GenomeNet

Database: RefSeq
Entry: NC_012996
LinkDB: NC_012996
Original site: NC_012996 
LOCUS       NC_012996            1865392 bp    DNA     linear   CON 25-SEP-2017
DEFINITION  Zygosaccharomyces rouxii strain CBS732 chromosome G complete
            sequence.
ACCESSION   NC_012996
VERSION     NC_012996.1
DBLINK      BioProject: PRJNA39573
            BioSample: SAMEA3138235
            Assembly: GCF_000026365.1
KEYWORDS    RefSeq; genomic DNA.
SOURCE      Zygosaccharomyces rouxii
  ORGANISM  Zygosaccharomyces rouxii
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Zygosaccharomyces.
REFERENCE   1  (bases 1 to 1865392)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 1865392)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-SEP-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1865392)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928179.
            The Zygosaccharomyces rouxii sequence is made of 7 chromosomes (A
            to G). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1865392
                     /organism="Zygosaccharomyces rouxii"
                     /mol_type="genomic DNA"
                     /strain="CBS 732"
                     /db_xref="taxon:4956"
                     /chromosome="G"
     gene            complement(<4148..>5011)
                     /locus_tag="ZYRO0G00132g"
                     /db_xref="GeneID:8206808"
     mRNA            complement(<4148..>5011)
                     /locus_tag="ZYRO0G00132g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497972.1"
                     /db_xref="GeneID:8206808"
     CDS             complement(4148..5011)
                     /locus_tag="ZYRO0G00132g"
                     /note="some similarities with uniprot|P36034 Saccharomyces
                     cerevisiae YKL219W COS9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498017.1"
                     /db_xref="GeneID:8206808"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5E1P1"
                     /translation="MSMISDESEIDLEKCVQMYEEEEIELPADSTSGKLVYFLAPYFF
                     EKTWTSDIVASLSAAFLSPSLVRLPYFIMRDLYDDPFETKLSDIFSPVWMIIHYFLCF
                     TFSFWNFIDNRKKVNIEKKVLQQLLKEVAEMDLPGDPVAWQRIASRVNHFSEETGYRY
                     SLFYSGEHCMRFFVREIVKPIECQTYDIRCYQEGSTVVNFWKNPPNKALTERALANYN
                     KCVESFGKLSHTAEKDEFRDGIFEKFHSIFNTSLFYLVIIELGSFIIMMLTFIISMIS
                     CAIFNSFATPH"
     gene            <5335..>6033
                     /locus_tag="ZYRO0G00154g"
                     /db_xref="GeneID:8205795"
     mRNA            <5335..>6033
                     /locus_tag="ZYRO0G00154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497973.1"
                     /db_xref="GeneID:8205795"
     CDS             5335..6033
                     /locus_tag="ZYRO0G00154g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498018.1"
                     /db_xref="GeneID:8205795"
                     /db_xref="UniProtKB/TrEMBL:C5E1P2"
                     /translation="MSNKKKSKSKASESHNRGGRENSPRGQHNSLSPQRDSSISDQQG
                     SENGGTGSRTNGIKLAARLFRNPLFSKRGFQHAKEGLKSESSGDSMSNVRFLGSFFLL
                     TYPIFLIGYSIFGFLYGDKNNGIHVFLYGSPLFTAVPYIIQYLNDVDTLLLSIFEIGE
                     KNLLEYFADPGIRELLLTVFEIVGFIYQLVKGRQNFEIFICGIVGFNLYLVGNTLLIW
                     ERKKRPKPVMADSA"
     gene            complement(<7333..>8019)
                     /locus_tag="ZYRO0G00176g"
                     /db_xref="GeneID:8205796"
     mRNA            complement(<7333..>8019)
                     /locus_tag="ZYRO0G00176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497974.1"
                     /db_xref="GeneID:8205796"
     CDS             complement(7333..8019)
                     /locus_tag="ZYRO0G00176g"
                     /note="similar to uniprot|P43543 Saccharomyces cerevisiae
                     YNL335W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498019.1"
                     /db_xref="GeneID:8205796"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="InterPro:IPR017771"
                     /db_xref="UniProtKB/TrEMBL:C5E1P3"
                     /translation="MSKYGFIKVNKEFEKAIKDPKDPLPRTTVPIPSGKVANFFYNYA
                     AKELPLATLNHSLRVFQYSVAIMKDQFPEWDLDEEVIYVTALMHDIATTDKNLNETKL
                     SFEFYGGYISRELILRETGGNTDYADAVAEAIIRHQELTTTGFITSLGLILQIATTLD
                     NAGANTNLIHQETIYSINEKYPRVNWSTCFANVLSKEDTQKPWSHSTTFGIEDFKEKV
                     LNNPVKYERQ"
     gene            complement(<8925..>9170)
                     /locus_tag="ZYRO0G00198g"
                     /db_xref="GeneID:8205797"
     mRNA            complement(<8925..>9170)
                     /locus_tag="ZYRO0G00198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497975.1"
                     /db_xref="GeneID:8205797"
     CDS             complement(8925..9170)
                     /locus_tag="ZYRO0G00198g"
                     /note="some similarities with uniprot|Q03034 Saccharomyces
                     cerevisiae YDR539W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498020.1"
                     /db_xref="GeneID:8205797"
                     /db_xref="UniProtKB/TrEMBL:C5E1P4"
                     /translation="MRKVYEDKLPISFFKNLKQQKGNVDPDNLFDIVGCVDSLRGFGN
                     DHARIAHHLRSSSHISMKEIISCLLEDRKKKQPYPIS"
     gene            complement(10051..10122)
                     /locus_tag="ZYRO0G00220r"
                     /db_xref="GeneID:8205798"
     tRNA            complement(10051..10122)
                     /locus_tag="ZYRO0G00220r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (TCC) cove score=71.59"
                     /db_xref="GeneID:8205798"
     gene            complement(<12031..>13032)
                     /locus_tag="ZYRO0G00242g"
                     /db_xref="GeneID:8205799"
     mRNA            complement(<12031..>13032)
                     /locus_tag="ZYRO0G00242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497976.1"
                     /db_xref="GeneID:8205799"
     CDS             complement(12031..13032)
                     /locus_tag="ZYRO0G00242g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|P53111 Saccharomyces
                     cerevisiae YGL157W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498021.1"
                     /db_xref="GeneID:8205799"
                     /db_xref="GOA:C5E1P5"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5E1P5"
                     /translation="MAVLVTGATGFIAQWVLDCLLKENYQVIGTVRSQEKGDKLHKQF
                     GSPSKLSFEIVKDISDTEAFEPLFKKRGKEIDIVLHMASPCHFNTSDYEKDLLIPALN
                     GTKGVLNAIKKYGDVKKVVVTSSYAAITDMVNSADGSLVFTEKDWNPATWERCQTDAV
                     NAYCASKKFAEQAAWEFSKETGVSLTTINPVFVFGPQKFDEDVTSQLNTSNEIINGLI
                     HSKPGDKLEPDYHSAYVDVRDVARAHLVAFQKDTTGERLGLSNGAFNCQSILDILNEK
                     FPQLDITKGPEPGMGDTKPGAVFDNRHSKEVLAFPFISLEQCVYDTVAQVLKKEGRL"
     gene            <18542..>20311
                     /locus_tag="ZYRO0G00286g"
                     /db_xref="GeneID:8205800"
     mRNA            <18542..>20311
                     /locus_tag="ZYRO0G00286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497977.1"
                     /db_xref="GeneID:8205800"
     CDS             18542..20311
                     /locus_tag="ZYRO0G00286g"
                     /note="highly similar to uniprot|P39003 Saccharomyces
                     cerevisiae YDR343C HXT6 High-affinity glucose transporter
                     of the major facilitator superfamily nearly identical to
                     Hxt7p expressed at high basal levels relative to other
                     HXTs repression of expression by high glucose requires
                     SNF3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498022.1"
                     /db_xref="GeneID:8205800"
                     /db_xref="GOA:C5E1P6"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E1P6"
                     /translation="MSTENYKSALADNGNVKNMIDDIPVEHARESTASDSLENRSLSK
                     NEKDDLQPVEGMNYDGHNGIQEEENDVALPKKPLSDYLSVFIFCVLIAFGGFVFGWDT
                     GTISGFVNQTDFIERFGQLNHRTGEHYLSKVRTGLIVSLFNIGCAFGGLILTKPADVY
                     GRKLAVTIAAVFYVVGTVISIASIDKWYQYMIGRIISGLGVGSLAVLSPMLISEVAPK
                     QLRGTLVSIYQLMVTAGIFLGYCANYGTKTYDNSVQWRVPLGLNFAWAILMVAGMTFV
                     PESPRYLVQIGKVQEAKRSLSRSNKVSPEDPGLLAELEQIETGIEAERAAGKASLQEL
                     FSTRGKVLQRVIMAAVIQSLQQLTGDNYFFYYGTTVFKSVGLNDSFETSIVLGVVNFF
                     STFFGIYYVERFGRRTCLLWGAATMVCCFVVFASVGVTRLWPNGQGNGSSKGAGNCMI
                     VFTCFYIYCFASSWAPICFVVVSETFPLRVKSKGMAIAMVANWVWGFLIGFFTPFITG
                     AINFYYGYVFMGCLVFAFFYVFFFVPETKGLTLEEVSTMWEENVLPWKSTSWVPPDRR
                     GRGYDSEALAHDDKPWYKAMFTK"
     gene            <20674..>22623
                     /locus_tag="ZYRO0G00308g"
                     /db_xref="GeneID:8205801"
     mRNA            <20674..>22623
                     /locus_tag="ZYRO0G00308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497978.1"
                     /db_xref="GeneID:8205801"
     CDS             20674..22623
                     /locus_tag="ZYRO0G00308g"
                     /note="similar to gnl|GLV|KLLA0C18953g Kluyveromyces
                     lactis KLLA0C18953g and some similarites with YKL015W
                     uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
                     Positive regulator of PUT (proline utilization) genes
                     zinc-finger transcription factor of the Zn(2)-Cys(6)
                     binuclear cluster domain type"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498023.1"
                     /db_xref="GeneID:8205801"
                     /db_xref="GOA:C5E1P7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E1P7"
                     /translation="MSGKKSKKACEICKRRKKRCSGGLPCEYCVKIDKPRECVYHTRT
                     SSKTVKVTERYVLNLKAKIKNLESRLATVSDDSSNANPSISSEEEDNGQTMGGNIDSS
                     GNYRLGNSACNKFLFQLKDSLVNSCQLPDDIYEPDIETISLESSPNVALIQLIFQENC
                     PSRSEAKRWISAAYNVIGADYMYIEPDYETKILDSLIWDENSRNANFVRYATEITRFF
                     TYLALGCLFNEERSPENTRSKFPGLQYFETALKLQSELLKVYDMVANTSLVQSFLYAA
                     YYALSLDKSDFAYLTIGSAIRMTFTLGLHKKTLTFTENRVFWLCFVYDRLVSVRFGLP
                     LMINEMDIDVPLLTESERPNQQGLFEAHHFNSQVRLAKITTQIVRKIYTRNSFSFVQN
                     CYMVLKELKHWLDTLPNSLKVDYGNFSAKQSRSTINLHINYNYTIIITTRPIFLYVFN
                     KLIESGRKAEEIFPEKLLNTITILLESSVQAAQIQSLILTRLYYDGRMVSASFLDCHY
                     IFNATIILIFAAFCRSMPNHTISFGCDINTLFERVQINLTVLQQISQFNIAACNFNKQ
                     LTEIIELISSPDLQVTLKGSFAKQSGYTESEQQSLEMPATSNFDMDVIRNLDLSRILD
                     DIGDTGKTDQVLPFDNEDFMKYGFF"
     gene            complement(<22695..>26561)
                     /locus_tag="ZYRO0G00330g"
                     /db_xref="GeneID:8205802"
     mRNA            complement(<22695..>26561)
                     /locus_tag="ZYRO0G00330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497979.1"
                     /db_xref="GeneID:8205802"
     CDS             complement(22695..26561)
                     /locus_tag="ZYRO0G00330g"
                     /note="highly similar to uniprot|P28273 YKL215C
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498024.1"
                     /db_xref="GeneID:8205802"
                     /db_xref="GOA:C5E1P8"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:C5E1P8"
                     /translation="MTGEPINQRIRIAIDRGGTFTDCIGNPGTGKVEDDVCIKLLSVD
                     PKNYKDAPLEGMRRLLETLEKKTIPRGMPLDVSNVSSIRMGTTLATNCALERNGEPCA
                     FVTTKGFKDVMAIGDQTRPDIFNLKIQKPQPLYEMVVEINERITLEDFSEDPLHNISK
                     PDNNAGTVYGTSGEVVRILKIPDPQEITLALKNIKQRGIESIAVSFLHSYTYPQHEQL
                     VGRIAKQLGFKHVSLSSEVSPMIKHLPRAHSSVADAYLTPVIRRYLESIQSGLINTEN
                     TSIQFMQSDGGLVEGQRFSGLKSILSGPAGGVVGYSRTCYDEANEIPLIGFDMGGTST
                     DVSRFGDSKLEHVLETTTAGIVIQTPQLNVNTIAAGGSSRLFWENGLFRVGPESATAN
                     PGPVAYRKGGPLTITDANLLLGRLVPEFFPKIFGPNEDESLDIDATRKQFEALTKIIN
                     ADLNTNMTPNEVAFGFLKVANESMARPIRAITEAKGHVLSKHRLVTFGGAGGQHAVAV
                     AESLGIKEVLAHRYSSLLSAYGIFLADVVEENQEPCFLLLNLPENSTKIKSKLESLVV
                     KCNDQLVSQGFPEHLIDHEKYLNLRYEGTETSLMVLEQDEDWDFENWFAEAHMREFGF
                     AFNDKNIIVDDIRVRAVAKSFVREEESVDAQLNKYERREVVTSKEASFFKKVYFDGKL
                     YETPIFRIDNMVYGSVVHGPAILADGTQTNIIPRNAKATVLKSHIFIEILHKSTDISS
                     LEEPESHVDPVMLSIFSHKFMDIAEQMGLQLKKTSVSTNVKERLDFSCALFDPDGNLV
                     ANAPHVPVHLGSMSTCIAAQAKLWKGKLKPGDVLVTNHPDIGGTHLPDITVISPAFSE
                     ETGEVIFYVASRAHHADIGGILPGSVPPNSKELYEEGAAIYSEFIVRGGEFQEQLIRK
                     LLLEEPAKYPECSGSRRLSDNISDLKAQIAANNKGIQLIAKLMREHGLGAIVKYMKAI
                     QNNASDTIKKMLKQLAQHFGQTEFSGEDLMDDGTLIKLKVKLDIEKEEYVFDFDGTSP
                     QVYGNINAPEAITNSAILYCLRCLVGEDIPLNQGCLKPITVKIPKGSVLSPINGIAVV
                     GGNVLTSQRVTDVVLKTFHVMADSQGDCNNFTFGTGGRDPKTGEVTNGFGYYETICGG
                     HGAGADSFRGPGWDGADAVHTNMTNTRMTDSEIFERRYPVILREFSIRSCSGGDGQYM
                     GGDGVIRDIEFSQPVQASILSERRVVAPHGIHGGQDGQKGINLWIRNNGKNTINIGSK
                     NSVRVNPGDRIIIKTPGGGGCGIKEN"
     gene            <27042..>28526
                     /locus_tag="ZYRO0G00352g"
                     /db_xref="GeneID:8205803"
     mRNA            <27042..>28526
                     /locus_tag="ZYRO0G00352g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497980.1"
                     /db_xref="GeneID:8205803"
     CDS             27042..28526
                     /locus_tag="ZYRO0G00352g"
                     /note="weakly similar to uniprot|P53322 Saccharomyces
                     cerevisiae YGR260W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498025.1"
                     /db_xref="GeneID:8205803"
                     /db_xref="GOA:C5E1P9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5E1P9"
                     /translation="MTEVDLTLRKNNESQKANGEESIVSLTENSEFIEEDLYIDKYEE
                     RKLLKKLDIRLLPMLAFMYFLSSLDRSNIANAYTSGMKEDLGLTSKQYSNCVSVFYST
                     YLAAELPAVLVLKRTNVKYYMSFLVFSWSIITLCSGFVKSHKSLLALRVLLGTFEGGF
                     FPAMTLIISIVYKPQEQAKRIAFFFGSSALSGAFGGLIATGLASVKDAGGLEGWRWLY
                     IIEGLISIGASIWLFLGLPAKFEYLPFLNERESKLMEIRSKQREQYMGTQEKFDWSFV
                     KDALMDFKTYFSFIIQFCQDTVMYGFSTFLTSILKMGLGYSSRKSQYMSAPVYILAGI
                     VFLISAFLSDRFKLRGPIFFGYNIMGIVGYILLLSVHNDAVKYFACYLITFSLYTGTG
                     LNISWLTNNMAPHYKRATALGLNQTLGNLSGAIAGQIYTKPPYTFGNSFSLGCIVLSN
                     ILTFSQVIILKRINIKKKKILAGESPDTAKSRRGDWALDYEYCL"
     gene            complement(<28649..>30553)
                     /locus_tag="ZYRO0G00374g"
                     /db_xref="GeneID:8205804"
     mRNA            complement(<28649..>30553)
                     /locus_tag="ZYRO0G00374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497981.1"
                     /db_xref="GeneID:8205804"
     CDS             complement(28649..30553)
                     /locus_tag="ZYRO0G00374g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498026.1"
                     /db_xref="GeneID:8205804"
                     /db_xref="GOA:C5E1Q0"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q0"
                     /translation="MLMIRRMIKVPKSLTTLAYLSKLDDNYGGERREMTKYTRSRNGC
                     RKCKELKIKCDEQRPRCQNCIRRNFQPCDYSKVLQWGGRPGKKNNQQQLQGLVCKPTP
                     KPSPLPTFQPDTLLQDLFVQNHQSIPSNCFDIENNNNENSDEYNDRLPLISTGDTSLH
                     SLRTPWSASVAFSKIPLSSLQLPSPLPDVLLNTPHYLNLFEFYMRETAYLLVPLPREL
                     YSDNPFCWRFGQMALACPTLLYLLLAFSANHRTMIATQKRKLELPSLEEPWNLESSSE
                     SSLAPFGDVETGNTLTNELLTITFNNLLVDLTNEQRRKSDCTLATIMMLAAFDIFFSD
                     RRRKWRAHVNGAGRLIMERLCGSDCNMLTLQDSEEQTDLFFLTRWFSYLDIIGSLSST
                     SRVITTEKLQAIKYKSMLTDPSVLKSRRINLSDLEAGTGFEYTILSYLAEVSSLIKEK
                     ESEQDETGMERMSQEMLAKVLELDYEINTYLENSERERSQIYEKYYSKKPWENYRGYY
                     NLRITNLIFGLTGSYQLKRRVLNLPLDSKIVQDLLVRITKLVDENVPLAASSTSCLSF
                     CLFSCGCELLNDSMAQYRPIYMERIDALNKEGVNCAAMAKSIMEKCWKFKKNWWDILR
                     EENLDITFAI"
     gene            complement(<30608..>31807)
                     /locus_tag="ZYRO0G00396g"
                     /db_xref="GeneID:8205805"
     mRNA            complement(<30608..>31807)
                     /locus_tag="ZYRO0G00396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497982.1"
                     /db_xref="GeneID:8205805"
     CDS             complement(30608..31807)
                     /locus_tag="ZYRO0G00396g"
                     /note="highly similar to uniprot|P38891 Saccharomyces
                     cerevisiae YHR208W BAT1 Mitochondrial branched-chain amino
                     acid aminotransferase homolog of murine ECA39 highly
                     expressed during logarithmic phase and repressed during
                     stationary phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498027.1"
                     /db_xref="GeneID:8205805"
                     /db_xref="GOA:C5E1Q1"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="InterPro:IPR005786"
                     /db_xref="InterPro:IPR018300"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q1"
                     /translation="MLKRLSSNSNFSKGLWKILNQRNMSTSKLDASKLQVTRVSQKSQ
                     PKPNDQLVFGKTFTDHMLSIEWTMEKGWDAPVIKPYGPITLDPASCVFHYAFELFEGL
                     KAYRTKDGKITMFRPDKNMERMNKSAARICLPTFDSDELIKLIGKLIEEDKHLVPEGQ
                     GYSLYIRPTMIGTTDGLGVGYPDRALLYVITSPVGPYYKTGFKAVKLLATDFATRAWP
                     GGVGDKKLGANYAPCILPQLQAADKGYQQNLWLFGPEKNITEVGTMNVFFVFKDSKTG
                     KKELVTAPLDGTILEGVTRDSVLSLARERLDPKEWEVNERYYTIYEVSERSKKGELVE
                     AFGSGTAAVVSPIKEIGWQDEDIQVPLLPGEQSGELTKDVANWIAAIQYGKEVHGNWS
                     RVVADVN"
     gene            <32322..>32969
                     /locus_tag="ZYRO0G00418g"
                     /db_xref="GeneID:8205806"
     mRNA            <32322..>32969
