNNEEIAFYQGTEVERAKVTELYSNYFDNSLQIDQSKFNY
                     TMMEDYILKYTWSALGYVFASIPIVISTLSSKENLENSNMRDFIVNKRLMLSLADAGS
                     RLMHSIKDISQLTGYTNRVFVLLGALHRVHFRRFNYGAFVGMEMGYGDSKDMVRGTVQ
                     RNFHGIRFENIDIIIPSRRAGRGAKLIGTLTFQIPSVIEPSSKSSSIQDFKKNFDPNV
                     PLIDSTGASLLILGPNSCGKSSIQRIITEVWPVYNKNGLLSIPAPSNLFCVPQRPYFT
                     RGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGCSYMDAVADWKD
                     VLSGGEKQRMNFARILFHRPRFVVLDEATNAISVDMEDYLFNLLKRYRFNFITISQRP
                     SLIKYHDMLLEVDSSGSWQLQALGTVEAITSIDHELDNLKGKLADVVKLEEERKALRQ
                     KLEVS"
     gene            <574536..>575384
                     /locus_tag="ZYRO0F07040g"
                     /db_xref="GeneID:8205265"
     mRNA            <574536..>575384
                     /locus_tag="ZYRO0F07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497458.1"
                     /db_xref="GeneID:8205265"
     CDS             574536..575384
                     /locus_tag="ZYRO0F07040g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497503.1"
                     /db_xref="GeneID:8205265"
                     /db_xref="InterPro:IPR013744"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DXQ9"
                     /translation="MAYPGVLHQYSTQVAFEFNPSGHKKVIVVIGGLSDGLLTVKFAP
                     GLAKAVEKLGFGVLQIQMRSSYIGWGTGSLDADVEDIKKLVEYLRSPEGGSRETIIIM
                     GFSTGSQDVMHYLLRHSDSIEGCIFSAPVSDREGQDPKDLERLNPKAQELVANGQGNE
                     ILPREYANYVFNTPITAYRWCSLHVKGGDDDYFSTDLSQEVFASTFGKLDKPFLVAFN
                     ELDEYVPKNVNKPEHIKRWQSVSNPKYWSKNSGIVKGSTHTVAQPEAQQDLFQRVLGF
                     LEEFSF"
     gene            <575519..>576184
                     /locus_tag="ZYRO0F07062g"
                     /db_xref="GeneID:8205266"
     mRNA            <575519..>576184
                     /locus_tag="ZYRO0F07062g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497459.1"
                     /db_xref="GeneID:8205266"
     CDS             575519..576184
                     /locus_tag="ZYRO0F07062g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497504.1"
                     /db_xref="GeneID:8205266"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DXR0"
                     /translation="MSTSQLHDGPHFFKPLVQEIEPVHFSLPKDGTVAIAYPIYSPDQ
                     VHSTLIDYMWHEFNYVIEEGLTYPQADNLTRDEFVHHWFHSFCVVAIKGGVDLQKEND
                     WDKVFLGTFYIKPNYMARCSHNCNAGFLVNHLQRGQKIGYRLGQVYLKWGALLGYKYS
                     VFNLVFVTNVASWKLWDKFKFDRIGLLPRAAILKGYEEPIDAIIYGRDLTKVDPELLE
                     GLS"
     gene            <576219..>576695
                     /locus_tag="ZYRO0F07084g"
                     /db_xref="GeneID:8205267"
     mRNA            <576219..>576695
                     /locus_tag="ZYRO0F07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497460.1"
                     /db_xref="GeneID:8205267"
     CDS             576219..576695
                     /locus_tag="ZYRO0F07084g"
                     /note="similar to gnl|GLV|CAGL0M02365g Candida glabrata
                     CAGL0M02365g and weakly similar to YPL148C uniprot|Q12036
                     Saccharomyces cerevisiae YPL148C PPT2
                     Phosphopantetheine:protein transferase (PPTase) activates
                     mitochondrial acyl carrier protein (Acp1p) by
                     phosphopantetheinylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497505.1"
                     /db_xref="GeneID:8205267"
                     /db_xref="GOA:C5DXR1"
                     /db_xref="InterPro:IPR008278"
                     /db_xref="UniProtKB/TrEMBL:C5DXR1"
                     /translation="MIQRVLGIGTDIVFTPRISHLLQRFPPNGSGFKRLTTKFMHQHE
                     LEELQLLLYQKKDPTTYLAGVWATKECVWKAMTSFVDPKLMPPAISVYTRLCYKTKGP
                     RGSPFLVFDSNFPQTTPLHSLFYNEVIYKRKIKALLSISHDKDYLVAFMTMLEDIN"
     gene            complement(<578670..>579593)
                     /locus_tag="ZYRO0F07150g"
                     /db_xref="GeneID:8205268"
     mRNA            complement(<578670..>579593)
                     /locus_tag="ZYRO0F07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497461.1"
                     /db_xref="GeneID:8205268"
     CDS             complement(578670..579593)
                     /locus_tag="ZYRO0F07150g"
                     /note="similar to uniprot|Q12380 Saccharomyces cerevisiae
                     YPL149W ATG5 Conserved autophagy-related protein that
                     undergoes conjugation with Atg12p and then associates with
                     Atg16p to form a cytosolic complex essential for
                     autophagosome formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497506.1"
                     /db_xref="GeneID:8205268"
                     /db_xref="GOA:C5DXR2"
                     /db_xref="InterPro:IPR007239"
                     /db_xref="UniProtKB/TrEMBL:C5DXR2"
                     /translation="MCVNALPREKAGTTMNMDQIRELVWSGAINVQINVKQSLLLNEV
                     SHKESLVNVRIPRDTYLVLYLPAIVSHLRNSLKIDPNGNDGGTYWFEFEDVPLFWNYP
                     LGVLYDSMLALNPPGRVSRDTENSINVWKIELAYGSNPPAGVIPLINGIDQIKSYWMH
                     QWKQSCYILNGSAKQVMSLSMQDSQQFWGSILNRDRTNFGRISSKIIPKRPKFIPIIL
                     HQTLPDIKRIQLSATECKDDGSLQTVADLAKIQFPEFFQDNQVLMKAVSNGIEVPLHS
                     NVFELYQRLMSFDGFLHVCICLVSNDEYGEA"
     gene            <579706..>581226
                     /locus_tag="ZYRO0F07172g"
                     /db_xref="GeneID:8205269"
     mRNA            <579706..>581226
                     /locus_tag="ZYRO0F07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497462.1"
                     /db_xref="GeneID:8205269"
     CDS             579706..581226
                     /locus_tag="ZYRO0F07172g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497507.1"
                     /db_xref="GeneID:8205269"
                     /db_xref="InterPro:IPR010770"
                     /db_xref="UniProtKB/TrEMBL:C5DXR3"
                     /translation="MQVIKPQKRVSSEWLWQFQDGDRFIDVFDSPSDTWLIFGVFYLD
                     KFDNDPHSKLEKLLNQLNDEICIWNHKYPWSEFNGISLQLDKTAQGVPFILGQICVED
                     NVVEEEAIVVALLQKFTSKCGMPQVFVKVCDTDGDFLLAEASDTIPEDYEYPVSINRL
                     WIHEGKFKLIPKEYYEHRGLNHEEALKFLRNNYYKLIVIDGIQRKISQGITNKYPEGF
                     LDNLVKLPLVFEDSQALSITNANPRIISFALKNLITEEIEVNKEVSQVNDGQRKEFLV
                     PRRFVDLLSLFLDSKGLKKSPDHIPLYCGRAVASVINSLLRSSIINVNSNAGSLPGNN
                     TGYFDSHKFQMASLNEPFKMDYNNDNVENIVERLGEFFKQGNDRKTSSDHEQEVQQDS
                     DDDDEKARQFFRDENVDIDEDDFFEFFLADALKMNKDNIEALRSQEEQNESSTSSENP
                     GSLDGYEELLADGDGLEGLSPSALGDLLKALAIDGATEGPLQTILRNAAGHQNDEL"
     gene            complement(<581438..>584254)
                     /locus_tag="ZYRO0F07194g"
                     /db_xref="GeneID:8205270"
     mRNA            complement(<581438..>584254)
                     /locus_tag="ZYRO0F07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497463.1"
                     /db_xref="GeneID:8205270"
     CDS             complement(581438..584254)
                     /locus_tag="ZYRO0F07194g"
                     /note="similar to uniprot|Q12152 Saccharomyces cerevisiae
                     YPL150W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497508.1"
                     /db_xref="GeneID:8205270"
                     /db_xref="GOA:C5DXR4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DXR4"
                     /translation="MSPTKAEQNQIKSIIGNSYNRLYSQFTSDELSEVGNYKILKQIG
                     EGSFGKVYLASHKPTHRKVVLKTSDKSDPNLVREVFYHRQFDFPYITKLYEVIVTETK
                     VWMALEYCPGRELYEHLLMLHRIPLDECAKLFAQIVSAVHYAHSLNCVHRDLKLENIL
                     LDKNGNAKLTDFGFTRECVSKSSLETICGTTVYMAPELIQRQAYDGFKIDIWSLGVIL
                     YTMINGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQ
                     ILSHPFLQPYGQIMLSRTEKIIKRQRLGMTQFRSRLERKLLKRLKQSGFDAQSIKASI
                     QKKKCDSLSGLWLLLLEHERACERVDYPRRSRSVLSVKKVFDSQPSIQETPESRIPIR
                     RQNSSSAADLKNVSSLRRMLSKNSDANDVLPSYVERRSQQQPQPLQQQTQNQSLVELK
                     NKKSIDPSRSVISKQSSPPPQQQWLSTNDSTASVSSIKGSGSSGGHPSGSKKNNILSK
                     VTKFFKSKKQQSNNNNNSSANNKCMNGNNGAGSHNGSQRNSNYRKSHSTSPTGSTNAI
                     DHTGYQDKKRTNRSESLKSATKSSNQSTAKDQDTAASQLNDVSADDAVIESKVHSDQR
                     LLKRLKSRTSSDISGQTSAGNYDVETVFNQNIQLSSHDGHKSPNFLRPRPVSGISEFS
                     NDTFNSEYSTDGNASSLRVSDFPRPNFPHASTGEVSSDLKGRSIYKQTLDRRDLSIMS
                     SASSASERSSRTDSFYDITTASPPTIMDIRKTKGTAVTDSVLPRFGAQHTWFPRRNRS
                     GSRRGSIGRKNHNRGFTKASQPQSIIQEEGSLNSQEEKHTSNSIILSPHQSLVMEEDN
                     DFLNQSDEHSVPKRVGSISRSLTHYHPFENSNSSLAGQISAGEARSCSPKFPIISSGM
                     SAPSLVTEDDEALRIADQEDNYSD"
     gene            <584726..>586192
                     /locus_tag="ZYRO0F07216g"
                     /db_xref="GeneID:8205271"
     mRNA            <584726..>586192
                     /locus_tag="ZYRO0F07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497464.1"
                     /db_xref="GeneID:8205271"
     CDS             584726..586192
                     /locus_tag="ZYRO0F07216g"
                     /note="similar to uniprot|Q08645 Saccharomyces cerevisiae
                     YOR241W MET7 Folylpolyglutamate synthetase catalyzes
                     extension of the glutamate chains of the folate coenzymes
                     required for methionine synthesis and for maintenance of
                     mitochondrial DNA present in both the cytoplasm and
                     mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497509.1"
                     /db_xref="GeneID:8205271"
                     /db_xref="GOA:C5DXR5"
                     /db_xref="InterPro:IPR001645"
                     /db_xref="InterPro:IPR004101"
                     /db_xref="InterPro:IPR013221"
                     /db_xref="InterPro:IPR018109"
                     /db_xref="InterPro:IPR023600"
                     /db_xref="UniProtKB/TrEMBL:C5DXR5"
                     /translation="MKLSMPLKMAVRGYQEAVTALNSLQSNYANIMAIRESGDRKNQM
                     NIWEMQEWSRRIGYNVSEFDKLNVVHITGTKGKGSTAAFVASILGKYKVPKVGLYTSP
                     HLKSVTERIRINGNPISEDKFAKYFFEVWDKLENTESELSKFPHMIPGSKPGYFKYLT
                     LLSFHVFMREGCDCCVYEVGVGGEFDSTNIVERPLACGVTQLGIDHTFMLGNTIEEIA
                     WNKGGIFKKQAPAFTVKEQPPKGLKMLEQRANERGTQLEEVPIYQGLRGRKLGIAGDF
                     QIANASLAVALSSQALASMYFLPSPIPNTEDASIPARFLEGLELTRWDGRCQTLVKGS
                     ATWFIDGAHTKESIEAASGWFTQQVVRSKNKKILLFNQQSRDANSLLSNLYSKTHPDV
                     QFDQVIFTTNVTWTSGSYSSDLVSMNTSKEQVDNLEVQKSLAEKWTALDGQRSKIHVT
                     SSIEAAYTLIRQLEEPVDVFVTGSLHLVGGLLVVFDNL"
     gene            complement(<586327..>587496)
                     /locus_tag="ZYRO0F07238g"
                     /db_xref="GeneID:8205272"
     mRNA            complement(<586327..>587496)
                     /locus_tag="ZYRO0F07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497465.1"
                     /db_xref="GeneID:8205272"
     CDS             complement(586327..587496)
                     /locus_tag="ZYRO0F07238g"
                     /note="similar to uniprot|Q96US5 Saccharomyces cerevisiae
                     YOR242C SSP2 Sporulation SPecific involved in sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497510.1"
                     /db_xref="GeneID:8205272"
                     /db_xref="UniProtKB/TrEMBL:C5DXR6"
                     /translation="MTASRNNSIPAYVYLDGKRNVENLQLNQGRSRVSSISSFFSSST
                     MEDNGNHELFGFRRFARNHLLGSEKSTRFKTARQSNLPNEQSSDNCYAQMNAVPHQLQ
                     FKSTTNKNKLGMNMDQEPSTKTHRLNVNGEMVDYELDVFGVPQRIPDLFQEDNAYAAV
                     DGENIYVTSSSEDELLENNVRPKAIVLGNIPKRTGIASILAQIHAGPLENIIVHTDDE
                     QALKKIELDFLTHEAAYSFMKYGRTNMFKINGQHLTPEWGKSSEHKTKKGNEWDDQQS
                     SSDDQDFCRSLIMKKYINCTKRTKYSEAYKESPLEPLNLSEIKQDFGTFGEILEITPV
                     VSRKLCISINFFNMESAMKAMKEYENPNSDLHKAYFNNWAIWYGKDITDRPCIAL"
     gene            complement(<587907..>589940)
                     /locus_tag="ZYRO0F07260g"
                     /db_xref="GeneID:8205273"
     mRNA            complement(<587907..>589940)
                     /locus_tag="ZYRO0F07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497466.1"
                     /db_xref="GeneID:8205273"
     CDS             complement(587907..589940)
                     /locus_tag="ZYRO0F07260g"
                     /note="highly similar to uniprot|Q08647 Saccharomyces
                     cerevisiae YOR243C PUS7 pseudouridylates U2 snRNA at
                     position 35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497511.1"
                     /db_xref="GeneID:8205273"
                     /db_xref="GOA:C5DXR7"
                     /db_xref="InterPro:IPR001656"
                     /db_xref="InterPro:IPR011760"
                     /db_xref="InterPro:IPR017091"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="InterPro:IPR020119"
                     /db_xref="UniProtKB/TrEMBL:C5DXR7"
                     /translation="MSETTNAPKRLPEESAEIGNDVKKPQTESVAGASASGNGVSESD
                     VGITHFLTPENPGFKGQIKQRYSDFMVNEIDLEGNVVYLKDRGFKRPQKPQPSAEELK
                     TQQEEESKRRQEFELDGELKQKLVEALGESDVEKIMDVFKHAQKMETERSFEDKFDRT
                     KVHQLLREAFNNELESVTTEDNTFKIARSNRKTRVDKKTFIEQTKDANGVENWGYGPA
                     KDFIHLTLYKENKDTMDAINIIAKYLRLPARAMRSSGTKDRRAVTCQRLSVSRIGLDR
                     LNALNRTLKGMVLGGYKFEDRSLSLGDLKGNEFVVVIRDAKLHEGADKSLDQVLKDGC
                     QSLAERGFVNYFGMQRFGTFSISTHVVGKELLLNNWQGAAELILSDQDSVLPTSKEAR
                     KIWSESKDANSAMKKMPRQCVAENAILSYLSTQKKEEDGQYSANAYYTAIMKIPRNLR
                     TMYVHAYQSFVWNTIASKRIEMYGLNVMEGDLVISENDESKAADSLEEDEFDEDVRTA
                     QFVRARPITKDEIESQKFKIEDVVLPTPGFDIVYPPNQKLSDLYVEIMKKDAMDPFDM
                     RRKVRDFSLAGSYRNVIQKPAALDYRIIHYSSPTQQLINTDLEILHNQRAKDNCQKYM
                     KEKLDRFTPDKGGEHTAVVLKFQLGVSAYATMVLRELMKVESSRRGDMCDVKV"
     gene            <590095..>591378
                     /locus_tag="ZYRO0F07282g"
                     /db_xref="GeneID:8205274"
     mRNA            <590095..>591378
                     /locus_tag="ZYRO0F07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497467.1"
                     /db_xref="GeneID:8205274"
     CDS             590095..591378
                     /locus_tag="ZYRO0F07282g"
                     /note="similar to uniprot|Q12417 Saccharomyces cerevisiae
                     YPL151C PRP46 Splicing factor that is found in the Cef1p
                     subcomplex of the spliceosome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497512.1"
                     /db_xref="GeneID:8205274"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DXR8"
                     /translation="MDDVDTLESINGFYSRVRWNNQFKQLTIVPKHLQTVFDGRKTVL
                     EKYQDIAGRSNGIDESKSLVKSENDHQNMLSQVFGQDSASHSVLQRQEQLLSQRPAWH
                     APWKLIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLASGKLKLTLAGHVMT
                     VRDVAISQRHPYLFSASEDKMVKCWDLEKNQIIRDYHGHLSGVHTVDIHPTLDLIASA
                     GRDGVVKLWDIRSRTAVMTLIGHKSPITKVHCLPVNPQVVSSSTDATVRLWDVTAGKS
                     YKILTHHKRSVRDFSLHPSEFSMVSACTDDIRSWKLPEGALLTNFASESTGIINTLSV
                     NQDDVLFAGGDDGMLSFYDYKSGHKYQTMATQEVPGSLESERAILTSAFDRTGLRLIT
                     GEADKSIKVWKQIPHSTPETHPGLPWAPSISAQRF"
     gene            <591558..>592859
                     /locus_tag="ZYRO0F07304g"
                     /db_xref="GeneID:8205275"
     mRNA            <591558..>592859
                     /locus_tag="ZYRO0F07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497468.1"
                     /db_xref="GeneID:8205275"
     CDS             591558..592859
                     /locus_tag="ZYRO0F07304g"
                     /note="highly similar to uniprot|Q08649 Saccharomyces
                     cerevisiae YOR244W ESA1 Histone acetyltransferase
                     catalytic subunit of the native multisubunit complex
                     (NuA4) that acetylates four conserved internal lysines of
                     histone H4 N-terminal tail required for cell cycle
                     progression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497513.1"
                     /db_xref="GeneID:8205275"
                     /db_xref="GOA:C5DXR9"
                     /db_xref="InterPro:IPR000953"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR016197"
                     /db_xref="InterPro:IPR025995"
                     /db_xref="UniProtKB/TrEMBL:C5DXR9"
                     /translation="MSGDEEKKQGIPRKISSLEEIIVKCECFVDKDGEERLAEILSIN
                     SRRSPPKFYIHYVDFNKRLDEWIPADRINLEKEVYFPRPKSNEDDLKKKKKKKKATEN
                     ENESNEPADVMDLDNLNVQGAGGELTHEEEIKKLRTSGSMTQNPHEIANVRNLNIVVM
                     GKYEIEPWYFSPYPVELTEEDVVYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYR
                     DDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRKDELGHHLVG
                     YFSKEKESADGYNVACILTLPQYQRCGYGKLLIEFSYELSKKEGKVGSPEKPLSDLGL
                     LSYRAYWADTLIKILVEHRNEITIEEISQMTSMTTMDILHTAKTLNILKYYKGQHIIF
                     LNEEILARYDYLKTKKRRSIDPNKLIWTPPLFTASQLRFAW"
     gene            complement(<592906..>593964)
                     /locus_tag="ZYRO0F07326g"
                     /db_xref="GeneID:8205276"
     mRNA            complement(<592906..>593964)
                     /locus_tag="ZYRO0F07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497469.1"
                     /db_xref="GeneID:8205276"
     CDS             complement(592906..593964)
                     /locus_tag="ZYRO0F07326g"
                     /note="highly similar to uniprot|Q12461 Saccharomyces
                     cerevisiae YPL152W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497514.1"
                     /db_xref="GeneID:8205276"
                     /db_xref="GOA:C5DXS0"
                     /db_xref="InterPro:IPR004327"
                     /db_xref="UniProtKB/TrEMBL:C5DXS0"
                     /translation="MIPEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRENTAY
                     KEPISKDMEPTMQLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVAT
                     TYPSLNKDQVEELAVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAAD
                     LVLKVFVEYLRIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLATHPHLRPKS
                     IHNEEVVEMFMDKYIYFGCIAFINSVKSTASLRWHSPMLDDISGVKTWAKVAEGMIKM
                     YKAEVLSKLPIMQHFYFGNILPCPEGISPPKGDHGRDLCEEGHVHNTWGDCCGIKIPS
                     AVAAHEAAKQNRNIIPFD"
     gene            complement(<594174..>595373)
                     /locus_tag="ZYRO0F07348g"
                     /db_xref="GeneID:8205277"
     mRNA            complement(<594174..>595373)
                     /locus_tag="ZYRO0F07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497470.1"
                     /db_xref="GeneID:8205277"
     CDS             complement(594174..595373)
                     /locus_tag="ZYRO0F07348g"
                     /note="similar to uniprot|Q08650 Saccharomyces cerevisiae
                     YOR245C DGA1 Diacylglycerol acyltransferase catalyzes the
                     terminal step of triacylglycerol (TAG) formation acylates
                     diacylglycerol using acyl-CoA as an acyl donor localized
                     to lipid particles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497515.1"
                     /db_xref="GeneID:8205277"
                     /db_xref="GOA:C5DXS1"
                     /db_xref="InterPro:IPR007130"
                     /db_xref="UniProtKB/TrEMBL:C5DXS1"
                     /translation="MDEAIQDLRRRPVDHRSPTHKEEVKGKLSSAPLLESCCSLRTPV
                     PRRIQTVAVAWYVSALAIILTCFLYSLANPFLWIFSIPYTIFFMFDRTPGNGNVMSRV
                     SPWFRSLPIWRRYCEYFPISLVKTANLEPTFTPRESKGERSPSSGSKWFWRKWFNSND
                     QLQRTGPRYIFGYHPHGVGCLGAFGVFGTEGCNWSKLFPGIPVSLLTLVNQFQMPVYR
                     DYLMALGVSAVSRKNSLKTLERDHSICIVVGGARESLLQGVNTVDLILNRRKGFIRLA
                     LEAGNVCLVPTFAFGEANCYNIIQPKNGSFWKKFQLWLKNNVGFTVPLFYARGLFNYD
                     FGFLPYRTPVTVVVGKPIFVEKRRETPTDEELDYYHGIYIQELKKIFYENRDKYGFSD
                     VELRIVG"
     gene            <595931..>598219
                     /locus_tag="ZYRO0F07370g"
                     /db_xref="GeneID:8205278"
     mRNA            <595931..>598219
                     /locus_tag="ZYRO0F07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497471.1"
                     /db_xref="GeneID:8205278"
     CDS             595931..598219
                     /locus_tag="ZYRO0F07370g"
                     /note="similar to uniprot|P22216 Saccharomyces cerevisiae
                     YPL153C RAD53 Protein kinase required for cell-cycle
                     arrest in response to DNA damage activated by trans
                     autophosphorylation when interacting with
                     hyperphosphorylated Rad9p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497516.1"
                     /db_xref="GeneID:8205278"
                     /db_xref="GOA:C5DXS2"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016256"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DXS2"
                     /translation="MEVTQPTQQSTQATQKYLVEKFSQEQIDDDIVCRIICTTGQIPI
                     RDLRADIDEVLQQKDPIKKVWTFGRNAGCDYHLGNITRLSNKHFQILLGEDGNLLLKD
                     NSTNGTWLDGQRVDKDRNQLLSQGDEITVGVGVSADVLTLVIFINERFKQRLEQAKSE
                     KLKGKKISKSGSAGAAGLQGVFKDFSIKDEVVGQGAFAVVKKAVERSTGKTFAAKIIS
                     KRKLMGNWDGVDRELAVLRKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAH
                     GSVGEDAGREITRQVLEAVAYIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQ
                     GNGTFMKTFCGTLAYVAPEVIGGKNDNTEEEKNEYSSLVDMWSMGCLVYVILTGHLPF
                     SGSTQEQLYEQISRGSYHEGPLKDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWI
                     RSGFHQDSLELSQVSLSQSLSQQRILESLDDAQYEFVKVRRRMEEERRKPLAGPPVSQ
                     GFKVPQQPPIRYTQPKVAAPQPLELSHPLDAIRLSNKKGGGKFLTLHPLPESRIQELI
                     KVKQGVNPFFVGRSDDCNCKIEDNRLSRVHCFVLKKRHVVGDSLYESPAQGLEDIWYC
                     HSGTNVSYLNNQRMTPGTKILLQNGDEIKIIWDRINNFTIGFKVELNDTTGLFNNGVA
                     VPPDQRTIEAQTEYEKSLVQKLGQIMAHKRLDSQNNPDQPGTLLKRVHSVSLSQSQSD
                     PTKKVKRAKLDQANEPQGLPFS"
     gene            <598584..>599840
                     /locus_tag="ZYRO0F07392g"
                     /db_xref="GeneID:8205279"
     mRNA            <598584..>599840
                     /locus_tag="ZYRO0F07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497472.1"
                     /db_xref="GeneID:8205279"
     CDS             598584..599840
                     /locus_tag="ZYRO0F07392g"
                     /note="highly similar to uniprot|P07267 Saccharomyces
                     cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
                     (proteinase A) required for the posttranslational
                     precursor maturation of vacuolar proteinases synthesized
                     as a zymogen self-activates"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497517.1"
                     /db_xref="GeneID:8205279"
                     /db_xref="GOA:C5DXS3"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DXS3"
                     /translation="MLTKNLLPLALSLLGYVEVGESKVHHAKIQKNEPLNVEEFAMAP
                     MFQNFDHADILKEKYLTQFQKAYPEAVFKNDHDDESSSYYPFGFYQSGHSVPLTNYLN
                     AQYYTEVSLGTPPQNFKVILDTGSSNLWVPSTECSSLACFLHSKYDHDSSSSYKPNGT
                     EFAIRYGSGSLEGYISQDTLNLGDLSITKQDFAEATSEPGLQFAFGKFDGILGLGYDT
                     ISVDGVVPPFYNAWKQGLLDEPKFAFYLGRDGESQDGGVATFGGVDDSKYEGEITWLP
                     IRRKAYWEVKFDGIGLGEEYAELENHGAAIDTGTSLIALPSGLAEIINAEIGAKKSWT
                     GQYTVECEARSSLPNMTFTLGGHNFELTAYDYILEVSGQCISAIFPMDFPEPVGPLAI
                     IGDSFLRKYYSIYDLGNNAVGLADAV"
     gene            <600148..>602112
                     /locus_tag="ZYRO0F07414g"
                     /db_xref="GeneID:8205280"
     mRNA            <600148..>602112
                     /locus_tag="ZYRO0F07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497473.1"
                     /db_xref="GeneID:8205280"
     CDS             600148..602112
                     /locus_tag="ZYRO0F07414g"
                     /note="similar to uniprot|P28743 Saccharomyces cerevisiae
                     YPL155C KIP2 Kinesin-related motor protein involved in
                     mitotic spindle positioning"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497518.1"
                     /db_xref="GeneID:8205280"
                     /db_xref="GOA:C5DXS4"
                     /db_xref="InterPro:IPR001752"
                     /db_xref="InterPro:IPR019821"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027640"
                     /db_xref="UniProtKB/TrEMBL:C5DXS4"
                     /translation="MIQKGTPMMRRNSYRSQSPSARSSLSFSNLRKGRIRSGSLSASS
                     SRSSSPIRSVSSSSDQLLPPPNYGGIKRQDSFGSPRKQEPYSGIISVVIRLKPNGGRE
                     LDPWFVRDEHTMQHADYGEFKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAY
                     GMTGSGKTFTMAGTEETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIY
                     DLLDCENELKPTAATSSRMFAHMGTRSSKTPVELKLREDSKYGVKIVGLTERRCESSD
                     ELLKWIRIGDKSRKTGETTYNTRSSRSHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGS
                     EKAVTHNERRKEGAFINKSLLALGTVISKLSAESTSHRNGGSSSPVTGHIPYRDSKLT
                     RILQPALSGNGVVTTICTIDTRPDASSETLNTLRFASRAKNVSLHIFRKPLLPSMSGS
                     NGIVEEKDKTIMSLTRQLEEQQLLIGKLRDDTRSLPSVSSNGVGGGASSRGSSDPSTN
                     LVETENKFLKYKLEHCEKLLDKDTTDLQDSEIAEIVDILPVEVGTLLETKFQGMESQL
                     RQYKEYTRTLEEKLAETERQIQAPQLSEMSLTSATSTADSEVLVELRKSLERKDRMIE
                     ALQSALRLRERALKPINGDELNVSPKEEFY"
     gene            complement(<602157..>603032)
                     /locus_tag="ZYRO0F07436g"
                     /db_xref="GeneID:8205281"
     mRNA            complement(<602157..>603032)
                     /locus_tag="ZYRO0F07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497474.1"
                     /db_xref="GeneID:8205281"
     CDS             complement(602157..603032)
                     /locus_tag="ZYRO0F07436g"
                     /note="similar to uniprot|Q12052 Saccharomyces cerevisiae
                     YPL157W TGS1 TrimethylGuanosine Synthase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497519.1"
                     /db_xref="GeneID:8205281"
                     /db_xref="GOA:C5DXS5"
                     /db_xref="InterPro:IPR019012"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DXS5"
                     /translation="MASDVSHFLHITRKRYRKQHQRLKELYHENSFLVKPDQVIKNRP
                     LIKYWRKKKSLFSKFDERPIFLTDELWYSVTPENIAKFVAKFVKASLPNATKVLDVFC
                     GAGGNTIQLALEFEKVYGVDFSLDHLYCTYKNAESYNVNDHIWLKYGAWEKLAEKGRF
                     AKIGIDFAFGSPPWGGPQYLQEKSYDLETSLKPMGITQLLRSMISVTPNVMLFLPRNS
                     NLEQISQATMQVLGPQGHCRIVYVKDNGFAKGILCMWGPSLVNAGQENEETFENIDPP
                     PPPPSKDTVNYNLDG"
     gene            <603959..>606127
                     /locus_tag="ZYRO0F07458g"
                     /db_xref="GeneID:8205282"
     mRNA            <603959..>606127
                     /locus_tag="ZYRO0F07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497475.1"
                     /db_xref="GeneID:8205282"
     CDS             603959..606127
                     /locus_tag="ZYRO0F07458g"
                     /note="some similarities with uniprot|Q99299 Saccharomyces
                     cerevisiae YPL158C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497520.1"
                     /db_xref="GeneID:8205282"
                     /db_xref="GOA:C5DXS6"
                     /translation="MIIRAPTRTMTKSFNGRQMGFKFPSVENMPQNPLDEYHMNNHHL
                     LNDNIAKSQQAQAHPHPPPHQKPISTDEDALSNINSDYTSGSNTNTNSGNSSNGYYSF
                     ANISDNTTPLPNKMYSYPSSPKSNESSEGGKMSELTVPKDEHNQSSQKSTEPMEVIPE
                     DNGFTSMSLNVQSIPTADNFSFDIASSNSLRPGSTTDKPGVATLARTPSSNTSRSSLL
                     SPSVRNPSSSSARIRQSKRRSQLKRSPSIRCKGGLLKYFHLLGSRIKKTLRKIKLALR
                     GKNSKRQASYRRSTSSTAAPKVARKPQVNVTRASSKKELTSHLKRTNGYVSNLKRSMS
                     QRSLRPLLETPEKCATAGSLHTPHPDTSSSDAFVTPPGSRIVRNPTTSLRRTPSSIRR
                     AASVIRTPIPAVPSATVAPSESFVYEDATTASPGSANGSENRSGLVRSTASKSLNSLV
                     RQRSIVVKNKVIPLSMHQYSIKEEDEDKEHDSQFMIRPSSDYSLSPVHSVSSEGNGSN
                     YDSDFEKYYSTGDYTDAYEDAEMGSFISSKRTSSTNTSSTAASSDAVSYTESVVPSVE
                     PTVEPAVESKSIDDGEDIDETTDSVSFNNEIEELRSNINHYFRCVIARRIKLRLQFSH
                     YESSNSLSPSYLDIMESLLKDYDDESTAGKDPAEFNTIDEEDEVAASELWSPRDSKTG
                     SIRVNVQTPYLKRGPTQHSLISLNSRDVRRSLTLPIGMKV"
     gene            <607194..>607904
                     /locus_tag="ZYRO0F07480g"
                     /db_xref="GeneID:8205283"
     mRNA            <607194..>607904
                     /locus_tag="ZYRO0F07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497476.1"
                     /db_xref="GeneID:8205283"
     CDS             607194..607904
                     /locus_tag="ZYRO0F07480g"
                     /note="similar to uniprot|Q99373 Saccharomyces cerevisiae
                     YPL159C PET20 Protein required for respiratory growth and
                     stability of the mitochondrial genome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497521.1"
                     /db_xref="GeneID:8205283"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:C5DXS7"
                     /translation="MFRQVSPLARGLARNQHTWNGARRCQSSFTFLNNQSLLQKEQLK
                     QSKRKNKKSFYKVEDDEYRTQHIQKKPEMDSQSGKPKKYDYSWLPRVPSTNYLRPRDM
                     SSKILYSGYRPLFLNPDELKTSQDGGNANNGARLYEFAMKLEELGEQSLWTSSATGQE
                     IYPEWDYVPMEVQRKLKPFNAPAPFNVDKEAEKNSLKKLKEEIYTQEKDKLLNRSKGR
                     KKPIVSLLQLRKKLNQED"
     gene            complement(<608118..>608390)
                     /locus_tag="ZYRO0F07502g"
                     /db_xref="GeneID:8205284"
     mRNA            complement(<608118..>608390)
                     /locus_tag="ZYRO0F07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497477.1"
                     /db_xref="GeneID:8205284"
     CDS             complement(608118..608390)
                     /locus_tag="ZYRO0F07502g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497522.1"
                     /db_xref="GeneID:8205284"
                     /db_xref="UniProtKB/TrEMBL:C5DXS8"
                     /translation="MHDAVAVELVHEDMDQILADNFTEQEQFVLWARDQDYDLDTCLE
                     LCDVVQFFNEDVSEREAEESWGMAAAEGDFAKLRDLEDKQEFGLAL"
     gene            complement(<608689..>611988)
                     /locus_tag="ZYRO0F07524g"
                     /db_xref="GeneID:8205285"
     mRNA            complement(<608689..>611988)
                     /locus_tag="ZYRO0F07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497478.1"
                     /db_xref="GeneID:8205285"
     CDS             complement(608689..611988)
                     /locus_tag="ZYRO0F07524g"
                     /note="highly similar to uniprot|P26637 Saccharomyces
                     cerevisiae YPL160W CDC60 Cytosolic leucyl tRNA synthetase
                     ligates leucine to the appropriate tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497523.1"
                     /db_xref="GeneID:8205285"
                     /db_xref="GOA:C5DXS9"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR004493"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DXS9"
                     /translation="MATTVEGKGLVLENTARRDALIAIEKKYQRQWTEEGLFEQNAPS
                     LEEVPLGMDSDELHAKYPKFLSSMAYPYMNGVLHAGHSFTLSKVEYSIGFERMRGKRA
                     LFPLGFHCTGMPILASADKIKREVELFGPDFSKVPPEVEEEPQEQKQEPQQQSEDVTK
                     FKAKKSKVAAKQGRGKYQFEIMMQLGIPKEEVSKFSDPQHWLTYFPPLCQRDCNALGS
                     RIDWRRSFITTDKNPYYDAFIRWQMNRMKEAGKIKFGERYTIYSVKDGQACMDHDRQS
                     GEGVTPQEYIGVKIEVVEFADAAKQIIESNASIDKSKKVYFVAATLRPETMYGQTCCF
                     VSPKITYGIFDAGDSYYITTERAFKNMSYQKLTPQRGVYSPVVNIDGKALIGSRIESA
                     LSVYKDLRVLPMETVLANKGTGVVTCVPSNSPDDFMTTKDLKNKAAFYGIDASWVKDE
                     ILPIIHTDKYGDITAEAVCKECKIHSPRDTNLLAEAKKLAYKEDYYSGTMIHGKYKGM
                     KVSDAKARVRDDIVASGDAFVYNEPEGPVVSRSGDECIVSLEDQWYVDYGEESWKKQT
                     LECLESMEVFAPEVKNAFEGCLEWLKNWAVSRTYGLGSKLPWDPQYLVESLSDSTIYQ
                     AFYTIAHLLFKDFYGNDVGVLGIKAEQMTDEVFDYVFHHSDRAPESGIPLKSLQILRR
                     EFEYFYPLDVSISGKDLITNHLTFFIYTNVALFPRKFWPRGVRANGHLMLNNAKMSKS
                     TGNFMTLEQIVEKFGADASRIALGDAGDTMEDANFDESNANAAILRLFNLKEWAEETV
                     KSADQFRTGPSDEIFDVAFENEMNALVEETYRQYELTNYKNALKFGLFDFQAARDYYR
                     ESCETMHKDLVLRYIEVQSLLLAPIAPHFCEYIYREVLGKQGSVQTAKFPRATKPVDQ
                     GALSALEYVRSLQRGIREAEGQALKKKKGGKQQSIDPSKPVKLILLVSESFPEWQSHC
                     VEIVRELFAQQSLDDNKKIRERVEPKEMKRAMPFISLLKQRLTTEPHEVVFNRELLFN
                     ETETIKSTKDVLQKAPQSLRVEEIVAIQFPYESKVGTNIFNGQETALPNAAKAVEGAI
                     PGSPGILFENL"
     gene            complement(<612245..>613213)
                     /locus_tag="ZYRO0F07546g"
                     /db_xref="GeneID:8205286"
     mRNA            complement(<612245..>613213)
                     /locus_tag="ZYRO0F07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497479.1"
                     /db_xref="GeneID:8205286"
     CDS             complement(612245..613213)
                     /locus_tag="ZYRO0F07546g"
                     /note="similar to uniprot|Q08651 Saccharomyces cerevisiae
                     YOR246C Protein with similarity to oxidoreductases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497524.1"
                     /db_xref="GeneID:8205286"
                     /db_xref="GOA:C5DXT0"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DXT0"
                     /translation="MFNPDSLPYYNPAEDRKVAVITGGNSGIGWYTVLHLYMHGFVVY
                     ICGRNSNRVNKAIKELEMEAANRISKRSKDSQEIHLGSLHYLHNDLSDLKCVERAASK
                     ICKREQKLDVLINNAATVALPYELTKDNFEIQLQTNYIAHFLLSLRLLPLLQRAQGRL
                     ITLTSVCHQIEFRYWGLSQDWNYGPNMLFTWLRYAMAKTASIQFTKMMAIKYPEVLCL
                     SIHPGMVMSTHIFSYWTRLPIVGIFFWMFFQIVGFFFGVSNEQGSLATLRCALSPHLN
                     TDKDNGKYFTTEGVESKPSYIANNLDDAASTWIWTVHALRDRGFDI"
     gene            <614018..>615763
                     /locus_tag="ZYRO0F07568g"
                     /db_xref="GeneID:8205287"
     mRNA            <614018..>615763
                     /locus_tag="ZYRO0F07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497480.1"
                     /db_xref="GeneID:8205287"
     CDS             614018..615763
                     /locus_tag="ZYRO0F07568g"
                     /note="similar to uniprot|P39011 Saccharomyces cerevisiae
                     YPL161C BEM4 Protein involved in establishment of cell
                     polarity and bud emergence interacts with the Rho1p small
                     GTP-binding protein and with the Rho-type GTPase Cdc42p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497525.1"
                     /db_xref="GeneID:8205287"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DXT1"
                     /translation="MDYEKVLFDLQPIIKAHSIDAIPLEGDFQERYLSVLDQVAVCLR
                     TEHNRAIAGSSGLLKRLLEVLEESLVKCFSNMHLDPFWWKFVSDLIRCVANCLVDNDD
                     NRKILFQEKPVIMDRYVGHILTLKTEGNEELQLRTLAMAKNMCLDNKDYVRRFSKIQS
                     PLLSLLHREDDESLTLIGSELLSDFLEIDQNVSLEDLQFFAEAIWSQSQEVKNQEDEQ
                     DEQEEDALDDPALEILTNFTQCLEIVVSKKSSLDFGDLLVSIIQLHLLQTLDELWPKQ
                     FENKLIHMRRLMTCVGHISAQESNTNKNERETCYENIHKSNNGYKIGAIFIVLTNSID
                     SPKDGSQVSKEISFQELIQAASKLTDPMQAQGFLALFKKLLTVSSAMELKSDIIRELS
                     FVLKKTHDQSTFFKDLSPLLDALLNKMFTVLPSSTVHDSLSDPSSPLLGIVRERDSVI
                     SCLALDKLLVSSKTALTTITEPLWQTACKFQDQVASGEGNISIFYIFQLAKTFGILLK
                     NLESHQELLQDDLKPWITQLLEFVKPLKEKNDQASQSAVNNGKFVATMLLKLLDQNNG
                     TEQDERLQKLAKELL"
     gene            <615925..>616743
                     /locus_tag="ZYRO0F07590g"
                     /db_xref="GeneID:8205288"
     mRNA            <615925..>616743
                     /locus_tag="ZYRO0F07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497481.1"
                     /db_xref="GeneID:8205288"
     CDS             615925..616743
                     /locus_tag="ZYRO0F07590g"
                     /note="similar to uniprot|Q12042 Saccharomyces cerevisiae
                     YPL162C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497526.1"
                     /db_xref="GeneID:8205288"
                     /db_xref="InterPro:IPR022127"
                     /db_xref="UniProtKB/TrEMBL:C5DXT2"
                     /translation="MGVTSQDKCQLLGPTSIVIQLAMGMAIVAGLLLKRNREHPRRKM
                     VVWAYDVGKQLIGALEIHFINLGLSIWQQRGVILFSGNNNNQDDDGQCDWYFLNLLCD
                     TTIGIPILWVILVLIQSILVHLEVTNIESGNYFSSASENKSLSTESKRPLFSAFLKQS
                     SIFVGGISAMKFIIYELLEHYEKGASWFANLLLGWCDHWPNFQVFVVMFVCPVGLNFF
                     QYFCVDNIIKLPTTCVNSQNLENFEPESLEEYLETNVNANTNRGSSHAIYGSLG"
     gene            <617417..>618133
                     /locus_tag="ZYRO0F07612g"
                     /db_xref="GeneID:8205289"
     mRNA            <617417..>618133
                     /locus_tag="ZYRO0F07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497482.1"
                     /db_xref="GeneID:8205289"
     CDS             617417..618133
                     /locus_tag="ZYRO0F07612g"
                     /note="weakly similar to uniprot|Q12254 Saccharomyces
                     cerevisiae YPL163C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497527.1"
                     /db_xref="GeneID:8205289"
                     /db_xref="UniProtKB/TrEMBL:C5DXT3"
                     /translation="MFFPVAFNLLFLFISYATAEYVNATVPCTTVTLSPTYTVQPSTS
                     VSTYNDLTTTIDITNTLYSTMWFTPTTVISSPSVTTTTTEMTTVYETTDLDTTSTITS
                     TITSTREVTFVQPTATSASAAGSSSGSSAPASPASPSAVQAAATYSPGASSIAAAPTS
                     SSSSSAADESTGACTPSVKIVTVSATVTEGSVTVTVTAGASSAPLSSAVTPGSVLPSQ
                     YSQAQINQPLVANGTTTLGA"
     gene            <618348..>620582
                     /locus_tag="ZYRO0F07634g"
                     /db_xref="GeneID:8205290"
     mRNA            <618348..>620582
                     /locus_tag="ZYRO0F07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497483.1"
                     /db_xref="GeneID:8205290"
     CDS             618348..620582
                     /locus_tag="ZYRO0F07634g"
                     /note="similar to uniprot|Q12083 Saccharomyces cerevisiae
                     YPL164C MLH3 Protein involved in DNA mismatch repair forms
                     a complex with Mlh1p to promote meiotic crossing-over
                     mammalian homolog is implicated mammalian microsatellite
                     instability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497528.1"
                     /db_xref="GeneID:8205290"
                     /db_xref="GOA:C5DXT4"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR014762"
                     /db_xref="InterPro:IPR014790"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR028830"
                     /db_xref="UniProtKB/TrEMBL:C5DXT4"
                     /translation="MAHGISKLDPNVSRVLRSQIVAVSLTSAVREVVQNSVDAGATAL
                     QIMVDPFQMSFMVKDNGYGMDPQDLDRVGCQHFTSKIRSLHDLQTLNTFGFRGEALFC
                     IANIAQVTLVSKRSDCNSSWIRDIPYESRLFKDPKGDASYHFSLQPISKEESGTTVLV
                     RNILYNVPVRRRILANDPLFKTLHTLREDLFQVLILRPDISLKVSYLDQLGKLKELIS