                     /locus_tag="ZYRO0G00418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497983.1"
                     /db_xref="GeneID:8205806"
     CDS             32322..32969
                     /locus_tag="ZYRO0G00418g"
                     /note="similar to uniprot|P40099 Saccharomyces cerevisiae
                     YER183C FAU1 5 10-methenyltetrahydrofolate synthetase
                     involved in folic acid biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498028.1"
                     /db_xref="GeneID:8205806"
                     /db_xref="InterPro:IPR002698"
                     /db_xref="InterPro:IPR024185"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q2"
                     /translation="MSKKAVRLAVKEALHKVTSKEVEIQSRCIASALRPLLESHHDVA
                     CYMSMDQGEIDTSYLMEWLFEQGKKVYLPRCTSTTKTGQVPLRAVGASGGHPHLTFHS
                     MDSWEKVKLLEPRGKYNLREPEAESPAPLPPRLDVMLVPGLAFDPSRGTRLGHGAGYY
                     DDFFQRYQLQHKGEKPLLVGLALIEQLRGSIPTDSHDWTMDCIVSGDGKVQWITN"
     gene            complement(<32982..>33701)
                     /locus_tag="ZYRO0G00440g"
                     /db_xref="GeneID:8205807"
     mRNA            complement(<32982..>33701)
                     /locus_tag="ZYRO0G00440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497984.1"
                     /db_xref="GeneID:8205807"
     CDS             complement(32982..33701)
                     /locus_tag="ZYRO0G00440g"
                     /note="similar to uniprot|P40098 Saccharomyces cerevisiae
                     YER182W FMP10 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498029.1"
                     /db_xref="GeneID:8205807"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q3"
                     /translation="MFRRLATNTFKRCYTYSKGPASFTVRPKPKQRKWVPWTIFGTSF
                     ITGLLITQHMTLTDFLAFWKYDKLPQGSPEVDNYKLELTQRCENLSVVKQLKQTGFTE
                     VFPNRREEDLLVAHTLDTPGGIAISPRFYYNPLTKETVGIYHLGMKLTGYPFIVHGGI
                     LATVLEDLMREAVKIIRAKPGEKTKELALSYKMPTFANQFVIVRTTKVEEFGKNTKLH
                     AQIMDQTGNTTLISGKGTFST"
     gene            <33882..>35339
                     /locus_tag="ZYRO0G00462g"
                     /db_xref="GeneID:8205808"
     mRNA            <33882..>35339
                     /locus_tag="ZYRO0G00462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497985.1"
                     /db_xref="GeneID:8205808"
     CDS             33882..35339
                     /locus_tag="ZYRO0G00462g"
                     /note="similar to uniprot|P38890 Saccharomyces cerevisiae
                     YHR207C SET5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498030.1"
                     /db_xref="GeneID:8205808"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q4"
                     /translation="MHLQIQTLSLNDDSGSLPAASIVPSNQQVCDSILLLWREEPASE
                     DYNLEELLKVVKERHSEWKLSVESLRKLLQSHSLYATDEKSLQIYSDKVRMPEMAEGE
                     VKLPRSVRIGACSGDKQRGLFATNALKAGDMIFEDLPLVVVPPMDKLVLMQSGKACPL
                     CGSSVSHSQHTIIMNGLDCGECGAVWCSKNCKKNDLTHTSLRHTRSRCRQINLNGWKK
                     YESFCKQYVFVAAYSIGIIYASMILDKNGKNGVHPKFQLLADVSQRIRKDSSDSTNLG
                     GTLDASSGAFTSDDPEPMWTQALDLFKEAFPELDDMDMEAYLNCIGKFNINQVSGQIF
                     PVYSFINHDCEPNVRYEIDDKLRLKLYARKHIKKGEELLTTYVNPLHGVKLRRRELRV
                     NWGFLCHCDRCNRELTKRKEKLTSPTPSAHHSPANSFSDKNRRKSSMRNARPDLHELL
                     KNGQEFDLEIPDNLETHHRKTSVRFDNNVSVAVDE"
     gene            complement(<35793..>37736)
                     /locus_tag="ZYRO0G00484g"
                     /db_xref="GeneID:8205809"
     mRNA            complement(<35793..>37736)
                     /locus_tag="ZYRO0G00484g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497986.1"
                     /db_xref="GeneID:8205809"
     CDS             complement(35793..37736)
                     /locus_tag="ZYRO0G00484g"
                     /note="similar to uniprot|P38889 Saccharomyces cerevisiae
                     YHR206W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498031.1"
                     /db_xref="GeneID:8205809"
                     /db_xref="GOA:C5E1Q5"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014402"
                     /db_xref="InterPro:IPR027718"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q5"
                     /translation="MNLSNDTDISRPSTSASTNLGIVNSASQNNGNNNNTIKAPSNDF
                     VRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKY
                     DFHKVKKSPEERQNSQYGELSWEFRHPYFTIHNEEALDNIKRKTTVQKKIMLDDSTVL
                     LKPNSGTQTGTEERAGANLILGNAVTKDKFNLLKRRVDRLQKDLDSAKEESYNAKLEF
                     QKLNSKYNTVVESLFTFKTVNDNLMNNFNILCSVLNNRGIELPPHIYQDPRLKQNSGT
                     QQQAQAATSAATQATTSASNSTAGMSPMQNKPFDPLNSAVNAMVPGPVPLSASLSNHN
                     AVNAAAELQLPLPNMNHGPTITTDKGDKLPETYDSFVLREGFHVLLVEDDAVCIQLCS
                     KFLRKYGCTVEVVTDGLAAISTLEKFRYDLVLMDIVMPNLDGATATSIVRSFDIHTPI
                     IAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLIRYLRDRVPLIKQQEQRAHAT
                     NEHHHHHGSTADNGTGTGTANGNSGGGVNHGSNSGDNSNGNGPHSVDRNGYASSEADS
                     QPELLTRSQSHSQMQGSLDDTTTNPPGVPPQSLPPTSGQAHGPGRGVPLSTTASGHSS
                     SAVSDHDVKGLVDDEPLLKKQRV"
     gene            complement(<38488..>40854)
                     /locus_tag="ZYRO0G00506g"
                     /db_xref="GeneID:8205810"
     mRNA            complement(<38488..>40854)
                     /locus_tag="ZYRO0G00506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497987.1"
                     /db_xref="GeneID:8205810"
     CDS             complement(38488..40854)
                     /locus_tag="ZYRO0G00506g"
                     /note="similar to uniprot|P11792 Saccharomyces cerevisiae
                     YHR205W SCH9 protein kinase involved in growth control may
                     be redundant with cAMP pathway cAMP-dependent protein
                     kinase homolog suppressor of cdc25ts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498032.1"
                     /db_xref="GeneID:8205810"
                     /db_xref="GOA:C5E1Q6"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q6"
                     /translation="MMNFFGSNKVASTGDSDSRNGDSINGSDSNNNGNNNNNNGSANH
                     IGTTLSSNLGTGFFPSFTSQTATPTTAVSQNSYAMGTTGVTSENVLSHMKAMNEGGDA
                     PGATFQSTTSSSQLSSQFPQNDSGMQETRLAKGQQQQQQPPLPQQQQQQRQHLNQAQV
                     HHLTLPTGGDSTRLGGASSTGLETEVPLGSLTVTIVEARNLLTRSATAQPYVVCTFES
                     SEFISDGPESVDNKPFHGSGWQQPGLPAIPENAAKHRPLYTHRSSSNLNKMREDADTQ
                     LEQHSSTNSSNPMWHHKTTFDVLGACSELEISVYDAAHDDMFLGQVRLRPRIQNTRKA
                     SQSQWHALQKRVLDEHVSGDILISWQYTSTKKRQYGPSDFEVLRLLGKGTFGQVYQVK
                     KKDSQRIYAMKVLSKKVIIKKNEIAHTIGERNILVRTASQLCPFIVGLKFSFQTPADL
                     YLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVMALEYLHDNDIVYRDLKPENILL
                     DANGNIALCDFGLSKAELKDRTNTFCGTTEYLAPELLLDETGYTKMVDFWSLGVLIFE
                     MCCGWSPFFAEDNQKMYQKIAFGKVKFPRDVLSPEGRSFVKGLLNRNPKHRLGAVDDG
                     RELRAHPFFADIDWEALRQRKIPPPFKPHLNSDVDTSNFDPEFTQTSTSYLNKNAPIA
                     ATPLSPAMQAKFAGFTFVDESAMDEHYNTTYNNRKFLQNSYFMEPGSFIPGNPDLPPD
                     EDVIDDQIDDDDPNDDFNQSKHLHGVGQVDYEGDQHMDDEFVSGRFEI"
     gene            complement(<41393..>43831)
                     /locus_tag="ZYRO0G00528g"
                     /db_xref="GeneID:8205811"
     mRNA            complement(<41393..>43831)
                     /locus_tag="ZYRO0G00528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497988.1"
                     /db_xref="GeneID:8205811"
     CDS             complement(41393..43831)
                     /locus_tag="ZYRO0G00528g"
                     /note="similar to uniprot|P38888 Saccharomyces cerevisiae
                     YHR204W MNL1 Alpha mannosidase-like protein of the
                     endoplasmic reticulum required for degradation of
                     glycoproteins but not for processing of N-linked
                     oligosaccharides"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498033.1"
                     /db_xref="GeneID:8205811"
                     /db_xref="GOA:C5E1Q7"
                     /db_xref="InterPro:IPR001382"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q7"
                     /translation="MLYTLIWVWVLLPIWAQASQEHFNRNDNSKQLQFEKYSFNRFEL
                     KHYRETVKDLFHFAHENYLQKGYPYDELRPIACIPKTRNFEDPDDEITNDVLGNFSVT
                     LVDSLTTLAVMNDRPKFAEMVKLIEDTFPNKFNIDSTVQVFETTIRIVGGLISAHLYA
                     TDPSKKVYLGEEYKGSLLQLAKDMADRLLPSYLTLTGLPVPRINLRSKFDPISVESVS
                     ENNVAAMVSPIFEFTMLSYLTLDSKYADVTRYAMNKTWALRTELQLLPMSFNPQSGQC
                     YTPISGVGASIDSFYEYALKGAILFDDDGLLKIWQDAYNSLNTNSRADWFYTNVQSTT
                     GQLQTLWIDSLSAFFPGLQVLAGDVEDAILKHMLTLKLWNTFGGVPERWDFQTLAAFE
                     KKKEFTPEDIKSFVPLEWYPLRPEFVESTYFLYRATRDPFYLNVGVAILESLQTRFKH
                     ECGFGGFQDVTTGEPQDRMETFILSETLKYLYLLFDVDNELHSTRDNVVFSTEAHPMW
                     LTPKMINNYEQNKYFNDTVYREHLRACRKRDRKSALHENERTFMGGKLLRFAKSLFTA
                     DQEPTKDISTHAQPEPEEQPDASKPSVYEQMCFPVDFAAPHTDKPQWLHSHLLSHFDR
                     LFEIDRRYNSTLIRPKHMQNVVPMELQRGFYEKWAHDKFAHSRPMPSTEALEIVLDLP
                     GECQLIRLPDGSIHRETLGGRNKIRLEKIEPGKIDVYGRILDPQLFVSARCKDVFKST
                     CDKIDRLYTPSLLYRATVLNGINLPADANLTINRKTVFKTQREENTFRDLFGQNSYNQ
                     LMLECTPIINMLMQ"
     gene            <44824..>45609
                     /locus_tag="ZYRO0G00550g"
                     /db_xref="GeneID:8205812"
     mRNA            <44824..>45609
                     /locus_tag="ZYRO0G00550g"
                     /product="40S ribosomal protein S4"
                     /transcript_id="XM_002497989.1"
                     /db_xref="GeneID:8205812"
     CDS             44824..45609
                     /locus_tag="ZYRO0G00550g"
                     /note="highly similar to uniprot|P05753 Saccharomyces
                     cerevisiae YJR145C RPS4A or to YHR203C uniprot|P05753
                     Saccharomyces cerevisiae YHR203C RPS4B"
                     /codon_start=1
                     /product="40S ribosomal protein S4"
                     /protein_id="XP_002498034.1"
                     /db_xref="GeneID:8205812"
                     /db_xref="GOA:C5E1Q8"
                     /db_xref="InterPro:IPR000876"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR005824"
                     /db_xref="InterPro:IPR013843"
                     /db_xref="InterPro:IPR013845"
                     /db_xref="InterPro:IPR018199"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q8"
                     /translation="MARGPKKHLKRLAAPHHWLLDKLSGTYAPRPSQGPHKLRESLPL
                     VVFLRNRLKYALNTREVKAIMMQRHVKVDGKVRTDSTFPAGFMDVISLDATNENFRLV
                     YDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGIPYVVTHDGRTIRFPDPNVKVNDTV
                     KIDLASGKIQDYIKFDTGKLVYVTGGRNLGRIGTIVHKERHDGGFDLVHIKDSLDNTF
                     VTRLNNVFVIGEPGKPYISLPKGKGIKLSITEERDRRRAQNGL"
     gene            complement(<45758..>47560)
                     /locus_tag="ZYRO0G00572g"
                     /db_xref="GeneID:8205813"
     mRNA            complement(<45758..>47560)
                     /locus_tag="ZYRO0G00572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497990.1"
                     /db_xref="GeneID:8205813"
     CDS             complement(45758..47560)
                     /locus_tag="ZYRO0G00572g"
                     /note="similar to uniprot|P38887 Saccharomyces cerevisiae
                     YHR202W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498035.1"
                     /db_xref="GeneID:8205813"
                     /db_xref="GOA:C5E1Q9"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006179"
                     /db_xref="InterPro:IPR008334"
                     /db_xref="InterPro:IPR014485"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5E1Q9"
                     /translation="MLVKTVCTVLAASHLVASWSVQHLFEQELPLHEKPSPQIRDLET
                     GQLNFLHTTDTHGWLGSHLLQSVYDADWGDFISFASYFRHRRLQKDQDLIIVDTGDKH
                     DGNGLSDATSPNGIETTKIFNEQDYDLLTLGNHELYTPDNTLLEYYATVLSPKFRDNY
                     VSSNVEFVKKDGTRVPFGNKYRAFRTEKNGLRILALSFLFDFKRFNERAVVTPALEEI
                     KQPWFHELTKEKYPEGSVDLVLVFGHMPVTDIANREINKLHEQLRQLYPNTIIQYFGG
                     HSHIRDFVELDSKSTGIQSGRFAETLGFLSIDYVNSDSPHFFRSYLDFSKKSFAHHLK
                     LDQSPTTDKGIRVSNLTKALRQKLNLDAQLGYVPHTYYMSSKPMDSDENLYHLLTTEV
                     LPRLHSKATNDSVSRFILMNTGAVRYDLHEGPFTLDTEFIVLPFSNDWLYLELPLRVA
                     SHIAEYLNKGPVIASLNPPHIAAAAAMAAAEMDTSAVRRTLKRKRCPRTDQPFLTPGL
                     TTSDDYGCDGDDTPHNTLDEFPIPNVVQSEELVSEDPDSLVHFVFYSFLKPYVLEAVS
                     ALTEEGLYQDLHCKHYGGESTKKLLEEFIKDTSR"
     gene            47870..47955
                     /locus_tag="ZYRO0G00594r"
                     /db_xref="GeneID:8205814"
     tRNA            join(47870..47908,47920..47955)
                     /locus_tag="ZYRO0G00594r"
                     /product="tRNA-Tyr"
                     /note="tRNA-Tyr (GTA) cove"
                     /db_xref="GeneID:8205814"
     gene            <48668..>50242
                     /locus_tag="ZYRO0G00616g"
                     /db_xref="GeneID:8205815"
     mRNA            <48668..>50242
                     /locus_tag="ZYRO0G00616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497991.1"
                     /db_xref="GeneID:8205815"
     CDS             48668..50242
                     /locus_tag="ZYRO0G00616g"
                     /note="highly similar to uniprot|Q00684 Saccharomyces
                     cerevisiae YFR028C CDC14 Protein phosphatase required for
                     mitotic exit located in the nucleolus until liberated by
                     the FEAR and Mitotic Exit Network in anaphase enabling it
                     to act on key substrates to effect a decrease in
                     CDK/B-cyclin activity and mitotic exit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498036.1"
                     /db_xref="GeneID:8205815"
                     /db_xref="GOA:C5E1R0"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR026070"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029260"
                     /db_xref="UniProtKB/TrEMBL:C5E1R0"
                     /translation="MRRSLYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDTIFY
                     NSFHLDFGPMNIGHLYRFAVIFHEILNDPDNTNKAVVFYSSTSTRQRANSACMLCCYM
                     VLVQGWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKERGLIDLH
                     SFNLENYERYEHVENGDLNVLTPDFIAFASPQEDSRLINSNTVSSKSHLNQAFRSVLK
                     FFANNNIQLVVRLNSPLYNKKHFEDVGIQHLDMIFEDGTCPDLSIVQNFVGAAETIIK
                     GGGKIAVHCKAGLGRTGCLIGAHLIYTHGFTANECIGFLRFMRPGMVVGPQQHWLYLH
                     QNDFREWKYTMRLSLVPNDIIGNLYPLVSFDKYRSQKRRLKDERRHRVYRDGDENEAK
                     DLAMTPPSPKKIPTNFGAAAVPQNSPGQPRKGQNGTNTIEELQRAKAKRLGTRHAQAI
                     ADNNSDDDMMQQDDTTSANSKVLNDVDKSAQFEDGDEDALLRQLLPKNKRISSGRRTA
                     SATGGVRKISGTSKKL"
     gene            complement(<50294..>51067)
                     /locus_tag="ZYRO0G00638g"
                     /db_xref="GeneID:8205816"
     mRNA            complement(<50294..>51067)
                     /locus_tag="ZYRO0G00638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497992.1"
                     /db_xref="GeneID:8205816"
     CDS             complement(50294..51067)
                     /locus_tag="ZYRO0G00638g"
                     /note="similar to uniprot|P43605 Saccharomyces cerevisiae
                     YFR027W ECO1 Acetyltransferase required for the
                     establishment of sister chromatid cohesion during DNA
                     replication but not for its maintenance during G2 and M
                     phases also required for postreplicative double-strand
                     break repair interacts with Chl1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498037.1"
                     /db_xref="GeneID:8205816"
                     /db_xref="GOA:C5E1R1"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR028005"
                     /db_xref="InterPro:IPR028009"
                     /db_xref="UniProtKB/TrEMBL:C5E1R1"
                     /translation="MAVKSSKKNGGKKLLQSRLQIGPTTNLTKCTKCGMTYSPSVIDD
                     TTTHKNYHEMHLKGKKWPATWGLGISLPSSDGSTALTPPSSSSKRGISNTKAERIVMV
                     RSDHQPEVRTTLHILDIVNDELHAPHNENEFWCRPNSNGKAFLYVKEDRAVGVITVEL
                     LKPERCRWMIYEDRSIVDGVEPRFILGVSRIWVCRTQRNKGIATKLLEAARSNTIYGK
                     TIEKWAMAWSQPTDSGGKLASHYNGVRHKSGKLLIPCYI"
     gene            51346..51418
                     /locus_tag="ZYRO0G00660r"
                     /db_xref="GeneID:8205817"
     tRNA            51346..51418
                     /locus_tag="ZYRO0G00660r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.19"
                     /db_xref="GeneID:8205817"
     gene            <51847..>52848
                     /locus_tag="ZYRO0G00682g"
                     /db_xref="GeneID:8205818"
     mRNA            <51847..>52848
                     /locus_tag="ZYRO0G00682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497993.1"
                     /db_xref="GeneID:8205818"
     CDS             51847..52848
                     /locus_tag="ZYRO0G00682g"
                     /note="similar to uniprot|P38635 Saccharomyces cerevisiae
                     YFR025C HIS2 Histidinolphosphatase catalyzes the eighth
                     step in histidine biosynthesis mutations cause histidine
                     auxotrophy and sensitivity to Cu Co and Ni salts
                     transcription is regulated by general amino acid control"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498038.1"
                     /db_xref="GeneID:8205818"
                     /db_xref="GOA:C5E1R2"
                     /db_xref="InterPro:IPR004013"
                     /db_xref="InterPro:IPR010140"
                     /db_xref="InterPro:IPR016195"
                     /db_xref="UniProtKB/TrEMBL:C5E1R2"
                     /translation="MHSHHSHSGDYVAHGVDPLEDVTSKAIEKKFHTYCLTEHMPRIN
                     AKFLYPEEQEGSIQQDAAVQRLQENFLNFLRHAKAIQDRPNASNTKFIVGTEIEGCDE
                     EHISYGKQLMAQHNDVVKFCVGSVHHIRDIPIDFDQQCWNQALMACNNNLQTMLLSYF
                     NLQYKMLTVLKPLVVGHFDIYKLYLPPTLRINPKTGDVSDESTAVPVSQVQPIHFWDS
                     VHKAVVRNLQFIESYGGLIEINTSALRKKLAEPYPGRDICELVKTYCGGRFVLSDDAH
                     AVTQVGVCYEQALKYITETLQLTQMYYLELNAQGDLSSKTLPIEQFKSNAFWGSNHL"
     gene            complement(<52966..>55011)
                     /locus_tag="ZYRO0G00704g"
                     /db_xref="GeneID:8205819"
     mRNA            complement(<52966..>55011)
                     /locus_tag="ZYRO0G00704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497994.1"
                     /db_xref="GeneID:8205819"
     CDS             complement(52966..55011)
                     /locus_tag="ZYRO0G00704g"
                     /note="highly similar to uniprot|P38708 Saccharomyces
                     cerevisiae YHR020W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498039.1"
                     /db_xref="GeneID:8205819"
                     /db_xref="GOA:C5E1R3"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004499"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR007214"
                     /db_xref="InterPro:IPR016061"
                     /db_xref="InterPro:IPR017449"
                     /db_xref="UniProtKB/TrEMBL:C5E1R3"
                     /translation="MSVENSLAHLSVEDKIVEGAIPVKSLVFKPKTAKTATPVPVVVV
                     ALQSTVTPAPLIAQSTGTKEPRLARDELFQSFFKCESAKAFTVAYLLNAESEFHLLID
                     KQLETVKDSDVLKLNDTLFITKGEFVKFLSKFESSQKVVDFSQEVSKDAGNAKKSNAA
                     TPAAAAATSAAIEDAKLIGITVDKSLDFSGWYQQILTKGEMLDYYDVSGCYILRPPSY
                     SIWESIQRWFDDRIKAMGVQNAYFPLFVSSRVLEKEKDHVEGFAPEVAWVTKAGSSDL
                     EEPVAIRPTSETVMYPYYAKWIRSYRDLPLKLNQWNSVVRWEFKHPQPFLRTREFLWQ
                     EGHTAHLTKADAEEEVLQILDHYAGVYEELLAVPVVKGRKTEKEKFAGGVFTTTVEGY
                     IPQTGRGIQGATSHHLGQNFSKMFNVSVENPLGPDHPKVNVFQNSWGLSTRVIGVMTM
                     IHSDNKGLVIPPRVSQYQAVVLPVGITKKTTEEQRAHIHSSAREIESRLKKAGVRAFG
                     DYNDNYTPGWKFAQYELKGIPLRLESGPKDIESNQVTVVRRNDFRKVTVKLDELETRI
                     PELLEELQRDLYLRAKELFDSHRVVVNEWKDFVSNLNKKNVILSPWCGVTECEEDIKE
                     SSAKRDDGEEFEQDEKAPSMGAKSLCIPFEQPELKPGQKCVKCSHPAVQYCMFGRSY"
     gene            <55274..>56932
                     /locus_tag="ZYRO0G00726g"
                     /db_xref="GeneID:8205820"
     mRNA            <55274..>56932
                     /locus_tag="ZYRO0G00726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497995.1"
                     /db_xref="GeneID:8205820"
     CDS             55274..56932
                     /locus_tag="ZYRO0G00726g"
                     /note="similar to uniprot|P38707 Saccharomyces cerevisiae
                     YHR019C DED81 Cytosolic asparaginyl-tRNA synthetase
                     required for protein synthesis catalyzes the specific
                     attachment of asparagine to its cognate tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498040.1"
                     /db_xref="GeneID:8205820"
                     /db_xref="GOA:C5E1R4"
                     /db_xref="InterPro:IPR002312"
                     /db_xref="InterPro:IPR004364"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004522"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018150"
                     /db_xref="UniProtKB/TrEMBL:C5E1R4"
                     /translation="MSVHINEKGGVDALTTVGSTEKPFQTAAFALYAQEELEHSEPKL
                     LVFKPEDNGYEEISASALKKAKKGAESLKKKALKQKELEAKKQQQEADKAAKQLEALD
                     IKIEEDKSLPQAQRVKINKAYESVGQRVKVNGWIHRIRNNKKLVFVVLRDGYGFLQAV
                     LTGNLALAKQTQELTLESSVALYGTVNKLPEGKSAPGGVELSVDYYEVVGLAPGGEDA
                     FTNKVSENADPSLLLDQRHLALRGETLSSMMKVRAIWMKCLRRFFENEGLTEVTPPCM
                     VQTQVEGGSTLFKLNYYGEEAFLTQSSQLYLETCLASLGDVYCVQESFRAEKSHTRRH
                     LSEYTHIEGELGFIDFDDLLSHLEKLFVETVGYIMEDPVGSAIVKQLNPDFKAPTYPF
                     KRLDYKDALEWLNEHGVPNEDGEKFKFGDDIAEAAERKMVDTMGVPIFLIRFPAEIKS
                     FYMPRCKDDPRVTESVDVLMPNVGEITGGSMRTWNEADLLEGYQREKIDHTPYYWYLD
                     QRKYGSVPHGGYGLGTERILAWLCNRYTVRDCSLYPRFTGRCKP"
     gene            <57164..>58552
                     /locus_tag="ZYRO0G00748g"
                     /db_xref="GeneID:8205821"
     mRNA            <57164..>58552
                     /locus_tag="ZYRO0G00748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497996.1"
                     /db_xref="GeneID:8205821"
     CDS             57164..58552
                     /locus_tag="ZYRO0G00748g"
                     /note="highly similar to uniprot|P04076 Saccharomyces
                     cerevisiae YHR018C ARG4 Argininosuccinate lyase catalyzes
                     the final step in the arginine biosynthesis pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498041.1"
                     /db_xref="GeneID:8205821"
                     /db_xref="GOA:C5E1R5"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR009049"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="InterPro:IPR029419"
                     /db_xref="UniProtKB/TrEMBL:C5E1R5"
                     /translation="MAENTQKLWGGRFTGETDPLMHLYNASLPYDWKMYRADLEGTRV
                     YTAGLNKLGLITPEELTKIHYGLGEIKKEWDEDKFVRHPNDEDIHTANERRLGEIIGR
                     DIAGKVHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKELVSVMVKRAEKEIGYLMPGY
                     THLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSPLGAGALAGHPYGIDREFL
                     AEELGFQGVIGNSLVAVSDRDFVVELMFWGTLFMNHISRFAEDLIIYSTAEFGFIKLN
                     DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLAGFLMSLKGIPSTYDKDMQEDKESL
                     FDSLTTVEHSILIATGVISTLAVNSENMVNALTVDMLATDLADYLVRKGVPFRETHHI
                     SGECVAKAENLGLSGIDKLSLEQYKTIDSRFEADLFETFNFEKSVERRDATGGTAKSA
                     ILKQLASLQSQI"
     gene            complement(<58618..>59736)
                     /locus_tag="ZYRO0G00770g"
                     /db_xref="GeneID:8205822"
     mRNA            complement(<58618..>59736)
                     /locus_tag="ZYRO0G00770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497997.1"
                     /db_xref="GeneID:8205822"
     CDS             complement(58618..59736)
                     /locus_tag="ZYRO0G00770g"
                     /note="similar to uniprot|P32792 Saccharomyces cerevisiae
                     YHR017W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498042.1"
                     /db_xref="GeneID:8205822"
                     /db_xref="InterPro:IPR013952"
                     /db_xref="UniProtKB/TrEMBL:C5E1R6"
                     /translation="MMYTRSQVTGKESMAQDIVDQVFDRVDSLYSKGSKVVSSVQDAV
                     SNTVSHIGGDPQWEAELAARSREEAGSPIVKSLSSLGSTIYRQLSGKVVIGCGFSALM
                     AILFWRKERLLGLPEHLPKNQPKCCLVLGDMHDPIIRSQVMDLYRRRFTIFVCSRDAP
                     SYREHEEDDDFLVHLDPTSSSDLANFVQSLNSTYELASILFMPNLSYHPSGEMSLSQL
                     ETEIRSNTLLYYCTLMKLLPHLPHTQLILFDPSLTYNMKVAHHPVEIIVSGIVKSLYQ
                     SLARHEKLDLYLIHLGILQLTAQPSNYKFLNLKGSNVNTALLEPVYRLIMAYNGNILR
                     RMWLWIVTFGFLNHHWYCGKYSWISTFSFITPLIKKWT"
     gene            <61277..>62797
                     /locus_tag="ZYRO0G00792g"
                     /db_xref="GeneID:8205823"
     mRNA            join(<61277..61323,61435..>62797)
                     /locus_tag="ZYRO0G00792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497998.1"
                     /db_xref="GeneID:8205823"
     CDS             join(61277..61323,61435..62797)
                     /locus_tag="ZYRO0G00792g"
                     /note="similar to Saccharomyces cerevisiae YFR024C-A LSB3
                     or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
                     YHR016C YSC84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498043.1"
                     /db_xref="GeneID:8205823"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007461"
                     /db_xref="UniProtKB/TrEMBL:C5E1R7"
                     /translation="MGLNNPVPRSLKSETKKAAKVLVSFIKPNQVLGTDQIIPPHVLK
                     KAKGLAIITVIKAGFLFSGRAGSGVIVARLPDGTWSAPSGIGMAGAGAGGLIGAELTD
                     FVFILNNQQAVDSFSRAGTLTLGGNISVAAGPLGRNAEADAAASAGGVATVFTYSKTK
                     GLFAGISVEGSAIVERKDANRKFYGASVSAKQILSGRVRPPPAADPLFRVLESRAFNF
                     RVPDESYADSFYDDIPESFDSSDADTMGPGGRSNGRRGYGRYDDDFYSSDDDFGGSSG
                     RYGRGPPPDRFDRRGDPPDRFDRYGGGSRGRRSSYDDPNGVNEYYRSQMRGRPRGGSS
                     RWDDAPSEKDRFDKGSDRYDRYGDKYDRYDRDVDDLSNRFSRSRISSGGPASSGRAPR
                     NEKAEFGAASPSAGDTFSNTPKAVALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWW
                     TGRVGGREGIFPANYVELV"
     gene            complement(<63018..>64982)
                     /locus_tag="ZYRO0G00814g"
                     /db_xref="GeneID:8205824"
     mRNA            complement(<63018..>64982)
                     /locus_tag="ZYRO0G00814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002497999.1"
                     /db_xref="GeneID:8205824"
     CDS             complement(63018..64982)
                     /locus_tag="ZYRO0G00814g"
                     /note="similar to uniprot|P39684 Saccharomyces cerevisiae
                     or to YHR015W uniprot|P38760 Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498044.1"
                     /db_xref="GeneID:8205824"
                     /db_xref="GOA:C5E1R8"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5E1R8"
                     /translation="MFNSLSLRKPNILDNISLNVPRTAELPTKGIKQERINTVIQATE
                     SFSILNENKSVSSRSSQSEFSDVVKLHGSMTQESGVATSNTNTQNGLDSQSVIESQPT
                     IALFIGDLDEQIDEEILIQIFKKFKSLTSVKVCTDAETGKSLGYGYLNFSRRQDTLAA
                     TEEFNYRPIFGKEVRIMPSLRNTFYRKNIGTNIFFSNLPLENSNLTTRVFYDTFKVYG
                     NILSCKLDKRKNIGFIYFDNDHAARVVIKEFNGSEFFGNKILCGIHFDKELRKFPEFE
                     KRKSSLNDITIPKEQLTLGPTDAKTVEHDSTQHLPHPNAIFVKNLPPSCPDDEILDYF
                     SNLGPVKSVFSSTSHKYESSWAFVTYKKGSDTNKAVKIYHGAQFKGRKLSVIKAESAR
                     NGHGSYNKQSSKISYRPILYLQNLSSVCNEQFLLQMCMEERIKIENLGITDFFHDSFT
                     YSGYVKCKSKKDADKILKLLNNRLIGGCEVKITRKKLNNNNGNSSIPVIDVYHSKNQS
                     KSPKHSTYNGLSKQPQVHLQSAIFPMPIYSAPTPTPGAGPMYYPQPMVLTPKIATFNS
                     SKETDEQLSQILKYLRRQVKKGIDFLRYPTATNDENLLRITNYIFEHYWHCDLNQLTK
                     FLLLMNANTQNESILNNHIEQTAKHLGFER"
     gene            complement(<65269..>67377)
                     /locus_tag="ZYRO0G00836g"
                     /db_xref="GeneID:8205825"
     mRNA            complement(<65269..>67377)
                     /locus_tag="ZYRO0G00836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498000.1"
                     /db_xref="GeneID:8205825"
     CDS             complement(65269..67377)
                     /locus_tag="ZYRO0G00836g"
                     /note="similar to uniprot|P40215 Saccharomyces cerevisiae
                     YMR145C NDE1 Mitochondrial external NADH dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498045.1"
                     /db_xref="GeneID:8205825"
                     /db_xref="GOA:C5E1R9"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C5E1R9"
                     /translation="MLTRLIAAKGLPRLTNRFTKPISTGTHSNSIVRRCMPHHKGSVA
                     GKTVFERQFHSSRTAFNDKQQDTIGNNVSRGSIFSNGIGKLVQFTVMGAGVLALTCGG
                     ALFIFFIYDSTTYKESYVPDAIEVPNEALHPPSGGPENLPIFSEKLDNYDDETKQLTS
                     YKPKLVILGSGWASVGLLKNLKKGDYDVTVISPQNYFLFTPLLPSAATGTLEIKSLMA
                     SIRKIVGDISGHYLEAKAEKIEFEDKLVKVSQVLQRGGEIRSFYVPYDKLVIAVGSTA
                     NTHGVEGLEYCDRLKSAEDALNIKKKIKGNLEISCLPTTTEEERKKLLSFVVCGGGPT
                     GVEFAAEVFDLLNEDLPRSYPRVLRQQVSVHIIQSRSHILNTYDEKISEYAMERFKKE
                     SIDLLTNARVERILPDKVVFNQKNPETDEMEYKELPFGLCLWSTGVAQNPLAKHVVQS
                     FQNNQRNKRAIETDSQLRVVGNPAKDVYAIGDCSTVRTDLAENTVNYMRNFIIKKDIG
                     AHQNSAIITDGDVRNISLSYDEIRALCRQVARLHPQTRESFVDLDDFLPRYDPENKGS
                     LNFEQLSTLLKETEAKVTSLPATAQRAHQQGSYLGKKFTKLARYTNDYIRSGQPVPAE
                     LEDGTCKPFKYVHLGSLAYIGNSAVFDLPGYSFVGGLIAMYLWRGAYFVQTVSLRTRV
                     LLFMDWLKRGLFGRDFIDTS"
     STS             66817..67769
                     /standard_name="ha2564"
                     /db_xref="UniSTS:515562"
     gene            complement(67767..67838)
                     /locus_tag="ZYRO0G00858r"
                     /db_xref="GeneID:8205826"
     tRNA            complement(67767..67838)
                     /locus_tag="ZYRO0G00858r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=73.86"
                     /db_xref="GeneID:8205826"
     gene            complement(68223..68295)
                     /locus_tag="ZYRO0G00880r"
                     /db_xref="GeneID:8205827"
     tRNA            complement(68223..68295)
                     /locus_tag="ZYRO0G00880r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.19"
                     /db_xref="GeneID:8205827"
     gene            <68991..>69485
                     /locus_tag="ZYRO0G00902g"
                     /db_xref="GeneID:8205828"
     mRNA            <68991..>69485
                     /locus_tag="ZYRO0G00902g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498001.1"
                     /db_xref="GeneID:8205828"
     CDS             68991..69485
                     /locus_tag="ZYRO0G00902g"
                     /note="similar to uniprot|Q75BF8 Ashbya gossypii ADL396W
                     ADL396Wp and weakly similar to YNL246W uniprot|P53853
                     Saccharomyces cerevisiae YNL246W VPS75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498046.1"
                     /db_xref="GeneID:8205828"
                     /db_xref="GOA:C5E1S0"
                     /db_xref="InterPro:IPR002164"
                     /db_xref="UniProtKB/TrEMBL:C5E1S0"
                     /translation="MPHYEERDGIIAKIPNFWKIVLSQHDDFANYVRASDFKYIDAIQ
                     FLVVKWQSPRDFDIIVGFQSVDQELPSQTVKKHFYHDGDEMKSQAVELKHNLPPRKRR
                     NRFFDWFQWQGLDDKGEFPNGDELARLIADEIYPLCVKFYTEAQRDVADEDSDEESSE
                     PELL"
     gene            complement(<69728..>72070)
                     /locus_tag="ZYRO0G00924g"
                     /db_xref="GeneID:8205829"
     mRNA            complement(<69728..>72070)
                     /locus_tag="ZYRO0G00924g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498002.1"
                     /db_xref="GeneID:8205829"
     CDS             complement(69728..72070)
                     /locus_tag="ZYRO0G00924g"
                     /note="similar to uniprot|Q759V0 Ashbya gossypii ADR172C
                     ADR172Cp and weakly similar to YOR018W uniprot|Q02805
                     Saccharomyces cerevisiae YOR018W ROD1 Membrane protein
                     overexpression confers resistance to the GST substrate
                     o-dinitrobenzene as well as to zinc and calcium contains a
                     PY-motif which is required for Rod1p interaction with
                     Rsp5p a hect-type ubiquitin ligase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498047.1"
                     /db_xref="GeneID:8205829"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5E1S1"
                     /translation="MFPLAKSNKAEPLLYDVRLHGTEHDVVLLKGSPDEASSVLLSGT
                     VVLSVREPIQIKNLSLKMTGKIRLNVPVQYQGPRGPAQRHVRYERTFYEHTWDNLNIN
                     SYFENLYDNYGKRATINSKSSGNLADLHRRSKSSTSSLISLAGLGSSSGSHNHHHHHT
                     LLQGNYEFPFSAILPGSLVESVEGLPNASITYKLEANIERNKFYSDLICKKHIRVVRT
                     LSTDAVELSETMAVDNTWPNKVDYSISVPAKAIAIGSLTPIHIEVVPLMKGLRLGPIK
                     VTMIENSQYCGSFGNVATQERTVCKTKLKDPLGHVNRGPRDPEEEELTFQDRWQVDTF
                     LQVPTSLSRCTQDCTLLNSIKVRHKLKFVISLINSDGHVSELRASLPAQLFISPFVAL
                     TVRNPLRPEYENGNGSSSSSRRTSLGDEEGDEDVIFAKTASELELANLINNWQVPSSV
                     PDLMSPPNYESHIYDRLWNDVSVPDTPHGSGTQTPIEGQSIGQVLDSQQNVDELEDNL
                     MRLHLQRQEGRNRSASTSNVIPGNPAKNPQETTIEGASNGNANAAVVPAATSPAQQAL
                     PMSRSGSAPLVDQQPGIRGLPPAPLVTSGASVQHLSRSSSSILQIPQSPNKEVTLDNL
                     SSVPSYEKAIKSESAGNDLPPVYPADENPSHDRKHHLERPQVVHHRSSSSLLSKKSNS
                     SIPSPQPSQAALVRRGSSSSSSGIPPPLQPHADSPSNGPAHNGKNQTVNKHFSFGMTP
                     VGSSSSTGSFPLKRSLSKGSLHERSSSLNNLRSLLKNHKK"
     gene            complement(<72544..>74184)
                     /locus_tag="ZYRO0G00946g"
                     /db_xref="GeneID:8205830"
     mRNA            complement(<72544..>74184)
                     /locus_tag="ZYRO0G00946g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498003.1"
                     /db_xref="GeneID:8205830"
     CDS             complement(72544..74184)
                     /locus_tag="ZYRO0G00946g"
                     /note="similar to uniprot|P43601 Saccharomyces cerevisiae
                     YFR021W ATG18 Phosphatidylinositol 3
                     5-bisphosphate-binding protein of the vacuolar membrane
                     predicted to fold as a seven-bladed beta-propeller
                     required for recycling of Atg9p through the
                     pre-autophagosomal structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498048.1"
                     /db_xref="GeneID:8205830"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E1S2"
                     /translation="MPDTLPFINFINFNQTGTCISLGTSQGFKIFNCDPFGKFYSEES
                     GSYAVVEMLFSTSLLAVVGIGDQPSMSPRRLRIINTKKHSIICEVTFPTSILSVKMNK
                     SRLVVLLQEQIYIYDISNMRLLHTIDTNPNTRGIMAMSPSLENCYLVYPSPPKVINSE
                     IKTNATTNNINVTSTSGSIPQLQHQHQHQFDSSTGPAEDGLDPSSGDIPIQEELQSDP
                     QNKKSGSGNVIKNGDVILFNLKTLQPTMVIEAHKGEIASLALSLDGSLLATASEKGTI