                     STNITKDMNHFMKLSQSFSNIFGSVTPIDMFTKVSVKFKGCSVTGLISKCPVRPKEFQ
                     FIYLNGRKYTNQAFQKVINGIFQTAGFGAGGLSDTLIKTVGKPFNNYPLIILDVRCPQ
                     VAEDLMQDPAKDVVSSSHAHLLHPLILRVIKSFLSHQGYMANSSAAVNDLTENNKTIP
                     NTSSPLPSTKFANSVLNSNARMARLKTDKKVDKTSPVTKQIDSGKIKPILDKLKRALP
                     QDKLDIEQIYEKNDCCVPTPYSNGLGHIERLEGMDFKLDRSQLIKAEVIRQVDKKFIL
                     LKIPPNENVAHSMLIIVDQHACDERINLENYLKDFLYQVLEGTLMTHPVSDCAIDIDI
                     TEGYLFRHYEKEFKKWAISCEIKILNLETCFLMVSSLPDVLTIKVQGDKQFLKNALLQ
                     MVHDFKNSEKIPITNMCDRHVFKMSINKFEWWKYLHCLPTMFREIFNSRACRSSIMFG
                     DLLSTPECSLLIKQLAQCHTPFQCAHGRPSVIPLLELSTEGGPSDNFSDYAKNSYLDY
                     DIDT"
     gene            complement(<620604..>622580)
                     /locus_tag="ZYRO0F07656g"
                     /db_xref="GeneID:8205291"
     mRNA            complement(<620604..>622580)
                     /locus_tag="ZYRO0F07656g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497484.1"
                     /db_xref="GeneID:8205291"
     CDS             complement(620604..622580)
                     /locus_tag="ZYRO0F07656g"
                     /note="similar to uniprot|Q08683 Saccharomyces cerevisiae
                     YOR249C APC5 Subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497529.1"
                     /db_xref="GeneID:8205291"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR026000"
                     /db_xref="UniProtKB/TrEMBL:C5DXT5"
                     /translation="MSMSKLKLISSEIECNQRKTMGAESQFKITTSLTPYDVSTLVLI
                     YLYCCHNVKVPMNIFVKLITPTIPSTEINPILEIEKLDLTVDRPLSVHLETLVSYVLH
                     SGQRQLVIQLLSVLNSLDSLDTLTQLLSFLEKECLVKTYRTKKPSSSQGCRSITKTSY
                     LGVYLDKCLIEYHLGSFDDREELWESFMQYLQSFKSTDLWKRLECELKPFEFEFRPTI
                     NDDDDDDSDREMIAWFQSFGKKITSVDKPVILIGERYLRSLLNWELVTVCKTRTKIDP
                     GTRQILAGLSLNDLTHFPAAHVLAYLEAVFDNSYQEAADALHNYFDYMLTQNDENCFH
                     ISLLCLATFHTCMHDGPAAIKAFEEATKVARENKNTGTLNLIMIWVVNFIEIYPEYSS
                     QFQVTVEQIVRYLKFCPDNENSLIFEKAYKFESLLLMMDNADTTLVLESFFKYMAIAI
                     QRLQFGSDFTQVCKYGTKLWETLGQPLLSEVYGAYMKERIQGDEGDQEIHDAFKSLES
                     GDHLTVNKILLKLRSPRLTDDHLKKLKLLEIKYLISTGDYEQAMQRVSESMRDLDTNV
                     MNAEWKFKFQVENCHILLSCGMAVRCLPILKDMLDASMQSKNVLRASESIVLLCATLK
                     QLGKDEESRFLLENNLHVILQYRHLETRAIGLLK"
     gene            complement(<622692..>624038)
                     /locus_tag="ZYRO0F07678g"
                     /db_xref="GeneID:8205292"
     mRNA            complement(<622692..>624038)
                     /locus_tag="ZYRO0F07678g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497485.1"
                     /db_xref="GeneID:8205292"
     CDS             complement(622692..624038)
                     /locus_tag="ZYRO0F07678g"
                     /note="similar to uniprot|Q08685 Saccharomyces cerevisiae
                     YOR250C CLP1 cleavage/polyadenylation factor IA subunit
                     interacts with Pcf11p in the 2-hybrid system
                     cleavage/polyadenylation factor IA subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497530.1"
                     /db_xref="GeneID:8205292"
                     /db_xref="GOA:C5DXT6"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028606"
                     /db_xref="UniProtKB/TrEMBL:C5DXT6"
                     /translation="MESLPGLSDGRALAVEDSNESHTLTIPKGSEWKVERPSEARLTI
                     RIKSGIAEIFGTELANDIEYEFRNFNFSILAVEDVTLEWKCHEMSSQSLQVVPNSTSN
                     LVYNLHFALEKMRCSSFEGPRVIVIGSSGSGKTALCRTLCSYAIKFKPFQPMFINVNP
                     QEGIFSPPGCVTAVPISDILDVQCSTWGQSMTSGATPLHSKQPFVKNFGLERISDNRV
                     LFTKMVNELALVVDDRLANDALVRRSGCIIDTPPLSHLDDDGQELENMIRQFKVNVII
                     AIGDDADEIFEKYSARFMPYVGPNFIRVPKLSGCISTDDVYKRLLQRSAIREYFYGTY
                     KTVLSPYAIGADIGDVNVWKPKNIMELPESEVGVATETEMLPVEVTAGNLQHSLVAIT
                     YADRKSSPVDVEHAPILGFALITEVNEKRNKLRILLPVPGRLPNKAVTLTSYRYLE"
     gene            complement(<624203..>625117)
                     /locus_tag="ZYRO0F07700g"
                     /db_xref="GeneID:8205293"
     mRNA            complement(<624203..>625117)
                     /locus_tag="ZYRO0F07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497486.1"
                     /db_xref="GeneID:8205293"
     CDS             complement(624203..625117)
                     /locus_tag="ZYRO0F07700g"
                     /note="similar to uniprot|Q08686 Saccharomyces cerevisiae
                     YOR251C catalyzes transfer of the sulfane atom of
                     thiosulfate to cyanide to form sulfite and thiocyanate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497531.1"
                     /db_xref="GeneID:8205293"
                     /db_xref="GOA:C5DXT7"
                     /db_xref="InterPro:IPR001307"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5DXT7"
                     /translation="MSFFKLITPKAFVELAQKETSRRVIPVDSTWYLPNLNRNGKQEF
                     LTLDRIPNSVFFDIDAVKDVNSPYPHMVPDLATFNQSMSELGLQRNDVLVVYDRIGNF
                     SAPRCAWTLAVFGHPSVYLLNNYNLYKKLGYPVENDKRTKWSELGPTEYKSDIDLSAQ
                     KVIGYDEMLQLVTSGELSKRFNVFDARTVGRFDGSAPEPRPEMSSGHIKGTQPLPFGE
                     LLEQDSGAFPESPELMKKRFDEALAKLKDNYNPSLPTIAMCGTGVTACIVMAGLEHAG
                     IRDVKLYDGSWTEWVMRSDPKLITKGRD"
     gene            <625246..>626406
                     /locus_tag="ZYRO0F07722g"
                     /db_xref="GeneID:8205294"
     mRNA            <625246..>626406
                     /locus_tag="ZYRO0F07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497487.1"
                     /db_xref="GeneID:8205294"
     CDS             625246..626406
                     /locus_tag="ZYRO0F07722g"
                     /note="similar to uniprot|Q12529 Saccharomyces cerevisiae
                     YPL165C SET6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497532.1"
                     /db_xref="GeneID:8205294"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5DXT8"
                     /translation="MLYHNEELIETVRRSQIVEEMDLMGPISDLFQIQHTPFGGRACF
                     SNTSLPRGTVVLDAEDSLGESISYEFRKEVCHYCLLYDNGKVMKCRINASELEPLGEQ
                     FKGKRFQGAGLWFCSPQCRDEFLRQDHILELISGYESLLNGLLFCQKRGSDEDIDEEK
                     LNSIPIDQQTIEFQWQQLADEWIPRVQGMKPSKKLAQLPHMTDDIYCCARSICRTLFQ
                     LKYLDPESVTNRSFQVLQSNELSKTSRFPILLSFQIAVYQTLYILLPPTLHSQLSIPK
                     FRHILGAEYGNAFGIWQMGESVGDREYLGYWLFPRASFFNHSCDPNVDKVRKGRKMCF
                     ILNRDVTSGTQLCIAYNCDLTLPVSGRQQTMKDNWFFECMCDRCSSELQTVH"
     gene            complement(<626383..>626976)
                     /locus_tag="ZYRO0F07744g"
                     /db_xref="GeneID:8205295"
     mRNA            complement(<626383..>626976)
                     /locus_tag="ZYRO0F07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497488.1"
                     /db_xref="GeneID:8205295"
     CDS             complement(626383..626976)
                     /locus_tag="ZYRO0F07744g"
                     /note="similar to gnl|GLV|KLLA0C09933g Kluyveromyces
                     lactis KLLA0C09933g and weakly similar to uniprot|Q12092
                     Saccharomyces cerevisiae YPL166W Protein of unknown
                     function green fluorescent protein (GFP)-fusion protein
                     localizes to the cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497533.1"
                     /db_xref="GeneID:8205295"
                     /db_xref="UniProtKB/TrEMBL:C5DXT9"
                     /translation="MNNQNTVVYVKLKGKRPEGFINPPKFEWNLDKERQLWAIVSKLE
                     NYQDQIDWQGLSHTLDVPDYFLKKRSYKLFAKRLKLLEQQIERKIKIDNDGKPQESTT
                     QIGPSLSFDDENTTTDDQRSLEENANANILEKTTMRTLQQLHTSKILSRPRLPSSNGR
                     DTRNGSQNQSNSDSESSSSLSVSNSALEEALMDRLKL"
     gene            <627169..>631617
                     /locus_tag="ZYRO0F07766g"
                     /db_xref="GeneID:8205296"
     mRNA            <627169..>631617
                     /locus_tag="ZYRO0F07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497489.1"
                     /db_xref="GeneID:8205296"
     CDS             627169..631617
                     /locus_tag="ZYRO0F07766g"
                     /note="similar to uniprot|P14284 Saccharomyces cerevisiae
                     YPL167C REV3 Subunit of DNA polymerase zeta which is
                     involved in DNA repair required for mutagenesis induced by
                     DNA damage"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497534.1"
                     /db_xref="GeneID:8205296"
                     /db_xref="GOA:C5DXU0"
                     /db_xref="InterPro:IPR006133"
                     /db_xref="InterPro:IPR006134"
                     /db_xref="InterPro:IPR006172"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR017964"
                     /db_xref="InterPro:IPR023211"
                     /db_xref="InterPro:IPR025687"
                     /db_xref="UniProtKB/TrEMBL:C5DXU0"
                     /translation="MSRQEPSSLDFISPVNPDWMHLQLNDYDFYTTRPSSLDTAHGNS
                     LPMNQYSSVPVIRIYGCLPSGHQAVCHVHGIFPYIFIGYDGKKQDSSTDMNHRCAKLH
                     RLLESKCQEFAGKNEKVPSGQPLGALSYIANVSVVKAVPFYGFHVGWSLFYKISLLNP
                     GLVNKFSDWIRDGKMFGKRVESYETHLPYLLQFSVDFNLFGCSWMDFNQCYFREPLLN
                     PILSLDVLLMNQDLKTILRRFYHPNSNALCKKDFPRMGNGLLEIDIIPQYIRNIDNLQ
                     FTGESHDSSGTSREELSKPYVTSTKNIVRDISMQRKAMSLEPFKDPPSLERYDINDHW
                     QSSDSFASAFKNFTQKLNQNPKNEHFGDDSSLFTHVNKPHELLSELWPSRPTAIPSAV
                     TESNNEVEDGLIDTLENDYVIVNSSDTENDDKGLEENDSPLAEEYQQNHSTVPVPDGE
                     VPAPGGEIPPLSMDVAMTQKMAKKRKFTFTQTATHSNVKVQKRKPKKIGIRYERNAYR
                     FKNPPVDYSSTLPGLEDLGFPKQDYIDPFFGDPKDLKSKPYVYAGKRFEIGSTHLSCR
                     IPMTFEEENIVEGKVRSGNVFHSWKYLRRPPEFQTVKHETESMRRTKSFISQIERSSF
                     QRKAIIREKNNAPEEKSSIFSPNTLTHFSMEIHVETEGSKKPDPVRNEVKMVVWCLEK
                     ESFPFDLDISHEGILAVVDQTAEPHLANHIVQGAGDVPVAFYKTEMDMFDALTDLVLF
                     FDTDILSGFEIHDGSWGYIIERCRKHYGIEISEDFSRVNSNLKNKARDRWGFTHASGI
                     MIAGRHMINVWRSMRSELNLTQYSLENLAFELLDERIPRFSFQALTQLWRNRQHPSNV
                     KTVINYWMTRVRMNIRLLQKQDYIARIVEQARLTGIDFYSVYYRGSQYKVESILFRLC
                     KQEDFLSLSPSRKQVKNQRALECVPLVMEPESAFYKSPVVVLDFQSLYPSIMIAYNLC
                     YSTMVGRVRDLDFKNELGVTKFPFPKNAFNTLEEHTRITANGIVYVKSSYRNSTLARM
                     LEDLLYTRRLVKKTMSDVGSKNSSLQKLLNRRQLALKLIANVTYGYTSASFSGRMPCS
                     DLADTIVQTGREILEKAIEFIEANEKWGAKVIYGDTDSLFIYLPGKCRYEAHNIGEEM
                     ATEVTKRNRSPISLKFEKVYHPSILLSKKRYVGFMYELPSQLQPIFDAKGIETVRRDG
                     HPAQQKIVKKCIQILFRTKDLSQVKKYVQEQFVKIHQSKVSLQDFCFARGVRLGSYKS
                     EKTAPPGAVVATRQKEHDHRSRPQYKERVPYVVARGSVGQILRDRCISPEEFLTDETL
                     ELDSDYYIEKTLVPPLSRLFNIMGVNVAEWAFEVTRNQSSPAHREAKNIEKVILNLSC
                     INCGNDTTTKSQLCEKCQMESLQTSGNLLERRNYREREIKTINTVCRICSYRYTQDAG
                     EMGGQVASLCESHDCPVYFSRVKAAGYINSTVNRRIAEALNSINHW"
     gene            <631796..>632362
                     /locus_tag="ZYRO0F07788g"
                     /db_xref="GeneID:8205297"
     mRNA            <631796..>632362
                     /locus_tag="ZYRO0F07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497490.1"
                     /db_xref="GeneID:8205297"
     CDS             631796..632362
                     /locus_tag="ZYRO0F07788g"
                     /note="similar to uniprot|Q08687 Saccharomyces cerevisiae
                     YOR252W RBF17 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497535.1"
                     /db_xref="GeneID:8205297"
                     /db_xref="InterPro:IPR021346"
                     /db_xref="UniProtKB/TrEMBL:C5DXU1"
                     /translation="MPVTKSLGKLQKQMRSKGRSHVHPNGRKHKQLTRATIRESNIAA
                     KKQEFQKRKTYELARVKYLQEVTNSESFKERSTFSLEETAVFLQEFIQRDNEELEELK
                     KNRRSNRPPSNRQLLLQQKYDREMEEFKKGFLCPDLTDKQNVVTLRNWNGTFGTLNAL
                     KTIRVNNEGKQMIGGNTSFTMNTDVEMQ"
     gene            complement(<632383..>633561)
                     /locus_tag="ZYRO0F07810g"
                     /db_xref="GeneID:8205298"
     mRNA            complement(<632383..>633561)
                     /locus_tag="ZYRO0F07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497491.1"
                     /db_xref="GeneID:8205298"
     CDS             complement(632383..633561)
                     /locus_tag="ZYRO0F07810g"
                     /note="weakly similar to uniprot|Q12467 Saccharomyces
                     cerevisiae YPL168W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497536.1"
                     /db_xref="GeneID:8205298"
                     /db_xref="UniProtKB/TrEMBL:C5DXU2"
                     /translation="MSITWDRFSSNCLSKLCRGYAKSVKKPVSWKLVFDQRTPRPQAI
                     WMFKQKLSESVENRSLAYTSDPHIREALNTLIKRSSISELSFEKSIQSLYKLILQRRV
                     PDDEVYDAISQVSAKEVVNVAIPPSSSSKDIDSDQERPSLHIHPEQRDHLGEVIKEIG
                     NHGKPVTKGDLFQNQEVKPESSSSHSHIDVGSLQKYLHKAEQGKNQKRYAWEGSRRYN
                     WDRNLNDSPRLTAGNLIFASRSKPLRRSASKVLQRSTGKTRHDSQAQKKPKDLLIYNL
                     GRRTKIVLPASHTNSIFNINYRDLFGVINGSGRAPEETLAVINQLETEGWQLIGDLYD
                     NSENVVFQRTAGSTGESESRIPYKIPVISVATILTGLGIYYAIESRKRLKEPDYHQHV
                     "
     gene            <633692..>635716
                     /locus_tag="ZYRO0F07832g"
                     /db_xref="GeneID:8205299"
     mRNA            <633692..>635716
                     /locus_tag="ZYRO0F07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497492.1"
                     /db_xref="GeneID:8205299"
     CDS             633692..635716
                     /locus_tag="ZYRO0F07832g"
                     /note="similar to uniprot|P53118 Saccharomyces cerevisiae
                     YGL144C ROG1 Protein with putative serine active lipase
                     domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497537.1"
                     /db_xref="GeneID:8205299"
                     /db_xref="GOA:C5DXU3"
                     /db_xref="InterPro:IPR007751"
                     /db_xref="InterPro:IPR016445"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DXU3"
                     /translation="MGHSDATDVLYHYKSALKVGEVERYVITYDLYDGDEIPTDISLD
                     SLWLKVKNLENLTHRAAYLMGPFILYCDVRTEDYHHSNKIYASVDRPKYEPNLQAQQR
                     CIAELSLHQIKKRYVWIVDVVSQILFSTVSQIAFEITIGKTKQALDEKVDGLIENGSL
                     SNQLTVSRLTTLDLWNLPHQLQMKKKVKHLVILTHGLHSNVSTDMVYLMEEIYKAQAN
                     YPDEQIVVKGYTGNVCQTEKGVKYMGTRLAKYIAEELYEESVGKISFIAHSLGGLVQT
                     FAISYIAVKYPWFFQRVRPINFICIASPFLGVVTDNPAYVNLLLSFGVIGKSGQDLSL
                     EKEPHSGAPLLYLLSGDPFKSILVKFKRRTLYMNAVNDGIVPLYTASMLFLDYEEVLR
                     KLKELENNQTTLQADNAGVIHQEDFVGKHLISPFNKFVSMLAPQKFPGDISKIPKQSF
                     LESAMSTIIPPLPDQSFILDPGSRKPVIVHDKIYTEKDIPPMLSEAEDTYKHSKNILL
                     EPFTIRRKDKGKSLEETIARRWHEGVSWRKVVVSLKPDAHNNIIVRRRFSNAYGWPVM
                     DHLIEAHFNGDDNNDYTHCNYLENSEELIPQDQSGHMLEPNKDYAWITRVENARLFDE
                     GPTGMISTVGEILDTFSRKTFYEHAQNDDSNGGNIEHNGFNTFELENGSI"
     gene            complement(<635767..>637884)
                     /locus_tag="ZYRO0F07854g"
                     /db_xref="GeneID:8205300"
     mRNA            complement(<635767..>637884)
                     /locus_tag="ZYRO0F07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497493.1"
                     /db_xref="GeneID:8205300"
     CDS             complement(635767..637884)
                     /locus_tag="ZYRO0F07854g"
                     /note="similar to uniprot|P33891 Saccharomyces cerevisiae
                     YGL145W TIP20 transport protein that interacts with Sec20p
                     required for protein transport from the endoplasmic
                     reticulum to the golgi apparatus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497538.1"
                     /db_xref="GeneID:8205300"
                     /db_xref="InterPro:IPR007528"
                     /db_xref="UniProtKB/TrEMBL:C5DXU4"
                     /translation="MMLLKNQHIVHKTTLFCKIFWHIVGSSSYIAMVLSSFDDLLNVD
                     TRIDQINLERDALAVQLSSARNKLEKSWKQNSGNGSDKTQFEAIANDISANATSLSDV
                     VTLREKYGDLQVLLQLQNLFEDQERADNNLERLQNLETEINELCELESSKLSIDKLKE
                     LHSELQSTKFGVEKSQFAKDIYSKFEEKLVARKAQELVEKFNAFLLEHKWDTPMFAPL
                     STQSMTSLRDQSATLYQLSQLYVVGEKPSILWNFKSIANNFTVRFTYHFHDVSFKIET
                     YFKFLKEYLGENMHKCTSIFHDEDNGLTRQLVHEQFINYVLQPIRDRINTILFQNDQS
                     TLITLISQIISTDKELSHSFHYHGEGLASLVPPRIWDKWLNYEVHVAMTQLTKIVSDP
                     SNLDKSASEFVKLINKMYEYLEPFYSLESGEILQKYKLLTCSQIFMRLLSSYLDFVLK
                     VDIIADRLPEEQLYQTFIKLQNCNVVSRRISELSLEYIFVHLTDIVNQRENKNYDSIL
                     QNVQESYQQIIENGNQGTIVHRIQKLLKESLKNYFKSGNWCLQNGPLDGDSPSSELVN
                     SIKLMTRIMTKLDSLLIPLEVALDIKSQLLNVIVNYFIESILKLNKFNREGLEQLKVD
                     FYALKASLNLPETVCNSQVAVLTEIVKILYLKYDDSSEMFIDTSYIKERDYTKLRSYH
                     GIKLLRDSEIQDALYRVAYGNVV"
     gene            <638451..>638873
                     /locus_tag="ZYRO0F07876g"
                     /db_xref="GeneID:8205301"
     mRNA            <638451..>638873
                     /locus_tag="ZYRO0F07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497494.1"
                     /db_xref="GeneID:8205301"
     CDS             638451..638873
                     /locus_tag="ZYRO0F07876g"
                     /note="similar to uniprot|Q12513 Saccharomyces cerevisiae
                     YDL110C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497539.1"
                     /db_xref="GeneID:8205301"
                     /db_xref="UniProtKB/TrEMBL:C5DXU5"
                     /translation="MSAGGIRRPIQIEEFKTAIGDMPSDELARIRNELGNSIRHLERS
                     NARLEKYIAKIEGRPKNSPEVDSGDELESIEEGDLQLYQESLRENQTVLNNYNERIEA
                     LDQENLYRSSHKGNGSTVPPTPKTNVTTANRGAEGIYL"
     gene            <639147..>639911
                     /locus_tag="ZYRO0F07898g"
                     /db_xref="GeneID:8205302"
     mRNA            <639147..>639911
                     /locus_tag="ZYRO0F07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497495.1"
                     /db_xref="GeneID:8205302"
     CDS             639147..639911
                     /locus_tag="ZYRO0F07898g"
                     /note="weakly similar to uniprot|P53117 Saccharomyces
                     cerevisiae YGL146C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497540.1"
                     /db_xref="GeneID:8205302"
                     /db_xref="GOA:C5DXU6"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="UniProtKB/TrEMBL:C5DXU6"
                     /translation="MLYCVWVILLYWRLIAPVVGLDNGDADTLNFKVEPVKYSNYDST
                     YDRFCFTMELSPTEELTSNVLFTFYVLDVLPFATDAGRFGGTSKSRGRQALHMSIKDP
                     ISGNLLRSTRNLKSGVTHVELNAGDSHKLDVCLANLVYDSSWSSLDIWEFVAVQLKTK
                     EQLAWSKLGSLQEEYQVQQDVDNCMNKISHTINGEIFQELRSTETEHRNINESLCNAF
                     VITLIVMIAFISSPPVILAYYCIKYKGFPGVRSPRA"
     gene            <640110..>640907
                     /locus_tag="ZYRO0F07920g"
                     /db_xref="GeneID:8205303"
     mRNA            <640110..>640907
                     /locus_tag="ZYRO0F07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497496.1"
                     /db_xref="GeneID:8205303"
     CDS             640110..640907
                     /locus_tag="ZYRO0F07920g"
                     /note="highly similar to uniprot|Q12277 Saccharomyces
                     cerevisiae YDL111C RRP42 Ribosomal RNA Processing
                     Component of the exosome 3->5 exoribonuclease complex with
                     Rrp4p Rrp41p Rrp43p and Dis3p (Rrp44p)."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497541.1"
                     /db_xref="GeneID:8205303"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DXU7"
                     /translation="MPLSIAEKSYLYDSLSSNAGTRPDGRLPHQFRPLEVYTDFLPSS
                     NGSSRIIASDSSECIVSVKANVVDHQVQQDLFQVEVDIAGQRDDSSEVETLTSLLNRV
                     LESRGSIDASKLKLTRKYSYKLFIDVLVISSSSHPVSLISFTIFSALNSTYLPKIISS
                     FDDLEVEELPTFHDADMVKLDVSPPLVFILAVVGENVFMDAAANESEVADNGLIITWS
                     GDKIVAPIRTVALNNSDVKGFNPLVLQRGIQMVQQYAGDVVRAFANL"
     gene            complement(<640952..>645256)
                     /locus_tag="ZYRO0F07942g"
                     /db_xref="GeneID:8205304"
     mRNA            complement(<640952..>645256)
                     /locus_tag="ZYRO0F07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497497.1"
                     /db_xref="GeneID:8205304"
     CDS             complement(640952..645256)
                     /locus_tag="ZYRO0F07942g"
                     /note="similar to uniprot|Q7LGS3 Saccharomyces cerevisiae
                     YDL112W TRM3 2'-O-ribose methyltransferase catalyzes the
                     ribose methylation of the guanosine nucleotide at position
                     18 of tRNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497542.1"
                     /db_xref="GeneID:8205304"
                     /db_xref="GOA:C5DXU8"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:C5DXU8"
                     /translation="MTVSDNGSAIISQYLGYDEQIKIVSRLVEEDQLSQVLGVLNIIS
                     IDFSGRSDLIDTLFENVRSKLLQQMESLDSKSFTGYGDSAYNELISDKELRVVAQLIC
                     KIEPLWYRFESWIVQELESYVARDHKKLFENVLYEQLVDTQGRENGSECDLNEVDTIF
                     LLKFLETVYSFGVEISKAEKLDDIILLLLGCNVEILAFTASGILRWRIDHIARRALKD
                     SHFDQVVWTLIKQYVDDGMNRDWKLRSALIFTLRFLLVSEPSSQLVTLLKTGEYWQNL
                     QFALSHKVQEYRKLGICVLRLTIEKLASLPISFETDIFTWDPAHKDEYLKIWDNFTTL
                     YEIVALETALNQIQAATSQILNLFANHILHPTWGLILLSTGLKATMDSVRKYMVSMLF
                     MIDDKSVFTSNVKALKKTFLPAALEAHYFTVKGSSCPYGERFSNWITSIISQSKENAS
                     VAISVSLEYLVEQPTLFDPSRVYLTFGIINSLKGKNSRLISPYHLELIKKLFEVESEE
                     GIVETTLQTMNLKFLLHTDYSTSPEAWIQTISSHVKNNKNGYKFFAPLIEDFIDFAIA
                     YFKTEDIDESFASWVQVDETFGLLSVLILGYENISITRPLIFELSKSGICKDEFNSKA
                     SEALSGLLAGDENVESYEGADVLVDYAGFNSYTWKSIKLDKLYGSLLKEFSESKFKFL
                     VTVYEKTFDNDAELLELTWSNLKQLYNIVKDFLGGSRDFKFKDEIYGTYMKFLFIHLK
                     AFPVNWEGYDKKGDEVTELLSLLSSNVTNENGNYKGNLYISKLCTYVLDSYVTVGKGV
                     ADNNNWNLLSAVINVFLAIWEEVFSERLILNQKNLHDALIEGLFHPTVLYYATENSEK
                     GAGLAAIISNCGQGIIDQAYTRRGYLPLLAQNINEFIRSNAEKLDDNKADYWWLINLI
                     LGILSSTQMNVNIFFLRPVIAELYDKKINLYQAGGKSLYEQVYGPEEISAKVLIIDTF
                     LYCGAHFKEQALVKAARSTNLLFPKKQTDGIEEIKRVQTWQLLLLGIKVYDKSLLFNF
                     VKDSVLPSLSDDISPLVRAYKEWFTAYVIADHYEEGKTNVVEDLVFSSMDDQTKPAVT
                     VSHERIAFLVLVGLTSANSDCPQRLLNRFMGSVISNATSNKPLVRHFSNSLMLSFWPS
                     FSQFITNETLKQIIHQLYLGAEQLRIPGKYRVGDANTWNIYEDLNLTGVFGGVLRRTS
                     SAEVPYFSEGLFNKYLSYKGWTIGTDDTSSFLIRRIDQEHSNGEFAPDSSSQLQMKSG
                     AWKTLMDIDNSKPEKTVNRSDLIVVASLVDKAPNLGGICRLCDVLGVGLLTVPNIKVK
                     NNPQFKNVAVTADRWMPIEEVTPQDITSFMKQKKQEGYTLIGLEQTDKSVKLDDHYKF
                     PAKSLVVLGTEAHGIPGHLLSELDLCLEIRQFGVIRSMNIQTATAVIVHSYTVQHM"
     gene            <646060..>647964
                     /locus_tag="ZYRO0F07964g"
                     /db_xref="GeneID:8205305"
     mRNA            <646060..>647964
                     /locus_tag="ZYRO0F07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497498.1"
                     /db_xref="GeneID:8205305"
     CDS             646060..647964
                     /locus_tag="ZYRO0F07964g"
                     /note="similar to uniprot|Q07528 Saccharomyces cerevisiae
                     YDL113C ATG20 Protein required for transport of
                     aminopeptidase I (Lap4p) through the cytoplasm-to-vacuole
                     targeting pathway binds phosphatidylinositol-3-phosphate
                     involved in localization of membranes to the
                     preautophagosome potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497543.1"
                     /db_xref="GeneID:8205305"
                     /db_xref="GOA:C5DXU9"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR015404"
                     /db_xref="UniProtKB/TrEMBL:C5DXU9"
                     /translation="MDKFDEVATNSHHGEENVESNVTKQEESEDTDSPAEVVNSQGKR
                     DEEDRSNEDNEDDGEDNYASEMVHTAITEKDNPFIEQNTTEEDKQMEQSSSQNHVSTK
                     KPGKQQLVNPNEVYQDDMDDILPLDDRRHSSAAQNSSCDDSISSMKHSPPNGSREVDG
                     DNTQMRNKVQILETNKLSEGQGRTYVAYTIKYGEAIVKRRYSDFESLRNILIRLFPMT
                     LIPPIPEKQTIKTYGKAIAGSKSTYLLPSESAGSVDLSLSVINGPVNNSDERLIRHRI
                     RMLTGFLNKLLQIDEITKTSIIADFLDSNNTNWCDFITSSATFSSLPKSVLQCNPLDP
                     TNTTKVHSSLPIPYSSPQLLNKDGSTDSRDGFTTIEHDYKRYEFILNNGLYKYNRRIT
                     KNMHDLKYSTKELSDAFGEFASNQSRGADLAEQLSHTSDAFEETSAELETIVGRLYYN
                     INEPLSECVHMAGSARDLIKYRKLKSIQLDMVKKSLVTKKSHLEKLQEQEKELKKVDD
                     EISQEMVKGQRINLEHPQPRSYSGRLFNKFSKLANIVKESVNYQDPDVHTTIATLKAD
                     IAQLEESLKVCEGDLEVITSVIRDQQLKQFSEERERELAEILKNYSKYYREFAEKQLK
                     LWQDVKTNQA"
     gene            complement(<648180..>649040)
                     /locus_tag="ZYRO0F07986g"
                     /db_xref="GeneID:8205306"
     mRNA            complement(<648180..>649040)
                     /locus_tag="ZYRO0F07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497499.1"
                     /db_xref="GeneID:8205306"
     CDS             complement(648180..649040)
                     /locus_tag="ZYRO0F07986g"
                     /note="similar to uniprot|Q07530 Saccharomyces cerevisiae
                     YDL114W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497544.1"
                     /db_xref="GeneID:8205306"
                     /db_xref="GOA:C5DXV0"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="UniProtKB/TrEMBL:C5DXV0"
                     /translation="MYRFAVRCKEDVEEFVAPTFGRISLNRETIALVTGGSKGFGWQL
                     VQKLALKGIRVIIADLGPPSVDLNPNGNIVYYPCNVAKYEQIKELHKTIIKNHGIVTL
                     LFNNAGITCISPLQETSDSDIHKVIDVNYIGAYMMIQTFLPGIIEIGQGYIVNVASVL
                     GIASPASLTSYGASKGGLIAYHNSLSQRLKRIKMRPVKTLLVCPGKLRTEMFANVQTP
                     SKLLAPDVDPAELASQIINAIDHNSTRTLNSPYYVNLVPFIKNLNWPYLRILKNLSGM
                     DKSTAAAARD"
     gene            <649457..>650488
                     /locus_tag="ZYRO0F08008g"
                     /db_xref="GeneID:8205307"
     mRNA            <649457..>650488
                     /locus_tag="ZYRO0F08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497500.1"
                     /db_xref="GeneID:8205307"
     CDS             649457..650488
                     /locus_tag="ZYRO0F08008g"
                     /note="similar to uniprot|A2TBP4 Saccharomyces cerevisiae
                     YDL115C IWR1 Protein of unknown function deletion causes
                     hypersensitivity to the K1 killer toxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497545.1"
                     /db_xref="GeneID:8205307"
                     /db_xref="InterPro:IPR013883"
                     /db_xref="UniProtKB/TrEMBL:C5DXV1"
                     /translation="MSEAPEFIRVKRRRDEDSVQALLVDEGQKKRKKGRFIFKLARTV
                     NSDSYENADEALTPLLKLAANDHRHFVLEREGKRRRDSDDVEQVPPVGKPAKVSHLED
                     HQKEADDLPPEINQMVSDILNLNKNDKGEQNRPRKPSKKHFGGSNREVVSLPSNDYIY
                     DIYHLESLKDDDLNSYKYEDLGFVKIVNKFIDLVPDEDTDPEQCSDDEDSNEENYYQN
                     DYPDDEDDDRSIPLGSEADEESLPEEITWKKQPQDDYAELFDKLGQSDNILDSLNTSN
                     LVNLDADDDDDDEDWHEDLDDEEFENDNYDGRNGYKANEFFPTDKDDSLAAHRDKIFG
                     RLEKLLNKG"
     gene            <650830..>651402
                     /locus_tag="ZYRO0F08030g"
                     /db_xref="GeneID:8205308"
     mRNA            <650830..>651402
                     /locus_tag="ZYRO0F08030g"
                     /product="60S ribosomal protein L9"
                     /transcript_id="XM_002497501.1"
                     /db_xref="GeneID:8205308"
     CDS             650830..651402
                     /locus_tag="ZYRO0F08030g"
                     /note="highly similar to uniprot|P05738 Saccharomyces
                     cerevisiae uniprot|P05738 Saccharomyces cerevisiae YGL147C
                     RPL9A Protein component of the large (60S) ribosomal
                     subunit, nearly identical to Rpl9Bp and has similarity to
                     E. coli L6 and rat L9 ribosomal proteins and to YNL067W
                     uniprot|P51401 Saccharomyces cerevisiae YNL067W RPL9B
                     Protein component of the large (60S) ribosomal subunit,
                     nearly identical to Rpl9Ap and has similarity to E. coli
                     L6 and rat L9 ribosomal proteins"
                     /codon_start=1
                     /product="60S ribosomal protein L9"
                     /protein_id="XP_002497546.1"
                     /db_xref="GeneID:8205308"
                     /db_xref="GOA:C5DXV2"
                     /db_xref="InterPro:IPR000702"
                     /db_xref="InterPro:IPR020040"
                     /db_xref="UniProtKB/TrEMBL:C5DXV2"
                     /translation="MKFIQTEQFVQIPEGVSVYIKARTIKVVGPRGTLFKNLKHVDVS
                     FSRVSAKLIKITVHNGDRKHVAALRTVKSLVDNLITGVTKGYRYKMRYVYAHFPINVN
                     VVEKDGKKLVEIRNYLGDKQVRHVPVREGVKIEFSTTQKDELILEGNSIENVSQNAAD
                     IQQICRARNKDIRKFLDGIYVSDKGVIQDL"
     gene            complement(<651601..>653226)
                     /locus_tag="ZYRO0F08052g"
                     /db_xref="GeneID:8205309"
     mRNA            complement(<651601..>653226)
                     /locus_tag="ZYRO0F08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497502.1"
                     /db_xref="GeneID:8205309"
     CDS             complement(651601..653226)
                     /locus_tag="ZYRO0F08052g"
                     /note="similar to uniprot|Q2XN15 Saccharomyces cerevisiae
                     YPL030W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497547.1"
                     /db_xref="GeneID:8205309"
                     /db_xref="GOA:C5DXV3"
                     /db_xref="InterPro:IPR011671"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DXV3"
                     /translation="MSMNRAQFKFNLDSKSILGEQWHSMYSTRETVKFDKAHFETAMM
                     NVIREPNINSSAILRADILQEVLCDSNGNKRTLKKCQDKELEISDPEAKKLGVDDFDV
                     RFPPINPELDLYCSTEIVRRIIPRNPYKDAIMNQTCLILNGLKDESTSLVIYIPHTQE
                     GDECPFYIPHVKAVAIFLHDKTLSVHYISFKNNTEQLRNESERVVRTAWRLLETAHKH
                     SMGVMQGYQKRVRHDLVVNKVDFQDRYIALKKKYSTHLVDNWQESTDPRKHVFEDIAI
                     AAFLIALWTKMHGPNFREKMQFRDLGCGNGILCYILLSEGIKGLGIDARHRKSWSSFP
                     PEIQACLKEQIIIPSILVRPHPEVKKRLPHLEHNGGIFPVKVAHEVIAPATVVYTSED
                     LLSSPKVNVTEFPENTFIIGNHSDELTCWIPLLGFPFMVIPCCSHNFSGQRVRFNVRK
                     SVKSSNSTVGNSTYAGLVDHVTCIANRVGWKVDQEMLRIPSTRNAAVIGCENDQLKNF
                     PTQEVYDVIMEDGGPNGWIQNSMALMKRNPRNH"
     gene            <654009..>655004
                     /locus_tag="ZYRO0F08074g"
                     /db_xref="GeneID:8205310"
     mRNA            join(<654009..654025,654107..>655004)
                     /locus_tag="ZYRO0F08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497503.1"
                     /db_xref="GeneID:8205310"
     CDS             join(654009..654025,654107..655004)
                     /locus_tag="ZYRO0F08074g"
                     /note="highly similar to uniprot|P17157 Saccharomyces
                     cerevisiae YPL031C PHO85 Cyclin-dependent kinase with ten
                     cyclin partners involved in environmental stress response
                     in phosphate-rich conditions Pho85p-Pho80p complex
                     phosphorylates Pho4p which in turn represses PHO5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497548.1"
                     /db_xref="GeneID:8205310"
                     /db_xref="GOA:C5DXV4"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DXV4"
                     /translation="MASFSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEE
                     GTPSTAIREISLMKELKHDNVVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNP
                     QGLELNLVKYFQWQLMEGAAFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGI
                     PVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDMWSCGCILAEMVTGKPLFPGTNDEEQL
                     KLIFDIMGTPNESTWPGVSSLPKFNLNFPQKLPRDLRSILQVCSKEPLDDNLIDLLHG
                     LLQLNPDMRLSAKQALHHPWFAEYYQHV"
     gene            complement(<655021..>656016)
                     /locus_tag="ZYRO0F08096g"
                     /db_xref="GeneID:8205311"
     mRNA            complement(<655021..>656016)
                     /locus_tag="ZYRO0F08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497504.1"
                     /db_xref="GeneID:8205311"
     CDS             complement(655021..656016)
                     /locus_tag="ZYRO0F08096g"
                     /note="similar to uniprot|Q03787 Saccharomyces cerevisiae
                     YDR249C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497549.1"
                     /db_xref="GeneID:8205311"
                     /db_xref="UniProtKB/TrEMBL:C5DXV5"
                     /translation="MGYAIAGYPTRKRRGHRHKVKLLKHGKEDKLTNKRRKRDDGKVS
                     IGMSELPVEIIQRIFIMSGNAAMYELNKFYHTILVPSTSLLSSMVWENYVWDPLQYGI
                     ELNEEDDDDNRHDGQKVLLMLETVFNVNAFWNYLTANMEILDSISRFIPTAVYQDFMS
                     EGDSGKVVQWWEQDGLMDFPQVFYANFELFVYNRNFIRSLSRFFILKDPYIHLNELIH
                     WFYDRNNNDDDDDDDELFFETVGLVLEIAKVEDGGIYSSEPLESLLDVLFVQNKSNKP
                     IQTFTKFLNLFYSRENAQEHLSDPSLWRLLRSTSNMTVIDIVVNHGGQPHYGAFF"
     gene            <656847..>659696
                     /locus_tag="ZYRO0F08118g"
                     /db_xref="GeneID:8205312"
     mRNA            <656847..>659696
                     /locus_tag="ZYRO0F08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497505.1"
                     /db_xref="GeneID:8205312"
     CDS             656847..659696
                     /locus_tag="ZYRO0F08118g"
                     /note="similar to uniprot|Q03088 Saccharomyces cerevisiae
                     YPL032C SVL3 Protein of unknown function mutant phenotype
                     suggests a potential role in vacuolar function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery cytoplasm bud and bud neck"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497550.1"
                     /db_xref="GeneID:8205312"
                     /db_xref="GOA:C5DXV6"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="UniProtKB/TrEMBL:C5DXV6"
                     /translation="MSSLLRVLVVGDNSNTLLYASRFRLAKSVELYHVSENKSNHFEV
                     DTLAYGHDSFQLDNHFTSVAHLEEAMKQSGETGVIFDLIILSAMSLQEMSSLAMQLNP
                     MININSKIFLESSGFVQLEQFVKMSMDLPQLNIFSIVTDYDLREVRPNQYKQFAAPGA
                     QNCIYLGDSSSISSKKQSSVGASPAKYPKSVGTLLATFQKLFEKLFPQDKIDLCNGSQ
                     ADFLSTMWTMAIPKICFDPLLILLEETDPQQLNHQVLAKPLISGLVTEVITILKSMGG
                     KLPTHLESETELLAHWQSSYAGTGEMPAAVYHFVNRTSPLNIDMLLLQPILLADDYYI
                     KTPYLEFLYSLMCQYQKLNDGSSKWFVRRETDELQNGGSNNIAVLTDENEHLQSQLVE
                     VREQLAEKDSHLRKMEATAQQSGSQVQALQNQIASLREVIVGQSQKHDALTQELRQAQ
                     QQAQQVAPLQQLRDVNGSNEQEGSFTSAVGEPPRETTNNNPYSENYESSGTPDLRDIE
                     NFALLGVSYGDTPQRDASKQEQQQQQQPQQRAAPVHPTQHTPPPTATNVNGVNGVPAH
                     STATGGTSDLDRSLKERELEIRRKELELQEKELNFQKRAVQQQQHRQHKYAGVAAPVG
                     GPVAGGGPPSPTLGSSRKPSHPQLQQAPGLRSNRTMHGATPGGFGPGGGYGDPMTGVN
                     GKPPRATAGPSGYGLQAAAPSQPQGHYPPHAIKPTSRKNRHSNMPTIGNASSVGFRDY
                     SRPTASAGAPVVSSRVNSMSTGNLQSVPVPKSVRQSSVPGMNFPGNGSNPRLATNGRA
                     PGIIGPSSTGAGNNGVPGTTGNELNKSFGSANSGTDPTHLTPDDSQNSVAHHMNGNSS
                     NLQVPELNNSENNGSSGPQPPILQVNGTEPEKPVEINTTADTNEASEINDEKDVASTG
                     AASVAGGGDENAGTGEKGKKKKFGLFGKKKNKSKK"
     gene            <660119..>660610
                     /locus_tag="ZYRO0F08140g"
                     /db_xref="GeneID:8205313"
     mRNA            <660119..>660610
                     /locus_tag="ZYRO0F08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497506.1"
                     /db_xref="GeneID:8205313"
     CDS             660119..660610
                     /locus_tag="ZYRO0F08140g"
                     /note="similar to uniprot|Q02642 Saccharomyces cerevisiae
                     YPL037C EGD1 Subunit beta1 of the nascent
                     polypeptide-associated complex (NAC) involved in protein
                     targeting associated with cytoplasmic ribosomes enhances
                     DNA binding of the Gal4p activator homolog of human BTF3b"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497551.1"
                     /db_xref="GeneID:8205313"
                     /db_xref="InterPro:IPR002715"
                     /db_xref="UniProtKB/TrEMBL:C5DXV7"
                     /translation="MPIDQEKLAKLQKLSSNNKVGGTRRKMGKKTGSSASSNKDDTKL
                     QAQLAKLHAVTVDNVAEANFFKDDGNVMHFNKVGVQVAPQHNTSVFYGLPQEKGLQEL
                     FPNIISQMGPEAIQALTQLSAQMQQAQQVQKPDADAAAGAEKKDEGIPELVEGQTFDA
                     DVE"
     gene            complement(<660746..>661294)
                     /locus_tag="ZYRO0F08162g"
                     /db_xref="GeneID:8205314"
     mRNA            complement(<660746..>661294)
                     /locus_tag="ZYRO0F08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497507.1"
                     /db_xref="GeneID:8205314"
     CDS             complement(660746..661294)
                     /locus_tag="ZYRO0F08162g"
                     /note="similar to uniprot|Q12041 Saccharomyces cerevisiae
                     YDR253C MET32 Zinc-finger DNA-binding protein, involved in
                     regulating expression of the methionine biosynthetic
                     genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497552.1"
                     /db_xref="GeneID:8205314"
                     /db_xref="GOA:C5DXV8"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DXV8"
                     /translation="MSEDAVFFRQAAEAIVATSLNAENVDPTIRELLSRIKYVSPEIK
                     KTDVNTSTSLLPTEDIKIGSSEKEPDVVFKPKERQDVEDSGNEDTQDAKGTLLQDRQF
                     HCAKCKLVFRRSSDLRRHERTHLPVLPNICSQCGKGFARKDALKRHFDTLTCRRNRSK
                     LLSIGGDINEILERAQQTGTGL"
     gene            complement(<661489..>662076)
                     /locus_tag="ZYRO0F08184g"
                     /db_xref="GeneID:8205315"
     mRNA            complement(<661489..>662076)
                     /locus_tag="ZYRO0F08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497508.1"
                     /db_xref="GeneID:8205315"
     CDS             complement(661489..662076)
                     /locus_tag="ZYRO0F08184g"
                     /note="some similarities with uniprot|Q03080 Saccharomyces
                     cerevisiae YPL039W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497553.1"
                     /db_xref="GeneID:8205315"
                     /db_xref="UniProtKB/TrEMBL:C5DXV9"
                     /translation="MNLLALRKKQFLVLNRFLISHFIKETLDKYAHLLNIEDDNFDSK
                     AIQFMETVLKRSHSSRLQFKTVCCIVTKFLKCCNENIMGSNYMRHLKYDFLKLVVASF
                     VLSVPNRTNDYGQRLITRDHCYALFSRVTGLSLDEVTNCSSIVRAVLIHNHPEREQDS
                     PNWSHLREEGYVKTTEIEQFDRASKKMVQEYFQLF"
     gene            <662239..>665223
                     /locus_tag="ZYRO0F08206g"
                     /db_xref="GeneID:8205316"