                     IRVFNVETGIKINQFRRGTYPTKIHSMCFSEDNQFLAATCSSKTIHIFKVAPANGRQS
                     EVHLEKHDSDDSTIEEDVIDNASQTNSSVGGGGGGSGGNESIDEISSNADDQSSLERS
                     REPYVDASRRTVARMIRKSSQRLSRHAAKTLGQIFPIKVSSLLEPSRHFASLKLPVES
                     GHGIKSITAIGTPIEVDISEYPELFEYHQQPHTQEESNPAQQLNQQQQNLQNFENTSV
                     QMLPIRVVTSEGYLYNYVLDPERGGDCLLLSQYSLMLA"
     gene            74705..74805
                     /locus_tag="ZYRO0G00968r"
                     /db_xref="GeneID:8205831"
     tRNA            join(74705..74741,74761..74805)
                     /locus_tag="ZYRO0G00968r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (GCT) cove"
                     /db_xref="GeneID:8205831"
     gene            complement(<74957..>81352)
                     /locus_tag="ZYRO0G00990g"
                     /db_xref="GeneID:8205832"
     mRNA            complement(<74957..>81352)
                     /locus_tag="ZYRO0G00990g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498004.1"
                     /db_xref="GeneID:8205832"
     CDS             complement(74957..81352)
                     /locus_tag="ZYRO0G00990g"
                     /note="similar to uniprot|P34756 Saccharomyces cerevisiae
                     YFR019W FAB1 1-phosphatidylinositol-3-phosphate 5-kinase
                     vacuolar membrane kinase that generates
                     phosphatidylinositol (3 5)P2 which is involved in vacuolar
                     sorting and homeostasis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498049.1"
                     /db_xref="GeneID:8205832"
                     /db_xref="GOA:C5E1S3"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR002498"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027483"
                     /db_xref="InterPro:IPR027484"
                     /db_xref="UniProtKB/TrEMBL:C5E1S3"
                     /translation="MSEPSNELVSLTQKVPAAVKPGPDKPEFLATQALIPRTTTDLDT
                     NPVLSNISLPQELSKNGNLPLQDAGMESSAAAAAAVAAAEKKKSGSSSSSNANHDDID
                     CYNGNDIDGYNGNDIEGYNGSNNIKLELDNREKATRGIHSMGNQVRSPLSKSDRGING
                     RSLTFSINNDANFKRSSIYESKSTVTAVPIRNPVTGAKQHYGDNDDASSSKSVSSSMT
                     KSFLFGFYNNQKKNENPTKGILSKQYWMKDDSAKECFTCGKAFTTFRRRHHCRICGQI
                     FCSGCTLLISGERFGYDKRMRVCKNCYQHADNYEDSSDEDSYGEQNSPHNDYNSAVQE
                     ASPDRWSGDSVPPSPGLGLANHNPLMKQTDLFMMNDEDVKSIVTTAEDTKLFVSTPPP
                     PPKMAIPATRQGESLEISFPSHRNENTLDNQHMESAGSTGKDRYTIKDVDMLTPYDLQ
                     YGSSSQLPGRSANKNVKNSLRRSVFNYVNSSRHSLDKPSSSGSADSIIGNLGSKNFKF
                     EFNYMKNARRPSSGSTKRDVNWLNHVQNEQEETGSSVSLQDDDTSEDEASMSIYSSLN
                     DPFHSKNPIRSMRNSTKSLQRAEASLQRMRFRRKSKSRPNNKDSDSIYKGLNVLTHST
                     PNLVSVVDEDNAFGSQNGGSGGSSILAKPKNKLGNAGQWRRISSMAGLKVPKEKKNEL
                     NQVARLHMEALLEQVMHDQNFETTEFWTPLLKDFLRKVQDIDLSARDSNTLDFRQNCV
                     KIKRVTGGGISSSEYINGIVFSKALPCKTMPRRLENPRILLIMFPLEYQRNENHFLSI
                     ETVFAQEQEYLDKLVSRLVSLSPDIVFVGANVSGYALELLNKVGVVVQFNVKPQVMER
                     ISKLTEADIAISVDKLAANVKMGECEEFEVKTYIYGNVSKTYTFLRGCNPSFGGTILL
                     RGDSQEVLRKVKDVTEFMVYVLFSLKLESSFFNDNFLQLPPTYYINERKRKEELEYTG
                     YFADFLAKFNSRILTISPTVEFPVPFLLQRARELEQELLDKRRRHELLLQKDNTEDDP
                     RIKALGLASKLTQRDLKYLIRFLHEKEIKALELQFQKRSRHWELSYAQSHNLLGTGSH
                     QCITVLYSMVSTKTATPCIGPQLVTIDYFWDSDISVGQFIENVIATASYPCRQGCGGL
                     LIDHYRSYVHGSGKVDVLIEKFQTRLPKLKDIILTWSYCKKCGTSTPILQMSEKTWNY
                     SFGKYLEVMFWSNNKGVTGIGNCTHDFTKEHVKYFGYNDLVARMEYSDLEVHELITPQ
                     RRIIWAPYKDIKMKVELYYQILDKINSFYDSVSTRLTRVKLDSMDGDKLLAGQDKLEE
                     LKERVDDEKKAVLEELETLYQDSPGDQHIKLNVIIKALHEKVVSWDTEFTEFGKKFLP
                     SENDITRITSNQLKKLFTDFNKTQETKSQHSKDHDKSFEMEDFHGSQNEKEKNFEKDK
                     TNLSAFNGTQTTTNDPEDSGKTKNDSSFSLPNSRRLDSNDSTGSHANRFTRPSLRKTS
                     SINSAGINNNDLRRSSLNSSLSGDSFLTREHRTKTKVGELANFFDQMHFDALSKEFEL
                     QREKERVQLNRNKYQASRLHQSTPIVEIYKNVKDAVDEPLHDQNKRSNREGLTKSKNE
                     SHDKNSSKASTQTQFDQKLESQLENSIYQWGESVFHKGDSGKKERIDPELTSNAILNG
                     GKEGITAAAAPPALTIANANKDEVSTQPEKSLLMKALTNFWADRSASLWKPLNYPTHP
                     TEHIFVDSDVIIREDEPSSLIAFCLSTSDYKQKMAKLDSQQPINVAPPENSQTPDVSF
                     SEMESQKSDDTYRNTSQIHPSKERFSSVTPDDAQTQPPNLQQLPRDENEILEAIMTKK
                     TAVHLRYQFEDSLSVMSCKIFFAEHFDAFRRICGCNEQFVQSLSRCVKWDSSGGKSGS
                     GFLKTLDDRFIVKELSHAELDAFIKFAPSYFEYMAQAMFHDLPTALAKAFGFYQIQVK
                     SSISGSKNYKMDVIIMENLFYEKNPSRIFDLKGSMRNRHVEQTGKENQVLLDENMVEY
                     IYESPIHVREYDKKLLRASLWNDTLFLAKINVMDYSLVVGIDNNGHTLTVGIVDFIRT
                     FTWDKKLENWVKEKSIVGGNSIKKPTVVTPKQYKSRFREAMERYILMVPDPWYQENA"
     gene            <81774..>82742
                     /locus_tag="ZYRO0G01012g"
                     /db_xref="GeneID:8205833"
     mRNA            <81774..>82742
                     /locus_tag="ZYRO0G01012g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498005.1"
                     /db_xref="GeneID:8205833"
     CDS             81774..82742
                     /locus_tag="ZYRO0G01012g"
                     /note="similar to uniprot|P43599 Saccharomyces cerevisiae
                     YFR018C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498050.1"
                     /db_xref="GeneID:8205833"
                     /db_xref="InterPro:IPR007484"
                     /db_xref="UniProtKB/TrEMBL:C5E1S4"
                     /translation="MIRTLIWLLIWALATQGLIDYRDYHDEFLPRFLSLENASDDNLL
                     LPFNTTRTPGSKESLEIQKLIKNFYDGLESPWELEEDSFENKGLNFNNLVYTLGANSS
                     SYVVLSAHYDSKVEPEGFIGATDSAASCAILLYVSRFLDAFYQNGNSSLSDEKNGDVG
                     FKIVFFDGEESLKQWTAEDSLYGSRHLASKWIEQGLIDKIHLFVLLDLLGSNPAPIRS
                     YFRETHEAYERLASLESTLFKSPPQLDPMDHSILQLNGPSIDDDHIPFYRAGVPVLHL
                     IPWPFPSFWHTLQDDFNHLQQNEIDKWAVLLSEFLVEESSGFADRL"
     gene            <82897..>84528
                     /locus_tag="ZYRO0G01034g"
                     /db_xref="GeneID:8205834"
     mRNA            <82897..>84528
                     /locus_tag="ZYRO0G01034g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498006.1"
                     /db_xref="GeneID:8205834"
     CDS             82897..84528
                     /locus_tag="ZYRO0G01034g"
                     /note="some similarities with uniprot|Q92325 Saccharomyces
                     cerevisiae YOL025W LAG2 affects longevity involved in
                     determination of longevity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498051.1"
                     /db_xref="GeneID:8205834"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E1S5"
                     /translation="MDVQSVVKQYRATEDNDLKYMALKEELSPLDVCENLQNYVDQLL
                     IPILMEEANAEIVNLVSLQVFPYAVELCLINDKSGPWFDDIVVNPLIEKMVSARTTIA
                     IQTLKTVSRKICERRIRLGTRPQLIEEFLQKCDDTVLSVEALYYLIQCYYDMHRGVPP
                     PIIDQILKLARSGPQDDTTRLLIRESLSRANLDAILQVKTQLNLQELEFASECWWRFA
                     PIFIDIFHLQLLPSLSNHETRASALRTLLNFQPFYTIKRLDDDTLLGRNNEKLLIQSL
                     QEIDQELSRTAPETPDKNHEQEADSDSDSDPEQTAYLAELPSDEEIEFENEVEGPAEP
                     LPRETNIRNICQEILTKLKANFDSSPLSSTYEPLPSILNKLFKREEEDLLSLSQLQAA
                     LETLSQLASVRPTPNLPWSQICQDLVLPRIVLDKTFVQKLKAGNLTQSIDEGATLRAS
                     AQSTLQQLLPLIDFKTICIMLEYELKNGIQDKDSGVKQLAAELVHSLLSTHYSEIIGL
                     QWQWYAALLKEEEDPRDLAAQALRTSLREDYPAVG"
     gene            <84782..>85069
                     /locus_tag="ZYRO0G01056g"
                     /db_xref="GeneID:8205835"
     mRNA            <84782..>85069
                     /locus_tag="ZYRO0G01056g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498007.1"
                     /db_xref="GeneID:8205835"
     CDS             84782..85069
                     /locus_tag="ZYRO0G01056g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498052.1"
                     /db_xref="GeneID:8205835"
                     /db_xref="UniProtKB/TrEMBL:C5E1S6"
                     /translation="MVSNTRNPIEEHPDMTMSEDFLSMEDPPAAKEMDFQWRPPSSGQ
                     QMDEQLPEEDSSQTKVRARRGAPDFKRRPSFEYEDYKKNAYNRLSIFDHQH"
     gene            <85279..>87249
                     /locus_tag="ZYRO0G01078g"
                     /db_xref="GeneID:8205836"
     mRNA            <85279..>87249
                     /locus_tag="ZYRO0G01078g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498008.1"
                     /db_xref="GeneID:8205836"
     CDS             85279..87249
                     /locus_tag="ZYRO0G01078g"
                     /note="similar to uniprot|P25038 Saccharomyces cerevisiae
                     YOL023W IFM1 Mitochondrial translation initiation factor
                     2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498053.1"
                     /db_xref="GeneID:8205836"
                     /db_xref="GOA:C5E1S7"
                     /db_xref="InterPro:IPR000178"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006847"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR015760"
                     /db_xref="InterPro:IPR023115"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E1S7"
                     /translation="MWRLAQSGRLQSGFLLGVRRYAKPSKKASTTISNSLKKLNFVIP
                     NYISVNKLSNLLNCRSERLVKDLTGLGFANVTQNYILSRDYVELILQEYNYELPASRK
                     QLNAQTVYDELKSPVNPKLLQKRPPVVTIMGHVDHGKTTIIDHLRKSSVVSQEHGGIT
                     QHIGAFQVVTPVSKKKITFLDTPGHAAFLKMRERGANITDIIVLVVSVEDSIMPQTIE
                     AIKHAKNSGNETIIAITKIDKIKQPRERERALERVTADLIAHDIQLEQVGGDVQVVPL
                     SARSGENMDLLEESIVLLSDVMDIRAEDSNKVAAEGWVLESQVKKSVGIVATVLLKKG
                     CLQKGNILVCGNTYCRVRNLLDSAGRPVTKAMPADAVEVLGWKEIPEAGDQVIQAKNE
                     AQAKKYNAKRIALLEVEEQAINVEKLNLERGLKRDEDDAQDENEDGEDIDSTKQELGP
                     KKVNFIVKADVSGSAEAIKESIASLGNEEVVCNVVSSSVGPPAESDLKMAQITDSKIL
                     CFNLGSLPTEVINNRKGVDIRQYNVIYKLIEDVTQVLTDNLKPIYETKHVAQIDVREI
                     FEFTLKKKVIKIAGCRVENGKIFRNSTVQILRNDQVIFDGKLATLKQGKDDTLEVTKG
                     NECGITFEKGFEDYEAGDKIMVYERQRVPRYL"
     gene            complement(<87284..>88486)
                     /locus_tag="ZYRO0G01100g"
                     /db_xref="GeneID:8205837"
     mRNA            complement(<87284..>88486)
                     /locus_tag="ZYRO0G01100g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498009.1"
                     /db_xref="GeneID:8205837"
     CDS             complement(87284..88486)
                     /locus_tag="ZYRO0G01100g"
                     /note="similar to uniprot|P25040 Saccharomyces cerevisiae
                     YOL022C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498054.1"
                     /db_xref="GeneID:8205837"
                     /db_xref="GOA:C5E1S8"
                     /db_xref="InterPro:IPR007320"
                     /db_xref="UniProtKB/TrEMBL:C5E1S8"
                     /translation="MSLSASDDENFADKTSQVYLGFVDTPVKEEDDISIEDTFIGGEP
                     KWLHPDSKPNDDFLKCGACKSKDNMRLLLQAFAPLDYDQMEDLQSLSGLKNMRYINPD
                     DDRVLYVFICTKCPRKANSVRCIRGVKKNRPQTGSQKISDKMASLSVEKEFNINPFDT
                     SKSNPNPFGGNPFGQSSENPFSAPTSATNNDSKKEKADTDDQQISAKTARKMHENLKD
                     KQFDSTRSFKSYLLYVEEESFKNKKPDHLKLPKNLKIDKNALELTGESESNLEKNPIK
                     LDPRTEKLSKFLDDETFQKFQEIVGYNPGQVLRYDLGGKPLLYVDTKVDLINTVANPG
                     YNPSSKRIFEMQLMPKMIIDLEEEVSLLDSMEWGTIMIFTDLENYVPQFDDNDVGYVE
                     ECVRVQWE"
     gene            88664..88734
                     /locus_tag="ZYRO0G01122r"
                     /db_xref="GeneID:8205838"
     tRNA            88664..88734
                     /locus_tag="ZYRO0G01122r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.56"
                     /db_xref="GeneID:8205838"
     gene            <89341..>91599
                     /locus_tag="ZYRO0G01144g"
                     /db_xref="GeneID:8205839"
     mRNA            <89341..>91599
                     /locus_tag="ZYRO0G01144g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498010.1"
                     /db_xref="GeneID:8205839"
     CDS             89341..91599
                     /locus_tag="ZYRO0G01144g"
                     /note="highly similar to uniprot|P43535 Saccharomyces
                     cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
                     kinase activity forms a complex with Gcn1p proposed to
                     stimulate Gcn2p activation by an uncharged tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498055.1"
                     /db_xref="GeneID:8205839"
                     /db_xref="GOA:C5E1S9"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E1S9"
                     /translation="MATIGSQVRSAAGSLDPVVTDYAVGYLNHLSNITFDAVQSKQVD
                     LSTEVDFISNLLLDAGATNEKVKQLSENVLDRLNQQLDENRAKLEVTGDTSRRLLDIN
                     VLQSHNGKANIDTSLNMLGVNGDIEHTGRKMDTRVDLKKLAKAEQKIAKKVAKRNNKF
                     VKYEASKLIAPQKEEDYDSFFLKINPLELGAGAGKSKDIHIDTFDLYVGDGQRILSDS
                     RLTLSSGHRYGLVGQNGIGKSTLLKALSRRELNVPKHISILHVEQEIKGDETQALQSV
                     LDADVWRKQLLGEESKINERLQEIEKLRTEFEEDSLEVKKLDNEQADLDNRLQQIAER
                     LVDMESDKAESRAASILYGLGFSQEAQKLPTNSFSGGWRMRLSLARALFCQPDLLLLD
                     EPSNMLDVPSIAYLSEYLKSYPSTILVVSHDRAFLNEVATDIIYQHNERLDYYRGQDF
                     DTFYATKEERRKNAQREYDNQMAYRKHLQEFIDKYRYNAAKSQEAQSRIKKLEKLPVL
                     EPPEGEKSVSFKFPECSKLSPPIIQLQDVTFGYNENNLLLKDVNLDVQLNSRIALVGA
                     NGCGKTTLLKIMMETLTPLKGYVSRNPRLRLGYFAQHHVDAMDLNASAVEWMSKTFPG
                     RSDEEYRRHLGSFGITGSLGLQRMELLSGGQKSRVAFAALCLNNPHVLILDEPSNHLD
                     TSGIDALVDALKNFTGGVLMVSHDISVINSVCNEIWVSEDGSARRFEGTIHDYKKYIL
                     ESADKQGVVKRQ"
     gene            complement(<91672..>94653)
                     /locus_tag="ZYRO0G01166g"
                     /db_xref="GeneID:8205840"
     mRNA            complement(<91672..>94653)
                     /locus_tag="ZYRO0G01166g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498011.1"
                     /db_xref="GeneID:8205840"
     CDS             complement(91672..94653)
                     /locus_tag="ZYRO0G01166g"
                     /note="highly similar to uniprot|Q08162 Saccharomyces
                     cerevisiae YOL021C DIS3 Nucleolar exosome component
                     involved in rRNA processing and RNA degradation binds
                     Gsp1p/Ran and enhances the GEF activity of Srm1p
                     implicated in mitotic control homologous to the E. coli
                     RNase R of the RNase II family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498056.1"
                     /db_xref="GeneID:8205840"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5E1T0"
                     /translation="MSVAAALPKRKRLSEGLTVTQKVFVRSRNGRASKIVREHYLRKD
                     IPCLSRACDKCPEIVVPDAKSELPSFVLSESPLELPSIGKHYVVLDTNVILQAIDLLE
                     NPDCFSDVIVPQIVLEEVRNKSYPVYTRLRSLTKNSDDKKRFIVFHNEFNEFTFIDRL
                     PEESINDRNDRAIRKACQWYGEHLEPYGIKIVLVTNDRLNRDAADKSKDSFISMSLFD
                     YVQALPNGDEIKDSIPNFEVSSENTKDTEAKSEFTYPEYYSTSRIMGGLKNGALFQGN
                     IQISEYNFLEGSINLPNFSKPVLIVGPKNLNRAFNGDQVVVELLPQSEWKAPSSIALD
                     SEHFDVNDNADIDGDDDNSQVVLSDKQRKLLTQDAILAQKSNKVQPTARVVSITRRSW
                     RQYVGQIAPNSVDAQNGGTQNVFVILMDKCLPKIRIRTRRAHELLSQRIVISVDSWPE
                     THKYPLGHFVRNLGEVESVQAETEALLLEHDVEYRPFSKKVLECLPPEGHDWKAPETL
                     DDASAVSKDPLLPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVT
                     HFVKPNTALDGEGASRGTSVYLVDKRIDMLPMLLGTDLCSLKPYVDRFAFSVLWELNE
                     NADIVNVDFAKSVIKSREAFSYEQAQLRIDDPNQQDELTHGMRALLKLSIKLKEKRIN
                     AGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKIYDSFPQ
                     TAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKDPYFNTLVR
                     IMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGY
                     EPLDLSHRDKNRMDMICKNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKVL
                     NNGIVVLVPKFGVEGLIRLENLTKDTGSASFDEVEFKLSFTQATTGKRRDVHVFEKVD
                     VQVRSVLDQVTSKRKAELLLI"
     gene            <95655..>97239
                     /locus_tag="ZYRO0G01188g"
                     /db_xref="GeneID:8205841"
     mRNA            join(<95655..95676,95759..>97239)
                     /locus_tag="ZYRO0G01188g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498012.1"
                     /db_xref="GeneID:8205841"
     CDS             join(95655..95676,95759..97239)
                     /locus_tag="ZYRO0G01188g"
                     /note="highly similar to uniprot|P43593 Saccharomyces
                     cerevisiae YFR010W UBP6 Ubiquitin-specific protease
                     situated in the base subcomplex of the 26S proteasome
                     releases free ubiquitin from branched polyubiquitin chains
                     deletion causes hypersensitivity to cycloheximide and
                     other toxic compounds"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498057.1"
                     /db_xref="GeneID:8205841"
                     /db_xref="GOA:C5E1T1"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5E1T1"
                     /translation="MSDSKLEFNIKHAGKSYPISLGNNATAGELKSCVEDLTKVPLSR
                     QKYMVKGGLVDDSAKLVDVIKPGSTLMLLGTADAGLVSKPAEKNQFIEDLAPEEQLQR
                     SSDLPIGFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKI
                     VLELQRCFQNLKNKSFKSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLF
                     HSLSVVFGDKFEDEFSINFKTTTTDSANENDVSVKEESDTKLQCHISSNTNFLKNGLV
                     ESLHETIEKRSEFTGANSKYVVDKQITRLPKYLTVQYVRFFWKRSTGKKSKILRKVSF
                     PFQLDVSDMLTPEYMKEKIKVRDEFRRIEKEKAEKDRDSKRRKIDSSNGSNLSSMTPR
                     ERYETEQALAQSEREHWEAEFKKHTPSEVTEGENPSSLYELVGVITHQGANSESGHYQ
                     SFIRDDYDEDKWYKFNDDKVSVVDKEKIESLSGGGESDSALILIYKGFGL"
     gene            complement(<97365..>97826)
                     /locus_tag="ZYRO0G01210g"
                     /db_xref="GeneID:8205842"
     mRNA            complement(<97365..>97826)
                     /locus_tag="ZYRO0G01210g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498013.1"
                     /db_xref="GeneID:8205842"
     CDS             complement(97365..97826)
                     /locus_tag="ZYRO0G01210g"
                     /note="similar to uniprot|P43594 Saccharomyces cerevisiae
                     YFR011C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498058.1"
                     /db_xref="GeneID:8205842"
                     /db_xref="InterPro:IPR012471"
                     /db_xref="UniProtKB/TrEMBL:C5E1T2"
                     /translation="MGSTTSKPSETRVFQPKTPVDFSETLLSQLESSNETNFTRKQLG
                     ERFVEQRVANRLSELEEETLKKFENKLDESLIKKDDEESPLTSQLLNEKVSSLDQKLA
                     ALKEKDDQKHSKFANHPARQQLTTCLLDNKGKPLNCYNQIENFKKLVEENS"
     gene            98626..98697
                     /locus_tag="ZYRO0G01232r"
                     /db_xref="GeneID:8205843"
     tRNA            98626..98697
                     /locus_tag="ZYRO0G01232r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove score=66.07"
                     /db_xref="GeneID:8205843"
     gene            complement(99245..99317)
                     /locus_tag="ZYRO0G01254r"
                     /db_xref="GeneID:8205844"
     tRNA            complement(99245..99317)
                     /locus_tag="ZYRO0G01254r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8205844"
     gene            <99814..>100350
                     /locus_tag="ZYRO0G01276g"
                     /db_xref="GeneID:8205845"
     mRNA            <99814..>100350
                     /locus_tag="ZYRO0G01276g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498014.1"
                     /db_xref="GeneID:8205845"
     CDS             99814..100350
                     /locus_tag="ZYRO0G01276g"
                     /note="similar to uniprot|Q03677 Saccharomyces cerevisiae
                     YMR009W ADI1 Predicted acireductone dioxygenease of the
                     methionine salvage pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498059.1"
                     /db_xref="GeneID:8205845"
                     /db_xref="GOA:C5E1T3"
                     /db_xref="InterPro:IPR004313"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR027496"
                     /db_xref="UniProtKB/TrEMBL:C5E1T3"
                     /translation="MVATYFFDDNNSVDFREPHYSGQDVTLEHLGKLGVLYKYLPSQS
                     DVDSLAEERAYKNRDVVNLSPASFANDEEKLLEKLNVFYKEHLHEDEEIRYCLDGSGY
                     FDIKDSTIDQWIRVRLDKHDLLIVPAGIFHRFTVTTDNYIKALRLFQDEPKWQAINKP
                     EADQNPVRKNYLATLQSA"
     gene            <100648..>101946
                     /locus_tag="ZYRO0G01298g"
                     /db_xref="GeneID:8205846"
     mRNA            <100648..>101946
                     /locus_tag="ZYRO0G01298g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498015.1"
                     /db_xref="GeneID:8205846"
     CDS             100648..101946
                     /locus_tag="ZYRO0G01298g"
                     /note="similar to uniprot|Q03687 YMR010W Saccharomyces
                     cerevisiae Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498060.1"
                     /db_xref="GeneID:8205846"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C5E1T4"
                     /translation="MDAAVSSSTLLSRSVTTVASSMVSASTSASPSESILSTLASASA
                     SATADAVAAVAEGVPVPAPHANSGDILSSYLPRVDQFYIPEWLTMQFVANNLVSFTPL
                     FSYGTTILSIERSKTALGFSIDICATMMIASILRISYYLITPYEITLLRQSIVMIFIQ
                     LILLRTTLLYRPEEYKYHNLHDVESFSQLIRNVWYEYFACSKPPFFSKDWRLMLRSLS
                     FKHLTGFLYKCLLMACYKVLKFFDPSYKRFKSFWQWDDESKFWKFLVYFASFQLFLTF
                     IISKVLNWESLSTWIGSVIGSLGLLIESLLPLPQIAILYKLKSVQGFKLILLISWFCG
                     DTLKITYLIFGASNISVIFLLFALFQMTLDFYIGGQYIYYRYYYPSLRNRREAPLRDE
                     EENGEIIELENFKMNNSDLELQTPPPHQHGRVRSHSLMGQ"
     gene            complement(<102166..>104355)
                     /locus_tag="ZYRO0G01320g"
                     /db_xref="GeneID:8205847"
     mRNA            complement(<102166..>104355)
                     /locus_tag="ZYRO0G01320g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498016.1"
                     /db_xref="GeneID:8205847"
     CDS             complement(102166..104355)
                     /locus_tag="ZYRO0G01320g"
                     /note="weakly similar to uniprot|P32606 YOR017W
                     Saccharomyces cerevisiae PET127 Protein with a role in
                     mitochondrial RNA stability and/or processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498061.1"
                     /db_xref="GeneID:8205847"
                     /db_xref="InterPro:IPR013943"
                     /db_xref="UniProtKB/TrEMBL:C5E1T5"
                     /translation="MRCTETTGILEDYQPIICLVSPLWPLSSMYRTSLFRTRYFYRGH
                     SFARSKLRRKPAKRYVINPDSDKGSSSANIPDASIVASVNNVQQMSVDPENGQFLGTK
                     NDKSLVKTKPPRLTHDLARVLYQPLTLHQLQDSRTGVYNFEPELEMIAPDMLEPKDDG
                     ELPFITPHKDETLHRMAKISKSEYVSSTSSMTSSLSQLHFLLSGFRPLNAVDLPLSRR
                     FPDKHLTYTQGAKLPASFILRKLDDKVTSIDSDKSLDREIVLSILGHSLEEFLTDRAQ
                     SQPESYHYSQVDSFLLRSQLDAYDSKLPGTGVFDLKTRAVAAIRHDLSFVESNNNYTG
                     YEIDRVFGEFESLEREFFELVRSTLLKYSLQARIGKMDGIFVAYHNIARMFGFQYLPL
                     EDLDFIIHSCYDSKFNFALSSKNHDLRSIYGDQVFFTQQQRDARKVASAVADKEFKIS
                     IHLFKNILMHVKNLLNSKGIKNWQKCKIMMQTVTSKDTNGSKSLRSVEKPVLKVVAVP
                     LPDDYEDKPLLTKDMDNNAISQQLAHIREENQQLLENLGDSIVGFQIKVSHEYRESQK
                     KELKIPGFARPSQKVLTPESCDYVIAKLNQDYYRNFKNFKYPSFFHPKDLAGWKVRTQ
                     IYNINSTEQLKSLYGTFLNQKLHVLEEQSVIISTNRSSNKEVSRRISDLMAEDFGGKV
                     EKKDGQELSALKSRLRAYAKKGETRRKLRDRLCSPKVKITWDSQDMD"
     gene            <104855..>106237
                     /locus_tag="ZYRO0G01342g"
                     /db_xref="GeneID:8205848"
     mRNA            <104855..>106237
                     /locus_tag="ZYRO0G01342g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498017.1"
                     /db_xref="GeneID:8205848"
     CDS             104855..106237
                     /locus_tag="ZYRO0G01342g"
                     /note="similar to uniprot|P23180 Saccharomyces cerevisiae
                     YHL021C FMP12 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498062.1"
                     /db_xref="GeneID:8205848"
                     /db_xref="GOA:C5E1T6"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:C5E1T6"
                     /translation="MYLRSAFKKCTRFYSAAVPLLKNSNGIGFDVAALRDSGRIIKAL
                     SNDKSTTITFVSDDLPDGKPYTVAFNNLFLRDSSRSPKSVDPTTGQKLLTTSQLSRNP
                     LSTTPISVQVTPEGKFVSIKWEDGDSYNYPLEFIYKFKGSSFVTESMRITSPNPKTLF
                     WDEETLNNHRDEVMGTDYEAYTHDDNHLYQLLRTLQKFGIVFINGVPQGDHGAIKKIA
                     ERIGPIRNTFYGETFDVKGANNETPNIAYSNLALPLHMDLLYMENVPEYQLLHTINNP
                     KEGSGGVNVFVDGFRAANEVRELDTISYQALQNVPINYHYSRGDKRYYQSKPMIEHHE
                     SHKGNTLDDYFDGLIKAVNYSPPFQAPFTFGIHAKSPESDACKSKLAERHMFNDFTNG
                     LELFEDCITDKSNQFEIKLPPNSCVILDNRRVLHARSAYSSDSRWIKGCYMDKDTIIS
                     RLNYLREKFL"
     gene            <106296..>107411
                     /locus_tag="ZYRO0G01364g"
                     /db_xref="GeneID:8205849"
     mRNA            <106296..>107411
                     /locus_tag="ZYRO0G01364g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498018.1"
                     /db_xref="GeneID:8205849"
     CDS             106296..107411
                     /locus_tag="ZYRO0G01364g"
                     /note="similar to uniprot|P23179 Saccharomyces cerevisiae
                     YHL022C SPO11 Meiosis-specific protein that initiates
                     meiotic recombination by catalyzing the formation of
                     double-strand breaks in DNA via a transesterification
                     reaction required for homologous chromosome pairing and
                     synaptonemal complex formation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498063.1"
                     /db_xref="GeneID:8205849"
                     /db_xref="GOA:C5E1T7"
                     /db_xref="InterPro:IPR002815"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013049"
                     /db_xref="UniProtKB/TrEMBL:C5E1T7"
                     /translation="MGKGLIDYMNDCSTKDDLYKSLLPRTRTIHMNMYDEDISGTIET
                     ILSLTKNSLEQHQQPVNILIRTKSKSPISLKFPDHGLYSSVAAHQNSNRIAIMLNLLQ
                     TIQECLTSSTVKTNRDLFYSNVELYGKQVTVDRWINTIAQSLELTNARDNLNVIPAQK
                     GLVFTTQEIRILTKGSEERINPYHSSLIPHMDQNSLCQIVPGRNATTRLLVLEKEAVY
                     NQLVNDVQYSPSYYDDCIIVTGKGYPDFLTRLFLHKLQVSTTAIERWEIYTDADPYGV
                     DIAMKYVQNVKEPCRCNKLVHRGVFLFQLMSNQRQQVQYLPMTQRDTAVATRILQRVT
                     ESNLPNMTTVQELQRQIFLQKKAEMNVMGRETYLGQK"
     gene            <107727..>108374
                     /locus_tag="ZYRO0G01386g"
                     /db_xref="GeneID:8205850"
     mRNA            <107727..>108374
                     /locus_tag="ZYRO0G01386g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498019.1"
                     /db_xref="GeneID:8205850"
     CDS             107727..108374
                     /locus_tag="ZYRO0G01386g"
                     /note="similar to uniprot|Q12450 Saccharomyces cerevisiae
                     or to uniprot|P39704 Saccharomyces cerevisiae YAL007C ERP2
                     Protein that forms a heterotrimeric complex with Erp1p,
                     Emp24p, and Erv25p; member, along with Emp24p and Erv25p,
                     of the p24 family involved in ER to Golgi transport and
                     localized to COPII-coated vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498064.1"
                     /db_xref="GeneID:8205850"
                     /db_xref="GOA:C5E1T8"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:C5E1T8"
                     /translation="MQLQSILPHLLAVICCCLIPAVKAESSNYAPFSIALPAFSKECL
                     YYDLTDNEDSLVVSYQVLTGGNFEIDFEITSPDGTKIISEKQKKYSDFLLKSFGLGQY
                     SFCFTNSYGTALKKVEVVLELEKGNLGIPDENSSPQDAISNNAIEEIDRNLQKITKAM
                     NYLRAREWRNMYTVESTDSRLTWLSLLIMGLMVGISVLQAVVIQFFFKVRSKNYV"
     gene            complement(<108457..>109059)
                     /locus_tag="ZYRO0G01408g"
                     /db_xref="GeneID:8205851"
     mRNA            complement(<108457..>109059)
                     /locus_tag="ZYRO0G01408g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498020.1"
                     /db_xref="GeneID:8205851"
     CDS             complement(108457..109059)
                     /locus_tag="ZYRO0G01408g"
                     /note="weakly similar to uniprot|P18411 Saccharomyces
                     cerevisiae YAL008W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498065.1"
                     /db_xref="GeneID:8205851"
                     /db_xref="UniProtKB/TrEMBL:C5E1T9"
                     /translation="MRPFTAPRTLLNIFKTTSSRGISTTFRPTSTRATLSAFQLRPTK
                     VATGLTLAASIGIGTPWVCKTIYNDAIVEVNSPASLHKGQELGLPSREPETTRARSRF
                     NGKLDYRQLCYGSILGVFLGVVVGKISSLLVFLGASAYLGLQFLQNRGVIDKGSTQRL
                     LQGFTVKTSRESIDLNTLVWERPSFKVSFLLTFILAAVNI"
     gene            complement(<109513..>111912)
                     /locus_tag="ZYRO0G01430g"
                     /db_xref="GeneID:8205852"
     mRNA            complement(<109513..>111912)
                     /locus_tag="ZYRO0G01430g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498021.1"
                     /db_xref="GeneID:8205852"
     CDS             complement(109513..111912)
                     /locus_tag="ZYRO0G01430g"
                     /note="similar to uniprot|P38903 Saccharomyces cerevisiae
                     YOR014W RTS1 B-type regulatory subunit of protein
                     phosphatase 2A (PP2A)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498066.1"
                     /db_xref="GeneID:8205852"
                     /db_xref="GOA:C5E1U0"
                     /db_xref="InterPro:IPR002554"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E1U0"
                     /translation="MMRGFKQKLIRKATGGSSSTNNKKKDKEKESSTSGGVSRSGSTS
                     SNSSSAQNTGIGGGSSNRSSLEKTRNPQGSSGSSSSSSKQHSSSSNSNKQKTSSSGSN
                     GSSSRGSNNNSRNATPVSSSSRTSGGGSTTPGPGTTSRSDNGSSTPTLTVTRDGSRQQ
                     QPNASPQTNSANGSQPTFIGATAAVPPSSPTGGGGGGGGGSPPVFASPLQSSAASMTG
                     SAKDLAGPQASPSSPTGIDIPRSSHSFERLPTPTKLNPDSELDLIKIPQRHSSSRFEP
                     SRYTQLAKLPDFESVSPEETIPLFIAKVDQCNTMFDFNDPSFDIQGKEIKRTTLQELI
                     EFIVTNRFTYTHEMYAHVVAMFKVNLFRPIPPPVNPIGDVYDPDEDEPVNELAWPHMQ
                     LVYEFFLRFVESPDFNHQIAKQYIDQDFIIKLLELFDSEDIRERDCLKTTLHRIYGKF
                     LSLRSFIRRSINNIFLQFTYETERFNGVAELLEILGSIINGFALPLKEEHKIFLVRVL
                     IPLHKVRCLSLYHPQLAYCIVQFLEKEPLLTEEVVMGLLRYWPKINSTKEIMFLNEIE
                     DIFEVIEPLEFIKVEVPLFVQLAKCISSPHFQVAEKVLSYWNNEYFLNLCIENAEVIL
                     PIIFPALYELTSQLEIDTANEEDGTSDPYMLVEQAINSGSWNRAIHAMAFKALKIFLE
                     TNPVLYENCNSLYISSVKETQKRKQERQEEWHRLEEYVQKLRVSGNAPAKAPVGGVPF
                     HSSTTTTTTTAAVPTAILSSNNSTISSHDEGLKVTNPSRTKDFETTAAGAQLQYNQQQ
                     R"
     gene            complement(<112450..>113160)
                     /locus_tag="ZYRO0G01452g"
                     /db_xref="GeneID:8205853"
     mRNA            complement(<112450..>113160)
                     /locus_tag="ZYRO0G01452g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498022.1"
                     /db_xref="GeneID:8205853"
     CDS             complement(112450..113160)
                     /locus_tag="ZYRO0G01452g"
                     /note="similar to uniprot|Q04170 Saccharomyces cerevisiae
                     YDR391C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498067.1"
                     /db_xref="GeneID:8205853"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5E1U1"
                     /translation="MSALTPPTHSIDLETGKHSRTVQPLDSLEELDQASKTLCRAFAD
                     SSANDYLLRKFFKLSLDEPMSRCRLNAMLTYLIAWYHDLGGEVVQAKDFDAVGVWSSP
                     GRHLPHTYSDDPKFNEIFFERLDERKLEVLPAGMDYYYLFMIGKDPTQRNVRGSVRKI
                     LEDYKKRADEDNCACILEAINEHAKSVYEYFGYKVVQEFKFGEGEINEDGTLDPNGKG
                     FTAYLMIYYKAPELLKIN"
     gene            complement(<113623..>115341)
                     /locus_tag="ZYRO0G01474g"
                     /db_xref="GeneID:8205854"
     mRNA            complement(<113623..>115341)
                     /locus_tag="ZYRO0G01474g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498023.1"
                     /db_xref="GeneID:8205854"
     CDS             complement(113623..115341)
                     /locus_tag="ZYRO0G01474g"
                     /note="similar to uniprot|P32837 Saccharomyces cerevisiae
                     YDL210W UGA4 Permease that serves as a gamma-aminobutyrate
                     (GABA) transport protein involved in the utilization of
                     GABA as a nitrogen source catalyzes the transport of
                     putrescine and delta-aminolevulinic acid (ALA) localized
                     to the vacuolar membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498068.1"
                     /db_xref="GeneID:8205854"
                     /db_xref="GOA:C5E1U2"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:C5E1U2"
                     /translation="MSDSKSLRISPVPSLGKGDVQVYTSAGRIRSIRSRTGAGEVNYI
                     NAATSNDDNQLLAEIGYKPELERKFSTLQVFGIAFSIMGLLPSIASELDDGLAGGPVS
                     TVWGWFIAGIFIFLVGVTMAENSSAIPTAGGLYFWTYHYAPEGYKAAISFVIGIGNSL
                     ALAAGVCSIDYGFAEEVLAAVVVSKDGNWDITQGKLYGVYAGCVILTIMVTCVASGWL
                     AKMQSISIYSNLFIIVLFLIALPIGTKVNRGGFNDGSFIFGKFENLSDWSNGWQFFLA
                     GFTPIVWTISSFDSCVHQAEEAKDASKAVPIGIMGSIFVCWILGWVINIVLMACIDKD
                     MNRVMNSPYQLGMAQIIFDSLGKNWTIAFLALMAFCQFLMGASSMTAASRQIWAFARD
                     DGMPLSNILKKVDSKFHVPFYASICSGLMSLVLGLLILIDDAAAEALFSLAIAGNYLA
                     WVTPNFLRLTWGRDVFRPGPFYLGKFWSPVVNWTTVVFMAFIIIMVMFPTQKNGINKE
                     NMNYACVIGPGTWLLSLIYYWVYKKKEYHGPKSNLDDEEYADAVGPEVLDAILSTDYS
                     TGYKAV"
     gene            115840..115939
                     /gene="SNR50"
                     /locus_tag="ZYRO0G01496r"
                     /db_xref="GeneID:8205855"
     ncRNA           115840..115939
                     /ncRNA_class="snoRNA"
                     /gene="SNR50"
                     /locus_tag="ZYRO0G01496r"
                     /product="snR50"
                     /note="C/D snoRNA monocistronic SNR50"
                     /transcript_id="XR_002648428.1"
                     /db_xref="GeneID:8205855"
     gene            complement(<115965..>116783)
                     /locus_tag="ZYRO0G01518g"
                     /db_xref="GeneID:8206805"
     mRNA            complement(<115965..>116783)
                     /locus_tag="ZYRO0G01518g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498024.1"
                     /db_xref="GeneID:8206805"
     CDS             complement(115965..116783)
                     /locus_tag="ZYRO0G01518g"
                     /note="similar to uniprot|P18410 Saccharomyces cerevisiae
                     YAL009W SPO7 Integral nuclear/ER membrane protein of
                     unknown function required for normal nuclear envelope
                     morphology and sporulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498069.1"
                     /db_xref="GeneID:8206805"
                     /db_xref="InterPro:IPR005605"
                     /db_xref="UniProtKB/TrEMBL:C5E1U3"
                     /translation="MENLQSKLDETEANLEVSKKSTSTARSSRLNVSGSSISSQAGSE