     mRNA            <662239..>665223
                     /locus_tag="ZYRO0F08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497509.1"
                     /db_xref="GeneID:8205316"
     CDS             662239..665223
                     /locus_tag="ZYRO0F08206g"
                     /note="similar to uniprot|P48526 Saccharomyces cerevisiae
                     YPL040C ISM1 Mitochondrial isoleucyl-tRNA synthetase null
                     mutant is deficient in respiratory growth"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497554.1"
                     /db_xref="GeneID:8205316"
                     /db_xref="GOA:C5DXW0"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR002300"
                     /db_xref="InterPro:IPR002301"
                     /db_xref="InterPro:IPR009008"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR013155"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023585"
                     /db_xref="UniProtKB/TrEMBL:C5DXW0"
                     /translation="MLNRPRCWVIRRFASQHAYQKTLNLPQTKFANRSNLQRTVNELI
                     PESCDKIYKSQLQEFLSKIEELGDDSNAKLKLVEENLFVLQDGPPYANGDLHYGHALN
                     KILKDIINRYQLSQGKYIFYKPGWDCHGLPIEMKALKQFNPDQLGKVSPVKIRAMASN
                     HARKAIKLQKEQFGKFAIMTDWDKPYVTMESEYEINQLRVFLKLVSRGLIKRQNKPVY
                     WGTETRTALAEGELEYNENHKSKAAYVEFPLTKDSCSKLFESANITPVADVSLLIWTT
                     TPWTLFSNRAICFNEKYEYQLLRDNNNGGNYVVVESNLAEKLEFLINYQKVAAVSGSA
                     LSRLQYTNPLLGDRVERPLLHGDHVTNSAGTGLVHTAPGHGFDDYNVAHNHKVEVVSP
                     VDAAGRFKLEELPPHLHELLTEHQTGLPRLVLEPSTAKVILDMLQKMGMLCSSHDYTH
                     SYPYDWRSKKPVIIRATPQWFADLHDVKGDAIESLEKVKFYPDRGNARLSSFIKNRNE
                     WCISRQRSWGVPIPAFYKKDDPDVTLMTEETVAHVIQVIREKGIDAWFKFDDSNMADW
                     LPPRYKNEANSYYRGKDTMDVWFDSGTAWNELKDFYLKELKLKQLPTYLADVYLEGSD
                     QHRGWFQSSTLTRVAYSGKPVAPFKTLITHGFTLDENGIKMSKSIGNVISPDAIIQGD
                     KTRGLPALGVDGLRYLVAQSNFTADVAAGPVIMNHVAEALKKFRLAFRFLLGNLQKAT
                     FQKISYDQLRPIDKYTLYKLQELQITARTFYNENNFSKVLTAVQYHMSNDLSALYFDI
                     SKDSLYSDALDSFKRQQIQTVLLQILLSYTAIIGPILPTLVQEVWNALPLKWLGEEEH
                     QKLTVFRTWPHYDIPESAKNSFANCELRLLDEFQRQFDTLEKSITKPVQTVTRIRSSE
                     CPLPYNEDELADILRTARVEIISGGVPEETETEISLPNGTKLHMLVRPSELSKCPRCW
                     KHNSSQEDTLCSRCNDTIHNKA"
     gene            <665663..>667612
                     /locus_tag="ZYRO0F08228g"
                     /db_xref="GeneID:8205317"
     mRNA            <665663..>667612
                     /locus_tag="ZYRO0F08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497510.1"
                     /db_xref="GeneID:8205317"
     CDS             665663..667612
                     /locus_tag="ZYRO0F08228g"
                     /note="similar to uniprot|P38227 Saccharomyces cerevisiae
                     YBR043C QDR3 Multidrug transporter required for resistance
                     to quinidine barban cisplatin and bleomycin member of the
                     major facilitator superfamily of transporters conferring
                     multiple drug resistance (MFS-MDR)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497555.1"
                     /db_xref="GeneID:8205317"
                     /db_xref="GOA:C5DXW1"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DXW1"
                     /translation="MHSECSNADLSAPDSQNSLKSDEHPLPQRFNKGDASSVSTTLEP
                     SEDLKGLSKLKDRQLWVTRNERRGVVANLSLIPEFKDSRDYPESVKKSIVFVIAFSSM
                     MGPMATSIIFPSIHEIEKDFSTTSMVVNVSVGVYQISLGVFPLWWSSISEMNGRRTVY
                     VVSFMLLLGFNIGCALSPNIGAFIALRFLSGAASASVQSVGAGTVSDLYVSEQRGRNL
                     GIYYLGPLLAPLISPIIGAALVSHWSWRSTQWFLVILAGANVLILILFLPETLRKQDN
                     SAAISAVLQERRGLLPSQQHEKVLELIDVDRHSGREIESSPEGLFYPVDPSTSLHRII
                     SENSSSRNYGLLEPNIDMDAPQVSRIQSHHPNLQKMMREDDLRRVQHDVREGISKLAS
                     KFTEATSSDISPSPESKWDTFKRLAYIYLFRPIKSVYFLKYPPVMLAIIFSSVSFSIL
                     YFVNMTLEYDYSRSPYNFPPMLVGLMYIPNSVTYILAAILGGKWVDYLLIQYKAKHGI
                     LAPEARISWNIVTAVISFPISLVIFGWCIDKGEHWETPLVGTALFGYASMMTIGATVS
                     YLVDSLPGRGATGVALNNLIRQLLAAVAVFVTEPLIKGMGTGWLFTMLAFIIIAAASV
                     LVIIKKHGDYWRENYDLQKLYNYLE"
     gene            <667791..>668438
                     /locus_tag="ZYRO0F08250g"
                     /db_xref="GeneID:8205318"
     mRNA            <667791..>668438
                     /locus_tag="ZYRO0F08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497511.1"
                     /db_xref="GeneID:8205318"
     CDS             667791..668438
                     /locus_tag="ZYRO0F08250g"
                     /note="some similarities with uniprot|Q6LE92 Saccharomyces
                     cerevisiae YPL041C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497556.1"
                     /db_xref="GeneID:8205318"
                     /db_xref="InterPro:IPR018811"
                     /db_xref="UniProtKB/TrEMBL:C5DXW2"
                     /translation="MNVIINSAGNTLYRCPLVGKKLLLTPGPLNILISKYSTVNNEKN
                     SSSRNQNQNQQDRLHKIIAKSKILSKLNQNPRFASYFARLSDAGVTSTVTSFLILHEF
                     TAIVPLFGLWYIFYQLDLPEQYELPLYFTDLLNRCGDAMEKLVGDKYASDLDHNRLIL
                     AGAISYSIVKLLYPIRVFASLWGAPYVGRWILSPFRRIRSKYAKKGEKSAENFDG"
     gene            <668685..>670508
                     /locus_tag="ZYRO0F08272g"
                     /db_xref="GeneID:8205319"
     mRNA            <668685..>670508
                     /locus_tag="ZYRO0F08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497512.1"
                     /db_xref="GeneID:8205319"
     CDS             668685..670508
                     /locus_tag="ZYRO0F08272g"
                     /note="similar to uniprot|P39073 Saccharomyces cerevisiae
                     YPL042C SSN3 Component of RNA polymerase II holoenzyme
                     involved in RNA pol II carboxy-terminal domain
                     phosphorylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497557.1"
                     /db_xref="GeneID:8205319"
                     /db_xref="GOA:C5DXW3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DXW3"
                     /translation="MYNSNEKVPNPYQRIPQGIVQAGGQQRVQPQQQPQQGFSGRSLW
                     QNQGSHQFNQQQSSVLGMKSTSGRNVHGKQPMLMANNDVFSIGPYKARKDSTRVSVLD
                     KYEIIGYIAAGTYGKVYKARRRAISKDDDTSIDPVNTEMNGSDLGGLQTRQSMLAESN
                     SHPDAEIVNRSVRTSESEINGLRTSDSGILSANNTHSPIGTHGSNGTLTPKGAIFRKK
                     ASPVYYAIKKFKTERDGVEQTHYTGISQSACREMALCRELDNKHLTQLTEIFLERKSI
                     YMVYEFAEHDLLQIIHFHSHPEKRMIPQKMIGSIMWQILDGVSYLHQNWILHRDLKPA
                     NIMVTVDGCVKVGDLGLARKFYNMLQTLYTGDKVVVTIWYRAPELLLGARHYTPAIDL
                     WAVGCIFAELIGLQPIFKGEEAKMDSKKSVPFQSNQLQRILEVLGSPNQKNWPNIHKY
                     PEYEQLGKFPKYRDNLATWYHSAGGRDKNALDLLYKLLIYDPTQRIDAINALDHEYFT
                     SGEFPVCENVFEGLNYKYPARRIHTNDNDITNLGIHRNKGISSQQPAVVNNSSTAALG
                     GLGVNRRILAAAAAAAAAVSGNNPSGQPASRSGEPNRKKRR"
     gene            complement(<670688..>672832)
                     /locus_tag="ZYRO0F08294g"
                     /db_xref="GeneID:8205320"
     mRNA            complement(<670688..>672832)
                     /locus_tag="ZYRO0F08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497513.1"
                     /db_xref="GeneID:8205320"
     CDS             complement(670688..672832)
                     /locus_tag="ZYRO0F08294g"
                     /note="similar to uniprot|P37838 Saccharomyces cerevisiae
                     YPL043W NOP4 Nucleolar protein essential for processing
                     and maturation of 27S pre-rRNA and large ribosomal subunit
                     biogenesis contains four RNA recognition motifs (RRMs)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497558.1"
                     /db_xref="GeneID:8205320"
                     /db_xref="GOA:C5DXW4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DXW4"
                     /translation="MSSEAEAGVNKKTNGVVAAQDGDVDMKTLFVRSIPPNTTDEDLS
                     VFFSNFAPIKHAVLVKDKNQKSRGFGFVSFAVEDDTMEALKQARRTKLNGHQVRVDLA
                     KRRHRSGKNDEGAQHQQQAAEVHIARHNEGDHEDDDEDALLKGKPKIIIRNMPWSCRD
                     PEKLKSIFGKYGLVVEATIPRKPNGQLRGFAFVTMKKISNCKKAIEDSKNLKIDGRPV
                     AVDFAVQKNFWEDFKNKQEEAEDEQESEAESEESGESESEEQNENSDDKSDNAEVELS
                     SDEEVNEEEEEEEEEEEEEAKTPRKPLNRTEEYSVFVKNVPYDATEESLAEHFEKFGP
                     VKYALPVIDRETGLARGTAFIAFRNKQSYDYCLKNAPAAGATSLLIGDDVLPEYVYEG
                     RVLSILPTLKREQADFMAEKNANKRKEALGKAPGEKDRRSLYLLNEGKVLEGSKLAAL
                     LSEKDMEVRNASYNLRVEQLKKNPSLHLSLTRLAIRNLPRSMNDKALKALARKAVVQF
                     AAEVKSGVRHPLSKEEIVRSTKEKYRHMTDEEIEHQKKKDKKHGVVKQAKVINEVKGS
                     SKGRSRGYGFVEFKDHKHALMGLRWMNVHQVTKGEILEGLNEEERKYADLDQKASRRL
                     CVEFAIENASVLKRRRERVKQAREPSNKRDEKGNLIKDTNSNQDTSSTQDTKSSNDDN
                     KSSQKRNRTDSGLSDDTKRLIGIKRKKRHNKK"
     gene            <673121..>674395
                     /locus_tag="ZYRO0F08316g"
                     /db_xref="GeneID:8205321"
     mRNA            <673121..>674395
                     /locus_tag="ZYRO0F08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497514.1"
                     /db_xref="GeneID:8205321"
     CDS             673121..674395
                     /locus_tag="ZYRO0F08316g"
                     /note="similar to uniprot|P38907 Saccharomyces cerevisiae
                     YDR254W CHL4 Outer kinetochore protein required for
                     chromosome stability interacts with kinetochore proteins
                     Ctf19p Ctf3p and Iml3p exhibits a two-hybrid interaction
                     with Mif2p association with CEN DNA requires Ctf19p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497559.1"
                     /db_xref="GeneID:8205321"
                     /db_xref="GOA:C5DXW5"
                     /db_xref="InterPro:IPR007902"
                     /db_xref="InterPro:IPR027716"
                     /db_xref="UniProtKB/TrEMBL:C5DXW5"
                     /translation="MELSDDFIPKQDRKVLLKKLGRLPLTVLCHLVEHWSHKYDPANG
                     MSPDKLAHIMSGYLKRRANRKTVVARILLEFWPQGLSLYQLAQIDSYTLVQRPNLLFW
                     KSTTAIDPNGIKKVLNLDPNSFVHNLKEDIHRLYLSHIYIFKHPELPSIICRIQLFEP
                     HNLVENGNEPNLISRSPYYVVFPMNSPNVIHSSDDDSYAQLILQSVQRTIAEKDPIVL
                     RQNDDPPVKSLETMHVLKGVSRYSNSLGPWSKYADADFDISPFDNYGNHISVKGKRVV
                     TGVYDDDDPGSKRQRLENIMLRFKGSKKGVKAKKAYEVQRFNSRMHHLQKDFPKMDAA
                     DTVSKYASLIPVNKVNFVDKQDLSDDRGQVSIRFKFRGNDVFGGLHELCDEGNIDIDR
                     VPGWLTGENGLDSGTILNGEFIKEEKRKGGLI"
     gene            complement(<674403..>676790)
                     /locus_tag="ZYRO0F08338g"
                     /db_xref="GeneID:8205322"
     mRNA            complement(<674403..>676790)
                     /locus_tag="ZYRO0F08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497515.1"
                     /db_xref="GeneID:8205322"
     CDS             complement(674403..676790)
                     /locus_tag="ZYRO0F08338g"
                     /note="similar to uniprot|Q03308 Saccharomyces cerevisiae
                     YPL045W VPS16 Vacuolar sorting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497560.1"
                     /db_xref="GeneID:8205322"
                     /db_xref="GOA:C5DXW6"
                     /db_xref="InterPro:IPR006925"
                     /db_xref="InterPro:IPR006926"
                     /db_xref="InterPro:IPR016534"
                     /db_xref="UniProtKB/TrEMBL:C5DXW6"
                     /translation="MRNPSFNWEKLDKVFFRSRELCNLEWPQQEHVVYSISTTLVAIE
                     LDETIQVYNYFGETLASWNSKQFGKVLKIEFDFEDHLIIVTPSTIFRITSWSPLEYDS
                     TSLDENLQDSIWDYKNGAIILKRTQDVYKLKDGAIKEVCRNDGRFTLLTKEHWDCNGK
                     KIILLDVNHTFQLDLRRKSLIQWLSDSQWHRCVISRANKVILYNAKLNKIQVYTDSKA
                     PQSEFAVHDIPSAIMWCGNDTVACAFSDEVKLYGSNNSYIAFWYPSEIMALKTEVDGL
                     KIFTSEKIHFISKIAEYTSSIFRVGSTESGAILLDSLDLLETQTSRALENLNAIDLEK
                     AIFDCMHAAQEEFSPQLQKKLLNAASFGKASLPYKEFDSDIFVKACDNVRLLNVLRTM
                     GIFVTNEQYKSITFHGIIQGLLMCHKYYQSILLCENLKEHKELLEVFAHWATTKIKVS
                     SELDDEELSKLIKKRYAELPKVGHPPMARIAHSAFLEGRFQLARDLALLESSPELKVL
                     ELLKLDDDSLALSECLKFQCPELTLSVLLVMRKKLSTAQLAKLLILDMPQDQLYPYLQ
                     RGNHEFLFDYFRQTDSFIELAHLFLAQGNKGESLRPFLPQIQELYGKVLNDNLIKQDK
                     ELLKKNHKLLDYQDALGNKYHHNFVGLTLDQTIASLIEIKQERDLGGLIKEFKICDKK
                     LWHIKCKALVKTKSFDDLYQFAISKKSPIGYKPFYNYLKRNSHNKEASTYISMISGIS
                     YEERRQMYLDCKNYQSAIDLAAKEKDIQGLKELHKLIPNNETRFRALIMELVNKL"
     gene            <676913..>677224
                     /locus_tag="ZYRO0F08360g"
                     /db_xref="GeneID:8205323"
     mRNA            <676913..>677224
                     /locus_tag="ZYRO0F08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497516.1"
                     /db_xref="GeneID:8205323"
     CDS             676913..677224
                     /locus_tag="ZYRO0F08360g"
                     /note="similar to uniprot|O13292 Saccharomyces cerevisiae
                     YPL046C ELC1 Elongin C forms heterodimer with Ela1p that
                     participates in transcription elongation expression
                     dramatically upregulated during sporulation widely
                     conserved among eukaryotes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497561.1"
                     /db_xref="GeneID:8205323"
                     /db_xref="GOA:C5DXW7"
                     /db_xref="InterPro:IPR001232"
                     /db_xref="InterPro:IPR011333"
                     /db_xref="InterPro:IPR016073"
                     /db_xref="UniProtKB/TrEMBL:C5DXW7"
                     /translation="MEEEDIKPNVTLVSSDNMEYSISKEAAMVSPTLRVMLEGPFKEK
                     SGRVELPGIEGNVLARVVDYLQYNLQYKFANKDQEDIPEFEIPTEMALELLLAADYLN
                     V"
     gene            complement(<677241..>678452)
                     /locus_tag="ZYRO0F08382g"
                     /db_xref="GeneID:8205324"
     mRNA            complement(<677241..>678452)
                     /locus_tag="ZYRO0F08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497517.1"
                     /db_xref="GeneID:8205324"
     CDS             complement(677241..678452)
                     /locus_tag="ZYRO0F08382g"
                     /note="similar to uniprot|Q12508 Saccharomyces cerevisiae
                     YDR255C RMD5 Cytosolic protein required for sporulation
                     also required for the ubiquitination of the
                     gluconeogenetic enzyme fructose-1 6-bisphosphatase which
                     is degraded rapidly after the switch from gluconeogenesis
                     to glycolysis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497562.1"
                     /db_xref="GeneID:8205324"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR024964"
                     /db_xref="InterPro:IPR027370"
                     /db_xref="InterPro:IPR027711"
                     /db_xref="UniProtKB/TrEMBL:C5DXW8"
                     /translation="MSVILPSLSQEIERLYDEENGQPLVSKCVEETHEFKTQLKKLKA
                     HLNKHIQEVEKGDDEKKGNKRRKDLVVEKLNKAHRQWDHSIKKNYKHASQQHSKISKF
                     LQNKLHEFDLDEVYVNKLHPESRTNIDKAISFHISRYNVGSLPVNGRQEIIDYLGQVY
                     GVTQDISERFVQLGQIVQDLKNGDTRSCIEWCHDDSLLQFELYTLNAMQLFQNGDVLN
                     TYKYLTENIPNSAFKYRQHQVITQVSPLLTQLLLGKRADDFDNKLQLQQEKCISLFTK
                     DYCAQNNLPFDSALFLIILSGVISFQFFTKYKSIRASAHVDWTTEDELPFDVKLPEFL
                     TRFHPIFICPVLKEETTLENPPYSLPCHHILSKKSLERLSKNGTSTFKCPYCPVNASK
                     AKTKKVNFVML"
     gene            complement(<678470..>678757)
                     /locus_tag="ZYRO0F08404g"
                     /db_xref="GeneID:8205325"
     mRNA            complement(<678470..>678757)
                     /locus_tag="ZYRO0F08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497518.1"
                     /db_xref="GeneID:8205325"
     CDS             complement(678470..678757)
                     /locus_tag="ZYRO0F08404g"
                     /note="highly similar to uniprot|Q03067 Saccharomyces
                     cerevisiae YPL047W SGF11 11kDa subunit of the SAGA histone
                     acetyltransferase complex involved in regulation of
                     transcription of a subset of SAGA-regulated genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497563.1"
                     /db_xref="GeneID:8205325"
                     /db_xref="GOA:C5DXW9"
                     /db_xref="InterPro:IPR013246"
                     /db_xref="UniProtKB/TrEMBL:C5DXW9"
                     /translation="METKESVSEGIYHNLITTLIQDIVAKETTKQQLLRSRYPNLKPY
                     CYDPSHQLDINGLPKQQESSQYLQCENCNRDISANRFAAHLQRCLSRGARR"
     gene            complement(<678955..>680481)
                     /locus_tag="ZYRO0F08426g"
                     /db_xref="GeneID:8205326"
     mRNA            complement(<678955..>680481)
                     /locus_tag="ZYRO0F08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497519.1"
                     /db_xref="GeneID:8205326"
     CDS             complement(678955..680481)
                     /locus_tag="ZYRO0F08426g"
                     /note="highly similar to uniprot|P15202 Saccharomyces
                     cerevisiae YDR256C CTA1 Catalase A breaks down hydrogen
                     peroxide in the peroxisomal matrix formed by acyl-CoA
                     oxidase (Pox1p) during fatty acid beta-oxidation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497564.1"
                     /db_xref="GeneID:8205326"
                     /db_xref="GOA:C5DXX0"
                     /db_xref="InterPro:IPR002226"
                     /db_xref="InterPro:IPR010582"
                     /db_xref="InterPro:IPR011614"
                     /db_xref="InterPro:IPR018028"
                     /db_xref="InterPro:IPR020835"
                     /db_xref="InterPro:IPR024708"
                     /db_xref="InterPro:IPR024711"
                     /db_xref="UniProtKB/TrEMBL:C5DXX0"
                     /translation="MSGKDNTNSSDVRGDRVVTTVEGAPINEPFATQRVGNHGPLLLQ
                     DAGLIESLAHFNRERIPERNPHAHGSGAFGYFEVTDDITDICGSAMFSEIGKKTRCLT
                     RFSTVGGEKGSADTARDPRGFATKFYTEEGNLDWVYNNTPIFFIRDPSKFPHFIHTQK
                     RNPQTNMKDANMFWDFLTTPENQVCVHQMCILFSDRGTPASYRNMNGYSGHTYKWSNK
                     KGEWHYVQVHIKTDQGIKNLTNEEAVKLSGENPDCCQQDLFENIEKGNPPSWTIYIQT
                     MTEDQASKQPFSVFDLTKVWPQNEFPLRRVGKLVLNENPQNFFAQVEQAAFAPSNTVP
                     YQEASADPVLQSRLFAYSDAHRYRLGANFNQIPVNCPYASRFFNPAIRDGPMNVNGNF
                     GSEPNYLAQSKKYTYVQQDRPIQQHQEVWHGPAVPYHWATSPGDVDYYQPRILYQKVL
                     AKQPGQQKNLAHNIGVHVAGACPEIQKRVINMFTRVDKKLAADIKKELQLASAPQAKL
                     "
     gene            complement(<680894..>682129)
                     /locus_tag="ZYRO0F08448g"
                     /db_xref="GeneID:8205327"
     mRNA            complement(<680894..>682129)
                     /locus_tag="ZYRO0F08448g"
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /transcript_id="XM_002497520.1"
                     /db_xref="GeneID:8205327"
     CDS             complement(680894..682129)
                     /locus_tag="ZYRO0F08448g"
                     /note="similar to uniprot|P29547 Saccharomyces cerevisiae
                     YPL048W CAM1 Translational cofactor elongation factor-1
                     gamma participates in the regulation of GTP-binding
                     protein EF-1 alpha may play a redundant role in the
                     regulation of protein synthesis or another GTP-dependent
                     process"
                     /codon_start=1
                     /product="elongation factor 1 gamma domain-containing
                     protein"
                     /protein_id="XP_002497565.1"
                     /db_xref="GeneID:8205327"
                     /db_xref="GOA:C5DXX1"
                     /db_xref="InterPro:IPR001662"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="UniProtKB/TrEMBL:C5DXX1"
                     /translation="MSEGLLYSNFRIRSLVPRALVWILKLDVEIQDPYQVDEKFTKDF
                     PLRKLPSFLGPHGYKLTEQMAINNYLIKLSKDEKIKAQLLGAEDDIKTQSQILRWESL
                     ANSDLIATMVKVFGPLKGDAPYIKKNVDDASNFLEEIVGIYEARLRDYTYLASESISL
                     ADLVSAAIFIRGFNFIFGEQWRKEHPAIVRWFKTVIESPFLAEETKDFKFIEKPLEPP
                     QGKKKEQPKQQAKQQPAQKAPAAQQPPQEKKPKHPLELLGKSSFPLEDWKRKYMNDDT
                     RPTALPWFWEHYNPEEWSLWKVEYRYNDELTLTFMSNNLIGGFFTRLFGSVKYMFGSM
                     VVYGENNDNGIVGAIMIRGQDYVKAFDVAPDWESYKFTQLDATKPEDKAFVEDMWAWD
                     KPVIVNGKPREIVDGKVLK"
     gene            <682779..>683999
                     /locus_tag="ZYRO0F08470g"
                     /db_xref="GeneID:8205328"
     mRNA            <682779..>683999
                     /locus_tag="ZYRO0F08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497521.1"
                     /db_xref="GeneID:8205328"
     CDS             682779..683999
                     /locus_tag="ZYRO0F08470g"
                     /note="some similarities with uniprot|Q03063 Saccharomyces
                     cerevisiae YPL049C DIG1 Regulatory protein of unknown
                     function constitutively-expressed involved in the
                     regulation of mating-specific genes and the invasive
                     growth pathway required for MAP-kinase imposed repression
                     inhibits pheromone-responsive transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497566.1"
                     /db_xref="GeneID:8205328"
                     /db_xref="UniProtKB/TrEMBL:C5DXX2"
                     /translation="MSPERMPQPEEITKAGASDSEPCLDDKIKNKDRDTDGVKEEVKD
                     SKVQSDDEAAASLGLHRVTERMLSKIKASKDIERKQRNVISKLALNSNGEEDEEEDDE
                     DDDDDDEDGEEEDHGDDENANGGKNDNLEATKKRTLELKASKGTSLKRKRIPPALDLS
                     SCSSGSTTTPNSNLSTAIHRHHTHHGRVESAPPNVSRFPRSTFTGRPIGKPRVQYLGK
                     SRQAPLLPQQQGYKLNTPFVPRIPLPQWQQQYYPYPYAATTAAPAPMLQAYQRPYNYP
                     VPPRSAIPVQMPYYQEYQGYTPYTTTQRKRPQQMTTATTAVNDSEDLRNRESEANQDQ
                     NQEQQETEYNQLTVEDDTTVPSTSDELMQGEIRIQRDVFSFEFPGNSPAIDKKMFMSI
                     CDKVWDESRETSRV"
     gene            <684329..>685519
                     /locus_tag="ZYRO0F08492g"
                     /db_xref="GeneID:8205329"
     mRNA            <684329..>685519
                     /locus_tag="ZYRO0F08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497522.1"
                     /db_xref="GeneID:8205329"
     CDS             684329..685519
                     /locus_tag="ZYRO0F08492g"
                     /note="highly similar to uniprot|P39107 Saccharomyces
                     cerevisiae YPL050C MNN9 Subunit of Golgi
                     mannosyltransferase complex also containing Anp1p Mnn10p
                     Mnn11p and Hoc1p that mediates elongation of the
                     polysaccharide mannan backbone forms a separate complex
                     with Van1p that is also involved in backbone elongation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497567.1"
                     /db_xref="GeneID:8205329"
                     /db_xref="InterPro:IPR005109"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DXX3"
                     /translation="MISLRLLFYRLRKNPWFMVLFPIALTVFIYFEIVSSGNPYLGND
                     GNSIADHKWAHEKENTFYFPYSNKYKMPKYSYKKKSSWLFNDRVEDIIPENHIAHYDL
                     NKLHSTAEAALNKEHVLILTPMQTFHQEYWDNLLQLTYPREFTELGFILPRTSSGDIA
                     LSKLEAAVKKVQTDKKNQRFSKITILRQNSAGFDKLMEKERHALEVQKERRSAMASAR
                     NELLFSSLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQ
                     IRPYDFNNWQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNL
                     DGVGGGCTLVKADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIE
                     ETNT"
     gene            complement(<685717..>687333)
                     /locus_tag="ZYRO0F08514g"
                     /db_xref="GeneID:8205330"
     mRNA            complement(<685717..>687333)
                     /locus_tag="ZYRO0F08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497523.1"
                     /db_xref="GeneID:8205330"
     CDS             complement(685717..687333)
                     /locus_tag="ZYRO0F08514g"
                     /note="similar to uniprot|P11491 Saccharomyces cerevisiae
                     YDR481C PHO8 Repressible alkaline phosphatase a
                     glycoprotein localized to the vacuole regulated by levels
                     of inorganic phosphate and by a system consisting of Pho4p
                     Pho9p Pho80p Pho81p and Pho85p dephosphorylates
                     phosphotyrosyl peptides"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497568.1"
                     /db_xref="GeneID:8205330"
                     /db_xref="GOA:C5DXX4"
                     /db_xref="InterPro:IPR001952"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="InterPro:IPR018299"
                     /db_xref="UniProtKB/TrEMBL:C5DXX4"
                     /translation="MAKVFQRGHRYNKARQFMRFVIPTLILLLAGFNLVTSSDKGLES
                     FFGGKHSGKRNVIFFVTDGMGPTSLSLTRSFRQYVHELAYNDVLVLDQHLIGSSRTRA
                     SDSLVTDSAAGATAFACALKSYNGAIGVDSDKVPCGTILEGAKLAGYHTGLVVTTRIT
                     DATPGAFSAHVDFRSQEDLIAEQQLGEYPLGRQVDLMIGGGRTHFYSSNSDPKYGDRG
                     SRKDGKNLISKAEKDGWQYVGNREQFDQLQLGQNVSLPLLALLADHDIPFDLDRKDEE
                     YPSLEEETITAINALNEATKDSDKGFFLLVEGSRIDHAGHQNDPSAQVREVLAFDRAF
                     QAAKKLADKSQVETILISTSDHETGGLAASRQITKSYPDYVWYPEVLSNAQHSGEYCS
                     KQIEGYKGDDKKSFVQHEVLEKMLEIHDYTDSDVDYLINEKDRNSIQDKLNDMISFRA
                     EIGWSTHGHSAVDVNIYAYSNRKKALDEIKDYLQGNHENTEIGDYMARYLNIDLAQVT
                     KEIRDTKHSPGKKFTAKVFDEYGHKVGGLE"
     gene            complement(<687627..>688223)
                     /locus_tag="ZYRO0F08536g"
                     /db_xref="GeneID:8205331"
     mRNA            complement(<687627..>688223)
                     /locus_tag="ZYRO0F08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497524.1"
                     /db_xref="GeneID:8205331"
     CDS             complement(687627..688223)
                     /locus_tag="ZYRO0F08536g"
                     /note="highly similar to uniprot|Q02804 Saccharomyces
                     cerevisiae YPL051W ARL3 GTPase of the Ras superfamily
                     required to recruit Arl1p to the Golgi; similar to
                     ADP-ribosylation factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497569.1"
                     /db_xref="GeneID:8205331"
                     /db_xref="GOA:C5DXX5"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006689"
                     /db_xref="InterPro:IPR024156"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DXX5"
                     /translation="MFHLARGLYNNWNRKEQYSILILGLDNAGKTTFLETLKQQYSLH
                     SKDLDKITPTVGQNVAQINVSKTCTLKLWDVGGQETLRSMWSEYYPQCHGIIFVVDST
                     DRSRIDECSDTLRSVVMDEEVEGVPVLMLANKQDRPDSLEVQDIKQIFNRIAEHLGAR
                     DSRVLPISALTGEGVRDTAEWLLVRLQRNKANRPPVYK"
     gene            complement(<688388..>688756)
                     /locus_tag="ZYRO0F08558g"
                     /db_xref="GeneID:8205332"
     mRNA            complement(<688388..>688756)
                     /locus_tag="ZYRO0F08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497525.1"
                     /db_xref="GeneID:8205332"
     CDS             complement(688388..688756)
                     /locus_tag="ZYRO0F08558g"
                     /note="similar to uniprot|Q03375 Saccharomyces cerevisiae
                     YDR482C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497570.1"
                     /db_xref="GeneID:8205332"
                     /db_xref="InterPro:IPR013170"
                     /db_xref="UniProtKB/TrEMBL:C5DXX6"
                     /translation="MSYNNVGLKTAKGSSTSGHIQRSLAGHNDSTQNYNKRNKRVERP
                     RTQEPASHRPKDAKLVDHLQRREIELQVSELRDQLEDGSDDDDETIDRKCNELREKLT
                     NATRTAYTSRKERENASEPK"
     gene            complement(<688910..>689533)
                     /locus_tag="ZYRO0F08580g"
                     /db_xref="GeneID:8205333"
     mRNA            complement(<688910..>689533)
                     /locus_tag="ZYRO0F08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497526.1"
                     /db_xref="GeneID:8205333"
     CDS             complement(688910..689533)
                     /locus_tag="ZYRO0F08580g"
                     /note="similar to uniprot|Q02803 Saccharomyces cerevisiae
                     YPL052W OAZ1 Regulator of ornithine decarboxylase (Spe1p)
                     antizyme that binds to Spe1p to regulate
                     ubiquitin-independent degradation ribosomal frameshifting
                     during synthesis of Oaz1p and its ubiquitin-mediated
                     degradation are both polyamine-regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497571.1"
                     /db_xref="GeneID:8205333"
                     /db_xref="GOA:C5DXX7"
                     /db_xref="InterPro:IPR002993"
                     /db_xref="UniProtKB/TrEMBL:C5DXX7"
                     /translation="MDSRTGMRDIGKPGGNLVQLYWDIILLTESKFLLPQYRQQQQSL
                     KSFQKYVVDKMGVTLNRMVKPVKVPYSRTGNLNTPWRQLGIKYLMVYLPLHFKDVIWC
                     KCDQFCFHVILPQNNASSALRRGISNDKEWLLSLLELGDKLGMQSIRIYIGRDDFNGV
                     STFLRNLNWIGGRLVPNENRAGLMAQYSSVDDLIFGDENYIILEFEC"
     gene            <690443..>691825
                     /locus_tag="ZYRO0F08602g"
                     /db_xref="GeneID:8205334"
     mRNA            <690443..>691825
                     /locus_tag="ZYRO0F08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497527.1"
                     /db_xref="GeneID:8205334"
     CDS             690443..691825
                     /locus_tag="ZYRO0F08602g"
                     /note="similar to uniprot|P27809 Saccharomyces cerevisiae
                     YDR483W KRE2 Alpha1 2-mannosyltransferase of the Golgi
                     involved in protein mannosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497572.1"
                     /db_xref="GeneID:8205334"
                     /db_xref="GOA:C5DXX8"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DXX8"
                     /translation="MAVFLSKRLLRLVVLVGVCLGILAVMSPRGGDQSGTTQSYLSNM
                     MPSNFDFSGSKLWGSQSNENVSEEKERYEAEKEKEKEQAKSEDSKESEESESLHKLPS
                     TEPYDESKTESPSSLEERNLVWEYMKPSYKNKGSRPKACFVSLVRNEELHNMLESIAQ
                     VEKKFNKKFHYPWVFMNEKKFTDEFKREVSQATSGEVEFVLIPEEYWSYPDYIDQNLA
                     ADERRKMDADGVVYGESESYRHMCRFQSGFFWQQEALDKYDWYWRVEPGIKLYCNINY
                     DVFQWMQDNEKAYGFTITIHEYMRTIESLWNTVRKWWKKNPEYIAKDNLLEFISEDKG
                     ESYNLCHFWSNFEVANLNLWRSPAYRDYFKYLDDTGNFFYERWGDAPVHSIAASLFLP
                     KDSIHYFSDIGYNHIPYDNCPLDKNVFKENECECNPDNDFTFHSYACGVQYYNSQGLT
                     KPNGWEKYNN"
     gene            <691992..>693131
                     /locus_tag="ZYRO0F08624g"
                     /db_xref="GeneID:8205335"
     mRNA            <691992..>693131
                     /locus_tag="ZYRO0F08624g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497528.1"
                     /db_xref="GeneID:8205335"
     CDS             691992..693131
                     /locus_tag="ZYRO0F08624g"
                     /note="similar to uniprot|P33313 Saccharomyces cerevisiae
                     YBR155W CNS1 cyclophilin seven suppressor component of
                     Hsp90p chaperone machinery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497573.1"
                     /db_xref="GeneID:8205335"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DXX9"
                     /translation="MGSGIKDPKRYKPGPNDPVLPPQLSEFQDKNADEILEELNRQPF
                     FMTQLDETDGDKGANLELEALKALAYDGEPHEVAENFKNQANDLYKAKRFKEAREVYK
                     KGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQKALQFNPKNMKCYYRIAKAF
                     YQLNKLDEAKESVKFGLTIDSENKSLQTLEGVIDRKQQELHEAEVKRLEEKQKKENLQ
                     FIFNGALRMRNIDNVATEKPSELVQEAGISLEDPLDPQSQLIFPAIIMYPTTDEFDFV
                     AQVGELTTVQELIELIMQRPPEWFQIPGHENFQVKSLLGFMETQSGGLVKVGKKVAFH
                     DILKKQTPHIPMFDHAIKIYLVPKSESEQWVSQWDKTKALQRRQK"
     gene            complement(<693181..>694953)
                     /locus_tag="ZYRO0F08646g"
                     /db_xref="GeneID:8205336"
     mRNA            complement(<693181..>694953)
                     /locus_tag="ZYRO0F08646g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497529.1"
                     /db_xref="GeneID:8205336"
     CDS             complement(693181..694953)
                     /locus_tag="ZYRO0F08646g"
                     /note="some similarities with uniprot|P38283 Saccharomyces
                     cerevisiae YBR156C SLI15 Mitotic spindle protein involved
                     in chromosome segregation."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497574.1"
                     /db_xref="GeneID:8205336"
                     /db_xref="InterPro:IPR005635"
                     /db_xref="UniProtKB/TrEMBL:C5DXY0"
                     /translation="MLKRNAKFTKLTLTTTNSSNKNEEGMDWAIQAAKKKNKRLPGGS
                     RSIIETLNVFNDVVTDGDLEINRILNGTRKWVNDIGNGLQGQLSPEKTVKIGDETIVN
                     DIPEEKTPERSVNLPSATPKSLAEESAPEPEPEREPEPEPEPAPLPQVQQERFTRRRT
                     TTRRSNVFVPLPSKDPLVVQPAPPPVPPAEPAAMPPAASLLPPAIPPTSIQSSTALSS
                     PASTASPTASVPSANTASHRRRRAIATASTANKSNVFDRLSSIPTKSFENKVNRTARK
                     GSSASSIDVTGSPMRRSSPRRNPGAVVDSSIQETLKSIFSTQPSGSKSSGKVTKREPP
                     VPHLARSFNRRANFKPSAAKSLARDPSPPRPISQHASQQQQQQQEANVPQPARQKYDR
                     LTKFQLLPPVESEKDDLKKKLNKRLSEVVRTQQEQHRRKQEQQKRKSHLEEDFKRRTK
                     LWSDTATTTTNTNKTAVPNPLQQLDKNNTILHDLYLADHRTILGENTATTGTGSGSGT
                     GGTTGAGNYDGYANQSLPYIHSDSDEEDDVALAPWARSPYLQRQLQLQQNWDPRKIFG
                     PIPPLHIDQIFQHSRLNRLKPKRG"
     gene            complement(<695007..>695564)
                     /locus_tag="ZYRO0F08668g"
                     /db_xref="GeneID:8205337"
     mRNA            complement(<695007..>695564)
                     /locus_tag="ZYRO0F08668g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497530.1"
                     /db_xref="GeneID:8205337"
     CDS             complement(695007..695564)
                     /locus_tag="ZYRO0F08668g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497575.1"
                     /db_xref="GeneID:8205337"
                     /db_xref="UniProtKB/TrEMBL:C5DXY1"
                     /translation="MNFNVPEEERYNLEKFRFPMRDERDHNIPESLRRLGLEPSTTRH
                     RQLDIKNLRDQVPDDGSLFQELSRYRMVPVSNHRRQRHHSRGLQKTLSPRSKGDERKS
                     VSPLRHLQPLPADSDYVYHSPSETIRNLNEQMERNFNGRYGSLVEFADNNQLDVEGKN
                     FASCEEPKIDLEQGFEEALRATRIS"
     gene            complement(<696225..>697271)
                     /locus_tag="ZYRO0F08690g"
                     /db_xref="GeneID:8205338"
     mRNA            complement(<696225..>697271)
                     /locus_tag="ZYRO0F08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497531.1"
                     /db_xref="GeneID:8205338"
     CDS             complement(696225..697271)
                     /locus_tag="ZYRO0F08690g"
                     /note="some similarities with uniprot|Q06701 Saccharomyces
                     cerevisiae YPL054W LEE1 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497576.1"
                     /db_xref="GeneID:8205338"
                     /db_xref="GOA:C5DXY2"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C5DXY2"
                     /translation="MGTPRRVHRRRHSRGYQPPSPTAAAIQQDSNTSNNNTHNTQHEE
                     SENAKNQSMFSPEQQKVIIEHLLITKNSAPQKNYSHVPCKFYRQGVCQAGQSCPFSHS
                     LDAFAADQRPCEYFKRGNCKFGAKCVNAHVTSEGTDAKKPLKQFSPPSRITTNIPSAT
                     PSVPQGNPAIGTSMIPQQQTDLADVFEDEEYFLPNDFSDLLTPEELSHRRSRSSSSNS
                     LKLDPISAASSLTSEPLFHHQRSLSGTSTTSSSSSFTSPLLHQQLAFFQSAQSTQVPL
                     KSPYNYTYATRPLQFKSQHTWGSMPSSGPPSSSSSSSSYPFSFANDLAKFRIEEEDTP
                     FLLDGLPSNTFSSF"
     gene            <698547..>700154
                     /locus_tag="ZYRO0F08712g"
                     /db_xref="GeneID:8205339"
     mRNA            <698547..>700154
                     /locus_tag="ZYRO0F08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497532.1"
                     /db_xref="GeneID:8205339"
     CDS             698547..700154
                     /locus_tag="ZYRO0F08712g"
                     /note="similar to uniprot|P38285 Saccharomyces cerevisiae
                     YBR158W AMN1 Involved in daughter cell separation and
                     Chromosome STability Chromosome STability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497577.1"
                     /db_xref="GeneID:8205339"
                     /db_xref="UniProtKB/TrEMBL:C5DXY3"
                     /translation="MKFASLSNGSFKRLRETPPVDLRPRKKSSPTPSDSESDNESNVN
                     NKWRNSLDQVFKRRNTSNNLGRKRRWKNKGPFVRTAQNPPSPVNVTPGPTSVKNGPRW
                     EDARIDSVIQLATISPFNEEKVTRHMADLTLVTPSSPTPPIALPPTVKPHPIFQMPEI
                     VENILRFVSAYAEIPREKPYARRKPLSLEHAKLIYKDEKKAMEVWNNRSQIGAHNSNG
                     DGNEMMGSVMYNCMMVNRLWFHVTLELLLEKFHFKDLTKFRRFLNVKNQMNTNKKLIK
                     PKMMVLHKFHKLQQSELDELSRFLSCESLKWLEFYICPDVVPPVAWINQFNNLEKLVL
                     PGNKKIDDKFLIQVSGHVNNLKVLDLRACDKVTDSGIIAMAIRCPQLQACNLGRHRNS
                     SNITSLAVVALARNTDVETLGMAGCKITDAGLWELAQLRGSRIKRLSLNNCDLLTNHS
                     IPTLLALNYFPNLAVLELRHVDQITEVKQLVKFKLWKRSQNIPVLIEGCERITRLMYD
                     EENRIRKSHSLLAFEDMSTWVNTESEL"
     gene            <700386..>701273
                     /locus_tag="ZYRO0F08734g"
                     /db_xref="GeneID:8205340"
     mRNA            <700386..>701273
                     /locus_tag="ZYRO0F08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497533.1"
                     /db_xref="GeneID:8205340"
     CDS             700386..701273
                     /locus_tag="ZYRO0F08734g"
                     /note="some similarities with uniprot|Q6Q5I8 Saccharomyces
                     cerevisiae YPL055C LGE1 Protein of unknown function null
                     mutant forms abnormally large cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497578.1"
                     /db_xref="GeneID:8205340"
                     /db_xref="UniProtKB/TrEMBL:C5DXY4"
                     /translation="MSDSGNSSVNSSEHSGNSPGAGSRYSGGYSRGYSSKSYHRGGGG
                     RYGNYKDNSYSSYHYRGDYYYGPSRYYSTRGGTRGGGPQYNHAYTGDYQNHNNGNYYG
                     GRRSHDDGRRFGANPGGRYYNGRHSEPWGTSSEPSVPPSQYSGPYGSGNNTPVDYYRR
                     NHSSVAAPTTVSATNTSSGSNTVNIPPVQQGNNTPTSFPSPHGISVATIKRRVDKDES
                     PFYYLTDLDKSSDDPKELESIRQMFKESDRLDKQLEEHNFNLLKNELELGLLATQCEK
                     DKLSVQLTQEKLDTFLMQS"
     gene            <701514..>702545
                     /locus_tag="ZYRO0F08756g"
                     /db_xref="GeneID:8205341"
     mRNA            <701514..>702545
                     /locus_tag="ZYRO0F08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497534.1"
                     /db_xref="GeneID:8205341"
     CDS             701514..702545
                     /locus_tag="ZYRO0F08756g"
                     /note="similar to uniprot|P38286 Saccharomyces cerevisiae
                     YBR159W microsomal beta-keto-reductase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497579.1"
                     /db_xref="GeneID:8205341"
                     /db_xref="GOA:C5DXY5"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020904"
                     /db_xref="InterPro:IPR027533"
                     /db_xref="UniProtKB/TrEMBL:C5DXY5"
                     /translation="MLFVDELQAVGANCKCANYFLWTAFGFGIIKLTTFVLRFLSLIF
                     DIFLLPSTDYSKYGAGKGSYCVITGASDGIGKEFARQMAAKKFNLLLVSRTLSKLEAL
                     QEELQKEFGVTVKTLAFDVSLDQNSNYLSLQKICDELPVTVLINNVGQSHSIPVPFLE
                     TEEKELRDIITINNTATLLITQSVASSIVRQASKGHTKGLILTMGSFGGLIPTPLLAT
                     YSGSKSFLQNWSNALAGELKPANVDVEIVLSYLVTSAMSKIKRSSAMIPSPKNFVRST
                     LSSVGHRSGAQERFASLTPYWSHALYHFVIEETLGVYSKMVNSINYGFHNSIRQRAIR
                     KAQRLAKSQ"
     gene            <702733..>703626
                     /locus_tag="ZYRO0F08778g"
                     /db_xref="GeneID:8205342"
     mRNA            <702733..>703626
                     /locus_tag="ZYRO0F08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497535.1"
                     /db_xref="GeneID:8205342"
     CDS             702733..703626
                     /locus_tag="ZYRO0F08778g"
                     /note="highly similar to uniprot|P00546 Saccharomyces
                     cerevisiae YBR160W CDC28 Catalytic subunit of the main
                     cell cycle cyclin-dependent kinase (CDK) alternately
                     associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs)
                     which direct the CDK to specific substrates"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497580.1"
                     /db_xref="GeneID:8205342"
                     /db_xref="GOA:C5DXY6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DXY6"
                     /translation="MSGELVNYKRLEKVGEGTYGVVYKALDLRHSQRIVALKKIRLES
                     EDEGVPSTAIREISLLKELKDDNIVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEAIPK
                     DQPLGTKIVQKFMMQLCKGIAYCHAHRILHRDLKPQNLLINRDGNLKLGDFGLARAFG
                     VPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDIWSIGCIFAEMCNRKPIFSGDSEIDQ
                     IFKIFRVLGTPNENVWPDIVYLPDFKPSFPKWHRKELSKVVPSLDARGIALLSSLLSY
                     DPINRISAKRAAMHPYFEAMV"
     gene            <704371..>705417
                     /locus_tag="ZYRO0F08800g"
                     /db_xref="GeneID:8205343"
     mRNA            <704371..>705417
                     /locus_tag="ZYRO0F08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497536.1"
                     /db_xref="GeneID:8205343"
     CDS             704371..705417
                     /locus_tag="ZYRO0F08800g"
                     /note="similar to uniprot|P33300 Saccharomyces cerevisiae
                     YPL057C SUR1 Probable catalytic subunit of a
                     mannosylinositol phosphorylceramide"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497581.1"
                     /db_xref="GeneID:8205343"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DXY7"
                     /translation="MRKELKYMIYGNVLVLITILYITFDLLTLAIDDTLKDALLDVDL
                     NPPPGTPEKAQLIPKIIHQTYKTDEIPGHWKEGRQRCLDLHPDYEYILWTDEMADKFI
                     EDEYPWFLETFRNYRYPIERADAIRYFILSHFGGVYIDLDDGCERKLDPLLTVPAFAR
                     KTSPTGISNDVMGSVPHHPFFIKLMHSLKKYDRNWIIPYVTIMSSTGPLFVSMVWQQY
                     KRWGVPKNGDVRVLQPADYKMHEHSFFSISKGSSWHLDDAKFVKSLLNHILACVVVGF
                     VFAFFVLYTEYCLYCWLCSTTGNKKAVNWRPWSWWKHEGVEEEKLRQKRLRKDSNVPF
                     VLPQVEKGFDGETV"
     gene            705717..705789
                     /locus_tag="ZYRO0F08822r"
                     /db_xref="GeneID:8205344"
     tRNA            705717..705789
                     /locus_tag="ZYRO0F08822r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.19"
                     /db_xref="GeneID:8205344"
     gene            complement(<706008..>707495)
                     /locus_tag="ZYRO0F08844g"
                     /db_xref="GeneID:8205345"
     mRNA            complement(<706008..>707495)
                     /locus_tag="ZYRO0F08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497537.1"
                     /db_xref="GeneID:8205345"
     CDS             complement(706008..707495)
                     /locus_tag="ZYRO0F08844g"
                     /note="weakly similar to uniprot|P38288 Saccharomyces
                     cerevisiae YBR162C TOS1 Target of SBF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497582.1"
                     /db_xref="GeneID:8205345"
                     /db_xref="InterPro:IPR018805"
                     /db_xref="InterPro:IPR018807"
                     /db_xref="UniProtKB/TrEMBL:C5DXY8"
                     /translation="MLFQKSLTAAAALAAFCTSFTEAGSTGGIKYTGVGFSGSYKDVI
                     SMDDSSCSCQQEDHSFSGTFAPLDEELSVHFRGPVKLLQFGVYYPAGSPQKKRDLSAV
                     EDGDCTETVAKHKHRRDVAVEYKEVTSTLVVPYSGEAQPTGGAPASGSGSAHAVVSTV
                     LATAPASGSSSPSGSASVDATGAFASPAPGVGAFASVASSGSSAATSGSSSAAPSSGS
                     SAPASSSSSSSSSASAPASSSSSAPSSSSSGSSSGGSGSWSRSAYYTPGSADGCVFMN
                     HQGGSGSGVWDMCFGNSISFAGEDGKSAASSATALGEVTFNSDEEFMIFSDESCSGND
                     CGYYREGIPAYHGFGGSDKIFVFEFTMPTDSTSGFNSDMPAIWLLNAKIPRTLQYGNQ
                     ECSCWKTGCGELDLFEVLSSGSDQLISHLHDGQGSGTDSNAGGGGPTDYFTRPTETSL
                     KAAVIFNSNANTIQLVQVDDDFGSSLDSSTVNGWLNKAASKAILM"
     gene            <709888..>714450
                     /locus_tag="ZYRO0F08866g"
                     /db_xref="GeneID:8205346"
     mRNA            <709888..>714450
                     /locus_tag="ZYRO0F08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497538.1"
                     /db_xref="GeneID:8205346"
     CDS             709888..714450
                     /locus_tag="ZYRO0F08866g"
                     /note="highly similar to uniprot|Q02785 Saccharomyces
                     cerevisiae YPL058C PDR12 Plasma membrane
                     weak-acid-inducible ATP-binding cassette (ABC) transporter
                     required for weak organic acid resistance strongly induced
                     by sorbate and benzoate regulated by War1p mutants exhibit
                     sorbate hypersensitivity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497583.1"
                     /db_xref="GeneID:8205346"
                     /db_xref="GOA:C5DXY9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:C5DXY9"
                     /translation="MSAAKEDRFEDKDSLSNVSTPNEEHSYAESLQSYEVHGATAEPH
                     GANGDPEDLRATSQISRHITNMLSNEDGTERLAAMSRIISSKTKKEMQEFEVNDLDFD
                     LRSLLNYLRSHAIEQGLTPRDSGIAFKNVTAIGIDASAAYGPSVEEMFRDLLKWPLKF
                     FKFGKKDAVPLREIVRNCTGVVESGEMLFVVGRPGAGSSTLLKCLSGEIDDYVRVEGS
                     FSYDGLDQAEMMKRYKGYVVYCPEMDFHFPKITVKETIDFALKCKTPRVRVDNMTRSQ
                     YVNSLRDMWCTVFGLRHTYATKVGNEVVRGVSGGERKRVSLVEAQCMMAALYSWDNAT
                     RGLDASTALEFAQAIRTATNMMNNSALVCIYQAGENIYQLFDKATVLYNGKQIYFGPA
                     DKAVAYFQDMGWVKPPRMTSAEFLTSVTVDFENRTLDIKPGYEDKVPKSGAEFEQRWL
                     ESEEYQELLRYYDDYQARHPADETRDRFETAKRQVLQKGQRMKSQFAVNYATQVWLCM
                     MRGFQRVKGDSTYTKVYLSSFITKGLIIGSMFHQIDHKNQSTTAGAYSRGGLIFYVLI
                     FAAVTSLAEIANSFANRPIVVKHKTYSMYHISAESLQEIITEMPIKFLAIVLLAVTTY
                     WMPLMKFTAGAFFQYFLYLFTCQQCMSFIFKFVATMTKDGTTAHAVGGLAVLMFTTAC
                     GFVIPIGEMHHWMRWFHYLNPLTYTYESLMSTEFHGRQMLCSNLVPNGAGYENVPVAN
                     KICDAAGSVKGRKYVSGDAYVQKNYHFAYKHAWRDWGVNVVWTAGYIMFNVIASEFLK
                     PLEGGGDLLLYKRGHMPNFGTENADAKTASREEMMEALNGPGVDLKKVIAEKDVFTWN
                     NLDYVIPYDGATRQLLCNVFGYVQPGKMTALMGESGAGKTTLLNVLAQRVNMGTVTGD
                     MLVNAKPLPQSFNRSCGYVAQADNHMAELSVRESLRFAAVLRQPASVPIAEKYDYVEK
                     ILLLLGMQNYAEAYVGKTGKGLNVEQRKKLSIGVELVARPALLLFLDEPTSGLDSQSA
                     WSIVQFMRALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGRMVYFGDIGPNSSTML
                     SYFERESGVKCGVSENPAEYILNCIGAGATASTSADWGDLWEKSPECAKAREEVEELH
                     RTLPSKPTNEDPELCTKFASTYPVQLKMLFKRTNLQFWRSPVYLRAKFFECIACALFV
                     GLSYVHLNHTLGAAQEAFASVFMLLLIAVAMVNQMHVFAFPSRELYEVREASSNTFHW
                     SALLLMHLLFEIIWSVACQFFCWVCYYWPAYYSGRASQAGFFWFFYVLIFPTYYCSYG
                     LWVLYMSPDVPSASMINSNIFAAFLLFCGILQPREKMPAFWRRLMYKTSPFTYVVQAL
                     VTCLVHNKKVVCGEHELLRMDPPSGQTCASYLQKYKSEQGGYIRNPGATSDCEYCPYT
                     VQDDVVRKYNIHWGQRWRNFGFLWAYIIFNVFFMLFCYYIMRVKVWSLGGLLNIKNWI
                     PKRKDRHEKDTTIFQAKPSDKNMVKK"
     gene            <716318..>720880
                     /locus_tag="ZYRO0F08888g"
                     /db_xref="GeneID:8205347"
     mRNA            <716318..>720880
                     /locus_tag="ZYRO0F08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497539.1"
                     /db_xref="GeneID:8205347"
     CDS             716318..720880
                     /locus_tag="ZYRO0F08888g"
                     /note="highly similar to uniprot|Q02785 Saccharomyces
                     cerevisiae YPL058C PDR12 Plasma membrane
                     weak-acid-inducible ATP-binding cassette (ABC) transporter
                     required for weak organic acid resistance strongly induced
                     by sorbate and benzoate regulated by War1p mutants exhibit
                     sorbate hypersensitivity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497584.1"
                     /db_xref="GeneID:8205347"
                     /db_xref="GOA:C5DXZ0"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ0"
                     /translation="MSTPKEDKFEDKDSLSNVSTPNEEHSYAESLQSYEAQGAAAETQ
                     GDEEELAATSQISRHLTNMLSNEDGTERLAAMSRIISTKTRKEMQEFEVNDLDFDLKS
                     LLNYLRSHSIDQGITPNDSGIAFKNVTAVGIDASAAYGPSLEEMLRDMVKWPVKFFKK
                     LTKSQDAVPLRNIIQNCTGVVESGEMLFVVGRPGAGCSTLLKCLSGEIADYVRVEGSF
                     SYDGLDQTEMMKRYKGYVVYCPEMDFHFPKITVKETIDFALKCKTPRVRVDNMTRSQY
                     VDSLRDMWCTVFGLRHTYATKVGNEVVRGVSGGERKRVSLVEAQCMMAALYSWDNATR
                     GLDASTALEFAQAIRTATNMMNNSALVCIYQAGENIYRLFDKATVLYNGKQIYFGPAN
                     KAVAYFQDMGWVKPPRMTSAEFLTSVTVDFENRTLDIKPGYEDKVPKSGAEFEQRWLE
                     SEEYQELLRYYDDYQARHPADETRDRFETAKRQALQKGQRTKSQFTVNYWHQVWYCMM
                     RGFQRVKGDSTYTKVYLSSFTIKGLIVGSMFHNIDNKSQSTTAGAYSRGGLLFYVLLF
                     AAVTSLAEIANSFANRPIVVRHKSYSMYHISAESLQEIITEMPTKCLAIIILGLTTYW
                     MPYMKYTAGAFFQYLLYLFTAQQCLSFIFKFVATMTKDGTTAHAVGGLAILMLCVYTG
                     FVLPIGEMHHWIRWFHYLNPLCYAYESLMSTEFHGRQMLCSQMIPSGPGYENVSVANQ
                     VCSSAGAVKGHKYVSGDAYVLKSYHFRYRHAWRNWGINVVWTAGFIMFNVILSETLKP
                     LEGGGDLLLYKRGHMPNFGTENADAKTASREEMMEALNGPGVDLKKVIAEKDVFTWNH
                     LDYVIPYDGATRQLLCNVFGYVQPGKMTALMGESGAGKTTLLNVLAQRVNMGTVTGDM
                     LVNAKPLPQSFNRSCGYVAQADNHMAELSVRESLRFAAVLRQPASVPIAEKYDYVEKI
                     LLLLGMQNYAEAYVGKTGRGLNVEQRKKLSIGVELVARPALLLFLDEPTSGLDSQSAW
                     SIVQFMRALADSGQSILCTIHQPSATLFEQFDRLLLLKKGGRTVYFGDIGPNSSTMLS
                     YFERESGVKCGVSENPAEYILNCIGAGATASTSADWGDLWEKSPECAKAREEVEELHR
                     TLPSKPTNEDPELCTKFAATYPVQLKMVLLRTLIQFWRSPVYLRAKFFECVACALFVG
                     LSYVHVNHSLGGAQEAFSSIFMLLLVALAMINQLHVFAYGSRELYEVREAASNTFHWS
                     ALLLMHTTVELMWSTMCQFFCFICYYWPANFNGRASHAGFFFFFYVLIFPLFFVTYGL
                     WILYMSPDVPSASMINSNLFAGMLLFCGILQPREKMPAFWRRLMYNTSPFTYVVQALV
                     APLVHNKKVVCNEGDYLRMDPPSGQNCGVYLKPFMSLHGGYLVNPDAGNECKYCPYTV
                     QDQVVARFNVRWDKRWRNFGFMWAYIIFNVFAMLVCYYIMRVKVWSLGSLLNVKSWIP
                     KKKDRHEKDTTIFQTKPGDENMVKKQ"
     gene            <721256..>722887
                     /locus_tag="ZYRO0F08910g"
                     /db_xref="GeneID:8205348"
     mRNA            <721256..>722887
                     /locus_tag="ZYRO0F08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497540.1"
                     /db_xref="GeneID:8205348"
     CDS             721256..722887
                     /locus_tag="ZYRO0F08910g"
                     /note="similar to uniprot|P38289 Saccharomyces cerevisiae
                     YBR163W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497585.1"
                     /db_xref="GeneID:8205348"
                     /db_xref="GOA:C5DXZ1"
                     /db_xref="InterPro:IPR019190"
                     /translation="MLRSRTKCANSLLQIRKKSHLRQVISFSSRELGLTEHELETIDK
                     LPFFDQDRVNTRKRYPTTKRQAYLNEKLPAVKLLFGEDPQYPGFISHSLPSMMPIPFE
                     ATQGTDEETIANRLSVTKLLTKSWCELRHAYDVYAKIPMFEGKPIIKGKEEHQRLEDE
                     THSLAEEQRAFEKDFEVVIPDDDFHKLAESWFASLVKMVNLFTDGEAREVLCHGYLNK
                     KKARLVEGPIIGDDDDDVLVSGIIDHLILKLRDVPVSNNVLPLRLENAIVSKNCEDIA
                     VVFDQLERAGPNLQNKFEIMVSDVKTRFMRKIPSQPSVLKASKLQVMYYRYFMEVLGQ
                     NPQETYNKLLINAQRRGFDVNRFIDPAKVLSMMATDDMIRMDMYRLKNGDAIGFEPFD
                     DSELNVSESATYDMSDYHDIITDARVIQKYSDFFEPWAKPVTLKYFAARLAQMYHHLR
                     PLLSNKLMIEYYYNGDNFHNIIFEFDPKLLRESSSDSAKFWFGQRDIEPISRNLKNFL
                     TFCKYCDYESVCSWKRGGNDMCKELGTDLAKIQKS"
     gene            complement(<723285..>723728)
                     /locus_tag="ZYRO0F08932g"
                     /db_xref="GeneID:8205349"
     mRNA            complement(<723285..>723728)
                     /locus_tag="ZYRO0F08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497541.1"
                     /db_xref="GeneID:8205349"
     CDS             complement(723285..723728)
                     /locus_tag="ZYRO0F08932g"
                     /note="similar to uniprot|Q02784 Saccharomyces cerevisiae
                     YPL059W GRX5 Hydroperoxide and superoxide-radical
                     responsive glutathione-dependent oxidoreductase
                     mitochondrial matrix protein involved in the
                     synthesis/assembly of iron-sulfur centers monothiol
                     glutaredoxin subfamily member along with Grx3p and Grx4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497586.1"
                     /db_xref="GeneID:8205349"
                     /db_xref="GOA:C5DXZ2"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR004480"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR014434"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ2"
                     /translation="MFARFAPRFAPGFAPRFAGLPRVSLLRQTQLFMSTETRAAIKEA
                     IGSAPVVLFMKGTPEFPQCGFSKATISLLGQQGVDPMKFAAYNVLEDPELREGIKEYS
                     EWPTIPQLYVNKEFVGGCDILTTMAQSGDLCNLLEQANVLVPEED"
     gene            724213..724284
                     /locus_tag="ZYRO0F08954r"
                     /db_xref="GeneID:8205350"
     tRNA            724213..724284
                     /locus_tag="ZYRO0F08954r"
                     /product="tRNA-Cys"
                     /note="tRNA-Cys (GCA) cove score=75.27"
                     /db_xref="GeneID:8205350"
     gene            <725016..>730517
                     /locus_tag="ZYRO0F08976g"
                     /db_xref="GeneID:8205351"
     mRNA            <725016..>730517
                     /locus_tag="ZYRO0F08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497542.1"
                     /db_xref="GeneID:8205351"
     CDS             725016..730517
                     /locus_tag="ZYRO0F08976g"
                     /note="highly similar to uniprot|P32528 Saccharomyces
                     cerevisiae YBR208C DUR1 2 Urea amidolyase contains both
                     urea carboxylase and allophanate hydrolase activities
                     degrades urea to CO2 and NH3 expression sensitive to
                     nitrogen catabolite repression and induced by allophanate
                     an intermediate in allantoin degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497587.1"
                     /db_xref="GeneID:8205351"
                     /db_xref="GOA:C5DXZ3"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR003778"
                     /db_xref="InterPro:IPR003833"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR014084"
                     /db_xref="InterPro:IPR014085"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="InterPro:IPR024946"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ3"
                     /translation="MTKDLSELTKGWSACEWVEFHLKSVPNASYELLLNLLKSQKCAP
                     EDPAWISLVSESNLQQQWQVLQSKSKKESLPLYGVPIAIKDNIDVYGVETTAACPSFA
                     YKPTKDSKVVELLRDAGAIIIGKTNLDQFATGLVGCRSPYGKTTCAFSDKHVSGGSSA
                     GSGAIVARGVVPLALGTDTAGSGRVPAALNNLIGLKPTRGVFSCKGVVPACKSLDCVS
                     IFALNLSDAERAFKVLCQPDESNDEYSRPFTPNPLRSYPNDVCIAVPKTVPWFGETEN
                     PKLYANAIESLRLMGARVVTIDFEPLLELARCLYEGAWVAERFEALRDFLATDPPSDS
                     LDPTVTKIIKSGANYSAADAFKFEYKRQGILRKVESLLQGIDVLCVPTCPLNPTLEDL
                     ENEPVLVNSRQGTWTNFVNLADMSALAIPAGFRPDGLPNGVTLIGKKFTDYALLDLAK
                     RYFQTKYPGGTRNYGIFTERHVGTMDDELTGPDVTESKSIKLAVVGAHLKGLPLHWQL
                     EKCNATYLSSPKTSKNYKLYALPKTGPVLKPGLRRVDEVAGSQIQLELYSVPLEKFGT
                     FMSMVPEPLGIGSVELENGEWVKSFICEEVGYAAKGSVDITPLGGFKPYIEHLQKEGA
                     KVQRPFKTVLVANRGEIAVRIIKTLKKLNITSVAVYSDPDRYAQHVLDADIAIPLHGV
                     SSTQTYLDIEKIIRAAKETNTEAIIPGYGFLSENADFSDRCAVEGIVFVGPTGDAIRK
                     LGLKHSAREIAAKAGVPLVPGSPLVTSPSDAKKIAAELEYPIMVKSTAGGGGIGLQKV
                     DSEDQIERVFETVQHQGKSFFGDSGVFLERFVENARHVEIQMMGDGYGKAIALGERDC
                     SLQRRNQKVVEETPAPNLSDSTRARMRKASENLGSLLKYKCAGTVEFIYDEKRDEFYF
                     LEVNARLQVEHPITEAVTGLDLVEWMLRIAADQPMDFNSSHINVSGAAIEVRLYAENP
                     VKDFRPSPGQLTEVKFPKWARVDTWVTKGTRVSAEYDPTLAKIIVHGTDRNDAILKMN
                     RALNETAVYGCVTNLDYLRSIVSSSMFKEAKVATKVLDSYDYKPYAFEILSPGAHTSI
                     QDYPGRLGYWRIGVPPSGPMDSYSFRLANRIVGNNSKAPAIEVTLAGPKLKFHTEAII
                     AITGGKAPCLLNGSEISQNQAINVKTGDELAIGKLITGCRSYLAIRNGVDVPEYLGSR
                     STFTLGEIGGYNGRVLKLGDVLFLNKPELEATSLPGPEYAPESAPEELIPQISGDKEW
                     TIGVTCGPHGSPDFFQEESAQQFFSETWKVHYNSNRFGIRLIGPKPKWARADGGEGGL
                     HPSNAHDYVYSVGAINFTGDEPVIVTCDGPSLGGFVCEAVVAEAEMWKVGQVRPGDVI
                     RFAPISYAVARELKESQDEAISTLSKTSLNVLTSNLELSTFENAILAEIPKRSDYSPK
                     VTYRQAGDRYILVEYGENQLDFNVSYRINRLIDLVRRHETVGIAEMSQGVRSVLIEFD
                     GYKISQKELLRTLMAYENEMHFDKNWSVKSKVIKLPMAFEDSKTLACVTRYQETIRST
                     APWLPNNVDFIADVNGITREDVRNMLYSARFLVLGLGDVFLSSPCAVPLDPRQRFLGS
                     KYNPSRTFTERGAVGIGGMYMCIYAAASPGGYQLVGRTIPIWDKLSIYPNAKDPWMLS
                     PFDQIEFYPVSEEELEKLTEDCENGQFAVDIEDGVFDHRDYLEWVQENAESIEEFQKK
                     QLGEKSAEFAQLIQVSNSELEQSQPSKPEVQESYPEDAELVYSEYSGRFWKPVVKEGD
                     FVKKDQGLIVVEAMKTEMTVVAPQDGKVYKILHKNGDFVDAGDVVAVLQ"
     gene            complement(<730755..>732056)
                     /locus_tag="ZYRO0F08998g"
                     /db_xref="GeneID:8205352"
     mRNA            complement(<730755..>732056)
                     /locus_tag="ZYRO0F08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497543.1"
                     /db_xref="GeneID:8205352"
     CDS             complement(730755..732056)
                     /locus_tag="ZYRO0F08998g"
                     /note="similar to uniprot|P38310 Saccharomyces cerevisiae
                     YBR207W FTH1 Putative high affinity iron transporter
                     involved in transport of intravacuolar stores of iron
                     forms complex with Fet5p expression is regulated by iron
                     proposed to play indirect role in endocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497588.1"
                     /db_xref="GeneID:8205352"
                     /db_xref="GOA:C5DXZ4"
                     /db_xref="InterPro:IPR004923"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ4"
                     /translation="MGFENYFSFQIFFIFLRESLEIIVIISILLAIVKQALSIHDDQD
                     RLSESRSRTEELAPLSLEEEEEVYDFMDGATPEERERSKSIDSVKLYSTLKIQIISGG
                     VLGLLLCMLIGGTFIVIFYHIGADIWGASEHIYEGVLSIFASVIISAMGLFFLRIGKL
                     REKFRIKLASIIYSDRGMLLRAHSNKTVNFSEKYAFFILPFITSLREGLEAVVFIGGV
                     GIDQPLTSIPLSMLSACSISGIFGYFFFKYSESLSLKICLVVTTCFLYMIAAGLFSKG
                     VWQLELQDYINKCGGQDMSEVGSGPGSYDISRSVWHVNCCNGETDGGWMILTAIFGWT
                     NSATYGSVTSYIVYWLAIIAVIHLLKSEEKGYIPYLPIRLQRSRMMKRLKIAKASLDL
                     KSANTSGPSGSGSLPVSGHRDSGDSSTPLYDQSNEDHGATR"
     gene            complement(<732319..>733470)
                     /locus_tag="ZYRO0F09020g"
                     /db_xref="GeneID:8205353"
     mRNA            complement(<732319..>733470)
                     /locus_tag="ZYRO0F09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497544.1"
                     /db_xref="GeneID:8205353"
     CDS             complement(732319..733470)
                     /locus_tag="ZYRO0F09020g"
                     /note="similar to uniprot|Q6B1B1 Saccharomyces cerevisiae
                     YPL060W LPE10 Mitochondrial inner membrane magnesium
                     transporter involved in maintenance of magnesium
                     concentrations inside mitochondria indirectly affects
                     splicing of group II introns functionally and structurally
                     related to Mrs2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497589.1"
                     /db_xref="GeneID:8205353"
                     /db_xref="GOA:C5DXZ5"
                     /db_xref="InterPro:IPR026573"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ5"
                     /translation="MWSITTRRIPSLVRTFCQSKRVWHQVDIEASTLLQKNLLQRNNA
                     LYNYGSGTIRCTIFDKVGQYHPVEMKRKDLVSKHELLPRDLRKIERSRKQDLVPSLLV
                     RQNGILISLLTTRALIMPDMVVVFDSVGSGISLDSRTHKKFIQDLELRLGNQVVDKDS
                     LPYEFRALEAIFVSALSNMSSEMKVLLTVCNGILEDLEYSITRDKLRFLLVQNKKLTV
                     FRRKAVLVREMLNDILEQDDMLCGMYLSDKLRGNLRAKDDHAEIEMLLETYYTHVDEI
                     VQTVEGTISNTKTTEEIINIVLDSNRNQLMLLGIRFAMGTLSLGAALWIGSLYGMNLE
                     NFIEETSFGFIFVTTLGLLGMSWLFIYSIRQLHKLQKMSLAASSHINIK"
     gene            complement(<733616..>734857)
                     /locus_tag="ZYRO0F09042g"
                     /db_xref="GeneID:8205354"
     mRNA            complement(<733616..>734857)
                     /locus_tag="ZYRO0F09042g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497545.1"
                     /db_xref="GeneID:8205354"
     CDS             complement(733616..734857)
                     /locus_tag="ZYRO0F09042g"
                     /note="highly similar to uniprot|P38130 Saccharomyces
                     cerevisiae YBR205W KTR3 Putative alpha-1
                     2-mannosyltransferase involved in O- and N-linked protein
                     glycosylation member of the KRE2/MNT1 mannosyltransferase
                     family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497590.1"
                     /db_xref="GeneID:8205354"
                     /db_xref="GOA:C5DXZ6"
                     /db_xref="InterPro:IPR002685"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ6"
                     /translation="MATIQRKRLMPKSAFLVKKYRRGIRISFTALCILLTLLFIMHAP
                     SSTTKDATTLNTGTDIASTSAISDPSNKEYLMPFTDKAQKVVHPKDDGIKENAVMVTL
                     ARNSDLWSLVHSIRHVEDRFNHKYHYDWVFLNDDEFTDEFKRVTSNLVSGEAKYGKIP
                     KEQFSTPPSIDKDKLSTTLKTMRDNGVIYGDSVPYRHMCRYQAGLFYRHPLLQQYNWY
                     WRVDTDITIFCDIQYDLFKFLRVNDKKYGFILSVSEYEATIPTLWSTTRKFMKEYPHL
                     VHKNNLMKYISDDNGETYNLCHFWSNFEIGSLDFWRSEAYDKYFEYLDQSGGFYYERW
                     GDAPVHSIAAALFLDRSQIHFFDGLGFHHPDFLSCPVEEDIRIQNHCTCNPNRDNTWG
                     ASYFCTRKFFLTQNYPLPPGV"
     gene            <735162..>736211
                     /locus_tag="ZYRO0F09064g"
                     /db_xref="GeneID:8205355"
     mRNA            <735162..>736211
                     /locus_tag="ZYRO0F09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497546.1"
                     /db_xref="GeneID:8205355"
     CDS             735162..736211
                     /locus_tag="ZYRO0F09064g"
                     /note="similar to uniprot|P38139 Saccharomyces cerevisiae
                     YBR204C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497591.1"
                     /db_xref="GeneID:8205355"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ7"
                     /translation="MKFDLNRVVEEVCLLEGQPLSERSLAAIVGEYDDGPTLSKTIRG
                     IGAEKDFNTRFIADRAECVDVRGKKIRVCHNCQDSSQVHELFLFIHGLGGELEQFEPL
                     LRLVDAMDQRFLALDLPGFGKSDEWDEYPMLKVVETIEEIAAKFNAAKIVLVGHSMGC
                     YLTSHFYEAYHKVHSINRIVLLSPPKRVLYELQGNVVQWGIWFGYKLPWLFDFYRSWF
                     DQSKGLASSGIRGFFSNDTITTIQTYRKLWQFHNNVQIKSRTIFGYLSGWQPIQWDKL
                     NQIWNVTATTLVVMCGDRDAVTPISAAQEIVESLPEHMEKKLVTIPDCGHHVCFDTPG
                     ETCRLFAHYVLNKDV"
     gene            complement(<736323..>738248)
                     /locus_tag="ZYRO0F09086g"
                     /db_xref="GeneID:8205356"
     mRNA            complement(<736323..>738248)
                     /locus_tag="ZYRO0F09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497547.1"
                     /db_xref="GeneID:8205356"
     CDS             complement(736323..738248)
                     /locus_tag="ZYRO0F09086g"
                     /note="weakly similar to uniprot|Q08905 Saccharomyces
                     cerevisiae YOR381W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497592.1"
                     /db_xref="GeneID:8205356"
                     /db_xref="GOA:C5DXZ8"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ8"
                     /translation="MNFNNTLFIRHANSGGDTSATLSSTVTSMTKSASAKPSPNPTYA
                     AKSKHLRTLNKQRGVWWGSGLMGFWALLVLISSIEHWSSRFFPNASMRCKKAMIRNPI
                     ARLWRKHITMPALFNQKHTTRVMFGGVIPTRFESLVLFAYFVLIVIGESVNYSYYKNN
                     TYWKERKQQISRYVGDRSAKITIFMIDALYLFAGRNNFLIWLTGWKISTFYAFHKWTG
                     RMAIVSSLVHTITMLINSYWIKKIHTRKYTAWWRWGSVAMVCGGIMLIQSLPMIRNRF
                     YSIFLYGHIVLAVFFLIGIWIHIKPFGDGPHAYAITAVWCFDRIMRILKISQFGLRLA
                     HIKLVDDDTLVMTIPSTVSIKKPTPGSFAYVYFLEGWNFFQSNPFTVICEDNGDTKFL
                     IRVKNGITKQMYRRILKHPEQEITTRVAIEGYYGEYKTAYAYDEVIMVGGGNGVVGLY
                     EYIKEIANKKKAGKSNVKFIKLYWTIKISDNIEWLATELMRLQEYDFVKPIVYMTRSQ
                     PRNKSDRLGFDVDGGNRTSSSDGSQREVEIEETGVGGTEDGSKAEEKIKENIVSTTNM
                     DEIESEFSHVEFRRSRPHIPQLLHDDIQECDPSDNICVMSCAHNAMCDDVRKTVSFEV
                     GEPRSGRIDLVELLQTW"
     gene            complement(<739081..>740883)
                     /locus_tag="ZYRO0F09108g"
                     /db_xref="GeneID:8205357"
     mRNA            complement(<739081..>740883)
                     /locus_tag="ZYRO0F09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497548.1"
                     /db_xref="GeneID:8205357"
     CDS             complement(739081..740883)
                     /locus_tag="ZYRO0F09108g"
                     /note="some similarities with uniprot|P38308 Saccharomyces
                     cerevisiae YBR203W COS111 Protein required for wild-type
                     resistance to the antifungal drug ciclopirox olamine not
                     related to the COS family of subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497593.1"
                     /db_xref="GeneID:8205357"
                     /db_xref="UniProtKB/TrEMBL:C5DXZ9"
                     /translation="MVVKEVPMQSVKQDVKEMESVSRSKLYKSLISLPSRKASESRNN
                     NHNNRIRRQGKQTKFKKWRRLPPEIVSRILSMLDNEGDQQTIVECLFVNQTFYHAAKE
                     VLYSCPHFTSTYRVAQFVTCLRQCENNGLLVRKLDLSQLRSGELTGLGGSWRDWQARY
                     SATRKCGHRPSVSVGSLENYLYHNNNGSYSNNNNYYSYSNSRGHRSNSSLSNASTRSG
                     SNSSGGSGGSSSSSSGESSSSGETPRKWTSLWTKFKRNSQKNKAITTSSASRPTNHKR
                     SASTATVSTASSTGIANYNHPHPHPHQHATIKNSAPYASYKDLPLGHLLHLLRLCKNL
                     IHLDLSHLILSTDFELPSSGQPQPRSMVPGAPVEPRATYLTDSTKPWDMNNNNYNNAQ
                     LCKLNPEIIFEILLERPTIRQLRMDNIVWVRQSMVSSYVLQAFTSGRETQLLSFNRSG
                     LHRHLAWTCQGTVQDLVALVIMDHVVSSDDLALQGLFPTIPQLHPDILEISHVFPIEL
                     QPNGVGSSFMVRLTILKTSGITTHHLRKLCPQYLSLVILLGDTPTSSSQPNVVEKRLA
                     KRAKISLRRLKELRNTDLRRALGQNYLVSGTSEI"
     gene            complement(<741490..>742959)
                     /locus_tag="ZYRO0F09130g"
                     /db_xref="GeneID:8205358"
     mRNA            complement(<741490..>742959)
                     /locus_tag="ZYRO0F09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497549.1"
                     /db_xref="GeneID:8205358"
     CDS             complement(741490..742959)
                     /locus_tag="ZYRO0F09130g"
                     /note="similar to uniprot|Q02776 Saccharomyces cerevisiae
                     YPL063W TIM50 Protein of the inner mitochondrial membrane
                     required for import of mitochondrial matrix proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497594.1"
                     /db_xref="GeneID:8205358"
                     /db_xref="GOA:C5DY00"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR027111"
                     /db_xref="UniProtKB/TrEMBL:C5DY00"
                     /translation="MLALRRSTTLLGRVATNATLVRPMPRRLNFGTFSSVMQKKQQDG
                     KDEKPQSILSEDLLAKAGFDLDDPSNQHQQKSQEGDSEAGKGAAGASESGRGDDKKKR
                     RKRQSSTDIKRERYANWFYIFTFASLAGVGLYMTRDWEEGDSKEVRQGVDNGYTAQLM
                     YQRFMTRIHNMFSYFQEPPFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSKKYGWR
                     TAKRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLDPIHAFISYNLFKEHCVYKD
                     GIHIKDISKMNRDVGKVVMIDTDPNCYKSQPENAIPAKPWDGTPDDGLLQLIPFLEYL
                     ATQQVNDVRPILSSFQDKSKIPTEFTQRVEKLKAKFFADHRAKTQDNWALTLLGVAPS
                     ASSVKFPLDMIREEGEKNYIRFMQLIEEEKEKIRIQQEQLGGQTFTLKDYVEGNIPSP
                     EEQVKMQLEKQQEVEQLYEQRKKEKAEQKRQQQLQQQQN"
     gene            <743076..>743864
                     /locus_tag="ZYRO0F09152g"
                     /db_xref="GeneID:8205359"
     mRNA            <743076..>743864
                     /locus_tag="ZYRO0F09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497550.1"
                     /db_xref="GeneID:8205359"
     CDS             743076..743864
                     /locus_tag="ZYRO0F09152g"
                     /note="weakly similar to uniprot|Q02770 Saccharomyces
                     cerevisiae YPL064C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497595.1"
                     /db_xref="GeneID:8205359"
                     /db_xref="GOA:C5DY01"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DY01"
                     /translation="MSIEPSTSSKCIINTSKGRIDVELWARELPNTTKIFLESCQGQK
                     LQRFDGVRSNGTVTIVGGSPDKKLDYERHARIRGCRRGSVGYDRNVNQWFFASQECSI
                     EDDSWILIGKIVGESNYVLRRIVGESQLDDRGKFVYPPIVNKTEVTVPHFDLGTLPQV
                     GPNLPKEEKPRFFKRGNAKVKLSYEEEEEEEDYERDAVPLKKIKPPPGVKDKGKNDPS
                     TKTQALKEKEPTEEISLREKETLALLSQFQQRQKGRDNILNRRP"
     gene            complement(<744109..>745638)
                     /locus_tag="ZYRO0F09174g"
                     /db_xref="GeneID:8205360"
     mRNA            complement(<744109..>745638)
                     /locus_tag="ZYRO0F09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497551.1"
                     /db_xref="GeneID:8205360"
     CDS             complement(744109..745638)
                     /locus_tag="ZYRO0F09174g"
                     /note="weakly similar to uniprot|Q03656 Saccharomyces
                     cerevisiae YMR216C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497596.1"
                     /db_xref="GeneID:8205360"
                     /db_xref="GOA:C5DY02"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DY02"
                     /translation="MTSVTVTSLAQSIYSGSSETLNEVDDEIVVEGNGVILESDSDST
                     VIGKNYSVDELYLEEPLSDYCLGGYHRGYVGEALGPDDRYVLLRKLGWGGYCTVWLAH
                     DKRHNRHVAIKIHKSSSEYSYAARKELQILRKIQSVARSSSHPGSPHIVELLDAFAHL
                     GPHGLHVCLVFEPLNESLLSLLGQCHQGATCNLKEVGTSCVKDGLPLELVKEVTRQVL
                     LALDFLHKECGIVHSDIKPENVMLEFPELPNKWDVVKFLHEYSLQEQKRNGDDFIKFT
                     VSKPLPSPLFHTFTEDLDGFSKPDFAQACGKHWKDFFKVKLVDFGNACPLTNKTQGYN
                     VQTFEYRAPEIFLQYPEWGYAADVWSTACLFSEMCTARYLFRTENNWPQASSQLELFS
                     TTLGPASGAFLDKCILFKNYEHCVKNRQFRSISENFKEELGMERLLAQRIEQFLMPML
                     QWDPAERADAMTCANHPFLRNENLISIGKLKGAITKPLLTKTPLTKSFKKFLRAGSIL
                     N"
     gene            complement(<746469..>747239)
                     /locus_tag="ZYRO0F09196g"
                     /db_xref="GeneID:8205361"
     mRNA            complement(<746469..>747239)
                     /locus_tag="ZYRO0F09196g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497552.1"
                     /db_xref="GeneID:8205361"
     CDS             complement(746469..747239)
                     /locus_tag="ZYRO0F09196g"
                     /note="similar to uniprot|Q02767 Saccharomyces cerevisiae
                     YPL065W VPS28 Component of the ESCRT-I complex which is
                     involved in ubiquitin-dependent sorting of proteins into
                     the endosome involved in transport of precursors for
                     soluble vacuolar hydrolases from the late endosome to the
                     vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497597.1"
                     /db_xref="GeneID:8205361"
                     /db_xref="InterPro:IPR007143"
                     /db_xref="InterPro:IPR017898"
                     /db_xref="InterPro:IPR017899"
                     /db_xref="UniProtKB/TrEMBL:C5DY03"
                     /translation="MQIIPLFEPGVSIRQREVAETLAEVYSIVICVDQVEKMYLKDVI
                     PDESEYNRVTARLLQQYRAIMANNDQDHDFQMAFGGSLQEFCKRYGVIASNGVLRLEK
                     GIPLTTEHAAAAGASKSSTSTASATNAAGAADGSITKDVDRNLQSNSANNGNGAKTTG
                     ENLARGIAEATGNFITVMDAVKLGYRTRDQLHPLLAELLLSTNRVARLESRSRGRLVE
                     WLVHVNRLRGQESIDEKAARELLGDLDTAYREFYSALG"
     gene            complement(<747451..>748779)
                     /locus_tag="ZYRO0F09218g"
                     /db_xref="GeneID:8205362"
     mRNA            complement(<747451..>748779)
                     /locus_tag="ZYRO0F09218g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497553.1"
                     /db_xref="GeneID:8205362"
     CDS             complement(747451..748779)
                     /locus_tag="ZYRO0F09218g"
                     /note="similar to uniprot|Q12194 Saccharomyces cerevisiae
                     YPL066W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497598.1"
                     /db_xref="GeneID:8205362"
                     /db_xref="UniProtKB/TrEMBL:C5DY04"
                     /translation="MTHPVISLKPSYNSVIRGCPGLPDTLPRIECELRIRSNDGKAFR
                     IDKIEVVLKGIESLLNGHHSFAPKSKVEKVTVHYKKNIKMSEKKIVGIDIPLTIGLPE
                     DVKETNFNSSFGSSITLLECTVRYNGLEDPQVFAQAVNVEKYTIVPNPKRFPSVSRQV
                     SSPDRKFSVDYTVVNPCVSVDDNLNLQLEIRPNGKVIGDSSSNSLFGKKFTKLKAVVV
                     GLKECLEILDPATGFGETRENVLREMVHTFDERISSNGIKLKLEMPVQARIGLFGEFE
                     SSLQEPDMLHRIGPQAVSHLPSTRLLQTKTHGSSGIPFQYHSSITTTGGSLFRITHSA
                     AVKVKISSGKSFHLNHLIDISPWTQQQLKGLDQLVTHEKETAKFARQFYDNFGGITRK
                     NKPTMSHSPAVVEYPPLPPVVYPNDNETLRKLDIKYANVGSFSHRIPLLE"
     gene            complement(<749042..>751558)
                     /locus_tag="ZYRO0F09240g"
                     /db_xref="GeneID:8205363"
     mRNA            complement(<749042..>751558)
                     /locus_tag="ZYRO0F09240g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497554.1"
                     /db_xref="GeneID:8205363"
     CDS             complement(749042..751558)
                     /locus_tag="ZYRO0F09240g"
                     /note="highly similar to uniprot|P38132 Saccharomyces
                     cerevisiae YBR202W CDC47 Component of the hexameric MCM
                     complex which is important for priming origins of DNA
                     replication in G1 and becomes an active ATP-dependent
                     helicase that promotes DNA melting and elongation when
                     activated by Cdc7p-Dbf4p in S-phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497599.1"
                     /db_xref="GeneID:8205363"
                     /db_xref="GOA:C5DY05"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR008050"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5DY05"
                     /translation="MNSALPSIQLSVDYQQLSSQIHDFLTHYKEDVVGGARIDEDDDM
                     QEYDNNDGIGKGPKYLQILQKVANRELDTVHIELDDIYRYQGEKFLEGGGDIDLVAVI
                     EENTRHFVDLFSRAIDDIMPLPTKEISYKDDVLDVILTQRRLRNERTVSDRTNEIRNE
                     NSMDPNAAPNSMNAALREVVEEEAELFPPNLTRRYFLYFRPLSPHFAKTKKEKNPSRT
                     AMSVREVKGDYLGRLITVRGIVTRVSDVKPAVMVVAYTCDQCGYEVFQEVHSRTFTPL
                     VECTSKECTQNQTKGQLFMSTRASKFSAFQDCRIQELSQQVPVGHIPRSLAVHVNGAL
                     VRTLSPGDVVDVTGIFLPSPYTGFKALKAGLLTETYLEGQYVHQHKKKFATFQVTPEV
                     RNQVAEMISQGNIYERLAKSIAPEIYGNLDVKKTLLLLLVGGVDKRVGDGMKIRGDIN
                     VCLMGDPGVAKSQLLKSIIKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMVLEGGAL
                     VLADNGICCIDEFDKMDEGDRTVIHEVMEQQTISISKAGINTTLNARTSILAAANPLY
                     GRYNPRLSPLENINLPAALLSRFDILFLLLDMPNKEEDEKLAEHIAFVHMHNRQPDLN
                     FTPIEPSKMREYIAVAKTKRPVMSHTVNEYVVQAYVRLRQDSKREMDSKFSFGQATPR
                     TLLGIVRMAQALAKLRLADSVDFEDVEEALRLIKVSKESLYQDDRRKTTEDENPITKI
                     FTIIKKMAQESSEQYKKALPYDTIVKVVRSRGFTMLQLNNCIQEYSYLNVWHLINEGS
                     VLKFVDDGSMDEGNDATPEAPVGLAQAALAPDAEDAEMQD"
     gene            complement(<751947..>753674)
                     /locus_tag="ZYRO0F09262g"
                     /db_xref="GeneID:8205364"
     mRNA            complement(<751947..>753674)
                     /locus_tag="ZYRO0F09262g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497555.1"
                     /db_xref="GeneID:8205364"
     CDS             complement(751947..753674)
                     /locus_tag="ZYRO0F09262g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497600.1"
                     /db_xref="GeneID:8205364"
                     /db_xref="GOA:C5DY06"
                     /db_xref="InterPro:IPR009486"
                     /db_xref="UniProtKB/TrEMBL:C5DY06"
                     /translation="MLLQSLVTGLAIASATALPFQKDVDSNGTSTAIPAESTFPVGTM
                     NVTSTDGAANGTMMPSSMAPNATAMPSPIAPNATVITTITSAAIQPNGTTVLPGGTTS
                     LSNHTVYQNYTITEAPKPTTYTAVIGGVTKTTTIGTVVETTCIDGVTIETCPVCDAQN
                     STVTATPANNQTLTYTAVVGGTTETKTVGNQTVTTCVGGTTVETCFNCGPVTSASSTQ
                     APEATSTATVPSCAPPAYFKPKVMIVNMFELEQTQWIEKLELTENITVPMLSPVYPHV
                     HANKNWTIMSFTTGEAESNAAASFTALLSSSLFDFSETYFLISGIAGGSPIETSIGSV
                     TFPKFAVQVGSAYELDSREIPGNWTYGYVNYGDDQPNKYPTQWYGTEVFELNGNLRNR
                     ALALANNATLTNLTSDLEKLIHKYNSSYAAVKGPQVVACDTATSDVYWKGFRLAQWAE
                     DTVRTYTNGTAKYCSTQQEDNASLEAILRATKFGLVDYNRVVISRSISDFDRPFNGVN
                     VTQFALNGTLSYAGQSTQIALDNLYNAGLPFVQDVITNWESLYKVNHFNPKNYTGDYF
                     ETLGGKKNF"
     gene            <754433..>755767
                     /locus_tag="ZYRO0F09284g"
                     /db_xref="GeneID:8205365"
     mRNA            <754433..>755767
                     /locus_tag="ZYRO0F09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497556.1"
                     /db_xref="GeneID:8205365"
     CDS             754433..755767
                     /locus_tag="ZYRO0F09284g"
                     /note="similar to uniprot|P39946 Saccharomyces cerevisiae