                     RKRSSSRTSSGKNVKSSSDITSASKIFRNLLILEDDLRHQAHRQKILKWEFTLFLSSL
                     AGVAGFAFYELYFTHDAITGFHRFILQFLLLFIAITVALFHLGGEYKRTIVIPRRFFT
                     STNKGVRQFNVKLVKVHSTWNEQFTDYVRFVSRNVAFINIYMLTKTLRLSESNALVTF
                     WRSVTIRSQPRIGAVDVKLVLNPRAFSAEVREGWEIYRDEFWAREGARRRKTRL"
     gene            <117049..>118395
                     /locus_tag="ZYRO0G01540g"
                     /db_xref="GeneID:8205856"
     mRNA            <117049..>118395
                     /locus_tag="ZYRO0G01540g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498025.1"
                     /db_xref="GeneID:8205856"
     CDS             117049..118395
                     /locus_tag="ZYRO0G01540g"
                     /note="similar to uniprot|P18409 Saccharomyces cerevisiae
                     YAL010C MDM10 Subunit of the mitochondrial sorting and
                     assembly machinery (SAM complex) has a role in assembly of
                     the TOM complex which mediates protein import through the
                     outer membrane required for normal mitochondrial
                     morphology and inheritance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498070.1"
                     /db_xref="GeneID:8205856"
                     /db_xref="GOA:C5E1U4"
                     /db_xref="InterPro:IPR022197"
                     /db_xref="InterPro:IPR027539"
                     /translation="MLDYMDYVQRQFEKSTDWNYDNSYANILASSRNILDFPVPNQFK
                     FQLSNNSTPHTFNTMEVFSRKIFNGSMTYLYTDAENMDKLVHDSNSISLQDVTDTYRY
                     VQPYYTHKPSSNGDNHVRSLYYGKMSYPSPNLEAMLIKRLNESTQLTLQCVSSFNGFN
                     ILTGYWQHDTGRNRHEVIMSTNDLLCGYRYLHNFLGTPSKLKTSLYNNFSLSLGGEVW
                     LGIVTLSPGCSTTLRYCTHSPTTGRPQTLTLTWNPLFGHISSTYTAKTSSSSTFSTKY
                     DFNLYSIESNLSFGCEFWRRGYQESSPQLQEQINGHASEPKDRIMYYHMMAPDSRNSI
                     SPRANSPQERQLLEDLTIAFSSSLKKIDKEKSMIEQFENRINQSNFTSVWKLSTSSKD
                     KNLRLLWEGKFKGFLLSAGTEFCKTNPRNEINEVPSTENKLTFYPNKFGIQLQYST"
     gene            complement(<118417..>120264)
                     /locus_tag="ZYRO0G01562g"
                     /db_xref="GeneID:8205857"
     mRNA            complement(<118417..>120264)
                     /locus_tag="ZYRO0G01562g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498026.1"
                     /db_xref="GeneID:8205857"
     CDS             complement(118417..120264)
                     /locus_tag="ZYRO0G01562g"
                     /note="some similarities with uniprot|P31376 Saccharomyces
                     cerevisiae YAL011W SWC3 Protein of unknown function
                     component of the Swr1p complex that incorporates Htz1p
                     into chromatin required for formation of nuclear-
                     associated array of smooth endoplasmic reticulum known as
                     karmellae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498071.1"
                     /db_xref="GeneID:8205857"
                     /db_xref="UniProtKB/TrEMBL:C5E1U5"
                     /translation="MPVILRSRHRPDSTPEETQRPAKTAGRRGKRSRRVDDEKDNSDS
                     GMSDSETGSYGKFNGNGRPFDIIAGLPCSLEVPQYNSALTHPLSVRDSAVLYDSLVIS
                     RRTWVRGEMFELYFSKPARSIKEESNQNKQDAMSQAMTVQIRDKMQKMCDCNMMGGPH
                     QFPVRLFILKNEELEKRWQEEQDSKRKEKEERRKRDQEEKKRRVEEKKQSQLQKKQEK
                     EKIMQMHKENKARAKQEMEAMKLKRKEEVKKSKEEHKKYRKTGDSAPRTVVSPLRKTS
                     PPPTNQSVNDPKMIANLNLMAQKDSRLNTLMGTVANGEATLEQVEEFKKFIEVARKMP
                     APPGWSPPPGLVQAKKDAPEPGVEKQQVREQEFKEEKMDNAIKVVVKEEEKKEEEKKE
                     EAHNMVKNEDNDTNASMAEPDKDKEPKRRRRPRGSVNEEEDKSMQLTAFQQKYVQDAQ
                     IIIEFTEYTHARYMLPRNAVLEYVEESNDYKLSWIMVHNKKEIDRYRNRRIKDMTKGK
                     KTDEEKKAIEEEYDVYGDEMCPSPLFTPMTVVFSGIHKKFNPIMVHSVEPLEKVQKEM
                     SSILSVGTKLSGYNLWYRLDGYDDKDLAESVRVDLTEHEYDLRGKRQKK"
     gene            <120582..>123848
                     /locus_tag="ZYRO0G01584g"
                     /db_xref="GeneID:8205858"
     mRNA            <120582..>123848
                     /locus_tag="ZYRO0G01584g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498027.1"
                     /db_xref="GeneID:8205858"
     CDS             120582..123848
                     /locus_tag="ZYRO0G01584g"
                     /note="similar to uniprot|Q08204 Saccharomyces cerevisiae
                     YOL034W SMC5 Structural maintenance of chromosomes (SMC)
                     protein interacts with Rhc18p and Nse1p to form a large
                     complex S. pombe homolog forms a heterodimer with S. pombe
                     Rad18p that is involved in DNA repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498072.1"
                     /db_xref="GeneID:8205858"
                     /db_xref="GOA:C5E1U6"
                     /db_xref="InterPro:IPR027131"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E1U6"
                     /translation="MASTTLNLAEYAEDGPASKKLKLGTVDYSPFHPGAIVKMRLENF
                     VTYTLTEFDLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSKRVEDFIKNGED
                     RGSIEITLKNSPKVEGMPGVDSEADTIKITRELIKSKSKSRYMINDRVVSEEDVRLLV
                     SKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDVLELLKDLQAKEIS
                     SQRELDLNKQKYDELLVQKEKLSESVKAFKELESKKSELELHLQLLPYAKLKDHKEKL
                     ADYKRDLDQAKANLKSLRKDKKPFSNAKQNLEERLEILSNKRDLKDKQLKEDQASYRR
                     VEQELESIREEIEKKEQQIEYYRNRTKKLEETAAKTREELENKYKLLETIELPSQSVF
                     DEITSQRHDLILREANLNESILELDNRASGINHNMRHLEKQMDNRLNSLNSNDRIGVL
                     DQNPDLKEVKAAVLYIRSRPEMRGKVLEPPIMSVSVTNPAFARYLNHCVDYNTSKAFT
                     IVDADSYEQFSDDVLKRFKVNLRELNDANVRPPLDRQVLRNAGFESYLSDFVTGDQNV
                     IRMLCQICNLHTVPVSRKELSSEQLSKLSKPAKNGEVLFRRIIHGNRVVDFRKSLYGS
                     KQVFSVDSNIKNTQFYNKSVMSEEQKTRINEEVAQLKSRHVGLRNDLDELSREKNDLK
                     HQLNDNNLKNDMIAQRAHSLNEIRKKHSLTKSNIESLEVKIRQITYESNKDVTQKIKD
                     VEAEISTQLQKQTRTLREMVSLVGKMNQHQRELADADIAELEAQNLNISMNDVLRSFI
                     EREAELEEEYAAKKRNAKEMRDTDEYREWKSQIQTYDEETKDKVNDRATNYEENHNFN
                     VTYIQDIIDRLESEIGMLNHDESSVTILSQVEKQLRGLQKTLPRQVEELNEIRNLLRE
                     NQHVLEPQLDAMISNISTRFSKLFTSVGSAGTVHLEKPHLFAEWKIEIMVKFRDNAVL
                     KKLDSHTQSGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENA
                     CAENTSQYFLITPKLLTDLYYHEKMRVHCVMAGPWIPDPMKRSDMINFGQTSNYVFYS
                     "
     gene            complement(<123893..>127810)
                     /locus_tag="ZYRO0G01606g"
                     /db_xref="GeneID:8205859"
     mRNA            complement(<123893..>127810)
                     /locus_tag="ZYRO0G01606g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498028.1"
                     /db_xref="GeneID:8205859"
     CDS             complement(123893..127810)
                     /locus_tag="ZYRO0G01606g"
                     /note="similar to uniprot|Q01476 Saccharomyces cerevisiae
                     YOR124C UBP2 Ubiquitin-specific protease that removes
                     ubiquitin from ubiquitinated proteins cleaves at the C
                     terminus of ubiquitin fusions capable of cleaving
                     polyubiquitin and possesses isopeptidase activity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498073.1"
                     /db_xref="GeneID:8205859"
                     /db_xref="GOA:C5E1U7"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR025305"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5E1U7"
                     /translation="MLLKDESSEPAVGGSARGVASSSDLPPELVETEQIGETMSESEI
                     SEDPGKNELLDTQDSGKVPLYPEAAARFPFKTADRLLDDILHDLSFINSDDHSILYSD
                     LSNGILKSPVLSYSRKVGKTRAYNLGSLVDQVVLQTKFEYDSVSCPQHNHLQVFMGVL
                     IDVTQQNVATFNNLATLPIFHLKVTVKTRDVLERTKKKAGITHYHSLDESEIHPYDKQ
                     DLLTFDSKDPQLLDYAIYVSSDSNKLILIEIFKPEFDSDEERDAFKEESINNRYEMAC
                     NRFDSLDPTRIPTQPDCINTLFKIFKGPLNRKSSEEPRKTINPNNVSLNSHIDPTWLT
                     SKYGFELHVEKDEETGEDILEYAPPDLTNYHRDWKVRRLRESFTRRCLELIFLGRVSI
                     RLLSQEAVNRNPKVYRIFSMMQTNFSTMFWFQLLGEYRAIFSTESSSPLDSDHHFIDL
                     SACYNYIDRDIIRNYEAQCTLDPENVGVYVDALNFIANRKGAYQLIAYCGKQDFVGQE
                     ALDHALGVFQIDSKEFDPHNLNDSVLLSIYKNESASTRNPNRHAELKNSLRLLAKFKK
                     SPKLKFYADYEPYRNVTQAYEILEVDESVDDDIIQTAYTVKVNDSPGLKIDCDRALYT
                     IAVHSRSLALFNFLVQQSEEFQEYFGPDQFSYQDALSVLQVNENAGDDTILEIFQRKW
                     YKEPVFDADQFLKLKGALSKIGFERNSKLISHFIDTGTVDASCLPAENWPTGLNNIGN
                     TCYLNSLLQYYFSISSLRQYVLDYRNTVQHFLNNQEYASRRIGGREITEAEVERSVQF
                     VYQLRDLFDSMIHAQDRCVTPRKELAYLAFVPSGLGVEFELPNASQANANAPVEKENY
                     VNIDSEPSPPPNDEPLLIDLDDDSDPNNHSKLNKNSNDDGKINEFDNSQAGENDVDVD
                     ISMTDSPAEEEKVTKADSGSSSNNSNKAVAMNTSTRVAKISSDQLENALEMGRQQDVT
                     ECIGNVLFQLESASDPISLGDDNEQNDLVKQLFYGNIKQNIIPLKDETQVRTKYERFL
                     SLLVNIGDHPKDIYDALDLYFRDEYLKLEEYGDVKRTVAVTDFPTILQIQIQRVYYDR
                     ERFMPFKSVAPLPFNETIYMDRYSDTNNPVLINRKRETEKLVQELNGLKGRQRELLSK
                     NELGLSRKGALIETSNFLKSDVLETQGIQIDNRTGLAQELDNIVLGINDELSQLYHNI
                     TQLESKISHQFDDFKSIGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETIT
                     EVPESEVFNFSEGNTATPYFLVYVKQGHEQEIEPLKRVLEVTV"
     gene            <128396..>128968
                     /locus_tag="ZYRO0G01628g"
                     /db_xref="GeneID:8205860"
     mRNA            <128396..>128968
                     /locus_tag="ZYRO0G01628g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498029.1"
                     /db_xref="GeneID:8205860"
     CDS             128396..128968
                     /locus_tag="ZYRO0G01628g"
                     /note="highly similar to uniprot|Q06389 Saccharomyces
                     cerevisiae YDR373W FRQ1 N-myristoylated calcium-binding
                     protein that may have a role in intracellular signaling
                     through its regulation of the phosphatidylinositol
                     4-kinase Pik1p member of the recoverin/frequenin branch of
                     the EF-hand superfamily"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498074.1"
                     /db_xref="GeneID:8205860"
                     /db_xref="GOA:C5E1U8"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR028846"
                     /db_xref="UniProtKB/TrEMBL:C5E1U8"
                     /translation="MGAKASKLSKDDLTSLRQSTYFDRREIQQWHKGFLRDCPSGQLT
                     RQDFVKIYKQFFPFGSPEEFANHLFSVFDKDNSGSVDFREFITVLSTTSRGTLEEKLV
                     WTFQLYDLNHDGFITFDEMLTIVTSIYKMMGSMVKLSDDEATPELRVRKIFKLMDKNE
                     DGYITLDEFREGSRVDPSIISSLNLYDGLV"
     gene            complement(<129026..>129712)
                     /locus_tag="ZYRO0G01650g"
                     /db_xref="GeneID:8205861"
     mRNA            complement(<129026..>129712)
                     /locus_tag="ZYRO0G01650g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498030.1"
                     /db_xref="GeneID:8205861"
     CDS             complement(129026..129712)
                     /locus_tag="ZYRO0G01650g"
                     /note="highly similar to uniprot|P41735 Saccharomyces
                     cerevisiae YOR125C CAT5 Mitochondrial inner membrane
                     protein directly involved in ubiquinone biosynthesis
                     essential for several other metabolic pathways including
                     respiration and gluconeogenic gene activation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498075.1"
                     /db_xref="GeneID:8205861"
                     /db_xref="GOA:C5E1U9"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR011566"
                     /db_xref="UniProtKB/TrEMBL:C5E1U9"
                     /translation="MLRTINPTTRRWFSVLSSLKNTAASEPVKEPVTAKAEPLSEARE
                     AYLERAVRVDQAGELGADYIYAGQYFVLANKYPHLKSVLQHMWDQEVHHHNTFNRWQT
                     ENRVRPSLITPLWKLGAFTMGAGTAAISSEAAMACTEAVETVIGGHYNQQLRCLANQY
                     DLKWTDGTNGPTKEIKSLTETIRQFRDDELEHLNTAIEHDSRKAVPYILLTEGIKGIC
                     RVAIWTAERI"
     gene            complement(<129871..>130860)
                     /locus_tag="ZYRO0G01672g"
                     /db_xref="GeneID:8205862"
     mRNA            complement(<129871..>130860)
                     /locus_tag="ZYRO0G01672g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498031.1"
                     /db_xref="GeneID:8205862"
     CDS             complement(129871..130860)
                     /locus_tag="ZYRO0G01672g"
                     /note="some similarities with uniprot|Q06390 Saccharomyces
                     cerevisiae YDR374C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498076.1"
                     /db_xref="GeneID:8205862"
                     /db_xref="InterPro:IPR007275"
                     /db_xref="PDB:4U8T"
                     /db_xref="UniProtKB/TrEMBL:C5E1V0"
                     /translation="MDWYYVDRPVRTIEDSFKDLESIFKDKNNNDTPRIPLTDELYKP
                     FGDTNINLNSSISAENNNYVATPRLPLASATLEDSSAVCSPVQPVQSPLNTLQTLEAH
                     AFRSVVPKQIVSPQPQPQPPLQVDFQSQVHRAAAAATSVTSPIGGISTNANHSNWKPP
                     QKKSSAIIPPWIHVPDHSRFFVIKSSSLEHVKKSFYNGIWSSTFYGNKRLSEAYESLP
                     QGAKIYLLFSVNASGRFCGVAEMSSNLREDLDTSIWGDNSRYRHAFKVRWIVVRDVHN
                     RSLKQFLIPANDMKPVTNSRDTQEIPATISKSILKLFKYEQSEVQSFLDDDYS"
     gene            <131064..>131285
                     /locus_tag="ZYRO0G01694g"
                     /db_xref="GeneID:8205863"
     mRNA            <131064..>131285
                     /locus_tag="ZYRO0G01694g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498032.1"
                     /db_xref="GeneID:8205863"
     CDS             131064..131285
                     /locus_tag="ZYRO0G01694g"
                     /note="similar to uniprot|Q2V2P8 Saccharomyces cerevisiae
                     YDR374W-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498077.1"
                     /db_xref="GeneID:8205863"
                     /db_xref="UniProtKB/TrEMBL:C5E1V1"
                     /translation="MGFDLGQYLLDQWRKRYEFVEEPSESERLILSSGFQEMLRKLLV
                     EAQSNAHRDGFNEVRPAHLEAALDELLDA"
     gene            complement(<131297..>132646)
                     /locus_tag="ZYRO0G01716g"
                     /db_xref="GeneID:8205864"
     mRNA            complement(<131297..>132646)
                     /locus_tag="ZYRO0G01716g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498033.1"
                     /db_xref="GeneID:8205864"
     CDS             complement(131297..132646)
                     /locus_tag="ZYRO0G01716g"
                     /note="highly similar to uniprot|P32839 Saccharomyces
                     cerevisiae YDR375C BCS1 Protein of the mitochondrial inner
                     membrane that functions as an ATP-dependent chaperone
                     required for the assembly of the cytochrome bc(1) complex
                     from the Rip1p and Qcr10p proteins member of the
                     CDC48/PAS1/SEC18 ATPase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498078.1"
                     /db_xref="GeneID:8205864"
                     /db_xref="GOA:C5E1V2"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR014851"
                     /db_xref="InterPro:IPR027243"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E1V2"
                     /translation="MPETPAGPPSVENTSVASPVGSTSPNKSGPLGKFLDNVMENNPY
                     FAAGGGLMLLGTGLAVARSGVVRASRLLYRQMIVDLEIQSKDKSYSWFLQWMSNHPHR
                     ISKHLSVRTTYIQHDNGSASTKFALVPGPGNHWIRYKGAYIRIKRERSGKMIDITSGS
                     PFEIVTLTTLWRDRHLFNEILDEAKGIALKSTEGKTVIYTSFGPEWRKFGQPKAKRAL
                     PSVILDKGISGGIVEDIRDFMKNGKWYSDRGIPYRRGYLLYGPPGSGKTSFIQALAGE
                     LDYNICILNLSEGHLTDDRLNHLMNNMPERSLLLLEDIDAAFNTRKQSGENGFHSSVT
                     FSGLLNALDGVTSSEEAITFMTTNHPEKLDPALMRPGRIDYKVYIGDATPYQVEKMFM
                     KFYPGESELCKQFVDKIRNLDITVSTAHLQGLFVMNKDQPAKALHMADTLRNQNNFL"
     gene            complement(<132802..>133521)
                     /locus_tag="ZYRO0G01738g"
                     /db_xref="GeneID:8205865"
     mRNA            complement(<132802..>133521)
                     /locus_tag="ZYRO0G01738g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498034.1"
                     /db_xref="GeneID:8205865"
     CDS             complement(132802..133521)
                     /locus_tag="ZYRO0G01738g"
                     /note="similar to uniprot|P41734 Saccharomyces cerevisiae
                     YOR126C IAH1 Isoamyl acetate-hydrolyzing esterase required
                     in balance with alcohol acetyltransferase to maintain
                     optimal amounts of isoamyl acetate which is particularly
                     important in sake brewing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498079.1"
                     /db_xref="GeneID:8205865"
                     /db_xref="GOA:C5E1V3"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="UniProtKB/TrEMBL:C5E1V3"
                     /translation="MEYKKFLMFGDSITEFSFNTRPQPEENLGDQFALGAALTNDYSR
                     KLTVLQRGFAGYNSKWGLKILPKILEYEQNIVIGFIFFGSNDSCAGGPQRVPEDEYES
                     NLHKSVQMFKARSIKPILVGPAFYDSSKWEPSRQDEVRQGYARSNEGFIRYGKITASV
                     ASKENVPFLDLRAAMEREAGKNWTDFLVDGLHFNGKGYEVFYKELLQAISDHYPEYHP
                     YNMAITPPYWKYVSEDESKLD"
     gene            <133707..>135182
                     /locus_tag="ZYRO0G01760g"
                     /db_xref="GeneID:8205866"
     mRNA            <133707..>135182
                     /locus_tag="ZYRO0G01760g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498035.1"
                     /db_xref="GeneID:8205866"
     CDS             133707..135182
                     /locus_tag="ZYRO0G01760g"