                     YOR269W PAC1 Protein involved in nuclear migration part of
                     the dynein/dynactin pathway targets dynein to microtubule
                     tips which is necessary for sliding of microtubules along
                     bud cortex synthetic lethal with bni1 homolog of human
                     LIS1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497601.1"
                     /db_xref="GeneID:8205365"
                     /db_xref="GOA:C5DY07"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017252"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /translation="MDLPLSDEQIRELDESTLDYLLWRNKGIDITQLANSLQVDAPTL
                     QEDTNRLPLLARKWTAIARLQRRIMSLEQNIRDLREASIEMNAPAFSPESSESARIAW
                     IAPAQPRASITLESPVTGVRLHPELAVVFVSTEQGRLHCFDLMDITLPLASIQAHTRA
                     ITSVDVFCWQQTTYVVTGSKDMQVRVFTWSAGQGLKLLRSFAGHEHVVSGVRIWVGPR
                     TTNIGGGSLLLASCSRDTSVKIWDVNSGWCLKSFQPHSDWVRCLDVYGEFLITGCQDS
                     TLRLTHWPSGNGLSVGLGHDFPVESVRFIGSLQDAVTTEGRTNNWLGHCVSTSRDRTS
                     KIWLLPQPRRLPQRPPVPHSTDAQFLCKWTLRGHDSWIKAVGSRGDHVFTASDDKSVI
                     CWNWTNGQCLKKWNRIHQGFVTCIDLDDSNHPLKRKIMVTGGIDCKCHIFMQ"
     gene            complement(<755837..>758299)
                     /locus_tag="ZYRO0F09306g"
                     /db_xref="GeneID:8205366"
     mRNA            complement(<755837..>758299)
                     /locus_tag="ZYRO0F09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497557.1"
                     /db_xref="GeneID:8205366"
     CDS             complement(755837..758299)
                     /locus_tag="ZYRO0F09306g"
                     /note="similar to uniprot|P32563 Saccharomyces cerevisiae
                     YOR270C VPH1 Subunit of vacuolar-ATPase V0 domain one of
                     two isoforms (Vph1p and Stv1p) Vph1p is located in
                     V-ATPase complexes of the vacuole while Stv1p is located
                     in V-ATPase complexes of the Golgi and endosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497602.1"
                     /db_xref="GeneID:8205366"
                     /db_xref="GOA:C5DY08"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:C5DY08"
                     /translation="MAVSEEAIFRSADMCLMQLYIPQEIAREMVYTVGQMGLVQFRDL
                     NKKVNAFQRTFIDDLKRLDNVERQYRFFHKLLKKHGISLLEEVSEESGQLTLAPATGV
                     IDDHAQNATLLEERLSQMEEASEQLELQKADLEQYRFLLQTGEQFFTRDAGSLSVEPA
                     FQDPEAALAGLPESVSYVTGVVLTEKVGILEQILWRALRGNLYFRHLSLGETIYDSSR
                     KERVRKSAFIVFSHGDLIIRRIKKIAESLDAHLYDVRETSEARSKQLQKVNQGLADLY
                     TVLETTNTTLNSELYAVGRELYGWFQDISREKHVYETLNKFDFDQGRKTLIGEGWVPE
                     DELGSLQAKLREVTQTLGVDVPSIIQLLETNRTPPTFHRVNKFTAGFQIICDCYGIPQ
                     YKEVNPGLPTVVTFPFMFAIMFGDIGHGIIMSLVALVMVLNESKLELLKRGEIFDMLY
                     SGRYIVLLMGLFSVYTGSLYNDIFSRSLTFFSSGWEWPDHWQVGELVNANQVGTYPFG
                     LDWKWHGSDNGLLFTNSYKMKLSILMGMAHMTYSYFFSLVNHLYYGSWIDIFGSFLPG
                     LLFMQSIFGYLSVAVIYKWARDWVKDGKPAPSLLNMLINMFLAPGVIDDELYPHQAGV
                     QVFLLLLALICIPWLLLAKPIYFTIKKRGSQASGDALEEHEALLNQQDEGENGNDQVP
                     SGEENEEDDEEGEHEEAIGDLIIHQVIYTIEFCLNTVSHTASYLRLWALSLAHAQLSQ
                     VLWDMTISLAFGPTGTLGVFMVVFLFAVWFGLTCAVLVCMEGTSAMLHSLRLHWVESM
                     SKFFVGEGIAYEPFQLLPQELE"
     gene            <758697..>759953
                     /locus_tag="ZYRO0F09328g"
                     /db_xref="GeneID:8205367"
     mRNA            <758697..>759953
                     /locus_tag="ZYRO0F09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497558.1"
                     /db_xref="GeneID:8205367"
     CDS             758697..759953
                     /locus_tag="ZYRO0F09328g"
                     /note="similar to uniprot|P07277 Saccharomyces cerevisiae
                     YMR208W ERG12 Mevalonate kinase acts in the biosynthesis
                     of isoprenoids and sterols including ergosterol from
                     mevalonate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497603.1"
                     /db_xref="GeneID:8205367"
                     /db_xref="GOA:C5DY09"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006205"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DY09"
                     /translation="MSVPFLVSAPGKVIIFGEHSAVYNEPAVAASVSALRTYLFVEPS
                     EDPEEIELDFPDINFNHKWHYNDFASILQDAEGLEEARLNTRELSQKIVSQLEVVQGE
                     LRNTLYYYAALCFCYLYVCLCPHIKGMKFHVKSTLPIGAGLGSSASISVALSLAMAHL
                     SGHIRADKPELSVSEKKFINTWSFLGEKCIQGTPSGIDNAVATYGNAVLFKREMDGTT
                     NFEFVEQFPQIPMVLTYTKIPRSTKTLVGNVRELVIRQPNVIKPVLTAMGQLALRGTE
                     ILDSLDDKNYEELLELVRVNHGLLVALGVSHPGLELVRFECDTNALGATKLTGAGGGG
                     CLLTILHKTTTQEQVQQFKTKLESSYGYKTFQTDLGGIGCGILPRDLIADDKLENIKS
                     LFCQEVSNDRIDQLLLPGKTDLHWIH"
     gene            complement(<759962..>760933)
                     /locus_tag="ZYRO0F09350g"
                     /db_xref="GeneID:8205368"
     mRNA            complement(<759962..>760933)
                     /locus_tag="ZYRO0F09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497559.1"
                     /db_xref="GeneID:8205368"
     CDS             complement(759962..760933)
                     /locus_tag="ZYRO0F09350g"
                     /note="similar to uniprot|Q12029 Saccharomyces cerevisiae
                     YOR271C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497604.1"
                     /db_xref="GeneID:8205368"
                     /db_xref="GOA:C5DY10"
                     /db_xref="InterPro:IPR004686"
                     /db_xref="UniProtKB/TrEMBL:C5DY10"
                     /translation="MASSVPGPLALPDSRWNLSTYWGRVRHCAEISDPSMLFTTDADL
                     QRARGIISSYRNGELKSTTSEFWNAKRQLDSTVHPDTGETVLLPFRMSCCVLSNLVVT
                     AGMLTPNLGTMGTLFWQWANQSVNVAVNSANANKSHPMSMSQLATNYTAAVTASCGVA
                     IGLNKVVPKLKGIKPHTRLILGRLVPFAAVVTAGVVNVFLMRGNEIKKGISVYDQEGQ
                     ELGKSKRAAMMAVGETALSRVINATPIMVIPPLLLVRLQRGLLRGKSLGWQTAANLGI
                     IAATSFTVLPLALAVFPQRQAIHLNRLERELRGDHDEHELVYFNRGM"
     gene            <761606..>762952
                     /locus_tag="ZYRO0F09372g"
                     /db_xref="GeneID:8205369"
     mRNA            <761606..>762952
                     /locus_tag="ZYRO0F09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497560.1"
                     /db_xref="GeneID:8205369"
     CDS             761606..762952
                     /locus_tag="ZYRO0F09372g"
                     /note="highly similar to uniprot|Q12024 Saccharomyces
                     cerevisiae YOR272W YTM1 microtubule-associated protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497605.1"
                     /db_xref="GeneID:8205369"
                     /db_xref="GOA:C5DY11"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR028599"
                     /db_xref="UniProtKB/TrEMBL:C5DY11"
                     /translation="MSADKSQVKLRFFTREKDESLHVQDTPVYAPIALKRFGLSEIVN
                     HLLQSEKPVPFDFLVDGELLRSSLQDYLTKKGLSSETLLNVEYARAVLPPSYLASFNN
                     EDWISSIDMGDQRIISGSYDGIVRTWNLSGKVDKQYSGHAGAIRSVKHISNTRIVSAG
                     NDRTLRLWKTKNDSTATDDENVEEGKTLAILEGHKGPVVSVDVSDNARILSSSYDNSL
                     GLWSTNYKEMNNVDPMEELINSNENKVSTAARKRRKLALKDGSIRRRAPLSLLESHQA
                     PVEQALFDARDNTVGYSVSQDHTVKTWDLVTSRCVDTKTTSYSLLSLAQLPSLHLLAC
                     GSSARHITLHDFRANSSSKITQQQLLGHKNFVVSLDTCPENEYMLVSGSHDGTAKVWD
                     IRANSPMYTITRQDPSVQKGVNDKVFAVKWAQDVGIISGGQDRKLQINKGDNIYKN"
     gene            complement(<763002..>764354)
                     /locus_tag="ZYRO0F09394g"
                     /db_xref="GeneID:8205370"
     mRNA            complement(<763002..>764354)
                     /locus_tag="ZYRO0F09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497561.1"
                     /db_xref="GeneID:8205370"
     CDS             complement(763002..764354)
                     /locus_tag="ZYRO0F09394g"
                     /note="similar to uniprot|Q03648 Saccharomyces cerevisiae
                     YMR209C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497606.1"
                     /db_xref="GeneID:8205370"
                     /db_xref="InterPro:IPR012901"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DY12"
                     /translation="MGVSTSSLPAIAFTILAVIMSFLRKYKPFQSWFIAKLENSFVDH
                     FTSAKQLVVNGDFSLTRTSKNFKTAGDTTLYDLSKALSHLSEYLVRAQGQNGVIFQRT
                     KELPPDVRDQLKTLSYFSKIQNVNISLQNNYKVVESVIRYVLEQLIKNNANNLEKGLR
                     DQLKATCLEFGYVLSEKNELCKNSDNTIVAMLESNQYRVSEAISHLCRDWSPNFRCER
                     EPFNQFFKERILSLGLPEDEKVLILVPGAGVGQLSHFLATNFPHYAVDSIEWSALMYI
                     CGQFALGYGKDVELSPFALRYSGQLDCARQIRTVEVQLSEVRRSSNLRFHWGDFCEFI
                     PTEDHYDSIVVCTEFFIDTAENLFEYFETIERFKNRCNNLHWINAGPLKYGTRPLVQL
                     NAMELNKLRQLRGWKDIHESNVTDYNHPLIGYLTDYGSLFQCYYGALKFHSTFATDRK
                     "
     gene            <766493..>767878
                     /locus_tag="ZYRO0F09438g"
                     /db_xref="GeneID:8205371"
     mRNA            <766493..>767878
                     /locus_tag="ZYRO0F09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497562.1"
                     /db_xref="GeneID:8205371"
     CDS             766493..767878
                     /locus_tag="ZYRO0F09438g"
                     /note="similar to uniprot|Q03652 Saccharomyces cerevisiae
                     YMR211W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497607.1"
                     /db_xref="GeneID:8205371"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR019605"
                     /db_xref="InterPro:IPR029209"
                     /db_xref="UniProtKB/TrEMBL:C5DY13"
                     /translation="MHEVISISAGHRCNHLSTQFFNCQEKKLYDEKRYKDNEFSVHLN
                     PSTDKLNQTVSFSPRALIWESKGGNGSLGTYQYVQPEDYFYSDDAKKDKNENVMLTGS
                     KVPRSEYQEALDNSATPIPQLNNEMAKYWSDYSKLIYDPTTFNNLKDWHHDLSKPNLP
                     DFKGLDVHKFGSYELGVQEFDDNYLQEFFDGNLHRQLEQCDTLQGLNLMSSLDSAWSG
                     FSSAMLLELRNELPKTTIFAWNYYKGELKGLNRALLPHWERQMKSSVVCNEEADLVFP
                     LRLDESLSDWEQAGQTVRVLDSVNSLFEQKGEKMQSMTHLQDCVGVSDQTRKFVSSIF
                     ENSDYNYSFFDDYPVFRNGHKDPHVFSECLIQRGSTTNSTPNPRTLQTTEFLPSDTVP
                     PQFQSPNSFDLQLSTTEKSRDVFLHWRDVASKYLRSAPDGDELVDNLGTIAATYEYGW
                     YDDEDSGDDDF"
     gene            <767997..>769286
                     /locus_tag="ZYRO0F09460g"
                     /db_xref="GeneID:8205372"
     mRNA            <767997..>769286
                     /locus_tag="ZYRO0F09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497563.1"
                     /db_xref="GeneID:8205372"
     CDS             767997..769286
                     /locus_tag="ZYRO0F09460g"
                     /note="similar to uniprot|P07884 Saccharomyces cerevisiae
                     YOR274W MOD5 Delta 2-isopentenyl pyrophosphate:tRNA
                     isopentenyl transferase required for biosynthesis of the
                     modified base isopentenyladenosine in mitochondrial and
                     cytoplasmic tRNAs gene is nuclear and encodes two isozymic
                     forms"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497608.1"
                     /db_xref="GeneID:8205372"
                     /db_xref="GOA:C5DY14"
                     /db_xref="InterPro:IPR002627"
                     /db_xref="InterPro:IPR018022"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DY14"
                     /translation="MIRALWKKMFVNSPGKVVVIAGTTGVGKSQLSIQLAKKFNGEVI
                     NSDSMQVYKGLPIITNKHPIEERDGIPHHVINHVDWSEEYYLHRFEKECVDAIEDIHQ
                     RGKLAIVVGGTHYYLQVLFNKHVKSIQRDVTKEERELLNSGNGQLIYDTLKMHDPAIA
                     TKFHPNDTRRVQRMLEIYYESGKKPSETYAEQEISLRYDTLFLWLYSDSDALEQRLDD
                     RVDKMLETGAMEEIKELYEYFQNNKYTIEQCENGVWQVIGFKEFLPWLIDEKKNMKIE
                     DGVERMKIHTRQYAKKQVKWIRKMLIPDVDGDVYVLDASDLSQWHEKVLVRSTNITRQ
                     FFENKPIQDIRAPERLKGLLDIGKTKDKSQRDWQQYVCTVCRDQQDKELIAIGETNWQ
                     IHLKSRRHRSNLTKGARKAAYEKWKAEKGVNDDEKEH"
     gene            complement(<769324..>771267)
                     /locus_tag="ZYRO0F09482g"
                     /db_xref="GeneID:8205373"
     mRNA            complement(<769324..>771267)
                     /locus_tag="ZYRO0F09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497564.1"
                     /db_xref="GeneID:8205373"
     CDS             complement(769324..771267)
                     /locus_tag="ZYRO0F09482g"
                     /note="similar to uniprot|Q12033 Saccharomyces cerevisiae
                     YOR275C RIM20 Protein involved in proteolytic activation
                     of Rim101p in response to alkaline pH member of the
                     PalA/AIP1/Alix family interacts with the ESCRT-III
                     subunits Snf7p suggesting a relationship between the
                     response to pH and multivesicular body formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497609.1"
                     /db_xref="GeneID:8205373"
                     /db_xref="InterPro:IPR004328"
                     /db_xref="InterPro:IPR025304"
                     /db_xref="UniProtKB/TrEMBL:C5DY15"
                     /translation="MTDLLCIPQKRTTDARLKDQLANAIESTSYQTASFFDAELNKIA
                     YLRESISDPEPSKTKLRDLQEYLLCLEEISKKFPNDQIQFTWSNPLLQKSDGTSEYSL
                     KFERLNIFYNIGSQYSILALESNDGSSQALKTMCLYFQYSAGCFQYIIRHLNDCEEPV
                     FDLNSGHALVNIMLAQAQECFWFKAIQDGHKDSLIAKLAKQVSEYYEESLKFGRKSQL
                     IRNDWCLHLESKANYFTAVTYFRNGLSLGGKRNYGAQIKSLEMALEYLRKSDLPSRAD
                     FSVKIEESLKEIQRDNDFIYLQTVPSYIDPVKPAPMVNASPVEAFIPKDSTPIFKDLL
                     PIGVLDACSAYNERQEEYVKQYVVNPLLSLNKLLYESLPKFELPPNLKNISEHELESY
                     ELSLNDLKFNSNNIEVQISEIDQILRQESETDSNLRLKYGTINWDSVPSANVNTAYYE
                     KLQKLREYLNQGRKVDEETFSLFRVIDKKLITSPIKFPESNSPLVKQVGNVTRSREKY
                     AKEVESKSTEHRLLPRIISEYKRTGETEFEALFLDHLKFFDIDIKYVQHQREENKRLL
                     NQLQSQEDDSGTKRLDPAALYVEDLQYSLKLLEDVKGNLGDGANFYRSLHKSANELLY
                     EVQKFENARSLERSSMESKLNSH"
     gene            complement(<771603..>773828)
                     /locus_tag="ZYRO0F09504g"
                     /db_xref="GeneID:8205374"
     mRNA            complement(<771603..>773828)
                     /locus_tag="ZYRO0F09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497565.1"
                     /db_xref="GeneID:8205374"
     CDS             complement(771603..773828)
                     /locus_tag="ZYRO0F09504g"
                     /note="similar to uniprot|Q03653 Saccharomyces cerevisiae
                     YMR212C EFR3 Non-essential protein of unknown function
                     exhibits synthetic lethal genetic interactions with PHO85
                     green fluorescent protein (GFP)-fusion protein localizes
                     to the cell periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497610.1"
                     /db_xref="GeneID:8205374"
                     /db_xref="UniProtKB/TrEMBL:C5DY16"
                     /translation="MRIFSPKHQKLVNQCYPSGRTPDKKPKSSETSYLLYYVSSRRSK
                     LEKVSTYLVKRTNVDLNHRRVGNVAVTLEIMHDIVEHCKENLNIFVKDFLNITIKILT
                     NNNFNNDSSIIELVERTFASICRNVDGAMSGGDAEFIKLYSSFEKLYFDVAREILDND
                     DLLLKGCIDISYTTDLASNPQINHFLPRSVIYALEKFIERNPRYSALDLGTPTDQNIT
                     KSLSKVQTRTAALDDIYNTNADLSVKTLQAYFTTTETDKLTLAIKALLDFLQRSPNKD
                     LLQFICNGIPVQLRYIVVVLLIRHLTDPGTKADPIISLRLISSLLVSDVSIVGLSIMD
                     MMRKILKYQLDNLANVNVVNQCRKTIADLNNKIYYRGQTADMLFELELKLQSTKDESE
                     RAVLIEDVDELLTHMGKPCVGLELFLNLAPFMDSNGKLKLFDAVDDRFSGGNLLSQLF
                     GMINGMENAVDQKVLMHLVFQKYKSLALLSGLNYFTENVEEPTRAYYLYHWEAATFLK
                     MNNYKAQVDLRCKNQTLFNKDELIGFYSDEKINKYSQKGTQILVSNPHNLSTSDLFSD
                     LHPQRMNNFAEVNGYNRDSMNGTFSGNDSTRASITRSLNGNGPADLLSWRGIKSSAPK
                     VTDLKRAISSPKKNIAARSNTMRGSQSVKSKVTNITFLLNELRNNDDGNTSHIMQPDE
                     DRPSVLDRNDVDTSSSTRVTPPPTRQDYSEANLSNVDQEKFQDAQEEVDLTNSTNGIA
                     A"
     gene            <774120..>775760
                     /locus_tag="ZYRO0F09526g"
                     /db_xref="GeneID:8205375"
     mRNA            <774120..>775760
                     /locus_tag="ZYRO0F09526g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497566.1"
                     /db_xref="GeneID:8205375"
     CDS             774120..775760
                     /locus_tag="ZYRO0F09526g"
                     /note="similar to uniprot|Q03654 Saccharomyces cerevisiae
                     YMR213W CEF1 Essential splicing factor associated with
                     Prp19p and the spliceosome contains an N-terminal c-Myb
                     DNA binding motif necessary for cell viability but not for
                     Prp19p association evolutionarily conserved and homologous
                     to S. pombe Cdc5p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497611.1"
                     /db_xref="GeneID:8205375"
                     /db_xref="GOA:C5DY17"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="InterPro:IPR021786"
                     /db_xref="UniProtKB/TrEMBL:C5DY17"
                     /translation="MSASSNNGKAGVWTNLEDQIVKAAIQKYGTHQWSKIASLLQHKS
                     ARQCQIRWDEYLNPRLNFHDFTRQEDARLLQLARRLPNQWRTIADAMGRTAQVCIDRY
                     NQLLEADSEFGIASSLQLEYPNAETQAARPDGIQLEDEEREMLAEARARLLNTQGKKA
                     TRKIRERMLEESKRIAQLQKRRELKQAGERTTIKKPRKRYETEIDYNEDVAYEQEPQP
                     GIYDTSHEDERMARDVANFEKRVSLRGLKEDRKGAVGKRQREPESSAKQANLTTTEFK
                     RPKLQLPEPGAKDDAAEAIRANRRALLAGPDVDESEPVETVVKPHKTLSQLFASLPAP
                     KNDFEIVLDEDEQDDAQEVQEETKTDAEEEQKAVVPAQDDTANESDLRPLHMDCLRMR
                     APDFIQHPKDAFGQTFNELSASYMIKEPFMQPTDASYFMDQVEHKMKDVSVDSEELQW
                     QQPTAAAVKDSISKQLDKVKDLQRSFEYLQPLAQFNDKLCQKLCVEQLPQLRKLQQKY
                     YMNYKIYQHEMQAIEVRRRRFQADLQGAVSSTFPSHRA"
     gene            <775871..>776995
                     /locus_tag="ZYRO0F09548g"
                     /db_xref="GeneID:8205376"
     mRNA            <775871..>776995
                     /locus_tag="ZYRO0F09548g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497567.1"
                     /db_xref="GeneID:8205376"
     CDS             775871..776995
                     /locus_tag="ZYRO0F09548g"
                     /note="similar to uniprot|P07285 YDR354W Saccharomyces
                     cerevisiae TRP4 anthranilate phosphoribosyl transferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497612.1"
                     /db_xref="GeneID:8205376"
                     /db_xref="GOA:C5DY18"
                     /db_xref="InterPro:IPR000312"
                     /db_xref="InterPro:IPR005940"
                     /db_xref="InterPro:IPR017459"
                     /db_xref="UniProtKB/TrEMBL:C5DY18"
                     /translation="MVDINSLVPYTKKLLAQPPTLSPSDLHAAISIILKLLEELESES
                     KDQGQEVNIYVVIGSFLTALRTTGLDHKAEYIAEAARAVLVYSDKVKLESGKEDGLVL
                     DIVGTGGDGQNTFNVSTSAAIVASGIPGFKVCKHGGKASTSNSGAGDMIAQLGCDVSK
                     VNSRTVPHLWDANDFLFLLAPYFHNGMRLVSKIRKLLGIPTVFNVLGPLIHPVPHVNR
                     RVLGVYSKELAPEYAKAAALVYPNSETFVVWGHVGLDEVSPIGKTTIWHVNGSGKLDV
                     FEIEPSMFGLPEHELSQCQSLGPEANAKLLKEEVLNGKLHCKEGHPVYDYILLNTAVL
                     YCLSKGNKDWREGIAQAEQSIHSGKALQSLQHFINELDEF"
     gene            <777197..>779704
                     /locus_tag="ZYRO0F09570g"
                     /db_xref="GeneID:8205377"
     mRNA            <777197..>779704
                     /locus_tag="ZYRO0F09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497568.1"
                     /db_xref="GeneID:8205377"
     CDS             777197..779704
                     /locus_tag="ZYRO0F09570g"
                     /note="similar to uniprot|Q756L3 Ashbya gossypii AER241W
                     AER241Wp and weakly similar to uniprot|P32380
                     Saccharomyces cerevisiae YDR356W SPC110 Inner plaque
                     spindle pole body (SPB) component"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497613.1"
                     /db_xref="GeneID:8205377"
                     /db_xref="GOA:C5DY19"
                     /translation="MADAPDHSLNGRRHLEFTPIGYSRQNPLKRLSRSPIQTVAEDDN
                     NGNGMSEEGPFKKQRRADLDDTIASHRMFNDSSQFDDTLPQLNGQSADNDNDNAHDSG
                     KETDDVVKNLMGNLKENAPASNPLKEQQEQLHKLNTDNYNLRLKCNSLLKFLHNVTDQ
                     GELTKSLGLLDEIHEWKQKHYTLNQQYLELKAKLIQVEANAAENKQEPVTEVDHTACQ
                     RELSYVQNQLEKTTLQLNTYRDEVAHLEDKTIRIQEDQRAKEEQHQLEIQMLRSDVNN
                     LNVSLVNKESELEEDRAKIQRLMNQLHEFDHKGSQSLLDLERQLEMKRDSISSLEKEV
                     RALTHDRVHLETRIKDREIENAKIQSELERLRDNVKNNNSSNFEIGELKHAKASLDDK
                     VRNLTEERHNLNQRISALRKECDEWKSKYQRNESLDSNHRKAFDSLRQELQTTKTQLE
                     ETRKTAQQLQTQVIENTTKNSERTSQRIKDKETQIQKLESELQFCKQQLKDGSRRLQA
                     EEERCRETFESELQNLEMKNGFERTKLEREITLLKEERVALIETHDRELELWKSKCDA
                     LNKENDILVRQEIGDLDGVKRKLSQQLDKLQEKLTTAEGERGDLAEKLIKLQHSKDSY
                     KDELKRVSSKLEYLSKEYLKSKQSAINDDEQKTKYNTMKQRLLVELKSLQDENLSLER
                     KLLEQRGSSSRSQESSSRSSSTTQDRLDYYKLKYNNEVKHNNDLRIMNDYLNRVLRAS
                     SQHLKLDLLKLESEISQPAVPSSRTYKTVLDDDRYRPRFRSGLISPGHIPTFKAVALL
                     VLACVRMKQTAVRCRWDEHRIRYLRNKMAIDDDRITW"
     gene            complement(<779708..>780034)
                     /locus_tag="ZYRO0F09592g"
                     /db_xref="GeneID:8205378"
     mRNA            complement(<779708..>780034)
                     /locus_tag="ZYRO0F09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497569.1"
                     /db_xref="GeneID:8205378"
     CDS             complement(779708..780034)
                     /locus_tag="ZYRO0F09592g"
                     /note="similar to uniprot|Q06333 YDR357C Saccharomyces
                     cerevisiae Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497614.1"
                     /db_xref="GeneID:8205378"
                     /db_xref="GOA:C5DY20"
                     /translation="MSQESNDDSLGIDKLSVDYDYLLYKIADYVSSIEFQTNQICKRQ
                     NELITKDIVNGIVDENIKHFREILTKCEKLENYFDMLDQINMITENFKTRLAQVARDY
                     KELQKP"
     gene            <780693..>782423
                     /locus_tag="ZYRO0F09614g"
                     /db_xref="GeneID:8205379"
     mRNA            <780693..>782423
                     /locus_tag="ZYRO0F09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497570.1"
                     /db_xref="GeneID:8205379"
     CDS             780693..782423
                     /locus_tag="ZYRO0F09614g"
                     /note="similar to uniprot|P38817 YHR108W Saccharomyces
                     cerevisiae GGA2 Golgi-localized protein with homology to
                     gamma-adaptin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497615.1"
                     /db_xref="GeneID:8205379"
                     /db_xref="GOA:C5DY21"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR004152"
                     /db_xref="InterPro:IPR008152"
                     /db_xref="InterPro:IPR008153"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="UniProtKB/TrEMBL:C5DY21"
                     /translation="MSQGIYLTDGPVRRPQPVGNPLLRKIQRSCRLSLPEPDLALNLD
                     VADYINEKQGPAPRDAVIAIVKLINSRDTHTAVFALALLDVLVKNCGYPLHLQISRKE
                     FLNELVKRFPEHPPMRYSKVQRLVLTAIEEWYQTICKHASYKEDMGYIRDMHRLLKYK
                     GYIFPKINDSDMAVLRPADQLKTPSEIQKEQEVAQSAKLEELIRRGRPEDLREANKLM
                     KVMAGFKEDNAREAKQTILTELNKLKRKADLLNEMLSSSDTPDLKNETVSELHSALKG
                     AQPKFQGIIEEEHEDDELVQDLLKFNDTVNQLLEKMDLLKAGDSGAASQIRPSNISSP
                     PPNSTSGALATEINLIDFDDEPAENSNNVHQPTSAGDSHSDPVSDLLGGLGELSLSSG
                     QSTQNFGLGGSIQLGSSQPAPPVTSNATSHSNSNLDLLGTLSSQSTSSGQPPQQSSSG
                     LDLFGDFQAPSGKVFVHQSNHLKIQGSFNRDNKQTIKCKFFFSNVSVSAIQGLTHLVA
                     VPKHLQLRLLPQSGSTLGGFINEGVTQEAYIEGTPEAIADAVKMKWKVTYNVDGKPVE
                     ETAVFTLPKV"
     gene            complement(<782721..>785711)
                     /locus_tag="ZYRO0F09636g"
                     /db_xref="GeneID:8205380"
     mRNA            complement(<782721..>785711)
                     /locus_tag="ZYRO0F09636g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497571.1"
                     /db_xref="GeneID:8205380"
     CDS             complement(782721..785711)
                     /locus_tag="ZYRO0F09636g"
                     /note="similar to uniprot|Q06337 YDR359C Saccharomyces
                     cerevisiae VID21 Component of the NuA4 histone
                     acetyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497616.1"
                     /db_xref="GeneID:8205380"
                     /db_xref="GOA:C5DY22"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR014012"
                     /db_xref="InterPro:IPR017877"
                     /db_xref="UniProtKB/TrEMBL:C5DY22"
                     /translation="MSSRSPSPPRRTVINGGKTEDGVDAQVEELIKMRNQKLIELYCV
                     SRMSELLDITDEAALKSELSSFLAQNDIKKGTRFQAGTLPKYEPVEQVKKSAPEIKKS
                     LPTKEKASSVSVPSNNTGMQQLQVPNSNNNNNNSNNNGDTTNNKRSLPDLHDSHEKRV
                     KLNPERASPLSSAPPASRLPHPMYYMDLNIPPAEPTPVEPSHKYQNRLIDEVTRKPVE
                     EGDFFHENNINSKESVYLLTKDIVPSKVAQALPLAELKYMVQTLPLIKLIPMAHKALT
                     TDIMNNALNEGRITVVSSRIEELRRLGLWSLRQPKPFLDPWENEPSHHRTLMAEAKWM
                     QADFKEGQAYKIAVCTTLAQAVTDYWAYGDVCCVKRAPVRHLPVDSDPTESHGTQEGP
                     QTVDENNSKIDQSQLIDEKSPNEKDDEPTTAMRETTEGPDLVQSADASTENDPHGIMK
                     DADCENKDNQFLLSKPDFSDEITKESHNEASGVKSGLQKSMVDPYKLTLSFDELKPLE
                     RTMLQNVPLYTGTDPGDISKGNLPFVPISKSMVTLEDDHYLKIVERQIMDEEQSLVQL
                     SKRRGMFYGNRRSHYLKPPPAPSLRYLQNRTPTIWLPEDDQELVKNINAYAYNWELIS
                     AHMNSRTSMSYVSNIERRTPWQCFERFVQLNEKFSFNDLKGPRAHSVQQWLIEAHKFQ
                     QRQNRRISPLGVGPESIQRGHRRLRWASMFEAMRKCIKKRENAPRPNPTQPRKPLDCK
                     NMKVPTPAEMSQLKAQRDEALRRDIQMRRSFKNRAQHQQFQQHKQQLPHQGGPTTPNI
                     GAMRTASRVNTSSSETRSNSGSTPQAAKTPTSRQALMQGAPLQRKFTERDIIEGYSRK
                     ILAQKPEISLETAMRAAQSYYRSLMARQQQQQQQQQQQQQQQQQQQQQQQQQQQGQQQ
                     QGQQQGQEQEQEQEEQQEQRQEQQPKPEQKQSPLQQYTLPHEEKSSKDPSNSPNTNSN
                     KSHSDSNSKIKSPTPQEILQRYQK"
     gene            complement(<786507..>787331)
                     /locus_tag="ZYRO0F09658g"
                     /db_xref="GeneID:8205381"
     mRNA            complement(<786507..>787331)
                     /locus_tag="ZYRO0F09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497572.1"
                     /db_xref="GeneID:8205381"
     CDS             complement(786507..787331)
                     /locus_tag="ZYRO0F09658g"
                     /note="similar to uniprot|Q06338 YDR361C Saccharomyces
                     cerevisiae BCP1 Essential protein involved in nuclear
                     export of Mss4p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497617.1"
                     /db_xref="GeneID:8205381"
                     /db_xref="GOA:C5DY23"
                     /db_xref="InterPro:IPR025602"
                     /db_xref="UniProtKB/TrEMBL:C5DY23"
                     /translation="MLETIKLSELTKKRRASEDDTGSEIDISSTDSEGDEEQVNDEEV
                     VNIDFDFFGGNPQVDFHAIKNLLRQILGNEESNKVQLSQLSDLILASPTTTIKTDGPE
                     SDPYCFLSFVDYKENRDSDYARYLRRDERMASFLRTVESNSKKSCALLLGERLINMPT
                     EVVPPLYKITLEDVTNALGDGKHYDFYVILSRKYEVNFDMDSDSEDEDQGKRSKKRVK
                     QHEVDYFHVEDRIFEKNAKLHFDLQPHKGLIPTYIVLSHQDLLKSISELEHELQSW"
     gene            <787498..>789222
                     /locus_tag="ZYRO0F09680g"
                     /db_xref="GeneID:8205382"
     mRNA            <787498..>789222
                     /locus_tag="ZYRO0F09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497573.1"
                     /db_xref="GeneID:8205382"
     CDS             787498..789222
                     /locus_tag="ZYRO0F09680g"
                     /note="weakly similar to uniprot|P38818 YHR109W
                     Saccharomyces cerevisiae CTM1 Cytochrome c lysine
                     methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497618.1"
                     /db_xref="GeneID:8205382"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5DY24"
                     /translation="MGMSEVAQWFLTNTDICLHQSVKIDKSTIGDPASGYGVFVDLSK
                     TGVMNGDKNTLELMRIPHGVTFDVHTVFQVLNDGTWYSSRQEFEKTKQKFKDVFARML
                     EYEGMMELLNESNTLVGFFLVCAMLRDEYELPSVLVYYLDNVLLETTIENAAKHLDLL
                     MEYYEQYVESHLFSKMLRKFEQFADRIPRETVRQVFAAVKSRCLEIPQELDQDSDDFV
                     VNSTLVPLLDLCNHSNRPNSHFDVDRETGDVILLLDLGKSKPLKDKFQEVFISYTPLV
                     EMLSFHNNYGFVPPPDDFQFFNLSIERDFLSQQKVGNRDLRLFCKWFKINPVVQLIRY
                     KGKWYINDTLEAFALLLLPFLPLPDDFTKSCWHYDDRNYETFAHFHQFLNDNDFTDFT
                     QSLKFYKREIRQQEHQNCDTIWFPQLAWCFRYKDDGELLRRRVEQIDALELAPFEDRK
                     QFELVIERFKEFFVGYLDHRESTLRSYQGDNESFNQLLHLELDILQQLNNGLKQNQVQ
                     FWSDIDTDAQEVPQLPFVWKPSGQEIQNDENLELDWEMLSIKPYNPRELTDFYDEELH
                     SFLQVMQG"
     gene            <789381..>790019
                     /locus_tag="ZYRO0F09702g"
                     /db_xref="GeneID:8205383"
     mRNA            <789381..>790019
                     /locus_tag="ZYRO0F09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497574.1"
                     /db_xref="GeneID:8205383"
     CDS             789381..790019
                     /locus_tag="ZYRO0F09702g"
                     /note="similar to uniprot|P38819 Saccharomyces cerevisiae
                     YHR110W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497619.1"
                     /db_xref="GeneID:8205383"
                     /db_xref="GOA:C5DY25"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:C5DY25"
                     /translation="MFLQFIVQFLVVLVSLPLSRGLHFYLKSGQVKCFYENLSLGNLM
                     IGDIDGYVEREDTFVEDPDLRLTVSVDESFDSNHRVMNQKNAHTGDFTFTALDTGEHR
                     ICIMPSYPQEDARLRIFMELDITNMRLLDTRRKDDERTAKQRVLQMVRRLEVIRLEQK
                     DIRKKEALFRNQSESANSKILRWSCLQVLGLVIMCVLQLRYLKNFFVKQKVI"
     gene            <790270..>791580
                     /locus_tag="ZYRO0F09724g"
                     /db_xref="GeneID:8205384"
     mRNA            <790270..>791580
                     /locus_tag="ZYRO0F09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497575.1"
                     /db_xref="GeneID:8205384"
     CDS             790270..791580
                     /locus_tag="ZYRO0F09724g"
                     /note="similar to uniprot|P38820 YHR111W Saccharomyces
                     cerevisiae UBA4 Protein that activates Urm1p before its
                     conjugation to proteins (urmylation)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497620.1"
                     /db_xref="GeneID:8205384"
                     /db_xref="GOA:C5DY26"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR007901"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR028885"
                     /db_xref="UniProtKB/TrEMBL:C5DY26"
                     /translation="MTVEVPESILRELESLKLENAKLKAELAGEKEFNKYPMSLEEYK
                     RYGRQMIVEDTGGVEGQLKLRNSKVLVVGAGGLGCPALPYLAGAGIGHIGIVDNDVVD
                     TSNLHRQVLHNSNKVGMLKCESAKQVLNELNPHVSVETYPIRLDGANAFPIFAKYDYI
                     LDCTDTPLTRYLISDVAVNLQKTVVSASGLGTEGQLTILNFKNKGPCYRCFYPVPPSP
                     TSVSSCQEGGVIGPCIGLVGVMMAIEVMKLIMEVYTEESFKPFLTSYSGFPTQSLRTF
                     KMRGRQKTCACCGENPTITRNAIESGEVDYTLFCGSRKYNVCDSMERMSVTDFENDYH
                     DRQDFVFLDVRPSHHYSISHFPSTHNIPLKKLRDMGGSISELQEHVPNIDKESEVVVV
                     CRYGNDSQLATRLLKDQFGIPKVKDIRGGFFKYIDDVDPSIPKY"
     gene            complement(<791636..>793573)
                     /locus_tag="ZYRO0F09746g"
                     /db_xref="GeneID:8205385"
     mRNA            complement(<791636..>793573)
                     /locus_tag="ZYRO0F09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497576.1"
                     /db_xref="GeneID:8205385"
     CDS             complement(791636..793573)
                     /locus_tag="ZYRO0F09746g"
                     /note="similar to uniprot|Q06339 YDR362C Saccharomyces
                     cerevisiae TFC6 one of six subunits of RNA polymerase III
                     transcription initiation factor complex (TFIIIC)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497621.1"
                     /db_xref="GeneID:8205385"
                     /db_xref="GOA:C5DY27"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017956"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DY27"
                     /translation="MTAMKRGRGRPRKNESKANETPKVSSKSSENDDNNNGNNDNIGI
                     IKSAVVEATRRRPRRTAARKVTPDPEAELGVQLDKEDEDEEFVPEVDVDEETQKPDKR
                     RKTRSPKTSIEINSSKVQQRGSNLERKGKIIRALKDLSSARDKIERIYGLNEHKLLRL
                     AKVKEGFEPYLFCFPSEMIQRDSPYYVDCKPPCSIDNVYDKVIPSTSSLKFHDIDVKE
                     LDQIFTKNKKEHKIIINESETALQSEQSMEFPVLPYGKRHGFVYNSGGFITDMAWLSQ
                     DESDDQYLAVALSQYFERPSDSHLRMFESESHTSCIEIFRLNTNTLKFTKLQTLAHSF
                     GEIWNLKWHEGCEKNGVLGVLAFVCQNGSFKLTEVTVPNDDSHVVRFFDEASLSVSMP
                     NTNITCYDFLSPTSIICGFKNGFVAEFDLTDPEFPSYYHKMHDSYVISICVASSETER
                     TTVGTLSVDGYFYIFDAKEIFTSKLEVTRFRGTNIIPIAYLPQLYAFVHSDGTNSLKT
                     VVPRAAFGMHTIALQETTIVSVGTSRLHPLVLNGSSDGNIAIDNVSRRVLTGIKNSSV
                     AHCSLRLWKWEYSKREDKYRLNHNYEIYKPSINEISGVKIDAHGVNISCIKWNETSAA
                     GQFYAFANSAGLLTIEKLGND"
     gene            complement(<793824..>794945)
                     /locus_tag="ZYRO0F09768g"
                     /db_xref="GeneID:8205386"
     mRNA            complement(<793824..>794945)
                     /locus_tag="ZYRO0F09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497577.1"
                     /db_xref="GeneID:8205386"
     CDS             complement(793824..794945)
                     /locus_tag="ZYRO0F09768g"
                     /note="highly similar to uniprot|P38716 Saccharomyces
                     cerevisiae YHR112C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497622.1"
                     /db_xref="GeneID:8205386"
                     /db_xref="GOA:C5DY28"
                     /db_xref="InterPro:IPR000277"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DY28"
                     /translation="MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQ
                     PNLDFLDENPVYSREGHPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVF
                     MDQCYHGVQGIVGILKRNYGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELA
                     RRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEV
                     ASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPAL
                     VELYHSSLQTEEFVKKQLSGGYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESL
                     VEWRAMCDSDIDQCLVRVSIGCESADDLINDLSTVLSQL"
     gene            <795479..>796963
                     /locus_tag="ZYRO0F09790g"
                     /db_xref="GeneID:8205387"
     mRNA            <795479..>796963
                     /locus_tag="ZYRO0F09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497578.1"
                     /db_xref="GeneID:8205387"
     CDS             795479..796963
                     /locus_tag="ZYRO0F09790g"
                     /note="highly similar to uniprot|P38821 YHR113W
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497623.1"
                     /db_xref="GeneID:8205387"
                     /db_xref="GOA:C5DY29"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:C5DY29"
                     /translation="MFRVTLRKLSTMSSIATSSKTNYPKEFIKFLNESHTPYHVVHNM
                     KLHLDQHGFQELSEREAWNGKVQRKGRYYVTRNNSSIVAFAVGGKWQPGNAIAITGAH
                     TDSPVLRIKPVSKRKTENYEQVGVECYGGGIWHSWFDSDLSIAGRVFVNDRESGKIVS
                     KLVDLNKPLLKIPTLAIHLDREVNSKFEFNKESQLLPIAGLVNGESKGDEDVKEDSFS
                     SLKAVVERHHRSILELVAQQLNLSSVSDIEDFELILYDYAAATLGGFHDEFVFSGRLD
                     NLTSCFTSLHALTLAADTNIDEETGIRLMSCFDHEEIGSSSAQGADSNFLPNVLERLA
                     SLKGDPSSDVNDPLSKSYILETFAKSFFMSSDVAHAVHPNYVNKYESQHKPIIGGGPV
                     IKINANQRYMTNSPGMVLVKKLADKAQVPLQLFVVSNCSSCGSTIGPILASKTGVRTL
                     DLGNPILSMHSIRETGGSEDLGLQIKLFKEFFEQYSSLESNIIV"
     gene            <797169..>798419
                     /locus_tag="ZYRO0F09812g"
                     /db_xref="GeneID:8205388"
     mRNA            <797169..>798419
                     /locus_tag="ZYRO0F09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497579.1"
                     /db_xref="GeneID:8205388"
     CDS             797169..798419
                     /locus_tag="ZYRO0F09812g"
                     /note="weakly similar to uniprot|Q06340 YDR363W
                     Saccharomyces cerevisiae ESC2 Protein involved in
                     mating-type locus silencing interacts with Sir2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497624.1"
                     /db_xref="GeneID:8205388"
                     /db_xref="InterPro:IPR022617"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DY30"
                     /translation="MVDSTYRSNSFSDDDDDDFFMGNIGDANDESPPIENVYVDAEPS
                     NKDQQKLDKTSDNEEEDSDSSDEPIQNKRKSEAVSDAESDDNVIVLDSSESDEDNAKP
                     SPRNRRTRITRNSSKTTGVVPSRSPTPPRRTKRSRTTPNIANNFLEPDENDEFFKQIA
                     KDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNG
                     FIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPK
                     EKENEFEQMINSRLLEDEQNPPDTAETGNLDARVEEFEKELKNVDNSTTNHETTELID
                     LEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHE
                     ELNLNESIGDQDMEDEDMIEVLTK"
     gene            798555..798627
                     /locus_tag="ZYRO0F09834r"
                     /db_xref="GeneID:8205389"
     tRNA            798555..798627
                     /locus_tag="ZYRO0F09834r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=75.47"
                     /db_xref="GeneID:8205389"
     gene            complement(<798821..>803197)
                     /locus_tag="ZYRO0F09856g"
                     /db_xref="GeneID:8205390"
     mRNA            complement(<798821..>803197)
                     /locus_tag="ZYRO0F09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497580.1"
                     /db_xref="GeneID:8205390"
     CDS             complement(798821..803197)
                     /locus_tag="ZYRO0F09856g"
                     /note="highly similar to uniprot|P04051 Saccharomyces
                     cerevisiae YOR116C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497625.1"
                     /db_xref="GeneID:8205390"
                     /db_xref="GOA:C5DY31"
                     /db_xref="InterPro:IPR000722"
                     /db_xref="InterPro:IPR006592"
                     /db_xref="InterPro:IPR007066"
                     /db_xref="InterPro:IPR007080"
                     /db_xref="InterPro:IPR007081"
                     /db_xref="InterPro:IPR007083"
                     /db_xref="InterPro:IPR015700"
                     /db_xref="UniProtKB/TrEMBL:C5DY31"
                     /translation="MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLEN
                     GRAPKTGGALDPKMGVSSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQI
                     LQGICKECSSILLEDTDKKHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGAL
                     NGVVKKAAAGGGSASLKIIHDTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRC
                     MDDLNPLKTLNLFKQVKPEDCELLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQD
                     SPASNEDDLTVKLTEVVWTSSLIKAGLEKGISINNMMEHWDYLQLAVAMYINSDSVNP
                     AILSGGTGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAV
                     PDRVAKVLTYPERVTRYNKGKLQQLVVNGPNEYPGANYLLKKDEDARRNLRFGDRVKL
                     AKNLRIGDLVERHLEDGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNA
                     DFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKD
                     SFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVVLNL
                     DAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRD
                     YGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAEELKEKKEEMVESAYAKCDELI
                     DLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPLIMATCGSK
                     GSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTP
                     PEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTY
                     GGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRL
                     VRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELM
                     DEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVG
                     AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE
                     SDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTIEDIA
                     VAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQLR
                     RALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV
                     YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR
                     DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSE
                     EQLKPKPTLFESLVNETSVKVN"
     gene            <803407..>803616
                     /locus_tag="ZYRO0F09878g"
                     /db_xref="GeneID:8205391"
     mRNA            <803407..>803616
                     /locus_tag="ZYRO0F09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497581.1"
                     /db_xref="GeneID:8205391"
     CDS             803407..803616
                     /locus_tag="ZYRO0F09878g"
                     /note="weakly similar to uniprot|O94742 Saccharomyces
                     cerevisiae YDR363W-A SEM1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497626.1"
                     /db_xref="GeneID:8205391"
                     /db_xref="InterPro:IPR007834"
                     /db_xref="UniProtKB/TrEMBL:C5DY32"
                     /translation="MSEKQEQPRRTLEEDDEFEDFPVDSWNQEENLKETAATNLWEED
                     WDDVEVEDDFTTELKSELEKHRQTA"
     gene            <804272..>805576
                     /locus_tag="ZYRO0F09900g"
                     /db_xref="GeneID:8205392"
     mRNA            <804272..>805576
                     /locus_tag="ZYRO0F09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497582.1"
                     /db_xref="GeneID:8205392"
     CDS             804272..805576
                     /locus_tag="ZYRO0F09900g"
                     /note="highly similar to uniprot|P33297 Saccharomyces
                     cerevisiae YOR117W RPT5 One of six ATPases of the 19S
                     regulatory particle of the 26S proteasome involved in the
                     degradation of ubiquitinated substrates recruited to the
                     GAL1-10 promoter region upon induction of transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497627.1"
                     /db_xref="GeneID:8205392"
                     /db_xref="GOA:C5DY33"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005937"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DY33"
                     /translation="MATLEELDAQQLPGDDELDQEILGLSTQELQTRSRLLDNEVRIF
                     RSELQRLGHENNVMLEKIKDNKEKIKNNRQLPYLVANIVEIMDMDELDDKENSEAVTQ
                     TGNLNLDNAAEGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILETLP
                     SEFDSRVKAMEVDEKPTETYSDVGGLDKQIEELVEAIVLPMKRADKFTDMGIRAPKGA
                     LMYGPPGTGKTLLARACAAQTNATFLKLAAPQLVQMFIGEGAKLVRDAFALAKEKAPS
                     IIFIDELDAIGTKRFDSEKSGDREVQRTMLELLNQLDGFGSDDRVKVVAATNRVDVLD
                     PALLRSGRLDRKIEFPIPSEDSRAQILQIHSRKMATDDDINWQELARSTDEFNGAQLK
                     AVSVEAGMIALRNGQSSVKHEDFVEGIGEVQARKSKSVSFYA"
     gene            complement(<805666..>807033)
                     /locus_tag="ZYRO0F09922g"
                     /db_xref="GeneID:8205393"
     mRNA            complement(<805666..>807033)
                     /locus_tag="ZYRO0F09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497583.1"
                     /db_xref="GeneID:8205393"
     CDS             complement(805666..807033)
                     /locus_tag="ZYRO0F09922g"
                     /note="similar to uniprot|P40968 Saccharomyces cerevisiae
                     YDR364C CDC40 Pre-mRNA splicing factor important for
                     catalytic step II of pre-mRNA splicing and plays a role in
                     cell cycle progression required for DNA synthesis during
                     mitosis and meiosis has WD repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497628.1"
                     /db_xref="GeneID:8205393"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DY34"
                     /translation="MSLVNYSSSSEDEGNVQIARDDRTVSVEGLKNSEANGKDDGSDI
                     KRRKLTRSEIRKSRQSRKGKGPWATWSSSSSSDSSSEEAEPETETRFDELKDEDDNSD
                     SEVELLKEKEEKSIFYAENEFDYQGRGILHPPVEVDLDFYKQDFKCYLPKRRIHSFTG
                     HTRGTSALQFLPKTGHLFLSGGNDNILKIWDFYHERICLRDYIGHSKPIKTVNFNEDG
                     NSFLSASFDQNVKLWDTETGQVKSRYRYNATPNDLKYRPGHLNEFVVGLSNSKINHYD
                     DRVAANQGLVQVYDHHLSSILSLEFFPDGSKLISSSEDKTVRIWENQVNIPIKQISDT
                     AQHSMPFLRVHPEHHYFCAQSMDNVIYSFGMKPKYRRHPNKFFSGHQSAGYGIHIDFS
                     PDGHYIISGDSRGKLMVWDWTTTKILKTLEVPGRQPVTQVAWHPQETSKVLCSGNMGK
                     IHLFD"
     gene            complement(<807207..>809042)
                     /locus_tag="ZYRO0F09944g"
                     /db_xref="GeneID:8205394"
     mRNA            complement(<807207..>809042)
                     /locus_tag="ZYRO0F09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497584.1"
                     /db_xref="GeneID:8205394"
     CDS             complement(807207..809042)
                     /locus_tag="ZYRO0F09944g"
                     /note="similar to uniprot|Q06344 YDR365C Saccharomyces
                     cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
                     processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497629.1"
                     /db_xref="GeneID:8205394"
                     /db_xref="GOA:C5DY35"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="UniProtKB/TrEMBL:C5DY35"
                     /translation="MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKD
                     LDVRRKAKVDKYGRRITGESKDLKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVV
                     DRARGELPEAYTSSESEDSESDLSEEESEADVAEAVEEAKPESGDPSKTLAVVNLDWD
                     HVRAADLMITFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDE
                     DSDSDVDIRDLYEEGDADKEVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDG
                     TEYESTANIFDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDET
                     PTDRLEVSKRAFSQKELEDMDFQAYLASGTDESDGEENNNEEAKNKLKSLVGQSLAYG
                     KQQEEEPDMEITFTPGLDDSKPQADEDHEETTIEKVKRKEQERRKARKQRLKELKQQA
                     EQEKKEKLRSGKNKKQVEDESDAKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKS
                     EKEKKKKGKYQDKGKIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEIL
                     EERSKRAHKKRKPLADDGDSKDNKHDISNIVNKLKKKGNNKKAKR"
     gene            <809604..>811268
                     /locus_tag="ZYRO0F09966g"
                     /db_xref="GeneID:8205395"
     mRNA            <809604..>811268
                     /locus_tag="ZYRO0F09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497585.1"
                     /db_xref="GeneID:8205395"
     CDS             809604..811268
                     /locus_tag="ZYRO0F09966g"
                     /note="similar to uniprot|Q12108 YOR118W Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497630.1"
                     /db_xref="GeneID:8205395"
                     /db_xref="GOA:C5DY36"
                     /db_xref="InterPro:IPR006571"
                     /translation="MGQRTSQATLQSSTHFTSNSDILKSFNDRALKQFTVTELVSFKN
                     KLGKDLNERLTNEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVL
                     KAIILTNPERCKKYVKSRNYDQLKLWFIALSIRKTVKEDPNLSSSSSSEESFDVTRIL
                     KTFDGLHVNELSVPFAYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTI
                     LRSMRPMDESSWIEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEI
                     ASSKLLNSALLAQISSALSKQLPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLL
                     RGKRILDDEEYSVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWK
                     ITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTIGGGIGIGNKQPVIKSTAKSYS
                     PGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKDFEVKMLLQDVEVWGCGGEKELE
                     EQLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV"
     gene            complement(<811306..>812688)
                     /locus_tag="ZYRO0F09988g"
                     /db_xref="GeneID:8205396"
     mRNA            complement(<811306..>812688)
                     /locus_tag="ZYRO0F09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497586.1"
                     /db_xref="GeneID:8205396"
     CDS             complement(811306..812688)
                     /locus_tag="ZYRO0F09988g"
                     /note="similar to uniprot|Q12196 YOR119C Saccharomyces
                     cerevisiae RIO1 Essential protein that plays a role in
                     cell cycle progression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497631.1"
                     /db_xref="GeneID:8205396"
                     /db_xref="GOA:C5DY37"
                     /db_xref="InterPro:IPR000687"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="InterPro:IPR018935"
                     /db_xref="UniProtKB/TrEMBL:C5DY37"
                     /translation="MSLETEFDRLHVSKHQDNTRILEKYENRIENGGFTSGKGNKTYK
                     DKSDRATVENVLDPRTMKFLSALTNRGVISEFNGCISSGKEANVYHAFGPEGQELAIK
                     IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIHSSGVVPTA
                     CPVEVKSNVLVMQFLNRGDGAPSPRLKDYQYKDELEVAHYYYKAIAYMRLLYQVCRLV
                     HADLSEYNIVVHQNALHIIDVSQSVEPYHPMSLDFLRMDIKNINAYFGKMGVSLFQER
                     MIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPLKTPTEGADEDEIFRSLHLVRSLGG
                     LEERDFDRFTDGKFDLLKSLIANDNERNLQRPQQQEIESSEDESEDKDEDEDEDEDDD
                     GSEGDSESESESDSEDERFTIPKGKKFEDKDEKKQRKHEAKELKKEKRKTKVKKHIKK
                     KLIKKTKSKK"
     gene            <812835..>813540
                     /locus_tag="ZYRO0F10010g"
                     /db_xref="GeneID:8205397"
     mRNA            join(<812835..812861,812941..>813540)
                     /locus_tag="ZYRO0F10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497587.1"
                     /db_xref="GeneID:8205397"
     CDS             join(812835..812861,812941..813540)
                     /locus_tag="ZYRO0F10010g"
                     /note="similar to uniprot|Q06999 Saccharomyces cerevisiae
                     YDR367W Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497632.1"
                     /db_xref="GeneID:8205397"
                     /db_xref="InterPro:IPR013862"
                     /db_xref="UniProtKB/TrEMBL:C5DY38"
                     /translation="MKTYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFT
                     GHPLEFLQWVLYLWSIFSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWF
                     TNQWYTLEDNTPTQKSIAAAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLAS
                     FVQGLLQHPRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLLT"
     gene            <813814..>814746
                     /locus_tag="ZYRO0F10032g"
                     /db_xref="GeneID:8205398"
     mRNA            <813814..>814746
                     /locus_tag="ZYRO0F10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497588.1"
                     /db_xref="GeneID:8205398"
     CDS             813814..814746
                     /locus_tag="ZYRO0F10032g"
                     /note="uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2
                     Glycerol dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497633.1"
                     /db_xref="GeneID:8205398"
                     /db_xref="GOA:C5DY39"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DY39"
                     /translation="MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKA
                     GYRHIDGAAVYGNEGEVGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGL
                     DYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGK
                     TKAIGVSNFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYS
                     PLGGENAPILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVL
                     TLSDSDVAKVDGLLKAKGERRTCYQDFSPFPIFQ"
     gene            complement(<814872..>816854)
                     /locus_tag="ZYRO0F10054g"
                     /db_xref="GeneID:8205399"
     mRNA            complement(<814872..>816854)
                     /locus_tag="ZYRO0F10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497589.1"
                     /db_xref="GeneID:8205399"
     CDS             complement(814872..816854)
                     /locus_tag="ZYRO0F10054g"
                     /note="weakly similar to uniprot|P33301 Saccharomyces
                     cerevisiae YDR369C XRS2 classified as an early
                     recombination function required for DNA repair but
                     dispensable for mitotic recombination (xrs2 is hyper-Rec
                     during vegatative growth) required for double strand
                     breaks meiotic recombination and spore viability DNA
                     repair protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497634.1"
                     /db_xref="GeneID:8205399"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="UniProtKB/TrEMBL:C5DY40"
                     /translation="MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDK
                     SISRQHVSICWDGKDRQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPL
                     KMQLQWMDSIWMVPQGSRSDHSALEELGIEVLSSELSRANLIVIDEQQNYSRWLYGLV
                     KRIPLMNLEFLNVVSQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTV
                     GKDEDTSLAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKT
                     FTVQDVVEAILKDEVNSLKNGVIGEVAKRPEAEVPMEKPVTKKRRLNRPRVKPLDILS
                     FFAGGDSMKESQGESTMKLNSQEEESKDPRKLEDPKEESKESKEVLQPEVPKEFNEYS
                     KEEPGQKSYEESKADENEKSLEETVEPTLQVTEPPPTSAAEKPNNARPHRKPTLSDYR
                     KGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLM
                     RRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKYGGQDSTSREGSSDTIRNRAFLLTRQY
                     VPTRTYTSGDSSKQAQEDLYDFPEPQPEAQSVPQVEAPGPNNLFVMDEDDSQDVALEE
                     PEKPVLPSTSHLIDDRESDSDSDDDEPKFQFKRRKR"
     gene            complement(<817036..>818484)
                     /locus_tag="ZYRO0F10076g"
                     /db_xref="GeneID:8205400"
     mRNA            complement(<817036..>818484)
                     /locus_tag="ZYRO0F10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497590.1"
                     /db_xref="GeneID:8205400"
     CDS             complement(817036..818484)
                     /locus_tag="ZYRO0F10076g"
                     /note="similar to gnl|GLV|KLLA0E02222g Kluyveromyces
                     lactis KLLA0E02222g and some similarites with YNL026W
                     uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
                     Essential component of the Sorting and Assembly Machinery
                     (SAM complex) of the mitochondrial outer membrane the
                     authentic non-tagged protein was localized to the
                     mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497635.1"
                     /db_xref="GeneID:8205400"
                     /db_xref="GOA:C5DY41"
                     /db_xref="InterPro:IPR000184"
                     /db_xref="UniProtKB/TrEMBL:C5DY41"
                     /translation="MAEAEAELIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSD
                     SLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLN
                     KEISESYGIETPLSTQAKVLLKRPDYNTISGTTTLSDDNISLAGSKTWKNLLGQADAE
                     NLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAIVEAEGIQRSLCSKPFVAPEDE
                     HVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLNEFKPTASELYAPFKGPFDK
                     TSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEH
                     HASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVGTGGQN
                     FFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNSYAAATGLSLVYKTPQ
                     ALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF"
     gene            complement(<818672..>819793)
                     /locus_tag="ZYRO0F10098g"
                     /db_xref="GeneID:8205401"
     mRNA            complement(<818672..>819793)
                     /locus_tag="ZYRO0F10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497591.1"
                     /db_xref="GeneID:8205401"
     CDS             complement(818672..819793)
                     /locus_tag="ZYRO0F10098g"
                     /note="similar to uniprot|Q06349 Saccharomyces cerevisiae
                     YDR370C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497636.1"
                     /db_xref="GeneID:8205401"
                     /db_xref="UniProtKB/TrEMBL:C5DY42"
                     /translation="MSHSKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEAS
                     YYYGGQLHDSISDSIGLKSPGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDS
                     SRGCYQWINKWENDNHTSYSQRSPFVVISPRHYLVELTMQLFQQSKYSILCTHLGDGK
                     IVLSQVENDKKSHQHTSRNTTMTKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDA
                     NISLVLRCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIG
                     VRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLV
                     GENVDRSSPQCFKLTIDESHKIQLEKLKHVPAHVELPIR"
     gene            <820318..>820635
                     /locus_tag="ZYRO0F10120g"
                     /db_xref="GeneID:8205402"
     mRNA            <820318..>820635
                     /locus_tag="ZYRO0F10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497592.1"
                     /db_xref="GeneID:8205402"
     CDS             820318..820635
                     /locus_tag="ZYRO0F10120g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497637.1"
                     /db_xref="GeneID:8205402"
                     /db_xref="InterPro:IPR005545"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:C5DY43"
                     /translation="MVEWVVIAFDKADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEP
                     KAPGEPRTFAGSHLQVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPVN
                     KLK"
     gene            complement(<820724..>821184)
                     /locus_tag="ZYRO0F10142g"
                     /db_xref="GeneID:8205403"
     mRNA            complement(join(<820724..821091,821172..>821184))
                     /locus_tag="ZYRO0F10142g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497593.1"
                     /db_xref="GeneID:8205403"
     CDS             complement(join(820724..821091,821172..821184))
                     /locus_tag="ZYRO0F10142g"
                     /note="highly similar to uniprot|P07274 Saccharomyces
                     cerevisiae YOR122C PFY1 Profilin actin- and
                     phosphatidylinositol 4 5-bisphosphate-binding protein
                     plays a role in cytoskeleton organization required for
                     normal timing of actin polymerization in response to
                     thermal stress localizes to plasma membrane and cytosol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497638.1"
                     /db_xref="GeneID:8205403"
                     /db_xref="GOA:C5DY44"
                     /db_xref="InterPro:IPR005455"
                     /db_xref="InterPro:IPR027310"
                     /db_xref="UniProtKB/TrEMBL:C5DY44"
                     /translation="MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIG
                     KIAAGFDEPSGLQSTGLFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYP
                     PSVQAGEATKIVEQLADYLIGAQY"
     gene            complement(<821488..>822759)
                     /locus_tag="ZYRO0F10164g"
                     /db_xref="GeneID:8205404"
     mRNA            complement(<821488..>822759)
                     /locus_tag="ZYRO0F10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497594.1"
                     /db_xref="GeneID:8205404"
     CDS             complement(821488..822759)
                     /locus_tag="ZYRO0F10164g"
                     /note="similar to uniprot|P38439 Saccharomyces cerevisiae
                     YOR123C LEO1 Component of the Paf1 complex which
                     associates with RNA polymerase II and is involved in
                     histone methylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497639.1"
                     /db_xref="GeneID:8205404"
                     /db_xref="InterPro:IPR007149"
                     /db_xref="UniProtKB/TrEMBL:C5DY45"
                     /translation="MSDPQEQAPEATAPVQDSSAEKELSNETKQEPSGDEKSGSQDEM
                     EDLFGEDEGEDEEDEKRKGSEDENDEGEVTLRHRQEMDDEEAEEHAMYTRKFYGEDVD
                     RVSDEEEAQEFREEDVELVRHIVPYRATQGTDKPVLYYAKIPEFLTIDPVPFDPPSFE
                     ASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLK
                     LGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKA
                     VMRRDHKQAAGPGTYIVQKDPELERGELEKKQQQVVRERRRRQVKEMESREASGDPDR
                     RAAISAEAEPMGNIRRNEYEQDDFLVDDDDEEEYASGSGEEGEEEEEEDEGNVSDEGA
                     ERLRRLKREGANNYEERKRRRVAVIDDEEDE"
     gene            <823029..>824588
                     /locus_tag="ZYRO0F10186g"
                     /db_xref="GeneID:8205405"
     mRNA            <823029..>824588
                     /locus_tag="ZYRO0F10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497595.1"
                     /db_xref="GeneID:8205405"
     CDS             823029..824588
                     /locus_tag="ZYRO0F10186g"
                     /note="similar to uniprot|Q06350 Saccharomyces cerevisiae
                     YDR371W CTS2 Sporulation-specific chitinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497640.1"
                     /db_xref="GeneID:8205405"
                     /db_xref="GOA:C5DY46"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR001579"
                     /db_xref="InterPro:IPR011583"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029070"
                     /db_xref="UniProtKB/TrEMBL:C5DY46"
                     /translation="MHWHNQPWFNHSIILAFIIASIVIEMCFYRKIFKSSAEHDVLDH
                     VHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAF
                     FLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFY
                     LRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDG
                     IDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDK
                     LNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEG
                     LDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEG
                     EPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLR
                     GGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEALRYYLEKFGQDEFLS
                     PFIIRIISKSH"
     gene            complement(<824737..>825735)
                     /locus_tag="ZYRO0F10208g"
                     /db_xref="GeneID:8205406"
     mRNA            complement(<824737..>825735)
                     /locus_tag="ZYRO0F10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497596.1"
                     /db_xref="GeneID:8205406"
     CDS             complement(824737..825735)
                     /locus_tag="ZYRO0F10208g"
                     /note="highly similar to uniprot|Q06385 Saccharomyces
                     cerevisiae YDR372C VPS74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497641.1"
                     /db_xref="GeneID:8205406"
                     /db_xref="InterPro:IPR008628"
                     /db_xref="UniProtKB/TrEMBL:C5DY47"
                     /translation="MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVK
                     LTDNVEVPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDD
                     SARKRFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKI
                     NYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPR
                     NLELNYNDYFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILK
                     QFSEYPFDLDTQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL"
     gene            complement(<826246..>827988)
                     /locus_tag="ZYRO0F10230g"
                     /db_xref="GeneID:8205407"
     mRNA            complement(<826246..>827988)
                     /locus_tag="ZYRO0F10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497597.1"
                     /db_xref="GeneID:8205407"
     CDS             complement(826246..827988)
                     /locus_tag="ZYRO0F10230g"
                     /note="similar to uniprot|P12630 Saccharomyces cerevisiae
                     YIL015W BAR1 Aspartyl protease secreted into the
                     periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497642.1"
                     /db_xref="GeneID:8205407"
                     /db_xref="GOA:C5DY48"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DY48"
                     /translation="MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGEN
                     YEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLW
                     ITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLTLTGGSMPSSFGS
                     FGSIDVSTGGIEPTETISGGGGGSGGSPTGSSSSGGQSIDCSRYGTFDKNQSSTYKSN
                     NTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETT
                     YSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFD
                     GSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTLSTTKIPALLDSGSTLAY
                     LPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPIS
                     SDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSI
                     PQATAAAGYSSTYSSSKSITSGGNIFSSGTLSGSASNTASGNNKSKNMAAAPVQIAPT
                     SLLATIFFAISMFF"
     gene            complement(<828774..>830429)
                     /locus_tag="ZYRO0F10252g"
                     /db_xref="GeneID:8205408"
     mRNA            complement(<828774..>830429)
                     /locus_tag="ZYRO0F10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497598.1"
                     /db_xref="GeneID:8205408"
     CDS             complement(828774..830429)
                     /locus_tag="ZYRO0F10252g"
                     /note="weakly similar to YYIL015W uniprot|P12630
                     Saccharomyces cerevisiae YIL015W BAR1 Aspartyl protease
                     secreted into the periplasmic space of mating type a
                     cells, cleaves and inactivates alpha factor allowing cells
                     to recover from alpha-factor-induced cell cycle arrest and
                     to YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
                     YPS3 Aspartic protease, attached to the plasma membrane
                     via a glycosylphosphatidylinositol (GPI) anchor and to
                     YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
                     YPS1 Aspartic protease, attached to the plasma membrane
                     via a glycosylphosphatidylinositol (GPI) anchor and to
                     YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
                     MKC7 GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497643.1"
                     /db_xref="GeneID:8205408"
                     /db_xref="GOA:C5DY49"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DY49"
                     /translation="MKFLTSLVTSVLLSTASAGLVSPPVYKLSFNKLRGETFEKAVGN
                     SNGHANFDIKNQQNFYSVELKVGTPAQNVLVLLDTGSSDLWITGSGNPYCSPSTRNSH
                     LGSAGSNSSTNNGPSSTANFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGS
                     FAKGLWGMDHVYLDGLNVSDVSFAVANESNSTVGVFGVGLPGEEATVTPGVNGNHYQY
                     KNFPQVLKDNGVVQKNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQ
                     GVAPREFDVTVQGITVGNSSSNSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGK
                     FSPSTGYYLIPKPSENDDTKITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGD
                     RAIFGDVFLVDAYVVYDLEDYEISLAQANFNSGSSDIEAISGSVPGASRAPGYSQTYT
                     GNQPSSSGSASPGGSTGQEASSSSSSSSSASNGDSESSSSSSSSSSSNSGSSGNNSES
                     SSSSFSNSDKRGLTVSENGVGSLRAANPMILAFVTTFITSMLT"
     gene            complement(<831057..>832775)
                     /locus_tag="ZYRO0F10274g"
                     /db_xref="GeneID:8205409"
     mRNA            complement(<831057..>832775)
                     /locus_tag="ZYRO0F10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497599.1"
                     /db_xref="GeneID:8205409"
     CDS             complement(831057..832775)
                     /locus_tag="ZYRO0F10274g"
                     /note="similar to uniprot|P12630 Saccharomyces cerevisiae
                     YIL015W BAR1 Aspartyl protease secreted into the
                     periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497644.1"
                     /db_xref="GeneID:8205409"
                     /db_xref="GOA:C5DY50"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DY50"
                     /translation="MRFTDAVVSLLSVASTCKSALIEQTSSPMVKLSFNKWHGPTYEE
                     SSLERRSLETRNNKEFNFIVENQQNFYSVDLLVGTPGQNITVLLDTGSSDLWLTAKNN
                     PYCKSNAGSNDKKEDYRLEDGDNQSIVSMLTASGTGTNPIGGSGIPTAISGSAQLTGT
                     YTSGTGTGPSGSSPEPTMDCSQYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTD
                     SVNFANMNLEGVSFAVANETNSTVGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQV
                     LKSKGAINKAAYSLFLNSLDASSGDILFGAVDRSKYKGDLYTLPLLNSDPTKYKNPME
                     FDVTLQGVGFTNGSSKTTFTTTKIPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIG
                     YYVIGCPSENDDSQLVFDFGGFTIKNNLSNYLLGSPDDGDDSQCVLGILPSDVQAILG
                     DVFLADAYVVYDLDDYEVSLAQASFDNSKEDIQIISDSIPGAKRAPGYSKTWSTPASI
                     KSGGNIFTSSNKKTERDHTAATATPVSGSASSTSGAQISSQDVANGFSPSMLALLNAF
                     ILSFVI"
     gene            complement(<833615..>835201)
                     /locus_tag="ZYRO0F10296g"
                     /db_xref="GeneID:8205410"
     mRNA            complement(<833615..>835201)
                     /locus_tag="ZYRO0F10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497600.1"
                     /db_xref="GeneID:8205410"
     CDS             complement(833615..835201)
                     /locus_tag="ZYRO0F10296g"
                     /note="weakly similar to uniprot|P12630 Saccharomyces
                     cerevisiae YIL015W BAR1 Aspartyl protease secreted into
                     the periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497645.1"
                     /db_xref="GeneID:8205410"
                     /db_xref="GOA:C5DY51"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DY51"
                     /translation="MKFAKGLYVCGLVSSVSCLPAVHDSRSSQSVAKIGFNKVYGKSF
                     SEATADRKYVNLFRNKNISDDNDEVALQNNANTYYSVNISLGTPGQNMTIQLDTGSSD
                     LWVIKPGGLQCTDNDTNLFKKRSENDNDNDAISSFISQLESYEGSFSTLFGPGPGSVG
                     TPTGTISSSMPAPTGNGSYDGGDSDSDGSNNCNATAFFEADNSKTFHRNRTDPYYIQY
                     EDLSYASGYWGTDDLQLGDLQVHNVSFAVANDTNSTTPVFGIGFPGGESSFASVGPEY
                     RAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPNSTYGNVLFGGVDHSQYQGQLYTLP
                     ILQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHKVKTKPIPVVLDSGTTAMYLPYKLA
                     KSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGGVTIKTDIRNYIFEQSENKCLL
                     GIIPNSDILAVFGDVFLTDAYVVYDLEGKEISLAQASFNSSSEQIEAITSSGVPGAKR
                     APGYSKTWKVVHSSQASALH"
     gene            complement(<835672..>837132)
                     /locus_tag="ZYRO0F10318g"
                     /db_xref="GeneID:8205411"
     mRNA            complement(<835672..>837132)
                     /locus_tag="ZYRO0F10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497601.1"
                     /db_xref="GeneID:8205411"
     CDS             complement(835672..837132)
                     /locus_tag="ZYRO0F10318g"
                     /note="similar to uniprot|P12630 Saccharomyces cerevisiae
                     YIL015W BAR1 Aspartyl protease secreted into the
                     periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497646.1"
                     /db_xref="GeneID:8205411"
                     /db_xref="GOA:C5DY52"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DY52"
                     /translation="MKFTTLNAIGILASTVSGAAIENHRREVSPKIIQLSFNKHGGAA
                     NNKDILTPTSQNTDISVNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNL
                     FCENHAVSDSNSTDKPLKSPTLPSPQPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGD
                     QSYALGRFGQDTVEMNSLSIPNVSLGVAHQANVTQGVLGIGLAGLETTNTGFSSTLNS
                     KSYTYENFPQVLKSQGIIDANAYSLFLNSPGASQGGILFGGVDHSKYTGPLYTVPIIN
                     TGAPGNPIQFQVTLQGVGISLDKSNGTNTNAADSTSNVTLTASKFPVLLDSGTTLMTL
                     PRPVTDQMAKQLGATYNSETSYYQLKCPSQNDNTRLILDFGGFQVNAKITNHITRSQN
                     GECLLGITPSDTDSGTLGDVFLVDAYVVYDLDNYEISLAQADFSDSAQSIEPISSSVP
                     SATKAPGYSNTWTGSESIKTGGNIFTAQTSAPTMTQ"
     gene            complement(<837799..>840255)
                     /locus_tag="ZYRO0F10340g"
                     /db_xref="GeneID:8205412"
     mRNA            complement(<837799..>840255)
                     /locus_tag="ZYRO0F10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497602.1"
                     /db_xref="GeneID:8205412"
     CDS             complement(837799..840255)
                     /locus_tag="ZYRO0F10340g"
                     /note="similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
                     YLR127C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497647.1"
                     /db_xref="GeneID:8205412"
                     /db_xref="GOA:C5DY53"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014786"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="UniProtKB/TrEMBL:C5DY53"
                     /translation="MNAVMRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNE
                     PQSNHQCKPPTLRLKNSIKMLVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFF
                     ASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINV
                     VSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNN
                     RFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVG
                     VYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAF
                     LTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQ
                     LSQELKDPEFGIESSFETIPQADLLSRPASTATTAAMLDPRLPYKSVIKNFLQWTPEP
                     MDTISKNYSKSLSASRNLLDILMDMFESKDFFVSEFLSLLTRKLLTLKLYTLDRKWSH
                     CLRLLKTKFGPAGAAAVVATGIGGGDGGSIDGVRGGDPSNINNIDVMLRDVRGSSELC
                     KRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTFQLDPQMALELDKYCQVYSEIKPGR
                     ALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQ
                     MDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAENLPASKDSSASSQARTMSPD
                     RDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLH
                     SLVEEERLICTTNDTYKLPK"
     gene            <840411..>841235
                     /locus_tag="ZYRO0F10362g"
                     /db_xref="GeneID:8205413"
     mRNA            join(<840411..840413,840483..>841235)
                     /locus_tag="ZYRO0F10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497603.1"
                     /db_xref="GeneID:8205413"
     CDS             join(840411..840413,840483..841235)
                     /locus_tag="ZYRO0F10362g"
                     /note="similar to uniprot|Q12395 Saccharomyces cerevisiae
                     YLR128W DCN1 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497648.1"
                     /db_xref="GeneID:8205413"
                     /db_xref="InterPro:IPR005176"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR014764"
                     /db_xref="UniProtKB/TrEMBL:C5DY54"
                     /translation="MENLVATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSEHDQ
                     DQSYSPELPQLFRKYAVVTPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRL
                     TDGITEGQFSYNWQQNGCTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGA
                     KTLETHTAVQYWTLFFATGQYPVIVEQQFFQLWISFVQQEQSISRDTWRMLFPFFNRF
                     SNLQSVRDNYNEADAWPYIIDEFYEYLADKGEI"
     gene            <841520..>843196
                     /locus_tag="ZYRO0F10384g"
                     /db_xref="GeneID:8205414"
     mRNA            <841520..>843196
                     /locus_tag="ZYRO0F10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497604.1"
                     /db_xref="GeneID:8205414"
     CDS             841520..843196
                     /locus_tag="ZYRO0F10384g"
                     /note="some similarities with uniprot|Q03761 Saccharomyces
                     cerevisiae YDR145W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497649.1"
                     /db_xref="GeneID:8205414"
                     /db_xref="GOA:C5DY55"
                     /db_xref="InterPro:IPR003228"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5DY55"
                     /translation="MSFNNSNNGAGNPSASGSGGNGGSAGSPSQGALLQHRQLLELRT
                     KFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQAYEQARNGAAAGG
                     STPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTPEQNQQYDNLLQ
                     TFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSLNMEYS
                     VLRQEFTNGKKKFYVECARHNPALQRLLQKSTQQQRMAQQQQQQMQQQVQQQVQQPQQ
                     KPVEQVQVPKTEPGVAKPQQQQQQQQQPQQQQQPQQQQPQQQRGPTSITTQKLPQQTQ
                     PRSQPSSSSVNKSQVTNVNATASMANNNAANKSAIFKQSDPLVPISENVTVKAPSPVA
                     YKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTERVMSKRKLRELVKTVGIDDGDGE
                     TVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGY
                     SADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGGASNKSLSQSK"
     gene            <843429..>846245
                     /locus_tag="ZYRO0F10406g"
                     /db_xref="GeneID:8205415"
     mRNA            <843429..>846245
                     /locus_tag="ZYRO0F10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497605.1"