                     /note="similar to uniprot|P48360 Saccharomyces cerevisiae
                     YDR376W ARH1 Oxidoreductase of the mitochondrial inner
                     membrane involved in cytoplasmic and mitochondrial iron
                     homeostasis and required for activity of Fe-S
                     cluster-containing enzymes one of the few mitochondrial
                     proteins essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498080.1"
                     /db_xref="GeneID:8205866"
                     /db_xref="GOA:C5E1V4"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR021163"
                     /db_xref="UniProtKB/TrEMBL:C5E1V4"
                     /translation="MILDGLSLKFVRWASKRISVVGSGPSGFYTAYRLLNKSPDPIHV
                     TLWEKLPVPYGLSRYGVAPDHPEVKNCEDTFAECAETFNQGKDGRKFSFIGGVTIGSD
                     EIPLQQLLKQEDAVILAYGCQSSRALGIPGEDASGVFSSRDFVNWYNGHPGFANDKRF
                     TEFDWSQVHRVGIIGHGNVALDITRVLMTNRVDEIWQPTDISRVAIDKLKQAPIQEVK
                     MIARRDFIHSKFTNRELRELWEMERFGVRGKIDQKYFHPTLFNDDQLKDRPFKRRVEM
                     CQEYSTPFDKRTKKNYKKHGPPPEERSHWVLDYLKTPLQTQTNDQGRVQSLQLCENEL
                     TPDNRVKQLPNSELNYNVDLLITSLGYKGQPMSEFKPLAVKWLGDRIANDRGRVLTTE
                     NEPIERLYAAGWIRRGSQGVIATTMEDSFQVADQVLHDLQNQQNLERIPPVDLSNIRH
                     TTWQDWEKINQSELNKGKQMGRVRSKYLTEPEIYNYLSMNH"
     gene            <135357..>135668
                     /locus_tag="ZYRO0G01782g"
                     /db_xref="GeneID:8205867"
     mRNA            <135357..>135668
                     /locus_tag="ZYRO0G01782g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498036.1"
                     /db_xref="GeneID:8205867"
     CDS             135357..135668
                     /locus_tag="ZYRO0G01782g"
                     /note="highly similar to uniprot|Q06405 Saccharomyces
                     cerevisiae YDR377W ATP17 Subunit f of the F0 sector of
                     mitochondrial F1F0 ATP synthase which is a large
                     evolutionarily conserved enzyme complex required for ATP
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498081.1"
                     /db_xref="GeneID:8205867"
                     /db_xref="InterPro:IPR019727"
                     /db_xref="UniProtKB/TrEMBL:C5E1V5"
                     /translation="MNPIARRSLSTLIPPKVVSSQNIGSAPNAKRIGNVVQFYKSLPQ
                     GPAPAIKPTGLISKYKAKYFDGDNASGKPLWHLAVSILVMGYSLEYYFHLRHSKNGEH
                     H"
     gene            complement(<135737..>136084)
                     /locus_tag="ZYRO0G01804g"
                     /db_xref="GeneID:8205868"
     mRNA            complement(<135737..>136084)
                     /locus_tag="ZYRO0G01804g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498037.1"
                     /db_xref="GeneID:8205868"
     CDS             complement(135737..136084)
                     /locus_tag="ZYRO0G01804g"
                     /note="some similarities with uniprot|Q06406 Saccharomyces
                     cerevisiae YDR378C LSM6 Component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing
                     splicing and decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498082.1"
                     /db_xref="GeneID:8205868"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5E1V6"
                     /translation="MVDVCMYVCMYTRGIGLTWSVDSTPIYKGDWSIIVTMAKIDSSQ
                     FLSTIIGQNVHVKLHSGMLYRGRLESIDGFMNVALSSAKEHYETGENGLLRTYPTDVF
                     LRGTQVMYISEVK"
     gene            <136404..>139541
                     /locus_tag="ZYRO0G01826g"
                     /db_xref="GeneID:8205869"
     mRNA            <136404..>139541
                     /locus_tag="ZYRO0G01826g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498038.1"
                     /db_xref="GeneID:8205869"
     CDS             136404..139541
                     /locus_tag="ZYRO0G01826g"
                     /note="similar to gnl|GLV|KLLA0B13794g Kluyveromyces
                     lactis KLLA0B13794g gi|28565040|gb|AAO32603.1
                     Kluyveromyces lactis MNN4 hypothetical start
                     KLLA0B13794g|KLLA-IPF6938|KLLA-CDS0444.1 and weakly
                     similar to YKL201C uniprot|P36044 Saccharomyces cerevisiae
                     YKL201C MNN4 Putative positive regulator of
                     mannosylphosphate transferase (Mnn6p) involved in
                     mannosylphosphorylation of N-linked oligosaccharides
                     expression increases in late-logarithmic and stationary
                     growth phases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498083.1"
                     /db_xref="GeneID:8205869"
                     /db_xref="InterPro:IPR007074"
                     /db_xref="InterPro:IPR009644"
                     /db_xref="UniProtKB/TrEMBL:C5E1V7"
                     /translation="MGALAHNLKHIHTAPKRLTPPYIVLYRLAAAYSVPFNGGYFLTL
                     SYSVFWLALIPFSWFASAPTTVRKGVTACSSAGRKLQPGYRILFTVYKDPENPKPKRG
                     THRTRTSIQPISNKLLQYCRDTQPLLYSTMTLLAKGGLRWVNSHKSLIQRVLLFSVIV
                     FIIVKQASFSSSEDAEVPLIIGSAGSKLDQARALYRKFKFDTSMIWPDVYTLKGSLLT
                     PSFGAKKGQQLESIDDLHYYDSDPRLVWTVYLDHAMNTAMTYQHEAHADITNEEPLPE
                     MPFSWYDWIDHHDFDKLIAAVHDGGVELGCAFFYEKAFNSDKLDELEASVGDYLFSYQ
                     RVKYYDAEWYRKIRNEKAAPENIPEGQCKSVNGPVKFNLPIQVHELHEDVRPEVYQMQ
                     ARSYLITKLNNPLSLTVLEGARSAYRFPLRSQRSNLIESRLLDTYLSRHMTRADKNSD
                     YKFDHLQTFHDFLLSDAAFRSKVVIPDAQRTQEDESAIPLKPSDFEFDVRAKIKELEK
                     LKDDKKISPHEEQYLESLKVSISYHPALQPKYLSEAAHISQFAGMGYHRDKRFFNGGL
                     VEEYQEYQARLNSLIRTWLKFTRVNGLLTWVAHGSLYGYLYNGKNFPWDNDYDVQMPI
                     RHLHLLSQYFNQSLILEDPREGNGKYLVDVGTSITVRTNGNGQNNIDARFIDVDSGLY
                     VDITGISVSSNPQRENFKDWYEEKKKGINLEQGMKDFDFPEKGDGYASMNITALSQYA
                     KEHEEEFNNEQKDWIKNVDKGERDHFKMRTAPQKGLTPEQRYYMNREVGAYNCRNNHF
                     ITMDFASPLVKTIYHGVEALVPYKVIYDLRKEYYVPENLGFTVYQGNVYVPELRSWFN
                     LSILKRFANINSWNANLREIKSPVHDLKQEDMDPLFENMHNIGYTDLFSLYYTSYNVS
                     AYRLKELEIQYDTTLNKIEKEDVLEILRHNIAPNMSSPVKDATLYVYEKRLWEGMTQK
                     LTRNEINKVTDQVSYEVYKDLTAAATAFYEKKSSLFVTTDEAGEIYDYNRIGIPIPKD
                     NKLFEKDYSDDRRKK"
     gene            complement(<139724..>140968)
                     /locus_tag="ZYRO0G01848g"
                     /db_xref="GeneID:8205870"
     mRNA            complement(<139724..>140968)
                     /locus_tag="ZYRO0G01848g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498039.1"
                     /db_xref="GeneID:8205870"
     CDS             complement(139724..140968)
                     /locus_tag="ZYRO0G01848g"
                     /note="similar to uniprot|P40354 Saccharomyces cerevisiae
                     YJR062C NTA1 Amidase removes the amide group from
                     N-terminal asparagine and glutamine residues to generate
                     proteins with N-terminal aspartate and glutamate residues
                     that are targets of ubiquitin-mediated degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498084.1"
                     /db_xref="GeneID:8205870"
                     /db_xref="GOA:C5E1V8"
                     /db_xref="InterPro:IPR003010"
                     /db_xref="UniProtKB/TrEMBL:C5E1V8"
                     /translation="MSSLVKSNLAVNLKIAIVQLNSQIGQIQPAVGRTWELLKKFNNR
                     VSSTPKKPDIIIFPEFALTGYNFHSRDQILPYCCVPNKGPSYELACKVSSMFQCYTVI
                     GYPERTAAGDKLYNSAIVINPQGELVFNYRKSFLYQTDEEWDCLENPQGFQTFPLSFK
                     DIARDQQGNVQDVTLKTSIGICMDLSPYKFKAPFHDYEFATYNVDQGTELIICPMAWL
                     HSTSAIAGDDNETELQASMDNIAKNCTRENIPTVGTQGEFDIDIDGHETPRLPREDED
                     DRNLFRELNKPDMCNVNYWLLRFLPFLGLKERSEWSVAALAKLIVRGRLLRSSYIGAA
                     LDNYWSFKNKNAVLAIANRCGIEEGKTVFAGSSGIYKFNGQEYENHDSLDSTNFSVEL
                     KGNLGKGNEGIIYREVNFQVSR"
     gene            <141118..>141489
                     /locus_tag="ZYRO0G01870g"
                     /db_xref="GeneID:8205871"
     mRNA            <141118..>141489
                     /locus_tag="ZYRO0G01870g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498040.1"
                     /db_xref="GeneID:8205871"
     CDS             141118..141489
                     /locus_tag="ZYRO0G01870g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498085.1"
                     /db_xref="GeneID:8205871"
                     /db_xref="UniProtKB/TrEMBL:C5E1V9"
                     /translation="MIPFEEGYNRRNGIQEPDWNVIEPDMWAQQAKSGSEPRIQKSTE
                     ESMGSNNSTTSTAPIDPPGSTGSTGSTGPSDPPAYVPLHDPRNQLSSLVKNAQNNEEA
                     LQQRNQRVKQSKMRSRKEFGW"
     gene            <141651..>142028
                     /locus_tag="ZYRO0G01892g"
                     /db_xref="GeneID:8205872"
     mRNA            <141651..>142028
                     /locus_tag="ZYRO0G01892g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498041.1"
                     /db_xref="GeneID:8205872"
     CDS             141651..142028
                     /locus_tag="ZYRO0G01892g"
                     /note="highly similar to uniprot|P32529 Saccharomyces
                     cerevisiae YJR063W RPA12 RNA polymerase I subunit A12.2
                     contains two zinc binding domains and the N terminal
                     domain is responsible for anchoring to the RNA pol I
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498086.1"
                     /db_xref="GeneID:8205872"
                     /db_xref="GOA:C5E1W0"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:C5E1W0"
                     /translation="MSVVGSLIFCLDCGDLLDNPSAVQGSEIECQQCQARYPKSKFSN
                     LKVVTSTADDAFPSSLKMKQSVVKTSIGRDDLGEGATIKEKCPKCGHDEMHYHTLQLR
                     SADEGATVFYTCTSCGYKYRTNN"
     gene            <142245..>143924
                     /locus_tag="ZYRO0G01914g"
                     /db_xref="GeneID:8205873"
     mRNA            <142245..>143924
                     /locus_tag="ZYRO0G01914g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498042.1"
                     /db_xref="GeneID:8205873"
     CDS             142245..143924
                     /locus_tag="ZYRO0G01914g"
                     /note="highly similar to uniprot|P40413 Saccharomyces
                     cerevisiae YJR064W CCT5 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498087.1"
                     /db_xref="GeneID:8205873"
                     /db_xref="GOA:C5E1W1"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012718"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5E1W1"
                     /translation="MAAVPQAMEMPDMSNAIVAQDEMGRPFIIVRDQGNKKRQHGLEA
                     KKSHILAARSVSSIIKSSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKLL
                     VQLSKSQDDEIGDGTTGVVVLASALLDQALELIEKGIHPIKIANGFEEAAKLAVQELE
                     AKSDDVIKEQKLFKDYLFEAAKTSLGSKIVSKDLDRFAQIAVNAVTSVMDEDRKDVDF
                     ELIKLEGRVGGSLKDSKLINGVILDKDFSHPQMPKVVLPREGEDGVKLAILTCPFEPP
                     KPKTKHKLDISSVEEYQKLQDYEQQKFKEMIDHVKKAGADVVICQWGFDDEANHLLLQ
                     NNLPAVRWVGGQELEQIAIATHGRIVPRFQDLSADKLGTCSKIYEMEFGTTKDRMLVV
                     EKCKDAKTVTCFIRGSNKMIVDEAKRALHDALCVVRNLVKDSRVVYGGGAAEVSMSLS
                     VSEEADKQRGIDQYAFRAFAQALDTVPMVLAENSGLDPIETLTTLKSKQLKEQTSIIG
                     VDCLGKGTNDMRELFVVDPFIGKKQQILLASQLCRMILKIDNVIISGKDEY"
     gene            complement(<144085..>145470)
                     /locus_tag="ZYRO0G01936g"
                     /db_xref="GeneID:8205874"
     mRNA            complement(<144085..>145470)
                     /locus_tag="ZYRO0G01936g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498043.1"
                     /db_xref="GeneID:8205874"
     CDS             complement(144085..145470)
                     /locus_tag="ZYRO0G01936g"
                     /note="highly similar to uniprot|P47117 Saccharomyces
                     cerevisiae YJR065C ARP3 Essential component of the Arp2/3
                     complex which is a highly conserved actin nucleation
                     center required for the motility and integrity of actin
                     patches involved in endocytosis and membrane growth and
                     polarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498088.1"
                     /db_xref="GeneID:8205874"
                     /db_xref="GOA:C5E1W2"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR015623"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:C5E1W2"
                     /translation="MSYLNNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIANAASSNA
                     KNTASSSSTGGAGLAASSTGGSSAASNPYFTNATSTTNFGNLTTASLMSNNLSGKRGT
                     EDLDFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFF
                     LLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVI
                     DSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEVDTSLRTAERIKQ
                     EYCYVCPDIVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIA
                     SSDFLTPLPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNR
                     IAETERLSGARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCHTKKDYEEYGPE
                     IVRNFSLFNMV"
     gene            <146015..>153403
                     /locus_tag="ZYRO0G01958g"
                     /db_xref="GeneID:8205875"
     mRNA            <146015..>153403
                     /locus_tag="ZYRO0G01958g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498044.1"
                     /db_xref="GeneID:8205875"
     CDS             146015..153403
                     /locus_tag="ZYRO0G01958g"
                     /note="highly similar to uniprot|P32600 Saccharomyces
                     cerevisiae YKL203C TOR2 putative
                     protein/phosphatidylinositol kinase involved in signaling
                     activation of translation initiation distribution of the
                     actin cytoskeleton and meiosis phosphatidylinositol kinase
                     homolg"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498089.1"
                     /db_xref="GeneID:8205875"
                     /db_xref="GOA:C5E1W3"
                     /db_xref="InterPro:IPR000403"
                     /db_xref="InterPro:IPR003151"
                     /db_xref="InterPro:IPR003152"
                     /db_xref="InterPro:IPR009076"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR014009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018936"
                     /db_xref="InterPro:IPR024585"
                     /db_xref="UniProtKB/TrEMBL:C5E1W3"
                     /translation="MLSLRRKAGGHHHTRKKLTSSSRSADDISTTSAHDGGGIVTADG
                     TRVTNGSGSDVKNYVDNEASIAIVDSNFSTFNLIFDKLRSPIPQERIAASYELKTSLI
                     SLVREVSVEQFQRFSNKINNKIFELIHGSDPDEKIGGILAVDTLIGFYAHTEELPNQT
                     SRLANYLRVLIPSNDIEVMRLAANTLGKLAVPGGTLTSDFVEFEVKTCIEWLTTSPEN
                     SSSSSKQEYRKHASLLIITALANNSPYLLYPYVNSVLDNIWRALRDTKLVIGMDAAVT
                     LGKCLSIIQDRDAPLTKQWVQRLFKGCVYGLTLNTNESIHATLLVYRELLTLKGFYLD
                     GKYDEIYQSTMTYKDHKYDVIRKEVYAILPLLASFDPQLFANKYLDQTMVHYLTILNN
                     MSTSAANHSDKSAILVSIGDIAYEVGSNIMPYMDPILDNIRDGLQTKFKNRKKFEKEL
                     FYCIGKLACAVGAALSKHLNRGLLSLMLLCPLSDYMQETLLIINEKIPALEPTINSSL
                     LDLLCTSLSGDKFKQPGSPMSLKSLSIERARQWRNQSILRKTGEVNDDTNDAQILTQA
                     LRMLHTINHKSSLTEFVRLVVILYIEHENPHVRKLAALTSCDLFVKDNICKQTSLHAL
                     NSVSEVLSKLLTVAITDPIADIRFEILQHLDSSFDPQLAQPDNMRLLFMALNDEIFAI
                     EMEAIRIIGRLTTVNPAYVVPSLRKTLLELLTELRYSNMPRKKEESATLLCALISSSR
                     EVTKPYIEPILDVLLPKSKDGSSAVASTALKAVGELSVVGGEDMKQYLSELMPLIINT
                     FQDQSNSFKRDAALKTLGQLSASSGYVIDPLLDYPELLGVLINILKSESAQNIRRETV
                     RLIGILGALDPYKHREVEVTSNAKISVEQNAPSIDIALLMQGMSPSNEEYYPTVVINT
                     LMKILRDSSLSSHHTAVIQAIMHIFQTLGLRCVQFLGQIIPGIITVMHSCPPSLLEFY
                     FQQLGLLVSIVKQHIRTHVDEMYEVIEEFFPITKLQITIISVIESISKALEGEFKRFV
                     PNTLTFFLNVLENDKSNKKAVSIRILKSLVVFDSNLEDYAHLIIPTVVRMAEYSPGTL
                     RMMAVVTLGKLAKSINLSQMSSRIVQALVRVLNTEDRELVRATMNTLSLLLLQLGADF
                     TVFIPIINKTLVKNHIQHSIYDQLVNKLLNNEGLPTNILSDREFDNNKREPTEAESAA
                     KKLPVNQLVLKNTWDCSQQRTKEDWQEWIRRLSIQLLKESPSHALRACSGLAGIYYPL
                     ARELFNASFASCWTELYTQYQEDLIQSLCSALSSPQNPPEIHQTLLNLVEFMEHDDKP
                     LPIPIQTLGKYAQRCHAYAKALHYKEVEFIQEPSTSTIESLISINNQLHQTDAAIGIL
                     KHAQRHHDLQLKETWYEKLQRWEDALTAYNQRENAGEDSLEVTMGKMRSLHALGEWEQ
                     LADLSSEKWSISKPDVRNVMAPLAAGAAWGLGQWDKIEQYISVMKPQSPNKEFFDAVL
                     SLHKNNFDEAEKHIFNARDLLVTEISALINESYNRAYSVVVRSQIIAELEEIIKYKQL
                     PLNSEKRIMIRNTWNKRLLGCQKNVDVWQRVLRVRSLVVKPKQDMQVWIKFANLCRKS
                     GRMGLAQKALNSLLEEGGDPEHPNTARAPPPVVYAQLKYLWATGSQKEALRHLIGFTS
                     RMAHDLGLDPSNMIAQSVPQNSIIAPHHVEDYTKLLARCFLKQGEWRISLQSNWRMEN
                     PDAILGSYLLATHFDDNWYKAWHNWALANFEVISMITSGSKDKSINGLRPSTNGVYKI
                     ENGMMGSDTFTPEGNSYPIELIQRHVVPAIKGFFHSISLSEASSLQDTLRLLTLWFTF
                     GGIPEAAQAMHEGFSMIKIGYWLEVLPQLIARIHQPDKVVSRSLLSLLSDFGKAHPQA
                     LVYPLTVAIKSESVSRQKAALSIIEKMRMHSPVLVDQAELVSHELIRVAVLWHELWYE
                     GLEDASRQFFGEHNTEKMFATLEPLHEMLKRGPETLREISFQNLFGRDLNDAYEWVLN
                     FKRKKDVSNLNQAWDIYYNVFRRISRQLPQLQTLELQHVSPKLLMARDLELAVPGTYA
                     AGKKIIRISRFEPVFSVISSKQRPRKFSIKGSDGKDYQYVLKGHEDIRQDSLVMQLFG
                     LVNTLLQNDSECFQRHLDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHREAKKIPL
                     NIEHWVMLQMAPDYDNLTLLQKVEVFTYALDNTRGQDLYKVLWLKSRSSESWLERRTT
                     YTRSLAVMSMVGYILGLGDRHPSNLMLDRNTGKVIHIDFGDCFEAAILREKFPEKVPF
                     RLTRMLTYAMEVSGIEGSFRITCENVMRVLRANNESLMAILEAFAFDPLIHWGFDLPT
                     QTIMERTDIQMPLTNTSELLRKDVITVEEAAKMEIEQKNEIRNARAMLVLRRITDKLT