                     /db_xref="GeneID:8205415"
     CDS             843429..846245
                     /locus_tag="ZYRO0F10406g"
                     /note="similar to uniprot|Q12220 Saccharomyces cerevisiae
                     YLR129W DIP2 Nucleolar protein specifically associated
                     with the U3 snoRNA part of the large ribonucleoprotein
                     complex known as the small subunit (SSU) processome
                     required for 18S rRNA biogenesis part of the active pre-
                     rRNA processing complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497650.1"
                     /db_xref="GeneID:8205415"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DY56"
                     /translation="MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNGPGQIITGAL
                     ENVNIWDIKTGELVSHLSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIK
                     IWDMFSKTVLLSFNGHRSAVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSH
                     KDSITGLSLPDENWLMSVSKDGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTT
                     SSDSQIKIWHLDLDADAGVKVTEKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKT
                     LEIIRLRKEEEISRALKKREKRFKEKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKI
                     RAASWAVTTSSKLELTVTTSGNTIEYYSIPYEKREPKHPTPIRVHSIELQGHRTDVRA
                     IDISDDGKLLATASNGLLKIWNIRTKTCLRTFECGYALTCKFLPGGVLVIVGTRSGQL
                     QLFDLASSTILENNEEAHDAAIWSLDITSDGRRLVTGSADKTVKFWNFIVEEKKVPGT
                     TDKLIPTMSLHHDTTLEMSDDILSVKISPENKLLAVSLLDNTVKVFYLETMKFFLSLY
                     GHKLPVLSIDISFDSKLIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESH
                     NFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALAVARSGTCVISVSHDSSIRVWEE
                     TDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAFKQDEKDDDHDDAVDVHKQTVES
                     LKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKKQGVEPERPQDNAILLAINKRPEE
                     YIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKKLLHNHLSLICKNLFFIV
                     QSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEGLKFIKQQWNLKHNYE
                     FVDEFDQRKQAEKTAKKRVFETLS"
     gene            complement(<846822..>849263)
                     /locus_tag="ZYRO0F10428g"
                     /db_xref="GeneID:8205416"
     mRNA            complement(<846822..>849263)
                     /locus_tag="ZYRO0F10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497606.1"
                     /db_xref="GeneID:8205416"
     CDS             complement(846822..849263)
                     /locus_tag="ZYRO0F10428g"
                     /note="similar to uniprot|P21192 Saccharomyces cerevisiae
                     YLR131C ACE2 Transcription factor that activates
                     expression of early G1-specific genes localizes to
                     daughter cell nuclei after cytokinesis and delays G1
                     progression in daughters localization is regulated by
                     phosphorylation potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497651.1"
                     /db_xref="GeneID:8205416"
                     /db_xref="GOA:C5DY57"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DY57"
                     /translation="MEPAADPWNINPSELLKGSMNSDPYIGFGNTNNIYNNNNHVEAS
                     GMGFGQDDLEKLLGFGCEDVDNLLSQELKDLDIPLMPRASKVNGNGAGDGDGITGLGF
                     SGFNEDPYSLNRHNNSHKREPSGTAIFGFHNHNKTLSISNWQKAFGDPREQQQQQQQQ
                     QQQLQQQQLQQQPQQQALGSIEETNPDGYLGQVLLKQQEELRIALERQQEVNKKLEEQ
                     LEANRVQQERLQRVLGEQDVTAHKFISSESASPQSATKTPANNGKSSTIIGDDGNIIV
                     TSNSNNGGYKFPPPANLEPPAYGPGSHTAMNGSPPRKVSRGRTPPINDDLREDADEDV
                     AMTNYLRPEIEQKEAVADSSHFLKKRNAQPGFTNGFSIQDQTRSPVNTRSTVHHNKKE
                     STISTVSTIPQHLDDNENSDSDSGGLLGLGIQSMNGKRAVPRNYSLRPPPVDIMPPIP
                     GSTDNTPIPKQPQLPQKHIFQHTPVKNQYPPVKSQHPPVQQPTQGYYSNAGISTGSGT
                     SLGENPFRDPIATPQLKPPSDHSSRRNSGYSADHNEIIGGHKSDFNGEEQQMEDGDEP
                     ESRFIVAKTPSPVLKSQGRFEGSSPQYDTTNVSPIKITRKPSTLPRGSIDKYVKELPD
                     KLFECQYHGCGKIFKRRYNIRSHIQTHLEDRPYMCDFEGCDKAFVRNHDLVRHKKSHA
                     EKCYACPCGKKFNREDALIVHRSRMICSGGRRYENVVIKKSPRRRGRPKKDDYSSTHS
                     SPVKETVERSNDGYLIYKMEEQLRNEMEEYGLLRPPPNLAVTNHALLLSPSPSSDNSD
                     MGSPKYELKEPQKKP"
     gene            complement(<849553..>850320)
                     /locus_tag="ZYRO0F10450g"
                     /db_xref="GeneID:8205417"
     mRNA            complement(<849553..>850320)
                     /locus_tag="ZYRO0F10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497607.1"
                     /db_xref="GeneID:8205417"
     CDS             complement(849553..850320)
                     /locus_tag="ZYRO0F10450g"
                     /note="weakly similar to uniprot|Q12208 Saccharomyces
                     cerevisiae YLR132C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497652.1"
                     /db_xref="GeneID:8205417"
                     /db_xref="GOA:C5DY58"
                     /db_xref="InterPro:IPR027521"
                     /db_xref="UniProtKB/TrEMBL:C5DY58"
                     /translation="MDHIREDYSSSDSESDIETVPELPDAILDKYHLTPSVNMNRAAT
                     GFNSFVYLEWRPSKLQRIHLTRVLVNFQAQCSGSGIEVLKRLKLEPLHVSALGSPEPL
                     HVSLTRSLEFSDAMQRDRFQQSLSTRLAASQLSPIDIAFEPRFQVLDSRFKDRVFLTL
                     PVLSSQRSHWFKFVYQVIWQSLREVWPNLNDKEIDEMLCPAESVHMSIAQTHGTRAKE
                     LAVWIQPLEPLQPLPTWNVTHLKLDKNRECIKIPLVT"
     gene            <850603..>852408
                     /locus_tag="ZYRO0F10472g"
                     /db_xref="GeneID:8205418"
     mRNA            <850603..>852408
                     /locus_tag="ZYRO0F10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497608.1"
                     /db_xref="GeneID:8205418"
     CDS             850603..852408
                     /locus_tag="ZYRO0F10472g"
                     /note="similar to uniprot|P20485 Saccharomyces cerevisiae
                     YLR133W CKI1 choline kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497653.1"
                     /db_xref="GeneID:8205418"
                     /db_xref="GOA:C5DY59"
                     /db_xref="InterPro:IPR007521"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR026712"
                     /db_xref="UniProtKB/TrEMBL:C5DY59"
                     /translation="MQETMPESRSSRSEVRLNPFSIGSPHPYSHSRTRSRSHSRSSSR
                     NRPSLTGPRPSQRLIRTISVDSDVSIGEDEFTLKTGESHVPPEVPEEDSKEIADQLEG
                     LKLSERSSFRESENVEVPYVPTVLDNSLPMDYLQDDVLNTIQNLRIPKWYVRGSMGVS
                     PLDRNKIKMTKITGAMTNVIYKVEYPGLPSLLLRVYGPNIDTIIDREYELQVLARLSR
                     RNIGPSLYGCFQNGRFEQFLENATTLGKDDIRNWKTSQRIARRMKELHTGVPLMKSER
                     EQGPVCWIKIEKWLENIEQRGEQWVNDVSNVQKWLMCRDWPTFKKAVLRYRDWLYSRG
                     LPYVRQGLVFCHNDTQYGNLLLSSPVIPLDNVDPVISNPKSASSSSTVSSLFPQSSNV
                     SLEQILNPPIQEQSQDSKLVVIDFEYAGANPAAYDLANHFSEWMYDYNSAEPYKCFAS
                     QFPTREQMLNFLYCYVSHLRNKNAVPIDDEVRYYYNAIIKWRATAQLFWSLWGVLQSG
                     KLDAPSAQLNDEKERPSGGKYIFTEMDEPSDALETPEATSESSSEKGVDIDSFDYLSY
                     SRHKIELFWGDLLQMGVVERDDCVGIEEQLEATLL"
     gene            complement(<852619..>853944)
                     /locus_tag="ZYRO0F10494g"
                     /db_xref="GeneID:8205419"
     mRNA            complement(<852619..>853944)
                     /locus_tag="ZYRO0F10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497609.1"
                     /db_xref="GeneID:8205419"
     CDS             complement(852619..853944)
                     /locus_tag="ZYRO0F10494g"
                     /note="similar to uniprot|P19262 Saccharomyces cerevisiae
                     YDR148C KGD2 Dihydrolipoyl transsuccinylase a component of
                     the mitochondrial alpha-ketoglutarate dehydrogenase
                     complex which catalyzes a step in the tricarboxylic acid
                     (TCA) cycle the oxidative decarboxylation of alpha-
                     ketoglutarate to succinyl-CoA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497654.1"
                     /db_xref="GeneID:8205419"
                     /db_xref="GOA:C5DY60"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001078"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR006255"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR023213"
                     /db_xref="UniProtKB/TrEMBL:C5DY60"
                     /translation="MLSRSIRTSASRAIKSSQCMRTVSCASAKRYASSSLFTRQSAPS
                     RIPQNLNSQFISRSLLQRRLESTKVEVPPMAESLTEGTLSQYTKQVGESIQQDELLAT
                     IETDKIDIEVNAPVSGKIVKLSFKPEDTVTVGQELAQIEEGEVSTGGEAPKEEPKPEE
                     PKKEEPAAAAPPPPKPEAPKKEAPKPAAPKKEAPKKPEPAPQAPKTTSFSRNEERIKM
                     NRMRLRIAERLKESQNTAASLTTFNEVDMSALLEMRKLYKDEIIKSKGVKFGFMGLFS
                     KASTLAAKDIPSVNGAIEGDQIVYRDYSDISIAVATPKGLVTPVIRNAESLSVLEVEQ
                     EIVRLSQKARDGKLTLEDMSGGTFTISNGGVFGSLYGTPIINTPQTAVLGLHGVKERP
                     VTVNGKIESRPMMYLALTYDHRLMDGREAVTFLRTVKELVEDPRKMLLA"
     gene            <854693..>856342
                     /locus_tag="ZYRO0F10516g"
                     /db_xref="GeneID:8205420"
     mRNA            <854693..>856342
                     /locus_tag="ZYRO0F10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497610.1"
                     /db_xref="GeneID:8205420"
     CDS             854693..856342
                     /locus_tag="ZYRO0F10516g"
                     /note="some similarities with uniprot|Q12098 Saccharomyces
                     cerevisiae YLR135W SLX4 Subunit of a complex with Slx1p
                     that hydrolyzes 5' branches from duplex DNA in response to
                     stalled or converging replication forks function overlaps
                     with that of Sgs1p-Top3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497655.1"
                     /db_xref="GeneID:8205420"
                     /db_xref="GOA:C5DY61"
                     /db_xref="InterPro:IPR018574"
                     /translation="MDFHRANRNLQLVESGVSDGRNPESFSLDETQVPVSSGFSSDSD
                     KDQQEQIFINTQVQGRLDEAEEADKVRANLGQFRYDSQDSAISPKHKSAIQRPSARTT
                     KRSSSSQRRKAPTKAQSLLKQLSGKHAKVQDMIKYQQKLDSLAGSQQRAKSKGKTTKT
                     KKQQEKRYDTYNANEWQHIYNLLLEKFPHTRPSEVEDVYQYLYGDESEDQPLWNESQR
                     PIEPESQDLGFLPPPPADKQRVSVLSLSQVMDDKHSREPDEDIIVPDSTDEEYIVIPI
                     PSSPQPLRPPLATKPPLLTKPPLKKVESDAGTPKTAHSPSDGVIDLTNGSFKVVKSLI
                     SPLKEETAQVQVPATRMPTLGTTPNLAPTKEQPLRYRLHRSQLESFSAVEGLIVCSPG
                     PSQDDVPVPDTESEDSAAEDHCMVELQPSILASRTPSPSVQSDWNSQSAQQLRQSMKS
                     LGLKTSRSKRQMLHSLQQASQVLEIDTGGQENQRQEIHDYLTSLVQSSPVLLEKVYTF
                     QPIASKELLTKLTEANPFVDVIDEYTIREWADYQGICLTTS"
     gene            <856604..>864181
                     /locus_tag="ZYRO0F10538g"
                     /db_xref="GeneID:8205421"
     mRNA            <856604..>864181
                     /locus_tag="ZYRO0F10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497611.1"
                     /db_xref="GeneID:8205421"
     CDS             856604..864181
                     /locus_tag="ZYRO0F10538g"
                     /note="weakly similar to uniprot|Q00402 Saccharomyces
                     cerevisiae YDR150W NUM1 Protein required for nuclear
                     migration localizes to the mother cell cortex and the bud
                     tip may mediate interactions of dynein and cytoplasmic
                     microtubules with the cell cortex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497656.1"
                     /db_xref="GeneID:8205421"
                     /db_xref="GOA:C5DY62"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR024774"
                     /db_xref="UniProtKB/TrEMBL:C5DY62"
                     /translation="MSSKSNKRESLLTQFENMHKQLNEESEGKSEPQPNAGDVTQGAD
                     IKKPSLFSNVLNKRDKNNSMPIFAGSATHNGVFTANNGKDMNFVMGLSENLLVECRRL
                     QAENEEKNGTINQLQDEYQNLEDKHEKLDSSHQVTSKELTALKDTNWELEVKLQQFSV
                     EFKELKDKLNRNKKELKVEQENSKTTMAELEVSRLQRTGLEKELAEREKEYSAELTEL
                     RKNVSELNDENDSLYGRIKTLDKKILQNESLRTQLSESAQLVDNLKRQLGELETKLEN
                     SSDNGILKAQLSKSESTVNKLKLQLTDLKTKNKNHDDLQLELLHSRGLISKLKQQVAT
                     FEATTNSNVDENKALKSNMELINQEAENLRLQVSELQKQLHERDNDKNNSLQSELSQS
                     KQLVEELRQQLATFETKKGTSNRNTRMKVRKRSKGRSVDVKELSDQESDVSETMDKLA
                     ALENLEDELAADEESNIPIEKVEKYAKLHKMRLISESEYSKAQLHKRTDSNEQLVNTV
                     GDTNLLALPNDNSSQKKYIEGATSIDAMIERVESSGYKVLSFPEFNEKQEKLHELENP
                     SEKYLKSKASHLGKILVSQDSYNKAVNPPASQLKETLEKAGYTIIGNDEYKKMVASIE
                     TPELNYLDTKLAAKGKMAVTAEDFKNYTSPGVQFVEDLTKSIGYVAIAQEKYNEMQRK
                     ITEPSIETILSTLDKQDFQAILSQFGKKHHLVLLNKKDHDHLVSAFANPSKQYLIEKC
                     PSQQIQPVPIDEYHRMLQTLQNPTLEFMNDKATSMNKKLIPLKTFEKLRRTSENPSVD
                     FLRQHAKKNHFIMLSEDDHHTMQRTLNEPNIEYLQAKAKNHKLVDLETHDKLTRTFNT
                     PSLEFLTEKASGKGYDVVNTKEHKELLRKVMRPTEDEISQSARNLGAVVVQVEEYEGL
                     KEITSAPSKDFILEKANKLNMVVLENGEYEKLKKASTDKESLFSSVKGLGFFPVPIPE
                     LNTLRGSTLEKSNVSDIEKRLKTLGYVAVSIKQYNELNKSPVDRATKEDTLALCSKYS
                     FKPISIEEYQKLKNDSKPTVYSEDELIEMLKSHGYAVMPVNEHEAMTGMIKSPTAEFL
                     EESAAQHGKVLINRDLHEQHINILDSPTIEFLSEKASTLGYKVIAEKEYESLRAQIDS
                     PSTDSLKKMAGLYNLTLIPHAKYNKLMNDVNNPSLSTLQTKATAMRKRVVDNAEYGEL
                     QRKTSSPTKEELQTLAVTLNMVLVVKDEYDNLLKQINHPSLEFLERKLAQFQYVAIPA
                     SDHHALKKSVEDPSEHFLSEKAASRGMLLLSKTDHEGHMDALENPSLEYLGESAKKYS
                     KVLVSSSEIKTPDQAALIEEIAKGDLVTIARKELDNLKNSAENPSTDVMIPKLEDSNY
                     VVLDEGKFDEMKRQIESPHLDRVAKHAKEHGHVLVRSKDLAEQSSHDVEDLGPLTKEG
                     SFLLLNAEEYDALLNSNIDTLGQRDLLRMCDKLGLIPVPRAKYEELNSTPDVTRLQEY
                     ATELGMVVISQDDFDEMISELEKPLEQSVHSFAEENNLLLIEKDSYENLLFRLNNPTK
                     DELEKHSERLGLVLVPSKQYETLVEQFKYKSSSSLPLQEGLTEAKENTNSGALHGSSA
                     SSGMLRSSNEEHGKSSDNISTPAFSKTDVYRAAESLDLTVLAADEYESLLSRNSTAEA
                     VTLKDIQEFAARHNMKLLPSTEQGYGNSTSQLRMAIDSTSTDSIEFKHNSTSTIGSDF
                     TNYFDTMEGRPAEITEAQKVEKSKEVYSGNNRFVGQSPEQIKSMSLASQESTLKTSGT
                     PSTSRAEPLSIETLKEKAAEVGYVLVPASEYELTSKKNESTEVEDTEDWYDAANFESG
                     SNNEAAILAKKAKQLGFVLAPSSESQEDLNNRGKTVSPEVVSGQAARLGLVVLERETF
                     QALDLKAKDSKERLEQLAEKFGCHVLQNEEYSLLDKRLKEAELNIDNIQAKAGELGYH
                     VLNEEQYEELKDAATAGRKELTPEEFKNKATEFDLVPLSAAAYGELMSKSAAEPRELN
                     EEDIKKRASALGLTTMPNDAYKNLLSKQIPQEATKEYLEERASKLGMTVLSNRAYEEL
                     STRRKRPAITKDMIMSRARDYGLTVLPNSTYKELTSANSFENSKESITADAQRLGLKV
                     MGKEEYDTLLSHTKRQRITMKDVVEKSGEFGMALVPKEQMNKKSELTKDDIVHASGKF
                     GLVTLGKKEFARLQRLSKPESLKERAQAANMICLPKSAIIASPDRTNVDDLVVIPTAY
                     YKKLLSREASMISARKQQVEMSKPSARPPQRIARQESIRSTQSGRPVQKVREQRSINS
                     LMGSTRSATGVGSGVGPGPVVASNASNSSSREVPIPRASSMGALSLNTLESLNEPSII
                     PALTQTVIGEYLYKYYQVFGVGGESRHERYFWVHPYSMTLYWSPTNPVVENPTNHSTK
                     CAPIVKVDSVIDKNPTQGLYHKCLVITTDTRVIKIACPSRQRHNVWYNSLRYLLQRSM
                     EGINLEDIAENPSDTMYSGKIFALSKQPSKKLPMSTSSSFLRGKH"
     gene            complement(<864294..>865548)
                     /locus_tag="ZYRO0F10560g"
                     /db_xref="GeneID:8205422"
     mRNA            complement(join(<864294..865283,865510..>865548))
                     /locus_tag="ZYRO0F10560g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497612.1"
                     /db_xref="GeneID:8205422"
     CDS             complement(join(864294..865283,865510..865548))
                     /locus_tag="ZYRO0F10560g"
                     /note="similar to uniprot|P47976 Saccharomyces cerevisiae
                     YDR151C CTH1 Member of the CCCH zinc finger family and
                     uniprot|P47977 Saccharomyces cerevisiae YLR136C TIS11
                     mRNA-binding protein expressed during iron starvation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497657.1"
                     /db_xref="GeneID:8205422"
                     /db_xref="GOA:C5DY63"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="UniProtKB/TrEMBL:C5DY63"
                     /translation="MSSVYLSLVHPSLMEPVYQISSDSIWRASSKIATKEVCSNIEKK
                     NYKMMLMNNRNYAGNMSVHSSSTGPSSVFSNDEGTYEQKVREIEEYYVRTLLNEDEVE
                     QESTDAVVDQEWNRSETSSVTSSPTKLPFAFESRNVSEKALFDTSNRSSVSAEPLEFN
                     GNVTASGTPIKKELEVKINSEYAPKSDLLPLTTENLERLSITSEKLPCKPAVHIKKTT
                     SSVNNNNGNGNDGNLQDTNRGLYKTELCESFTTKGTCRYGNKCQFAHGLSELKFRQFG
                     NNFRTKPCINWTKLGYCPYGKRCCFKHGSDQDIKVYLKAGTYLSNSEKEEKKNLHANV
                     KALQKITW"
     gene            complement(<865754..>866074)
                     /locus_tag="ZYRO0F10582g"
                     /db_xref="GeneID:8205423"
     mRNA            complement(<865754..>866074)
                     /locus_tag="ZYRO0F10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497613.1"
                     /db_xref="GeneID:8205423"
     CDS             complement(865754..866074)
                     /locus_tag="ZYRO0F10582g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497658.1"
                     /db_xref="GeneID:8205423"
                     /db_xref="UniProtKB/TrEMBL:C5DY64"
                     /translation="MSQAFVINNIPSSVSDVTLLRFIRENSALCNVEHIQPFPDAYHH
                     INDKAGTKSVQVFFNNDEEGKLLTKLFEDQGTTERLVHLEDSVGNDVLVNRVPVRRIS
                     VTGC"
     gene            complement(<866249..>867151)
                     /locus_tag="ZYRO0F10604g"
                     /db_xref="GeneID:8205424"
     mRNA            complement(<866249..>867151)
                     /locus_tag="ZYRO0F10604g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497614.1"
                     /db_xref="GeneID:8205424"
     CDS             complement(866249..867151)
                     /locus_tag="ZYRO0F10604g"
                     /note="similar to uniprot|P00812 Saccharomyces cerevisiae
                     YPL111W CAR1 Arginase responsible for arginine degradation
                     expression responds to both induction by arginine and
                     nitrogen catabolite repression disruption enhances freeze
                     tolerance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497659.1"
                     /db_xref="GeneID:8205424"
                     /db_xref="GOA:C5DY65"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR014033"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:C5DY65"
                     /translation="MSQLSIVLAPFSGGQPRKGVDLGPKFMLKQGLPTHLKDLGYQVE
                     INEPLAGLPEAEEDDKFGHIKNPTSVGDATKLIYQNNLNVLDKGSFPLTLGGDHSIAI
                     GTVSAVLEKHPDAGLLWIDAHADINTLESTVSGNLHGCPVSFLMGLNENVPESLQWVP
                     KRLRPNKIAYIGLRDVDAGEKEIIRKLGISAYSMYHIDRYGMNKVIEMALEAIGSGPI
                     ILSYDVDAIDPQYVPATGTPVRGGLTLREALFLPERLAETKRLVAMDVVEVNPRLASN
                     DVHVVDTISAGCAVARCALGETLL"
     gene            867865..867936
                     /locus_tag="ZYRO0F10626r"
                     /db_xref="GeneID:8205425"
     tRNA            867865..867936
                     /locus_tag="ZYRO0F10626r"
                     /product="tRNA-Met"
                     /note="tRNA-iMet (CAT) cove score=75.85"
                     /db_xref="GeneID:8205425"
     gene            <868136..>869119
                     /locus_tag="ZYRO0F10648g"
                     /db_xref="GeneID:8205426"
     mRNA            <868136..>869119
                     /locus_tag="ZYRO0F10648g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497615.1"
                     /db_xref="GeneID:8205426"
     CDS             868136..869119
                     /locus_tag="ZYRO0F10648g"
                     /note="weakly similar to uniprot|Q6B2A9 Saccharomyces
                     cerevisiae YPL112C PEX25 Peripheral peroxisomal membrane
                     peroxin required for the regulation of peroxisome size and
                     maintenance recruits GTPase Rho1p to peroxisomes induced
                     by oleate interacts with homologous protein Pex27p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497660.1"
                     /db_xref="GeneID:8205426"
                     /db_xref="GOA:C5DY66"
                     /db_xref="InterPro:IPR008733"
                     /db_xref="UniProtKB/TrEMBL:C5DY66"
                     /translation="MSRPITMEENEEPLSAREQTVVTDSPPSPPQPKIRVVRNLEILE
                     YLIGTIAGTDKLTKVAKYALDVIKAIVVSRPNSVLARLISLIPNFKSKATYVSSTLST
                     YRYILRFGYTPFALSKLFDRLKATIKDPSKINKIWMNEGALNNVLDFYYGVFDELDTL
                     YRLSVWKNPKVYNKVVTQQCWAWEAFILLGLKNGLTQLNSIKSQITQLEVQRRVKNHA
                     MQLSASLHDQGPRPDSFVRQQLLQDLNKNKETAEREQEIERQLQELRHQKLVTYLDVA
                     RLSFDCAANLSDLLHIPGPAYTYSVLSLGSGVTGLIKMWTNAAKTLSGQQN"
     gene            <869295..>870491
                     /locus_tag="ZYRO0F10670g"
                     /db_xref="GeneID:8205427"
     mRNA            <869295..>870491
                     /locus_tag="ZYRO0F10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497616.1"
                     /db_xref="GeneID:8205427"
     CDS             869295..870491
                     /locus_tag="ZYRO0F10670g"
                     /note="similar to uniprot|Q02961 Saccharomyces cerevisiae
                     YPL113C Putative dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497661.1"
                     /db_xref="GeneID:8205427"
                     /db_xref="GOA:C5DY67"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DY67"
                     /translation="MEGSSKILEVMPKPKVLIPYQHALDVADHIPEWDQLSQVVEFVK
                     YKITDVDEFKRYLAESSIQGFWITDELFSAVGSPSELWDYYPETLKVMVIPWVGHDFI
                     DGRRLRDEKGVVLCNIGPNAGSSVADLAVHLTLSCFRLTSFWEHCLKFAVNGRVLESR
                     KYLGSDSTELWQSEQGPTNDGGTRGVTEFQYPKVAEISDDKNLSRQFTVGNKIVDTPS
                     GKTALILGFGNIGQSIGKRLVCGFDMKVKYTKRSGPLPRELLGYDAEFCSDLKDAKVW
                     SDVDLIVLSLPGNPHTDNLINSEVLEKCKDGVRIVNVGRGSCIDEDALVEALNSGKVN
                     SCGLDVFKDEMTQVRPDLLMRFDVTALPHIGSTVETLMIRQTAVTLQNVESVLVKGEG
                     GIFPVN"
     gene            complement(<870661..>871392)
                     /locus_tag="ZYRO0F10692g"
                     /db_xref="GeneID:8205428"
     mRNA            complement(<870661..>871392)
                     /locus_tag="ZYRO0F10692g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497617.1"
                     /db_xref="GeneID:8205428"
     CDS             complement(870661..871392)
                     /locus_tag="ZYRO0F10692g"
                     /note="similar to uniprot|P32773 Saccharomyces cerevisiae
                     YOR194C TOA1 Transcription factor IIA large chain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497662.1"
                     /db_xref="GeneID:8205428"
                     /db_xref="GOA:C5DY68"
                     /db_xref="InterPro:IPR004855"
                     /db_xref="InterPro:IPR009083"
                     /db_xref="InterPro:IPR009088"
                     /db_xref="InterPro:IPR013028"
                     /db_xref="UniProtKB/TrEMBL:C5DY68"
                     /translation="MSNPEASRVYELIVDSVVNEVREDFENAGIDEQTLQDLKRVWQI
                     KLSETQVTKFSWDPQEAEYPGQQLGSQVEQDDNSLRNGIPSEYTLNSDSQGLVLPGFP
                     NEGGSKVDQLNAAPESELQEQQDDDKPADDDNDDPKGKEIELSLSYPDGNAPDMTKMQ
                     EKKAKRSALLDTDEVGSELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRTKARWKCS
                     LKDGIVTVNRKDYTFQKSQVEAEWV"
     gene            <871970..>874096
                     /locus_tag="ZYRO0F10714g"
                     /db_xref="GeneID:8205429"
     mRNA            <871970..>874096
                     /locus_tag="ZYRO0F10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497618.1"
                     /db_xref="GeneID:8205429"
     CDS             871970..874096
                     /locus_tag="ZYRO0F10714g"
                     /note="weakly similar to uniprot|Q08581 Saccharomyces
                     cerevisiae YOR195W SLK19 Kinetochore-associated protein
                     required for normal segregation of chromosomes in meiosis
                     and mitosis component of the FEAR regulatory network which
                     promotes Cdc14p release from the nucleolus during anaphase
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497663.1"
                     /db_xref="GeneID:8205429"
                     /db_xref="InterPro:IPR024312"
                     /db_xref="UniProtKB/TrEMBL:C5DY69"
                     /translation="MNSAPTTPGRSIENQNGSKSAETVGTHLRRHAHGLSSKRRLAPR
                     VSSPLPKDNDTTTIDKMDVNTMFDTDKSLVKMNHSPIRIDLSSPTRPEESVDRPIPEP
                     KRLKLELASAPNLSQPDTGIEMIEMLDPKNSPQKEHDEDPFELEEAIRESKENQDSVA
                     NTPNSNEKMNSILDLHKLTPVYNDGEMEDQNDTPGEDLFRIVSKRNEDLVTQLHHLNR
                     SINEVISSCDSTVGKYRRQIDSLRQDYESKLEDRMSEMASVIQESNTYKERFNIARRR
                     VSETRDEIKMINQNQSILRNKYEGATAELEECRRKLNELEEENSKLKSESSENGIKFS
                     RLENMYQEALRRTQNLETANQNVLDAQAESDRKLDALSHELDDRSEECQKLKAQLEET
                     LAAQEGGRDEKTRQLEELLRHREELESRISTLQKEYTHREENLQSKVQNLETELKSIN
                     QNTHTHESNEAQLRQELESKVQECQHWQKNYETVNDDVEILRAEVKELYSDIDEHKEL
                     KHYLETSIAQLEEQVNGWRHKYEEHRKDYDKVLLELDSIHLKYNNTEGEHLTELEQLH
                     DNLSSLQITLKKDSELISQLTRKNETLEFQLKDLQTPSDVPQLHKEIESWKEKFYNKE
                     AESNRSLKLLAEDLYIQYSSKHEQKVKLLKKGYETRYQGKLDKLSLQNEGLEQEVDQL
                     KSQLATERKEKQKLIGLLENQTNEAT"
     gene            <874574..>877732
                     /locus_tag="ZYRO0F10736g"
                     /db_xref="GeneID:8205430"
     mRNA            <874574..>877732
                     /locus_tag="ZYRO0F10736g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497619.1"
                     /db_xref="GeneID:8205430"
     CDS             874574..877732
                     /locus_tag="ZYRO0F10736g"
                     /note="similar to uniprot|P32873 Saccharomyces cerevisiae
                     YPL115C BEM3 Rho GTPase activating protein (RhoGAP)
                     involved in control of the cytoskeleton organization
                     targets the essential Rho-GTPase Cdc42p which controls
                     establishment and maintenance of cell polarity including
                     bud-site assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497664.1"
                     /db_xref="GeneID:8205430"
                     /db_xref="GOA:C5DY70"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001683"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DY70"
                     /translation="MERKQSNGSSNSTLELLAKYNDHRSQKEKAFEHIERRTVSEDNS
                     LTYDELLKENVRLKLQNKELQDEVEALYKIVDSLKSGKSTPHQNTTLSQIIEKHDEDE
                     RPEQELVLPPRSADRNKHGKNLHLPANLPPSTTEAPAIDVTGESSSNKSGNSSEIHQP
                     NEDAEKDTTRPPPVSQGNTDGSGSPAASTTYTSSRITVSHPSSPRRPLTENKLRSPQS
                     ANRSATVINNQLHSPMASAFGGETSINLKVGTEPLPSPPTEMEKKFGLDEKSTPLLHN
                     IKLQSPDEFSPASKQNLNNFADYLDDTFKDDAGSIDTITEKTVPDNRSPAGDNMPSHA
                     PPPVPSPQHIEAPNQSLSAAQLGSPVLLNRKDHSKQSRDIKSPLTSTFANSRSRDNLN
                     DNSILGTTSTESLSTKSVSTAASNAGSHADAASRIRRPHAESVSTVESAAPSATSDIP
                     LFVQPEEFDTIRMEVISSLFFETENFDHPQILFSVIDRKSNKEIFKFAKTFRKIYDLD
                     SYLRQRLPSSTLTPLPDRQIFDTLVPSKVDVRREKLNQYFTTLFRVLELAPALNLKLA
                     QFMSTDTVMNPIMVGDTTKEGSLLMRKAKALGNASNWRIRYGILRGEIVQLFDKGQLA
                     ETINLKQSSIELLPNLPEDRHGTKNGFLLTEHKKSGLSSTAKYYLCSETSKERESWVA
                     AVSEFVLSPAPAPAPTSLSAPSAPSLNTFGDDAASSTYKSDTSVDQIYVTDLTEPPSI
                     SQNNDSSSASSPRIATEASEDDKDNRRLKMRSFFPFKKLTSGAFSLGSDATEAETVNS
                     QESEPKYSDNSIAKSLESMNLTEPTMTAVFGSPVDKCLQLSSHCYQGKHDIPSVVYRC
                     LEFLYRNRGIQEEGIFRLSGSSALIKSLQEQFDREYDIDLCNYNQNVANSSTGTNLLG
                     LYVDVNTVSGLLKLYLRKLPHVIFGEEQYPMFKKAADNNHDNPAQIALEFKNIIQSNV
                     VPQPNFSLMYALFELLLRINENSRANKMNLRNLCIVFSPTLNIPVTVLQPFITDFSCI
                     FQDGQPVDQQLREKIDLHIPGM"
     gene            complement(<877995..>879155)
                     /locus_tag="ZYRO0F10758g"
                     /db_xref="GeneID:8205431"
     mRNA            complement(<877995..>879155)
                     /locus_tag="ZYRO0F10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497620.1"
                     /db_xref="GeneID:8205431"
     CDS             complement(877995..879155)
                     /locus_tag="ZYRO0F10758g"
                     /note="highly similar to uniprot|Q74ZH6 Ashbya gossypii
                     AGR231C AGR231Cp and similar to YOR196C uniprot|P32875
                     Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497665.1"
                     /db_xref="GeneID:8205431"
                     /db_xref="GOA:C5DY71"
                     /db_xref="InterPro:IPR003698"
                     /db_xref="InterPro:IPR006638"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /translation="MIRVRTSLKKCDVSLGLRLISTTRTNPTTPTTPRKRRATVFKDT
                     LNKGPSFEDFVSGRAAEVSLDPLERARSTVEENQRLPKWLKTPIPKGSNFHKLKEDVR
                     DLKLSTVCEEARCPNIGDCWGGNDKSKATATIMLLGDTCTRGCRFCSVKTNRKPGAPD
                     PMEPENTAEAISRWGLGYVVLTTVDRDDLIDGGSHHLAETVRKIKQKAPNTLVETLAG
                     DFRGDFQAVDVMAQSGLDVYAHNLETVESLTPHVRDRRATYRQSLNVLKRAKQTVPTL
                     VTKTSLMLGLGETHEEVIQTLRDLREIKCDVVTFGQYMRPTKRHMKVVEYVTPEKFEF
                     WKEQALEMGFLYCASGPLVRSSYKAGEAFIENVLRKRKPLEQQQESLSAFRI"
     gene            complement(<879680..>881686)
                     /locus_tag="ZYRO0F10780g"
                     /db_xref="GeneID:8205432"
     mRNA            complement(<879680..>881686)
                     /locus_tag="ZYRO0F10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497621.1"
                     /db_xref="GeneID:8205432"
     CDS             complement(879680..881686)
                     /locus_tag="ZYRO0F10780g"
                     /note="similar to uniprot|Q02959 Saccharomyces cerevisiae
                     YPL116W HOS3 Trichostatin A-insensitive homodimeric
                     histone deacetylase (HDAC)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497666.1"
                     /db_xref="GeneID:8205432"
                     /db_xref="GOA:C5DY72"
                     /db_xref="InterPro:IPR000286"
                     /db_xref="InterPro:IPR023801"
                     /db_xref="UniProtKB/TrEMBL:C5DY72"
                     /translation="MPDPLDNFYRQFQLFVQNNPNVISAARAASQIPESAKAVVVLSP
                     YSLEHSFGRNWVSKSYLKSIVERPERLLASSLGIAAAITMYPALYTLKSSDRKKSSIL
                     SPHVLKVHGKDWPPQLLRLCKEADAKLAAKEVEVPASWNAGDIYLSSKTVEALQGSIG
                     ALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSGFCLLNNAHVAIEYAKDRF
                     GVTHAAILDFDLHHGDGTQDICWKRAGFRPDEEDEDSPGYDSFGKKFAEYPRVGYFSM
                     HDINSFPTESGYATKENVKNASTCIMNAHDVNIWNIHLSPWETEEDFAKLYHTKYRSL
                     FVKADEFFKQGKIEMAAQNKPFKGLVVISSGFDASEFEQTSMQRHGTNVPTYFYTAFT
                     KDALKLSQMHCHGKVLSIMEGGYSDKAIVSGVFAHLIGLQNQNWIKEWGSEHVVKEIV
                     RGCKSNWKPYKTKKARDVIRIWAEEVIKLGRAMIPGFETLFQDIPSNNKVAAANVAPR
                     VTRSKAQTTKSTHREPTGTTLDPSKETPAAPRHRRIEGTGVTQEPVPFTQEELHSEDD
                     NDDEDYVYDEELNKTFNRTVEDITIDDISRHLETLEIIEQPPPAPTAQSKYKVPSKTT
                     TQHLRSSTRPQQLANSNASADDSDISMVSHVSTRKHTTRSGARW"
     gene            <882144..>883394
                     /locus_tag="ZYRO0F10802g"
                     /db_xref="GeneID:8205433"
     mRNA            <882144..>883394
                     /locus_tag="ZYRO0F10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497622.1"
                     /db_xref="GeneID:8205433"
     CDS             882144..883394
                     /locus_tag="ZYRO0F10802g"
                     /note="similar to uniprot|Q08601 Saccharomyces cerevisiae
                     YOR197W MCA1 Putative cysteine protease similar to
                     mammalian caspases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497667.1"
                     /db_xref="GeneID:8205433"
                     /db_xref="GOA:C5DY73"
                     /db_xref="InterPro:IPR011600"
                     /db_xref="InterPro:IPR029030"
                     /db_xref="UniProtKB/TrEMBL:C5DY73"
                     /translation="MYPGHQGNGYHRPAAPPPGYGGGYSRPPVPPPQETNHYSRPAVP
                     PPGRTAGNRDGGYNRPPAPPPGAGGASYSRPPAPTPVDGPQGYDRPQANLPPPPSQMQ
                     SIPGTQSSYQYSMCNGRRKALIVGINYIGSKNELRGCINDAHNMWNFLTSRYGYRPED
                     IVMLTDDQRDMVRIPTKANMLRAMHWLVNGAMPNDSLFFHYSGHGGQTKDLDGDEVDG
                     MDDVIYPVDFEMAGDIVDDIMHDIMVKPLQPGVRLTALFDSCHSGTVLDLPYTYSTKG
                     VVKEPNIWKDVGQDGFQAVMGYATGNTSAITGALGSLARSVKNNLGGHSSRDQVIQMK
                     FSPADIVMLSGSKDNQTSADAVEAGRATGAMSYSFVKVLSMQPQQSYLSLLNNMRAEL
                     SSKYSQKPQLSSSHPLDVNLQFIM"
     gene            complement(<883483..>884865)
                     /locus_tag="ZYRO0F10824g"
                     /db_xref="GeneID:8205434"
     mRNA            complement(<883483..>884865)
                     /locus_tag="ZYRO0F10824g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497623.1"
                     /db_xref="GeneID:8205434"
     CDS             complement(883483..884865)
                     /locus_tag="ZYRO0F10824g"
                     /note="similar to uniprot|P38934 Saccharomyces cerevisiae
                     YOR198C BFR1 Component of mRNP complexes associated with
                     polyribosomes implicated in secretion and nuclear
                     segregation multicopy suppressor of BFA (Brefeldin A)
                     sensitivity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497668.1"
                     /db_xref="GeneID:8205434"
                     /db_xref="UniProtKB/TrEMBL:C5DY74"
                     /translation="MSQARIKRPDVSVRDKKLDVYNTQLKKIDGEIAVLRKQIDQNQI
                     SDVTQNERKKLQEQTREIIKTQADLKSRRNAIHERVKQLDANIKRKTGEINEKLGRKA
                     KYSTTAEVKQRINEIEEAISSGDLTLVDEKRLVKEMQALNKLNKDLVAVEPVKKSIEN
                     DKQQIASLKEELSQLNPREVSDKFEQTQEKLNSLQSKTQGVYDKRQTLFNKRTALYKK
                     RDEIYAQIKKIRADFDGEFKAYKQKLEKDRLKREEDQKLSKLLEEKDAKLGKLQEKLA
                     HAKLPAFSSEIGTIENALFVLDPTYEKPQRKLFDDDKDSKPAQPVKKVDDADLVPINK
                     KDDISNTEPSKSKKLKKKQQGQQANGGSVNTNHDFTLEPTLIAALAELEVTVPISQDQ
                     VSTTVDQLKEKLESYTSKQDEQTEKNIEQVEKQISQLETDYSEKEKQVKEALEAKRAK
                     EQEEQKENAQ"
     gene            <885653..>886486
                     /locus_tag="ZYRO0F10846g"
                     /db_xref="GeneID:8205435"
     mRNA            <885653..>886486
                     /locus_tag="ZYRO0F10846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497624.1"
                     /db_xref="GeneID:8205435"
     CDS             885653..886486
                     /locus_tag="ZYRO0F10846g"
                     /note="highly similar to uniprot|P15496 Saccharomyces
                     cerevisiae YPL117C IDI1 Isopentenyl
                     diphosphate:dimethylallyl diphosphate isomerase (IPP
                     isomerase) catalyzes an essential activation step in the
                     isoprenoid biosynthetic pathway required for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497669.1"
                     /db_xref="GeneID:8205435"
                     /db_xref="GOA:C5DY75"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR011876"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="UniProtKB/TrEMBL:C5DY75"
                     /translation="MTQQFSKLVESLGAQEILDEFPEIIPVQKRPNTHSSSSSSEESS
                     DNVFSGHDEEQIKLMNENCIVLDWNDEAVGAGTKKLCHLMKNIEKGLLHRAFSIFIFN
                     EQGELLLQQRASEKITFPDLWTNTCCSHPLCVDDEIGLKGTLESKVDGARTAAIRKLD
                     QELGIPQQQTKEHGQFHFLNRIHYMAPSNEPWGEHEIDYIFFYKLNKGQDLTVQPNLN
                     EVQDYKWVNKNTLQEMFKDSNLKFTPWFKLICESYLFEWWGKLDDLSGVENDRRIHRL
                     L"
     gene            complement(<886608..>887855)
                     /locus_tag="ZYRO0F10868g"
                     /db_xref="GeneID:8205436"
     mRNA            complement(<886608..>887855)
                     /locus_tag="ZYRO0F10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497625.1"
                     /db_xref="GeneID:8205436"
     CDS             complement(886608..887855)
                     /locus_tag="ZYRO0F10868g"
                     /note="uniprot|Q9UVE2 Zygosaccharomyces rouxii
                     Hypothetical protein similar to YOR201C uniprot|P25270
                     Saccharomyces cerevisiae YOR201C MRM1 Ribose
                     methyltransferase that modifies a functionally critical
                     conserved nucleotide in mitochondrial 21S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497670.1"
                     /db_xref="GeneID:8205436"
                     /db_xref="GOA:C5DY76"
                     /db_xref="InterPro:IPR001537"
                     /db_xref="InterPro:IPR004441"
                     /db_xref="InterPro:IPR013123"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5DY76"
                     /translation="MRRATMLSYSSFERKFVKMSLIYGAIRGFTSCARRSGVKVDRNI
                     PQLTRKKAWERAGEDKEAWFKRKYAHVHAKQKQQQEPRDPFGKRKAHELRLKENQRRM
                     EQERTTHVHKFEKKNATQGLRPNPLMEYVYGTNSVLAALQGNKREYYSRLLHYGQLDP
                     RLQKLAKSRNVELVETDKHRLNLMTNYAVHNNIILETKPLQPPEISHLQMVNPESGTI
                     QYSELAFEDEKITQEMPYGVKNGKNFPLGIYLDEVVDPHNIGAIMRSAYFLGADFIVM
                     SRKNCAPLSAAVSKTSSGAIELLPIFYVDKPLSFFSESQQGGGWTFVTAGLTDFTQKD
                     KKFNSGKILELNDLEGLCEQVPVVLVVGNEGSGVRTNLKMRSDFFVEIPFGRDDEKGP
                     VDSLNVSVATALLINYLLKGSNM"
     gene            <887958..>888638
                     /locus_tag="ZYRO0F10890g"
                     /db_xref="GeneID:8205437"
     mRNA            <887958..>888638
                     /locus_tag="ZYRO0F10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497626.1"
                     /db_xref="GeneID:8205437"
     CDS             887958..888638
                     /locus_tag="ZYRO0F10890g"
                     /note="uniprot|Q9UVE1 Zygosaccharomyces rouxii HIS3
                     Imidazoleglycerol-phosphate dehydratase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497671.1"
                     /db_xref="GeneID:8205437"
                     /db_xref="GOA:Q9UVE1"
                     /db_xref="InterPro:IPR000807"
                     /db_xref="InterPro:IPR020565"
                     /db_xref="InterPro:IPR020568"
                     /translation="MIPEQGEHKAFVQRNTNETKIQIAISLNGGHIEIPESIIGKKRV
                     ESDGVATQATSSQTIDIHTGVGFLDHMIHALAKHSGWSLIVECIGDLHIDDHHTTEDC
                     GIALGDAFKQALGQVRGVKRFGFGFAPLDEALSRAVVDLSNRPYSVIELGLKREKIGD
                     LSCEMIPHFLESFTEAARLTVHVDCLRGFNDHHRSESAFKALAVALREATSPNGTNDV
                     PSTKGVLM"
     gene            complement(<888696..>889760)
                     /locus_tag="ZYRO0F10912g"
                     /db_xref="GeneID:8205438"
     mRNA            complement(<888696..>889760)
                     /locus_tag="ZYRO0F10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497627.1"
                     /db_xref="GeneID:8205438"
     CDS             complement(888696..889760)
                     /locus_tag="ZYRO0F10912g"
                     /note="similar to uniprot|Q02950 Saccharomyces cerevisiae
                     YPL118W MRP51; homolog group vGLR.3476 derived from GLR.
                     3476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497672.1"
                     /db_xref="GeneID:8205438"
                     /db_xref="InterPro:IPR016712"
                     /db_xref="UniProtKB/TrEMBL:C5DY78"
                     /translation="MSLSSARLAQLIKNSRVAQVPRNGKPLVQTGPRYHPTHQIIETK
                     PSTLDRQEWGLKSSIPSKVKSRYLIFNDLDTLERITTFEPNGGAQWNRLRFQELGIAP
                     KYNPGKANPLFQGSSSHADQLAPFSSILNVNSGNATTQKVVNSRLPSVKAMRNEFKQW
                     LLSKDPEALKNKSFTPRDLHSFAVQFLSERGFGNGDSKRLNKATMKNVVGTGGLTYSL
                     PGKLKNSPNGVVAKNIVPGRFLNIDGNDRLAAIGGFVANASSSSPMTSQVDYNMGDFV
                     RELTFPFEVQQASVEDNGRVMLRAKVVSGISPRARLQMSGRNYQQRPLRTGGRHPAVR
                     AEDSTKHAEELLSILTNFDK"
     gene            <890412..>892223
                     /locus_tag="ZYRO0F10934g"
                     /db_xref="GeneID:8205439"
     mRNA            <890412..>892223
                     /locus_tag="ZYRO0F10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497628.1"
                     /db_xref="GeneID:8205439"
     CDS             890412..892223
                     /locus_tag="ZYRO0F10934g"
                     /note="similar to uniprot|P06634 Saccharomyces cerevisiae
                     YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
                     helicase required for translation initiation of all yeast
                     mRNAs mutations in human DEAD-box DBY are a frequent cause
                     of male infertility"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497673.1"
                     /db_xref="GeneID:8205439"
                     /db_xref="GOA:C5DY79"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DY79"
                     /translation="MADLSNQVENLNIDGNASSYVPPHLRNSSRRPRNDGEGSSFNNK
                     GSFFGRGRGGGFSSNRGGRGGGSGGGFRPAGTGRWINGKHVPTERNEKLELQLFGATG
                     DPNFQSSGINFDNYDDIPVEASGENVPEPVTEFTSPPLDELLLENIKFAHFVKPTPVQ
                     KYSIPIVANKRDLMACAQTGSGKTGGFLFPVLSESFFTGPSEIPEAARSSYMRKAFPT
                     AVVLAPTRELATQIFDEAKKFTYRSWVRPTVVYGGSDVGSQMRDLDRGCDLLVATPGR
                     LNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRNIVEGCDMPGVDQRQTLMFSAT
                     FPVDIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKSALLDLLSASSGGL
                     TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALGSFKTGKADLLVATAVA
                     ARGLDIPNVTHVINYDLPGDVDDYVHRIGRTGRAGNTGLATAFLNRGNKNVVKGLIEI
                     LSEANQEVPSFLNDLSRESAFGSRGGRGGGGFSNNRSFGTRDYRKQGTGSFGASRGGG
                     GSLGGSFRGGGNSGSSWGGGRSSNWDSFGSAGGNSWW"
     gene            complement(<892914..>895541)
                     /locus_tag="ZYRO0F10956g"
                     /db_xref="GeneID:8205440"
     mRNA            complement(<892914..>895541)
                     /locus_tag="ZYRO0F10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497629.1"
                     /db_xref="GeneID:8205440"
     CDS             complement(892914..895541)
                     /locus_tag="ZYRO0F10956g"
                     /note="highly similar to uniprot|P21524 Saccharomyces
                     cerevisiae YER070W RNR1 Ribonucleotide-diphosphate
                     reductase (RNR) and to YIL066C uniprot|P21672
                     Saccharomyces cerevisiae YIL066C RNR3 Ribonucleotide-
                     diphosphate reductase (RNR), large subunit; the RNR
                     complex catalyzes the rate-limiting step in dNTP synthesis
                     and is regulated by DNA replication and DNA damage
                     checkpoint pathways via localization of the small
                     subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497674.1"
                     /db_xref="GeneID:8205440"
                     /db_xref="GOA:C5DY80"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:C5DY80"
                     /translation="MTNIADIGSNANPGYEYNPPLMRQKLRELSFGLNLDYLDFDKIV
                     QKISSGVPDDVEGWQVIRHAAETVASLTSIHPDHSILAARLEIDELHKSLRGITFTEN
                     LKQLRSSTRVTSEGDNRVPSKRQKVMRAPKKGVISEEFLQMALKYEKKLNDAIVHERD
                     FNFTYFGWKTLCQSYLIKKNADQIHETPQFLFMRVALAIHGPFEDIDSVIETYELMSR
                     KYFIHASPTLFNAGTVNQYLSSCFLVGMKEDSIEGIFKTLEDTALISKASGGIGIHVS
                     NIRASGAHVSGSNGTSNGIVPMLRVFNNTARYVDQGGNKRPGAYCIYLEPWHSDVFDF
                     LQLRKNHGKDELRARDLFFALWIPDLFMKRVQCNGEWSLFSPDEAPGLSDVYGKEFEE
                     LYEQYEATALPMKRVKAQKLWSEILQAQVETGGPFMLYKDSCNLKSNQKNLGTIKSSN
                     LCCEIVEYSSKDETAVCNLASVALPTFVVQVTNKGSIFDFVKLHAVVKTITRNLDRVI
                     DVCKYPIPQAQYSNLRNRPEAIGVQGLADVFLMLRIPYESQEARILNTQIFETIYHAA
                     VETSIELAEEYGAYETFQGSPASQGLLQFDLWGLNEDNYDFLYRDWGELKHRIQNGRG
                     LRNSLLLGPMPTASTSQILGYTESFEPMTSNVYARRVLSGEFINVNQYMVDHFCQLGI
                     WNEKLKNRIIADNGSVQNIQGLPDWIKKIYRTVWEIPQRPLIDMARDRSPFIDQSQSL
                     NLFMKTPTMGKLTSMHFHAWRHGLKTGMYYLRTQAASAAIQFTVNDENTLTGSVELNG
                     SDEEESKTPILGKYPGTTFPKRHIDFFDPKKISIENIVSQKSDSTVGWGEDAYGIHDK
                     TPLSCSGGKENEYCESCSG"
     gene            complement(<895804..>897255)
                     /locus_tag="ZYRO0F10978g"
                     /db_xref="GeneID:8205441"
     mRNA            complement(<895804..>897255)
                     /locus_tag="ZYRO0F10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497630.1"
                     /db_xref="GeneID:8205441"
     CDS             complement(895804..897255)
                     /locus_tag="ZYRO0F10978g"
                     /note="similar to uniprot|Q02948 Saccharomyces cerevisiae
                     YPL120W VPS30 Protein required for sorting and delivery of
                     soluble hydrolases to the vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497675.1"
                     /db_xref="GeneID:8205441"
                     /db_xref="GOA:C5DY81"
                     /db_xref="InterPro:IPR007243"
                     /db_xref="UniProtKB/TrEMBL:C5DY81"
                     /translation="MRNSDETGLKCQNCQLPLEIDSSLLDLSLAQRDMLVNFSNDYNP
                     NNYNIPTDRLHRLNKVVSPTELNIQNSILDSYVFLQDGSHDEHPSSQRSLDASSQTTF
                     REEDSGDEPDDNQPSSPTARTLSTQVTALANVFNVLSSKTNIDYPVCQDCCNILIQRL
                     QSEYDDATKERDTYTQFLSRIEKQKQLSSSDSPDITSEEINQLKLEREKLFKELLQLE
                     HQDEELDQEIISLQSNLKDKIQHENEDLRKKNIEDLEQLEFSKEVRSLKNQHELTLNN
                     LDKLRKVNIYNETFKISHEGPFGVINGLRIGGFDNTTVPWHEINAGLGQVVLLLATIC
                     ARLKIKLDDYKLQPMGSFSTISKFIQETQEWENYEVYSNENFRLGKIFRKETTFDKAM
                     VSILAIIQQMAIWLSRSNATSATDDQSPNKSVDDGIDLPYLMHKDKINGNSVKLFGAK
                     PGIEWTIAMKFLLTNAKWLLAFSSSRLVQSSPA"
     gene            complement(<897427..>899124)
                     /locus_tag="ZYRO0F11000g"
                     /db_xref="GeneID:8205442"
     mRNA            complement(<897427..>899124)
                     /locus_tag="ZYRO0F11000g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497631.1"
                     /db_xref="GeneID:8205442"
     CDS             complement(897427..899124)
                     /locus_tag="ZYRO0F11000g"
                     /note="similar to uniprot|Q08622 Saccharomyces cerevisiae
                     YOR205C FMP38 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497676.1"
                     /db_xref="GeneID:8205442"
                     /db_xref="GOA:C5DY82"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /translation="MLKEQFLNAFDHPSRCLFMTLRFRRWFSTTLARLINCNSCGIKL
                     QNENPKTIGYYIKPKKPTVNKLQSLEDVKYLLFSQDLQHVKEQQDVGSLEELNETMES
                     PLICKRCNDALHRNQYDLKEFGRYTITDVLEKIPRGSNILHVVPLPEFPFHFEKSLLE
                     VPHFNTSLLLTKGDQLANDKNTLQRRSLVFFKDFLKYQLGIISNKTVAVSGLKNWNIQ
                     SAYAAMNANSYLVGDANVGKSTLINSVMQRYLGYKIHTDRKGQIVTNEPSVKDLKNIK
                     HFFKNQFAGVSHIPNMTRNLQGYRVGDKFIYDLPGFTTNINGAYYEDIIQKDWLERTR
                     KTEKFNTKKLKKQRYISVKGNEKGNCYTVGGIFFWQPPAGTVNQVVSYIPGEGREFAD
                     INRGLEVFRACQDDAHPLAKFCGVHPQICQRENYVRHVIPPFQGSIEVVLKDIGYFTI
                     KTTGRYQFKGLHEFWVPRGIDVLVREPLESLISEGSWRHTESKGRVPACPKDRPIVSS
                     TYIVDPEESDLLGKMKEMYLERTSNDISSRRFLYDDPLEVVSKLHEERPNLYWYYRW"
     gene            <899338..>901482
                     /locus_tag="ZYRO0F11022g"
                     /db_xref="GeneID:8205443"
     mRNA            <899338..>901482
                     /locus_tag="ZYRO0F11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497632.1"
                     /db_xref="GeneID:8205443"
     CDS             899338..901482
                     /locus_tag="ZYRO0F11022g"
                     /note="similar to uniprot|P39744 Saccharomyces cerevisiae
                     YOR206W NOC2 Protein that forms a nucleolar complex with
                     Mak21p that binds to 90S and 66S pre-ribosomes as well as
                     a nuclear complex with Noc3p that binds to 66S pre-
                     ribosomes both complexes mediate intranuclear transport of
                     ribosomal precursors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497677.1"
                     /db_xref="GeneID:8205443"
                     /db_xref="InterPro:IPR005343"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DY83"
                     /translation="MGKVSKATKKFQSKHLKHTLDQRKKEKEHKKKIQSRRGNKSEKE
                     KRDAALTKDEQKARKGAKEEVFKDMPIDEFFEDGIDIPKQSKKNKNKNKEKNESEHDE
                     SSSSEDENDVAAGMAQLSEKDPEFYKYLQENDKNLLDFGGSNPLDGIDDEEEEEVPEK
                     DEAPAEEGESDEEEVKSIAKIELTLKLVKKWRDQLHNSPNFKTIRNVVSAFKMAINMN
                     NDESKEDYKYSMSDERAFKELLFVALRDLPRAIQAMIPYHNKHGARTLPSGTNVSKMS
                     SIVKSHSASLIICLNDIFNTETAALVLQSVNQLLPYLISYRRIVKEVIKAVVETWSTT
                     REVETQIATFAFLISASKEYKKALLEIVLKTTYSTFIKSCRRTDMRTMPLINFQKNSA
                     SELFGIDENLGYQVGFEYIRQLAIHLRNTITATTKKTNKHNPAEAYKIVYNWQFCHSL
                     DLWSRVLSFACNFNREKAHESQMRDLIYPLVQVTLGVIRLIPTPQFFPLRFYLIRSLI
                     RLSQNTGVYIPIFPLLLEILNSNAFTKMSKKKESLEAFDFEHNIKCNKQYLGTRTYQE
                     GLAEQFVDILGEYFVLYCKSVSFPELATPAIIALRRYIKTSKNPKYSKQLSNVVEKLN
                     QNSSYIEQKRSKVEFSPSNKVEVARFLSDVPWEKTPLGAYIVIQREVKEERARILRES
                     LEEEQEEEKNKDEDEDKELELDGDGDSEMSDA"
     gene            <901768..>902463
                     /locus_tag="ZYRO0F11044g"
                     /db_xref="GeneID:8205444"
     mRNA            <901768..>902463
                     /locus_tag="ZYRO0F11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497633.1"
                     /db_xref="GeneID:8205444"
     CDS             901768..902463
                     /locus_tag="ZYRO0F11044g"
                     /note="similar to uniprot|P32489 Saccharomyces cerevisiae
                     YPL121C MEI5 Meiosis specific protein involved in
                     DMC1-dependent meiotic recombination forms heterodimer
                     with Sae3p proposed to be an assembly factor for Dmc1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497678.1"
                     /db_xref="GeneID:8205444"
                     /db_xref="InterPro:IPR018468"
                     /db_xref="UniProtKB/TrEMBL:C5DY84"
                     /translation="MDSNTPSNSSPNYTPIARKKNVFRPPVRNPQQVLSTPNTLVKTS
                     VDKVDKGSIEDRRLAYELKLLNNEFTRQINSYKIENNQLNQSIKVLKNYEKEEKVMRL
                     IEKWRSISQAGMSYMLNSTMLKITKIGGYEELKRKEMEAEKRKIEYQVDDNLQDEMDN
                     VLESEEFQMLPEEDQEEYKNRMQDKIEEMEIWKEKALTKLEEQVKLSANQEMTMQELA
                     QRLKINYQFVFPE"
     gene            complement(<902529..>905960)
                     /locus_tag="ZYRO0F11066g"
                     /db_xref="GeneID:8205445"
     mRNA            complement(<902529..>905960)
                     /locus_tag="ZYRO0F11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497634.1"
                     /db_xref="GeneID:8205445"
     CDS             complement(902529..905960)
                     /locus_tag="ZYRO0F11066g"
                     /note="highly similar to uniprot|P22276 Saccharomyces
                     cerevisiae YOR207C RET1 Second-largest subunit of RNA
                     polymerase III which is responsible for the transcription
                     of tRNA and 5S RNA genes and other low molecular weight
                     RNAs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497679.1"
                     /db_xref="GeneID:8205445"
                     /db_xref="GOA:C5DY85"
                     /db_xref="InterPro:IPR007120"
                     /db_xref="InterPro:IPR007121"
                     /db_xref="InterPro:IPR007641"
                     /db_xref="InterPro:IPR007642"
                     /db_xref="InterPro:IPR007644"
                     /db_xref="InterPro:IPR007645"
                     /db_xref="InterPro:IPR007646"
                     /db_xref="InterPro:IPR007647"
                     /db_xref="InterPro:IPR014724"
                     /db_xref="InterPro:IPR015712"
                     /db_xref="UniProtKB/TrEMBL:C5DY85"
                     /translation="MVDNKVKKQPHIKKDDTFQDLLQPVYKGKKLTDDVSTAEDKWNL
                     LPAFLKVKGLVKQHLDSFNYFVDVDLKKIIKANQLILSDVDPEFYLKYVDIRVGQRSN
                     ASSKDYLTPPHECRLRDMTYSAPIYVDIEYTRGRNIIMHKDVEIGRMPIMLRSNKCIL
                     HNSDEKTMARLNECPLDPGGYFIVNGTEKVILVQEQLSKNRIIVEADEKKAIVQASVT
                     SSTHERKSKTYVVTKNDKIYLKHNSIAEEVPIVVVLKACGIVSDLEVMQLVCGNDSSY
                     QDIFAVNLEEASKLGLYTQQQALEYIGSKVKTVRRQKLSVLQEGIEAIATTVIAHLTV
                     AALDFREKALYIAMMTRRVVMAMQNYKMVDDRDYVGNKRLELAGQLISLLFEDLFKKF
                     NNDFKASIDKVLKKPNRAMEYDALLSINVHSNNITSGLSRAISTGNWSLKRFKMERAG
                     VTHVLSRLSYISALGMMTRISSQFEKSRKVSGPRALQPSQFGMLCTADTPEGEACGLV
                     KNLALMTHITTDDEEEPIKKLCFILGVEDITLIDSASLHLHYGVYLNGTLIGTTKFPV
                     KFVSQFRNLRRSGKISEFISIYTNSHHKAVHIATDGGRICRPLIIVSNGKSRVTSEHL
                     KELLEGRLVFDDFLKLGLVEYLDVNEENDSFIALYEQDIAPEITHMEIEPFTVLGACA
                     GLIPYPHHNQSPRNTYQCAMGKQAIGAIAYNQFKRIDTLLYLMIYPQQPMVKTKTIEL
                     IDYDKLPAGQNATVAIMSYSGYDIEDALVLNKSSIDRGFGRCETRRKTTAVLKRYPNH
                     TQDIIGGMRVNENGEPIWQHKSLGPDGLGEVGMKLDSGQIYINKSVPTNASEGVLTQT
                     QSQYRETPVIYRAPEPSHIDQVMMSVSDNDQALIKVLLRQNRRPELGDKFSSRHGQKG
                     VCGIIVQQEDMPFSDQGVVPDIIMNPHGFPSRMTVGKMIELISGKAGVMNGSLEYGTC
                     FGGSKLEDMSQILVDNGFNYSGKDMLYSGVTGECLQAYIFFGPIYYQKLKHMVLDKMH
                     ARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCVIAYGASQLLLERLMTSSDAFEVEV
                     CEKCGLMGYSGWCTTCRSAEHINKMSIPYAAKLLFQELLSMNIAPRLRLEDIFQA"
     gene            <906284..>907813
                     /locus_tag="ZYRO0F11088g"
                     /db_xref="GeneID:8205446"
     mRNA            <906284..>907813
                     /locus_tag="ZYRO0F11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497635.1"
                     /db_xref="GeneID:8205446"
     CDS             906284..907813
                     /locus_tag="ZYRO0F11088g"
                     /note="highly similar to uniprot|P87331 Saccharomyces
                     cerevisiae YPL122C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497680.1"
                     /db_xref="GeneID:8205446"
                     /db_xref="GOA:C5DY86"
                     /db_xref="InterPro:IPR004598"
                     /db_xref="UniProtKB/TrEMBL:C5DY86"
                     /translation="MSSQHLLKSSVNQYLEELPQQIQSRLYESPATCLAIYRLLPQLA
                     KFFIMSMVFNESAISLRDLDRWVKSSGKLQFQDAIKSMKSLHLLIPVRSNGPMLIDLN
                     HTFRESFKNALTGGEVSNSFGIVMELDNDTVTTDMLDKYSADKWETILHFMVGTSLAH
                     IPSENVLNLLKHSKLMEESNTTGEFKITNEGFQFLLQEVNSQLWALLLQYLKMTEMLQ
                     MDPVDILNFIFMLGALEFSKPYSTNGLSETQKVMLKDMRDYGLVFQMNSNANVFYPTR
                     LASMLTSDPKSIRGASGAMDSVLKQNKEDVLNKSGGAGANADDDADEIGSEGQNMQDG
                     ALIVETNFKLYSYSNSPLQIAILSLFVHMKSRFSNMVTGQLTRESIRQALLNGITADQ
                     IIAYLETHAHPQMRRMAEEQLEKRLELDPNSKDPLQILPPTVVDQIKLWQLELDRIIS
                     FEGSLYSDFENHQEFTLLSSYAQDIGVLIWKDDRKKKFFVSKEGNSQVLDYAKRKLKK
                     K"
     gene            <908737..>912342
                     /locus_tag="ZYRO0F11110g"
                     /db_xref="GeneID:8205447"
     mRNA            <908737..>912342
                     /locus_tag="ZYRO0F11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497636.1"
                     /db_xref="GeneID:8205447"
     CDS             908737..912342
                     /locus_tag="ZYRO0F11110g"
                     /note="highly similar to uniprot|P53622 Saccharomyces
                     cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
                     coatomer complex which surrounds transport vesicles in the
                     early secretory pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497681.1"
                     /db_xref="GeneID:8205447"
                     /db_xref="GOA:C5DY87"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006692"
                     /db_xref="InterPro:IPR010714"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016391"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DY87"
                     /translation="MKMLTKFESKSTRAKGIAFHSSRPWVLVALFSSTIQLWDYRMGT
                     LLHRYEDHEGPVRAVDFHPTQPLFVSAGDDYNIKVWSLDTNKCLYTLTGHLDYVRTVF
                     FHNELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMSAQFHPTEDLVVSASLDET
                     IRVWDISGLRKKHSAPGATSLEDQMLMQQNLLDGGFGDCVVKFILEGHTRGVNWASFH
                     PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKT
                     LRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSVIHQ
                     NELVYVNKEKQVQTFDYTNNVSSLPYASLKKLGQAWNSFRSISYNPSQHSILVNEGND
                     RFGLVILPKRPTGAVDPSSVLEDAGSFATFVARNRFVVYNRMSESLELRTLENTVTKT
                     LKIEEPVKDIINAGAGSVLLLQPKQVVLYDVQQGKKLAEISLKNVKYVSWSPDGQYAA
                     LMSKHTITITTKRLELINSMHETIRIKSACWDETGVLVYSTLNHIKYILLNGDSGIIK
                     TLENTLYINKVKGKFVYALDREGEMEVLTIDPTEYRFKKGLANKNFPEVLRIIKNSNL
                     VGQNIISYLQKSGYPEVALQFVQDPQTRFDLALECGNLEVGLEEAKKLNSNLVWDRLS
                     KEALVQGNTSLVEMIYQNQMAFDKLSFLYLLVGDTEKLSKMEAISENRGDIFDLISDT
                     FYNNSTSTRARAFAEAGSLPLAYAVAKTSGDESAAASFLEQDEFDENDVVLPDVVNST
                     PAIKAPAISQPIQNWPLKQAELSFFEKAVLNQIDDLSLEEPTEEETLEEQPRAQSAEA
                     VFEEDGVGEEGDAWDLGSEDLDIGEEEQTEEPSKEATVAPEESETATWVKNSKLPAIL
                     IASGAFDAAAQALNKQVGIVNFEPLRSKFLNIYEGCRTYLPSTPGEVPSIVGYIRADA
                     EEEDPTKILPRTPDVSTVAAQMNEGFKFFKANKLEPAIECFRDAIYTITLLAVNNEED
                     ERIARQALQKAREYILGLSIELTRRSLPAEDVKRNLELAAYFTRAKLSPAHRSNALQV
                     AMSQSFKHKNFVLASYFADEFLKIMSSGPRAEQAAKVKDKADTLAHDAVEIDFDPYAE
                     FDICASSYTPIYKGSPSATDPLTGAKYHIAQEGSIDKIALISKIGARSSGLRILL"
     gene            complement(<912922..>913563)
                     /locus_tag="ZYRO0F11132g"
                     /db_xref="GeneID:8205448"
     mRNA            complement(<912922..>913563)
                     /locus_tag="ZYRO0F11132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497637.1"
                     /db_xref="GeneID:8205448"
     CDS             complement(912922..913563)
                     /locus_tag="ZYRO0F11132g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497682.1"
                     /db_xref="GeneID:8205448"
                     /db_xref="UniProtKB/TrEMBL:C5DY88"
                     /translation="MYFTPNLILSVLAITTLDNAVLSAPVNSTAQSSNPVLNSTQASG
                     SLLNSTQAASASVSSSAQSADAWAHPVLNKRSEHTGASISTQAAVSGYNSTESFAPNN
                     STQPFNAHASGNSVQGAGALSQGATQSNGAAPSAPVAASSAAATASQAASLANASGVQ
                     ASDTSVNFTQPTAGGANSTQAGGSTSGTSIGSATVTSDNASPGTQDAGSQGAA"
     gene            <914089..>915501
                     /locus_tag="ZYRO0F11154g"
                     /db_xref="GeneID:8205449"
     mRNA            <914089..>915501
                     /locus_tag="ZYRO0F11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497638.1"
                     /db_xref="GeneID:8205449"
     CDS             914089..915501
                     /locus_tag="ZYRO0F11154g"
                     /note="similar to uniprot|P53378 Saccharomyces cerevisiae
                     YLR212C TUB4 Gamma-tubulin involved in nucleating
                     microtubules from both the cytoplasmic and nuclear faces
                     of the spindle pole body"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497683.1"
                     /db_xref="GeneID:8205449"
                     /db_xref="GOA:C5DY89"
                     /db_xref="InterPro:IPR000217"
                     /db_xref="InterPro:IPR002454"
                     /db_xref="InterPro:IPR003008"
                     /db_xref="InterPro:IPR008280"
                     /db_xref="InterPro:IPR017975"
                     /db_xref="InterPro:IPR018316"
                     /db_xref="InterPro:IPR023123"
                     /db_xref="UniProtKB/TrEMBL:C5DY89"
                     /translation="MAGEIITIQVGQCGNQVGKHFWSQLCREHGIDVDGQNQVPDDPN
                     TPRSDDTNPFFKQNDRNRYTPRAIMIDLEPSAVQDVQNSFPDFFDSRNIWVSPEESGA
                     GNSWSKGYDYGFAQQEEFLNMIDKEIDATENFEGFQLIHSVAGGTGSGLGSNLLEAIS
                     ERYPRKFLASYSVFPSDESEVVIQPYNTILTMRRLAENSDASIVFDNNALLNLTTRVF
                     RDPYTSYIHTNQLISAAMSSITNSIRFPSYMYNSLPSIFSTLVPTPELHFLTAGFTPF
                     TSDYVVGGKDFKSNTAYDVLLDLFDDSNLLVTRQSDGTIYFNTYCTLVGQVEQSDVLK
                     AISKAQQRLNFAPWSTSSLHVNVGRRSPYLPPQTKHTYVSGLMLSNTSAITSLFRGTC
                     KMFDKIFSKGAFLNTFKDGRMFQNGWDEFTESREVVQNVVEEYSAAEQENYLDDVILE
                     DENMVGNQSAQLDAEGDDII"
     gene            complement(<915602..>916996)
                     /locus_tag="ZYRO0F11176g"
                     /db_xref="GeneID:8205450"
     mRNA            complement(<915602..>916996)
                     /locus_tag="ZYRO0F11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497639.1"
                     /db_xref="GeneID:8205450"
     CDS             complement(915602..916996)
                     /locus_tag="ZYRO0F11176g"
                     /note="similar to uniprot|Q12342 Saccharomyces cerevisiae
                     YDL146W Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cell
                     periphery cytoplasm bud and bud neck"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497684.1"
                     /db_xref="GeneID:8205450"
                     /db_xref="InterPro:IPR018556"
                     /db_xref="UniProtKB/TrEMBL:C5DY90"
                     /translation="MILDPSAPHPHVHTDDEVLEFWEMMERMVELTDVSQGEANAALV
                     GYVKRACDNYMVYINSDTDLCRMAAIFIDSKVFKQREEFCLSKLLSLLSIDLLELNMK
                     FLIAYILLWDSKNNLNSLDTMLNYQGFNVFYNTCYTQFAYLIKYGEQQEQRYNLHESE
                     EIELRIIDDMKQISTVLLDLLFQIFKYCKCTMENVQMIDDFFVYYLMATMKSDSVNDN
                     DMFNNVKFRLSLALNEQYMMFSRDYEIENKVYKYLCNDTMHTDFPELFLLKFNRAQDS
                     TLKIMMCKILYLILNSTNDHVSMNFFYTNDLNVFVDVMIRELQNISDNDELLRNYYLR
                     VLTPLLKNTELCNTHYKKDEINNLLHYLTRVDNICGTDVPTQEQQLTLKLANKCLNQV
                     PWLETNGDDWDSDSTSARSSITGITPVTNSTPTDRQPRQLYSNPEMVYSAESLGRRKT
                     RPPPPPPARKVRMP"
     gene            <917238..>917971
                     /locus_tag="ZYRO0F11198g"
                     /db_xref="GeneID:8205451"
     mRNA            join(<917238..917255,917321..>917971)
                     /locus_tag="ZYRO0F11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497640.1"
                     /db_xref="GeneID:8205451"
     CDS             join(917238..917255,917321..917971)
                     /locus_tag="ZYRO0F11198g"
                     /note="similar to uniprot|Q05789 Saccharomyces cerevisiae
                     YLR211C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497685.1"
                     /db_xref="GeneID:8205451"
                     /db_xref="UniProtKB/TrEMBL:C5DY91"
                     /translation="MSQLIEVYNCIDGAENKTRKGDLSESLSSYKHAIELLNGLECQG
                     VSLEIIHAIQLLRQDIDARIKELESLIEGQKPISAAAVAAAVAKNGSLASSTGSTAKT
                     RGWDSPRNLNSSVMGPPGDPLLASIFGKLQANLVNSICEQFKEEDPHIVGEVENRVRQ
                     QLVRFKKELGLYEQKKSKDYSVRFEQAINENKKLSNQILKLRGRWDSLVESAKQRRSR
                     QHED"
     gene            complement(<918059..>919393)
                     /locus_tag="ZYRO0F11220g"
                     /db_xref="GeneID:8205452"
     mRNA            complement(<918059..>919393)
                     /locus_tag="ZYRO0F11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497641.1"
                     /db_xref="GeneID:8205452"
     CDS             complement(918059..919393)
                     /locus_tag="ZYRO0F11220g"
                     /note="highly similar to uniprot|Q12250 Saccharomyces
                     cerevisiae YDL147W RPN5 Essential, non-ATPase regulatory
                     subunit of the 26S proteasome lid"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497686.1"
                     /db_xref="GeneID:8205452"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5DY92"
                     /translation="MSRDAPIKAEKDYTEILKEELPKIDKTAENDYQAALDQLLNLEK
                     KIRQASDLASSKTVLAKIVDLSVAQGKWSELDEQLTLLSKKHGQLKLSIQYMIQQVMK
                     HLDDDKLDLDTKIKAIETIRVVTENKIFVEVERAGVTRQLTHIRRDQGKIEEACDILC
                     ELQVETYGSMEMSEKIGFILEQIELSILKGDFSQATVFSRKILKKTFKNTKYESLKLQ
                     YYQLLIKIGLHKRDYLEIAQYFQEIYLTDSVKADESQWKPALSNLVYFLILSPYGNLQ
                     NDLIHKVKLDNNLKKLEVQESLVKLFTTPELMRWAIVKKTYEPVLNNEKVAFGGKENA
                     HHWQVLHNRVVEHNLRVISRYYSRITLPRLNELLDLNEAETETFISDLVNQGIIYAKV
                     NRPAKVVNFERPKHSSELLNEWSENVDQLLEHIETIGHLITKEEIMHGLKAK"
     gene            <920505..>922964
                     /locus_tag="ZYRO0F11242g"
                     /db_xref="GeneID:8205453"
     mRNA            <920505..>922964
                     /locus_tag="ZYRO0F11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497642.1"
                     /db_xref="GeneID:8205453"
     CDS             920505..922964
                     /locus_tag="ZYRO0F11242g"
                     /note="similar to uniprot|Q99207 Saccharomyces cerevisiae
                     YDL148C NOP14 Nucleolar protein forms a complex with Noc4p
                     that mediates maturation and nuclear export of 40S
                     ribosomal subunits also present in the small subunit
                     processome complex which is required for processing of
                     pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497687.1"
                     /db_xref="GeneID:8205453"
                     /db_xref="GOA:C5DY93"
                     /db_xref="InterPro:IPR007276"
                     /db_xref="UniProtKB/TrEMBL:C5DY93"
                     /translation="MYRNYKPFINTATAKVSTYSNIMGGSQLKNLKATLKANDLTGQT
                     APKKKKGSKRQAKNYDHEERQQVIAKIREQFSPFEIKAAKSKQGKEKMVPVGKPGTSK
                     QIGEEQRQRIFEAKKAQKNKQGGVVDRRFGERSRHMTEEEKMLERFTREKQSQSKSRK
                     NLFDLNDDDGDDMFGAKLTHLGQDLEDDFDEGDLGVDEEDDKGGFSSKRKYEDSLGEP
                     QPESRKKTKAEVMQEVIAKSKFYKQQRQKSQEQRQDQIEELDEGFDDIMSELRSSNVQ
                     RNPEEPNQEEKDKQKEYDMKVRELIMDRRAAPADRTKTEEEIKKEEEEKMKRLEQQRI
                     DRMSGIVMDEDGEEKGVDDLDDDFWGSDEEQEGSGEEAIADSDEDVQLSSEDEGEARR
                     PIRDISCPDNHKEFMDMVKGPVSEHPKIVKKIIKAYQPKLAEGNKEKLGKFTGIILRH
                     MIFLSEQKYSGNVPEFASVQNSLLGILKSMSEKYNHPLSDTCRDIIKEMQIRFKEKHF
                     SGLSVGDLTFFTLVGCLFSTSDQYHLIVTPCSILIAEFLEQIKFNSLERLGFGAVLVR
                     ISLQYQRLAKRYIPEVTYFLEKSLATFLANDNCINFNVDTKDLAISKTQDFSKEIPST
                     LNLHLLFESHELGDDLKASIFLNILDSLRIAVTTIWKNLSAFEEICVNTEFLLNEIIK
                     SFPGLKIAHQLLETIQKLKKFDQHYPLSLQNHRPLAIPSHAPKFEENFNPEKKSYDPS
                     RTRNEINKMKAQLKKERKFTMKEIRKDTRFEARQKVDEDKKNAASYHAKMAQIFNTIS
                     TEEGAEKNKYEKEKKLRTGKH"
     gene            complement(<923118..>926063)
                     /locus_tag="ZYRO0F11264g"
                     /db_xref="GeneID:8205454"
     mRNA            complement(<923118..>926063)
                     /locus_tag="ZYRO0F11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497643.1"
                     /db_xref="GeneID:8205454"
     CDS             complement(923118..926063)
                     /locus_tag="ZYRO0F11264g"
                     /note="similar to uniprot|Q12142 Saccharomyces cerevisiae
                     YDL149W ATG9 Transmembrane protein involved in formation
                     of Cvt and autophagic vesicles cycles between the
                     pre-autophagosomal structure and other cytosolic punctate
                     structures not found in autophagosomes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497688.1"
                     /db_xref="GeneID:8205454"
                     /db_xref="InterPro:IPR007241"
                     /db_xref="UniProtKB/TrEMBL:C5DY94"
                     /translation="MDRSKPSSQSNGRDTFLSRVFGLQSDDVTTSIHTDELSQFREQD
                     VHGDSQLSAVRTGVESASSGEDEEGVRVPESDQGTTSEEDEMVEQGGVIVPEEEPTTE
                     DVDLNDGSVMPSFQRRKTDDSMPKVGQLSSEEEQDGGSDAIDDEDEDEADEDRPLFSK
                     SAFTNPKQNRQPSHQNHSLLFQRILKHNKQKDQQQKLFTSSKDTNNRRIPRDLEAQNG
                     NSRPGRGSNGGDGGVHNSFISRGNQLGKKIFNTGGFNLKRPNILNNISVLNNTPVNRL
                     HSLSPKERALWKWANVENLDIFLQDVYSYYLGSGYFCMVLLKVLNLATLTFVVLISTY
                     MGYCIDYSKVPQSHTFSEITIDRCYKNNITGFTKFLLWIFYIFVVLKVAQLYFDIQNL
                     NEIHNFYTYLLNISDKELQSIPWQNVIQQIMFLKDQNALTANVVEVKAKNRIDAHDVA
                     NRIMRKENYLIALYNNDVLDLSLPIPLYRTSPLTKTLEWNINLCIMGYAFNESGFLKQ
                     SFLKPSQHEYVKEELQKRFMLAGFLNIILSPFLVSYFVLLYFFRYFNEYKTSPGSLGA
                     RQYTPMAEWKFREYNELYHLFQKRIGLSTFLADRYIDQFPKEGVNLMLRFVAFVTGSF
                     VAILGIFTILDPENFLNFEITHDKTALFYITVLGTIWTVCRSSISDEYNVFDPDETIQ
                     DLAAYTHYLPVEWEGRYHTEEVKNEFCKLYNLKIIILLRELASLIMTPFILWFSLPRS
                     ADRIVEFFRDNSVYVDGLGYVCKYAMFEINDSTDTKTRHRKESRRGSRNTRSSTKISD
                     LPGGRRPSYQDDGSGGAFGSDESEVEDEDRELAVNKMMQSYMYFMDDYENSENALGKH
                     QLPHKKYEESTDGVRNLSNSYSWKKQFKPGQRPELFRIGRHALEVNKPLRGNARRRSD
                     TSARRRKKKGNQFNNDLNKDVEESFISSVPLQHYELPDTGRNGDSARSGGGVLGLVKE
                     YYRKSDIGR"
     gene            complement(<926359..>927639)
                     /locus_tag="ZYRO0F11286g"
                     /db_xref="GeneID:8205455"
     mRNA            complement(<926359..>927639)
                     /locus_tag="ZYRO0F11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497644.1"
                     /db_xref="GeneID:8205455"
     CDS             complement(926359..927639)
                     /locus_tag="ZYRO0F11286g"
                     /note="similar to uniprot|P25441 Saccharomyces cerevisiae
                     YDL150W RPC53 RNA polymerase III subunit C53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497689.1"
                     /db_xref="GeneID:8205455"
                     /db_xref="GOA:C5DY95"
                     /db_xref="InterPro:IPR007811"
                     /db_xref="UniProtKB/TrEMBL:C5DY95"
                     /translation="MSSDNGPGRLPSLKNAGAGKPGLKFKPKVAARRSKEEREASAPK
                     LESDEGPKPNDKKKPMNKRMTGPGNQNRRMARYLNNTHVVSTGPLAAGNFVGDKGGGP
                     KRAFTKLEGGGGGASPLVLQGLKKMGGNDDDDDDEEDEEGGEDDEDKKKSSAQNRFNM
                     GKEYSIHDLNGSEDEEGEGTPDMDEETWRALKTEELFPIRPVRYRHQDLEVLQNVDKE
                     ASTSDLTTREPTPAALKQEPVDSANELQDTLKQKDSELHKKLNELSLAQEFQSLDQNE
                     FVAEVKSMTEDHDRIWKKLNKINNKPNRFVLFQLPPKLPEFEHNVIRPEPIATEQPTE
                     VKEDDDGKKTTKKKDAEPAEPLPPLAGRIGSIRVHKSGRLSAKIGNVVMDISRGTETT
                     FLQDAVTINQSSDTPPFAELLGRVDGRVVMTPRF"
     gene            <927860..>929680
                     /locus_tag="ZYRO0F11308g"
                     /db_xref="GeneID:8205456"
     mRNA            <927860..>929680
                     /locus_tag="ZYRO0F11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497645.1"
                     /db_xref="GeneID:8205456"
     CDS             927860..929680
                     /locus_tag="ZYRO0F11308g"
                     /note="similar to uniprot|Q05842 Saccharomyces cerevisiae
                     YDL153C SAS10 Component of the small (ribosomal) subunit
                     (SSU) processosome required for pre-18S rRNa processing
                     essential nucleolar protein that when overproduced
                     disrupts silencing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497690.1"
                     /db_xref="GeneID:8205456"
                     /db_xref="InterPro:IPR007146"
                     /db_xref="InterPro:IPR018972"
                     /db_xref="UniProtKB/TrEMBL:C5DY96"
                     /translation="MARKNSKRVSQKSASKPIANNDDEYGMNEVDDFASKREKVMFDE
                     STLGDRNEEDYDSNDDEEVMAVDDDEDEEDEEDEQQEINGEEAYRKVFGRRLNADTQQ
                     LDEGEGMLDNDAAWGTSKNEYYGADDLDDEETAKEIEEEALRQRKKHLEELNMNDYVD
                     EELDNEWVKSAKEFDTKEFKESTHQKDSAVSIKDILNMDPESQKKHLQTLFPEFLPLC
                     KEFSQLSNILESLKSRKQSEPVYLKIMALSSYLGTLSSYFSILLHELNTNEDFATMKD
                     HPIMESILTSKELWRQASELPDETIQGSQDMDKEDNEIVQVEDINQEERSESESDQTS
                     ENEEEQEQDQEQGEEEEDEEEEEESDVDLDDFEEYVKQSRVSKAKPEKQSNTEEPDDY
                     MEEGIADIDAQEKKARKRTLRFYTSKIDQEENKKVDKFKGDDDVPYKERLYERQQRLL
                     EEARKRGQHGSKETDLDARDYDSGDEAVSKSVNEDGEKDYFNEVLTKKQIKKQSRQQA
                     HKGAVKAAKEGKLAELAEEVGEDGKRAINYQILKNKGLTPHRKKENRNARVKKRKRFD
                     KAQKKLKSVRAVYSGGLSGPYEGEKTGIKKNLTKSVKFSN"
     gene            complement(<929734..>932277)
                     /locus_tag="ZYRO0F11330g"
                     /db_xref="GeneID:8205457"
     mRNA            complement(<929734..>932277)
                     /locus_tag="ZYRO0F11330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497646.1"
                     /db_xref="GeneID:8205457"
     CDS             complement(929734..932277)
                     /locus_tag="ZYRO0F11330g"
                     /note="similar to uniprot|Q12175 Saccharomyces cerevisiae
                     YDL154W MSH5 Protein of the MutS family forms a dimer with
                     Msh4p that facilitates crossovers between homologs during
                     meiosis msh5-Y823H mutation confers tolerance to DNA
                     alkylating agents homologs present in C. elegans and
                     humans"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497691.1"
                     /db_xref="GeneID:8205457"
                     /db_xref="GOA:C5DY97"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DY97"
                     /translation="MDQDISSFIADESFSIGESNILCIEVLRDKLGCCLLEGSTGTLK
                     ILMQDQLLSISKSDETSMIAESLILVNNPQVCLISARLDEISYNYIEKICSNNGCKLE
                     LQASDSFNRSSEVELLSVAGHRGFSLLKHSIVNSNGSTCVTAATINCLLSWLNKNGEN
                     GFEDDSSTTLLPRSNEIIYQIESLDLKDRAFIDEDSLFSLNVLPQMQKMGQDKLVQNA
                     CFSVWELLGQDLSEMGKKKLRSWITGPLTNKEMIVKRYDIIRTLLNRTNASLFEELRT
                     AAKRMPNVISTMNQLQEGKTTVNSWCSLLDFLTRSLQVYRLVSMLRFDRSNQNIFTRI
                     QQTVNSKIVKRLSARINDVIDLETSKETKSIAIRDGVDSRLDHCRNVYNSLEAILCSV
                     AKDAEITILNSLVGQGIDTDAIDESLVNAVYIPQLGYMVTLEIGFEQAEWISQDLQWD
                     EIFRTETNIYYKNYRVNELDNEFGDVHTLIFDLEIDILHSLQNHVLEQREMLCFYRHL
                     LAELEVLLSFAYVSESRNYVEPEISEKSCILEVEEGRHALYETMVNTYIPNSISLNGG
                     PFHVSNPSAWFESGFERIAILTGANQSGKSVFLTQNGLIVLLAQIGCFVPAKRAKIGI
                     VDKILTRIQTRETMTKDQSSFALDSLQMAKCLSLATEKSLILVDEFGKGTDIADGPAL
                     FGSVISVSSKDQRCPRIIGCTHFHELFKNGILSEDVLGVKHYTTDILLLNQESQSQAI
                     DVHKENFGITFLYSVQEGISRESFGIYCAKVCGVDRPIVTRANELASLMNQGYDMVDY
                     CGRLTETEIADLQQNQEIVKRFLLWDLDLEETTDTNDLKEKLRSIINPS"
     gene            complement(<932482..>933927)
                     /locus_tag="ZYRO0F11352g"
                     /db_xref="GeneID:8205458"
     mRNA            complement(<932482..>933927)
                     /locus_tag="ZYRO0F11352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497647.1"
                     /db_xref="GeneID:8205458"
     CDS             complement(932482..933927)
                     /locus_tag="ZYRO0F11352g"
                     /note="similar to uniprot|P24870 Saccharomyces cerevisiae
                     YDL155W CLB3 Involved in mitotic induction and perhaps in
                     DNA replication and spindle assembly G(sub)2-specific
                     B-type cyclin and uniprot|P24871 Saccharomyces cerevisiae
                     YLR210W CLB4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497692.1"
                     /db_xref="GeneID:8205458"
                     /db_xref="GOA:C5DY98"
                     /db_xref="InterPro:IPR004367"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014400"
                     /db_xref="UniProtKB/TrEMBL:C5DY98"
                     /translation="MHYSSHSTSSAPQEYAKENENTEYGDVGIAMAHYKQRQGQNQQA
                     HQHQHAPFQQHRVALSDVTSQVSNRMYINNASVKQLATTSTVENGGPKRASMGRNERY
                     VAIDELENKQLQSQHKVQRSVDQSEVYVDVLKRNEMIGNEHADAVVEDQTEVNEDDDE
                     EEEEDEEDDDDDSDDDSNEPLSPVFNERSEAILDQAFREYHRDSPDPLDDDTYDVVMV
                     SELSTEIFEYLRELEMKYRPNPSYMDIQPELKWSYRSTLIDWIIQVHSRFQLLPETLY
                     LTVNIIDRFLSRKTVTLNRFQLVGAAALFVAAKYEEINCPTLNDIVYMLDHAYTKEDI
                     VKAEKFMIDTLDFEIGWPGPFSFLRRISKADDYEYDTRTLAKYLLETTTMDSKLVAAP
                     PSWLATGAYFLSRIILGCNEWTLKHIYYSGYTQEQIFPLATVILENCRFAERRHQAIW
                     KKYSERRQHRSAQVVAKWIALAERRIDQSSI"
     gene            complement(<934451..>935983)
                     /locus_tag="ZYRO0F11374g"
                     /db_xref="GeneID:8205459"
     mRNA            complement(<934451..>935983)
                     /locus_tag="ZYRO0F11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497648.1"
                     /db_xref="GeneID:8205459"
     CDS             complement(934451..935983)
                     /locus_tag="ZYRO0F11374g"
                     /note="similar to uniprot|Q12510 Saccharomyces cerevisiae
                     YDL156W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497693.1"
                     /db_xref="GeneID:8205459"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DY99"
                     /translation="MSELSSFQKKRLENIKRNNDLLKKLNLSGAANQVKKESGLDEHR
                     PQKKKKKTAGDTNGKKSESPRAEKIPTRRSRRIRGENAEGKGVPNVNDNELLKMGSPD
                     KELVDEVKDTRIIGDIKLSDLIKDEEESSLLDKYARVNFSSGDFFQEIKKHQKVDSDL
                     QREFDLQPYDVFEPNDIKLVYERISAMCFHPSLDQKLIIAGDTTGNLGLWNVKEGTPD
                     EDEEPDITRVQLFSKNVGRLDCFPSDTSKLLAASYDGFIRSIDLNTMQSTQITNLTNE
                     YDDPLGVSDCKFSYDDLNLLHLTTLSGEFTSLDLREPSKNFNFKRLSDKKIGSMDVDP
                     KRPYQIATGSLDRTLKIWDLRTTVDNPDWISYEDFPSLGLVSTYDSRLSVSAVSFSPT
                     DDTLVCNGYDDTIRLFDMNNNGSQLASELQPRLTIKHNCQSGRWTSILKAKFKPNRDV
                     FAIANMKRAIDIYDSQGQQLAHLRTATVPAVLAWHPLSNCIVGGNSSGKAFLFTNQEK
                     QD"
     gene            <936151..>936471
                     /locus_tag="ZYRO0F11396g"
                     /db_xref="GeneID:8205460"
     mRNA            <936151..>936471
                     /locus_tag="ZYRO0F11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497649.1"
                     /db_xref="GeneID:8205460"
     CDS             936151..936471
                     /locus_tag="ZYRO0F11396g"
                     /note="highly similar to gnl|GLV|CAGL0I03520g Candida
                     glabrata CAGL0I03520g and similar to YDL157C
                     uniprot|Q12082 Saccharomyces cerevisiae YDL157C
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497694.1"
                     /db_xref="GeneID:8205460"
                     /db_xref="UniProtKB/TrEMBL:C5DYA0"
                     /translation="MSNIIDVFNPRPNRELSEQETMDCLPCQVMSSLFALGFGGYLAT
                     GQPFKYTDKERGQGITLAEFEKRNPLWWKYSLRGFGSVLITFGIVRGTEGWIWNKDKK
                     YKKF"
     gene            complement(<936573..>938117)
                     /locus_tag="ZYRO0F11418g"
                     /db_xref="GeneID:8205461"
     mRNA            complement(<936573..>938117)
                     /locus_tag="ZYRO0F11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497650.1"
                     /db_xref="GeneID:8205461"
     CDS             complement(936573..938117)
                     /locus_tag="ZYRO0F11418g"
                     /note="similar to uniprot|P06784 Saccharomyces cerevisiae
                     YDL159W STE7 Signal transducing MAP kinase kinase involved
                     in pheromone response where it phosphorylates Fus3p and in
                     the pseudohyphal/invasive growth pathway through
                     phosphorylation of Kss1p phosphorylated by Ste11p degraded
                     by ubiquitin pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497695.1"
                     /db_xref="GeneID:8205461"
                     /db_xref="GOA:C5DYA1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DYA1"
                     /translation="MNFQAPSLFHGRTQKKRNLKQLALPQNAIDGNAYGCEITTSAQE
                     HGSSNENLHDMNNIRLGSSSSSSSGKLNFPKNDASNLYLRRGFKGKIHLNNNSALDLK
                     NENRNGSNEGLGMVQQSFVVSSPTNSSPSTTTSLNHVFTPMDEEVSVGLPEGELSKSS
                     IFRNSDSSTSGTTGNSIKLDNLVQLGKIGSGNSGTVIKALHVPDSRIVAKKTIPVENN
                     NHLVVNQLVRELTIMKSVHMHDNIVSFYGAYYTHASNNEIIILMEYMNCGSLDKILSV
                     YKRYVARHTSSRAVPWFNGLVISKISNGVLNGLLYLYERYKIIHRDIKPSNVLINSKG
                     QVKICDFGVSKKLINSIADTFVGTSTYMSPERIQGNVYSIKGDVWSLGLVIIELVTGE
                     FPLGGHNDTPDGILDLLQRIVNEPSPKLPQGQGYEFPKEMIDFVNRCCVKEESQRSSI
                     QELLCHDFINMYKSRDKDYKHWCKKVKVRIREDKQIRREDNERVKLEQKQLEKAAEAA
                     TTARRS"
     gene            <939613..>941184
                     /locus_tag="ZYRO0F11440g"
                     /db_xref="GeneID:8205462"
     mRNA            <939613..>941184
                     /locus_tag="ZYRO0F11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497651.1"
                     /db_xref="GeneID:8205462"
     CDS             939613..941184
                     /locus_tag="ZYRO0F11440g"
                     /note="highly similar to uniprot|Q75BS4 Ashbya gossypii
                     ACR197W DHH1 ATP-dependent RNA helicase DHH1 and similar
                     to YDL160C uniprot|P39517 Saccharomyces cerevisiae YDL160C
                     DHH1 Cytoplasmic DExD/H-box helicase stimulates mRNA
                     decapping coordinates distinct steps in mRNA function and
                     decay interacts with both the decapping and deadenylase
                     complexes may have a role in mRNA export and translation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497696.1"
                     /db_xref="GeneID:8205462"
                     /db_xref="GOA:C5DYA2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DYA2"
                     /translation="MSQEDWTSQLKKPTKDTRPQTDDVLNTKGNTFEDFFLKRELLMG
                     IFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIPTLEKVKPKINKIQAL
                     IMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRLNETVHVLVGTPGRVL
                     DLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQILIFLPPQHQSLLFSATFPITVK
                     EFMVKHLHKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQVNQAIIFCNS
                     TNRVELLAKKITDLGYSCYYSHARMRQQERNKVFHEFRQGKVRTLVCSDLLTRGIDIQ
                     AVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIAA
                     IPATIDKSLYVAEDVSTVPTPFPLQQQSLPQQQHQQQPQQQPQYGSPAQSFTPQSFAQ
                     QLTPQGLAPQGLAAAQNLSPQGLAPQGLAPQALSPQALTNGLPQGIPQGLAQGLPQGI
                     MAQGIPPNFAAPPHY"
     gene            <941970..>942884
                     /locus_tag="ZYRO0F11462g"
                     /db_xref="GeneID:8205463"
     mRNA            <941970..>942884
                     /locus_tag="ZYRO0F11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497652.1"
                     /db_xref="GeneID:8205463"
     CDS             941970..942884
                     /locus_tag="ZYRO0F11462g"
                     /note="similar to uniprot|Q05788 Saccharomyces cerevisiae
                     YLR209C PNP1 purine nucleoside phosphorylase specifically
                     metabolizes inosine and guanosine nucleosides"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002497697.1"
                     /db_xref="GeneID:8205463"
                     /db_xref="GOA:C5DYA3"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR011268"
                     /db_xref="InterPro:IPR018099"
                     /db_xref="UniProtKB/TrEMBL:C5DYA3"
                     /translation="MLIQEQRSIIHSAAEFLAARVKAHFLDDFRPRVLIICGSGLGGI
                     SNKISSDDPKPLEIGYDDIPGFKKSTVAGHQGALIFGKMNGVPVVLMNGRLHGYEGHY
                     LFEITLPIRVLHHMGDVKQLIVTNAAGGINPKFEPCDLMCIYDHINLPGFAGLHPLKG
                     SNFDETGPRFLPLSDAYDLGLRKLLFKKKQELGIDRPLHEGTYMYVSGPTFETRAESR
                     LIRQLGGDAVGMSTVPEIIIARHCGWRVLALSLITNKCVIDPPPSALETEQPPMDQGI
                     ASHAEVLENGKKASLDVELLVAAVVSEL"
     gene            complement(<943018..>943902)
                     /locus_tag="ZYRO0F11484g"
                     /db_xref="GeneID:8205464"
     mRNA            complement(<943018..>943902)
                     /locus_tag="ZYRO0F11484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497653.1"
                     /db_xref="GeneID:8205464"
     CDS             complement(943018..943902)