                     GNDFRRFQELNVPEQVDKLIQQATSVENLCQHYIGWCPFW"
     gene            complement(<153430..>153876)
                     /locus_tag="ZYRO0G01980g"
                     /db_xref="GeneID:8205876"
     mRNA            complement(<153430..>153876)
                     /locus_tag="ZYRO0G01980g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498045.1"
                     /db_xref="GeneID:8205876"
     CDS             complement(153430..153876)
                     /locus_tag="ZYRO0G01980g"
                     /note="similar to uniprot|P47118 Saccharomyces cerevisiae
                     YJR067C YAE1 Essential protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498090.1"
                     /db_xref="GeneID:8205876"
                     /db_xref="InterPro:IPR019191"
                     /db_xref="UniProtKB/TrEMBL:C5DZ73"
                     /translation="MSNSLDDVWGSDSDDDGSVVQESPDFKKLRDIHFKRGYVDGISG
                     SKEAKLQEGFDTAFPLGSRLGMEVGRLIGILQFLDFKYGKDDEELHGDFQLAQKELKI
                     DRVLIKSMFDSDLNLMGEHQVISKWRRIVKVHCNKYAASISSTIGN"
     gene            <154079..>155137
                     /locus_tag="ZYRO0G02002g"
                     /db_xref="GeneID:8205877"
     mRNA            <154079..>155137
                     /locus_tag="ZYRO0G02002g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498046.1"
                     /db_xref="GeneID:8205877"
     CDS             154079..155137
                     /locus_tag="ZYRO0G02002g"
                     /note="highly similar to uniprot|P40348 Saccharomyces
                     cerevisiae YJR068W RFC2 Subunit of heteropentameric
                     Replication factor C (RF-C) which is a DNA binding protein
                     and ATPase that acts as a clamp loader of the
                     proliferating cell nuclear antigen (PCNA) processivity
                     factor for DNA polymerases delta and epsilon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498091.1"
                     /db_xref="GeneID:8205877"
                     /db_xref="GOA:C5DZ74"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZ74"
                     /translation="MFEGFGANKRRKVNIEEEPEHTKPWVEKYRPKKLDDVSAQDHTI
                     SVLKKTLTSANLPHMLFYGPPGTGKTSTIFALTRELYGPELSKTRVLELNASDERGIA
                     IVREKVKNFARLTVSKPSKEALEKYPCPPYKIIILDEADSMTADAQSALRRTMENHSN
                     VTRFCLICNYVTRIIDPLASRCSKFRFKSLDESNAIGRLKEISQLENVPHEEGALQRI
                     LEISNGDMRRAITLLQSAAKRLGFGELDKITSQEVEELAGLVPTHILQEMLNKVSQGN
                     VNEIIEYVNEFVKNGWSAVSVVNQLHDYYITSNDYGTDFKNKISLLLFDADAKLANGT
                     NEHLQLLNLLVQISQVPT"
     gene            complement(<155297..>157360)
                     /locus_tag="ZYRO0G02024g"
                     /db_xref="GeneID:8205878"
     mRNA            complement(<155297..>157360)
                     /locus_tag="ZYRO0G02024g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498047.1"
                     /db_xref="GeneID:8205878"
     CDS             complement(155297..157360)
                     /locus_tag="ZYRO0G02024g"
                     /note="weakly similar to uniprot|P36041 Saccharomyces
                     cerevisiae YKL204W EAP1 eIF4E-associated protein binds
                     eIF4E and inhibits cap-dependent translation also
                     functions independently of eIF4E to maintain genetic
                     stability plays a role in cell growth implicated in the
                     TOR signaling cascade"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498092.1"
                     /db_xref="GeneID:8205878"
                     /db_xref="UniProtKB/TrEMBL:C5DZ75"
                     /translation="MDDPVVAASAGSETETIGTDMQNPQRSSADEIAKFFDDIRSRQG
                     IFNGQQSQQVTDGIDFSADENVKAAAEQYNCDYKPPITLNKQNVYSINELISISKQLP
                     EGLVEEIVFTLPKKKFWRLNHKQPDHANQGKPMGHRGSNKGLNGSSNGKGFSGEDTNS
                     LFEKKGNKGKYSRMANGKKNGKFVKHERSGFMEEKDINVNHDDLQALEEEFEPTGNSM
                     ADFESWKAKMKEMERRKKGLPPAESSGNSKPSLSATSSSISDFLGLNKIQNDTATNPA
                     QPESIETEKSLDDEINNLNKDLHSDSGKGSYSRFSSFFTQSSSSSSLPTMRNSHDPEN
                     LANKNSHSNIGESTPNSRNPSVPGGSKLLSFFNKEAGTPKGSRNQASLNTEDVRQKPI
                     NSSVVPPSQPHGQVPPQPPIRLPEQQLQHRQHQQHHQQLQQQQQQQQQRVMPPPVIAP
                     DQLQTNNAFFQNLLSKGELQNQKGTGPSGPPPGVMLPPPGGQSGIPLGQQPPRVSAQG
                     GQPPAGMGMSAPFPMGMPPGPGAFPPGLAPGGQAGMPLGLQPPGTGSPAGKPRGSGGQ
                     PPMNDNHSNGAKGARNAGGANSRESGSRMQQTQQPPPPLQPGMVPPQFIPGMAPPGFP
                     MMPPNFNPMYGPPQGGLMPPPAGQGFFPPMPPPSGNMNFNAFPMQPPVFNQQHQEANS
                     TESKK"
     gene            complement(<157899..>161087)
                     /locus_tag="ZYRO0G02046g"
                     /db_xref="GeneID:8205879"
     mRNA            complement(<157899..>161087)
                     /locus_tag="ZYRO0G02046g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498048.1"
                     /db_xref="GeneID:8205879"
     CDS             complement(157899..161087)
                     /locus_tag="ZYRO0G02046g"
                     /note="similar to uniprot|P33418 Saccharomyces cerevisiae
                     YKL205W LOS1 Nuclear pore protein involved in nuclear
                     export of pre-tRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498093.1"
                     /db_xref="GeneID:8205879"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013598"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DZ76"
                     /translation="MINRIQEVVAIANSPTTDAVTKKQALDFLTQIKSEPNAVQVFAP
                     LLSDSQSDDVTKFVALQVLADLAQQQTSDLQFIRTTAVELLRHKVVNGIRDPEYVKNK
                     IAEVLTNLFYSMYGEINGNQWSTFFTDMVEILSIRQLCNDSTKEFIPLGLDYFLRICL
                     AVNSSIGDQTFVRSKDVQVKNNSLKDTMRIQDVQTLVTVWLNTLKSIVPQEQSDLAVL
                     TLSCVGSYISWIDVQLIVNPLYITVIYGYLDFAETKVACSQCLCEVISKKMKPLDKLS
                     LLGMLSLTDKVTSVGNDELEVYEQLAKLSSSMGFELAKVIEQCNENDSTPEVQQVATA
                     ADNQIIEQVAPLVLKFMEHEYDSVTQQCFLFVSQYLSVLKKQFALGGKPGSAIAVNSK
                     RLPIDPPHEMFLTSLLLAGFKKMRIDESCDEDSEDEIDEFFDTIRSKLKVFQDSVAMI
                     NPALYLQNISNHIQECLSKVDWRDLELGIYQMHNLSESIRNNLFGIGKQEIANSEATM
                     VMTKFMSVLLQNSSVFQMESPYVQVLFFELVVRHYQFLGSDEKDELALLNIFCSPFGM
                     FNKREKVRLRTWYLFTRLIKTTRLKLTTPVLSQILIKISPLLGIRAIPPNPDGTDYDT
                     TFDNQLYLFEGVGFLIGGNSDCNYDIIDEILSPLFAGLETCISSQLQSPDIVLQSHHL
                     LMAIGTLARGVHGGLVPDNQVNNALVSKKLIHKSLIEKFSNIAEVVLVSFSYFNKHEN
                     VRDASRFTFSRLIPILNSDIVSFASKLIALFLESELSTVEMCDFLGFLGQMIHMFHTD
                     NGCYELFDNLLTPVIDKVHAIIDRIDQESALETESWYNGSTPAVTNPEAAGGTRDNNG
                     KNVVVTDSFRDKIQLKKAYYGFLQSFISNSITSLLLTDRNRVTLSTILMDLLVFIPQE
                     IQETSTIKLALNVLTNFVKCFGSGKCTDPNDMHASDIGSLEGLNEFFITKIVPLVFEI
                     PFKPDYKFNIRDGSCRVVACDLSRLLKELYIQCGGGTDPMANPSLKYMGQVYFPQIQF
                     PSDMGLELIQALALADSKDFEKYYVNLINNLT"
     gene            complement(<161725..>162303)
                     /locus_tag="ZYRO0G02068g"
                     /db_xref="GeneID:8205880"
     mRNA            complement(<161725..>162303)
                     /locus_tag="ZYRO0G02068g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498049.1"
                     /db_xref="GeneID:8205880"
     CDS             complement(161725..162303)
                     /locus_tag="ZYRO0G02068g"
                     /note="highly similar to uniprot|P47119 Saccharomyces
                     cerevisiae YJR069C HAM1 Protein of unknown function that
                     is involved in DNA repair mutant is sensitive to the base
                     analog 6-N-hydroxylaminopurine while gene disruption does
                     not increase the rate of spontaneous mutagenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498094.1"
                     /db_xref="GeneID:8205880"
                     /db_xref="GOA:C5DZ77"
                     /db_xref="InterPro:IPR002637"
                     /db_xref="InterPro:IPR027502"
                     /db_xref="InterPro:IPR029001"
                     /db_xref="UniProtKB/TrEMBL:C5DZ77"
                     /translation="MVDIVFVTGNANKLKEVQMLLAPEEGVPPPFTLTNNPLDLLEVQ
                     DASLEAIGIAKCKQAVQELGKGQAVFVEDTALRFDEFNGLPGAYIKWFLKSMGLDKIV
                     KLLEPFSNKGAEAVTTIVYADEQGQFHTFQGITRGNIVPSRGPTTFGWDSIFEPLESN
                     GKTYAEMEKTEKNLISHRGKAFQDFKKFLYAQ"
     gene            complement(<162473..>163441)
                     /locus_tag="ZYRO0G02090g"
                     /db_xref="GeneID:8205881"
     mRNA            complement(<162473..>163441)
                     /locus_tag="ZYRO0G02090g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498050.1"
                     /db_xref="GeneID:8205881"
     CDS             complement(162473..163441)
                     /locus_tag="ZYRO0G02090g"
                     /note="highly similar to uniprot|P47120 Saccharomyces
                     cerevisiae YJR070C LIA1 Protein that binds to the
                     C-terminal domain of Hyp2p (eIF5A) has four to five
                     HEAT-like repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498095.1"
                     /db_xref="GeneID:8205881"
                     /db_xref="GOA:C5DZ78"
                     /db_xref="InterPro:IPR004155"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR027517"
                     /db_xref="UniProtKB/TrEMBL:C5DZ78"
                     /translation="MSTDFERRLEEQVDDCSLEQLRDILVNKSGQTQLTNRFRALFNL
                     KCAAEEFESKPEDASKAAKYIAEAFNDDSELLKHEVAYVLGQTKNFECVPYLKDCVLN
                     LNQQCMVRHEAAEALGALGDQSSLDVLEKVQKEDPSLEVRETCELAIDRIKWQHSEAG
                     AKERLQPSLYSSIDPAPPLALEQNYDIPELQKLLNDKKKPLFERYRAMFRLRDFGTDE
                     AALALATGFDDDSALFKHEIAYVFGQMGNTCIVPKLIEVLGRRNEEPMVRHEAAEALG
                     SIASDDVVPVLKGYLNDEVAVVRESAHVALDMYEYENSNELEYAPA"
     gene            <163931..>164776
                     /locus_tag="ZYRO0G02112g"
                     /db_xref="GeneID:8205882"
     mRNA            <163931..>164776
                     /locus_tag="ZYRO0G02112g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498051.1"
                     /db_xref="GeneID:8205882"
     CDS             163931..164776
                     /locus_tag="ZYRO0G02112g"
                     /note="similar to uniprot|P36040 Saccharomyces cerevisiae
                     YKL206C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498096.1"
                     /db_xref="GeneID:8205882"
                     /db_xref="InterPro:IPR016562"
                     /db_xref="InterPro:IPR019151"
                     /db_xref="UniProtKB/TrEMBL:C5DZ79"
                     /translation="MTRTLLIPLVSTGNVPQLTTDLVLHSLSKEFQFVKCLDSTYLHP
                     FVGPLDYVFEQQEPVLFNKSNVNKNYSTALELFYNESRSLYVIQQRTPVIQGYLNNFV
                     KEIICPLVQEFKITDVVILDSFGALDEDIVANTSRTSKTNSFYSDAICQVRSVGEVVR
                     EMESGLHLNPASEQQSNNNVISTLFQFTNDSVQQEVSTRQQAFKFAYHLLNSPVSELQ
                     RIKYCSAFVHEGDNSYDAHLLCDHLPNVIEGFAKINVHTPPISWKGVYGTRPIPTSFD
                     EGIYI"
     gene            complement(<164812..>165969)
                     /locus_tag="ZYRO0G02134g"
                     /db_xref="GeneID:8205883"
     mRNA            complement(<164812..>165969)
                     /locus_tag="ZYRO0G02134g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498052.1"
                     /db_xref="GeneID:8205883"
     CDS             complement(164812..165969)
                     /locus_tag="ZYRO0G02134g"
                     /note="highly similar to uniprot|P47122 Saccharomyces
                     cerevisiae YJR072C NPA3 Cytoplasmic protein required for
                     cell viability identified by association with
                     pre-ribosomal particles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498097.1"
                     /db_xref="GeneID:8205883"
                     /db_xref="GOA:C5DZ80"
                     /db_xref="InterPro:IPR004130"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZ80"
                     /translation="MPLKTVICIGMAGSGKTTFMQRLNSHMRSKQNPPYVINLDPAVL
                     KVPYGANIDIRDSIKYKKVMENYGLGPNGAIVTSLNLFSTKIDQVIKLVENKRDKIEH
                     CIVDTPGQIECFVWSASGSIITESFASTFPTVIAYIIDTPRNSSPTTFMSNMLYACSI
                     LYKTKLPMILVFNKTDVCSADFAKEWMTDFEAFQRALRDDQEVNGNSGLGSGYMGSLI
                     NSMSLMLEEFYSQLDMVSVSSFTGQGFDDFLNVVDNGKINEYDQYYKVERERVLKLKE
                     EKEKQRKDKSLEGLMNDLGINDKKKSKDEDDSADVVSDLEEGENDGLVVPDEFEDTER
                     EYTFAPSDRTQGEVNAQSAPDLQKAYEEAANRVGKSASSETAENIARYLRQ"
     gene            complement(<166192..>166995)
                     /locus_tag="ZYRO0G02156g"
                     /db_xref="GeneID:8205884"
     mRNA            complement(<166192..>166995)
                     /locus_tag="ZYRO0G02156g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498053.1"
                     /db_xref="GeneID:8205884"
     CDS             complement(166192..166995)
                     /locus_tag="ZYRO0G02156g"
                     /note="similar to uniprot|P36039 Saccharomyces cerevisiae
                     YKL207W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498098.1"
                     /db_xref="GeneID:8205884"
                     /db_xref="GOA:C5DZ81"
                     /db_xref="InterPro:IPR002809"
                     /db_xref="InterPro:IPR008568"
                     /db_xref="UniProtKB/TrEMBL:C5DZ81"
                     /translation="MALSVWSVWSLITAGSAGAVAELTLDPKLKYWVLLPISIVMVLT
                     GILRQYIMDLIAPNTKGVPRVKLTESQWIYKAQALLANGSNLSAEAFQLRKEHLIEVL
                     AGGKYLVKLNTDGQAPSPLSDPNLSENMFSMAKGNLANFIPQTIIMWWVNHFFAGFVL
                     MKLPFPLTPRFKEMLQSGVMTADLDVRWVSSISWYFISVLGLNPVYNLLLSDTESIDI
                     NAAQQPPTMGGPGEPQPEAVMKGLANDLTIAENESCFDDIEQRVLEKYS"
     gene            complement(<167163..>167834)
                     /locus_tag="ZYRO0G02178g"
                     /db_xref="GeneID:8205885"
     mRNA            complement(<167163..>167834)
                     /locus_tag="ZYRO0G02178g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498054.1"
                     /db_xref="GeneID:8205885"
     CDS             complement(167163..167834)
                     /locus_tag="ZYRO0G02178g"
                     /note="weakly similar to uniprot|P36038 Saccharomyces
                     cerevisiae YKL208W CBT1 Subunit of complex involved in
                     processing of the 3' end of cytochrome b pre-mRNA involved
                     in RNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498099.1"
                     /db_xref="GeneID:8205885"
                     /db_xref="UniProtKB/TrEMBL:C5DZ82"
                     /translation="MCRNYQLLKALDAPRFVYRYSRTRSTVPRLQNKLECRVLAQRYS
                     KYLSEYNTFALFQWHSPKDLKFDKDYFWKEFAHDVSSSNQNAIFLEDKVHNEAMNNSL
                     KSSIISPSDDTEYRCTFQTVSEPHPIEYMLRLTGKPNTKLQLHTLGLRTEGNIIASYI
                     QSLLEESENMYKDLSYEKLLSIAKRSRSDRDKPIKELLNNLAENGITNSRIMGTEQWL
                     VLSKA"
     gene            168123..168194
                     /locus_tag="ZYRO0G02200r"
                     /db_xref="GeneID:8205886"
     tRNA            168123..168194
                     /locus_tag="ZYRO0G02200r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (CGT) cove score=77.16"
                     /db_xref="GeneID:8205886"
     gene            complement(<168322..>168972)
                     /locus_tag="ZYRO0G02222g"
                     /db_xref="GeneID:8205887"
     mRNA            complement(<168322..>168972)
                     /locus_tag="ZYRO0G02222g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498055.1"
                     /db_xref="GeneID:8205887"
     CDS             complement(168322..168972)
                     /locus_tag="ZYRO0G02222g"
                     /note="similar to uniprot|P05375 Saccharomyces cerevisiae
                     YJR073C OPI3 Phospholipid methyltransferase
                     (methylene-fatty-acyl-phospholipid synthase) catalyzes the
                     last two steps in phosphatidylcholine biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498100.1"
                     /db_xref="GeneID:8205887"
                     /db_xref="GOA:C5DZ83"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR024960"
                     /db_xref="UniProtKB/TrEMBL:C5DZ83"
                     /translation="MGLEEKFQDLQSIYMELLNDVDFDKPSFRITMYFIIFNPVFWNI
                     VARLEYHTHFLSRFTGSARSGCYTLAGSIFLLGLGRDVYFRRALNDQPKSALLDDDRI
                     AVAGRFLAIIGQVLVATSMWKLRITGTYLGDYFGILMDEIVTDFPFNVSSNPMYQGST
                     LTFIGYTLMEGKAAGLLLSFMVYSMYYFALKFEEPFTAMIYAKRDEERANRKKKVT"
     gene            <169369..>173190
                     /locus_tag="ZYRO0G02244g"
                     /db_xref="GeneID:8205888"
     mRNA            <169369..>173190
                     /locus_tag="ZYRO0G02244g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498056.1"
                     /db_xref="GeneID:8205888"
     CDS             169369..173190
                     /locus_tag="ZYRO0G02244g"
                     /note="similar to uniprot|P12866 Saccharomyces cerevisiae
                     YKL209C STE6 ATP-binding cassette (ABC) transporter
                     required for the export of a-factor catalyzes ATP
                     hydrolysis coupled to a-factor transport contains 12
                     transmembrane domains and two ATP binding domains
                     expressed only in MATa cells"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498101.1"
                     /db_xref="GeneID:8205888"
                     /db_xref="GOA:C5DZ84"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZ84"
                     /translation="MGFHNNIYSYLQGKKDVILLGFVSASTIASGLVPAALSILTGRV
                     FNLLNEYTQWSDPIHELRLRSMVILALGAGSIVIIWICISSWMLLGERQNFRVRTQLI
                     DSYLQKPMKWYDDNDTLTGDLTQTNRCVEELRSSSAEASALTWKNLVTILALTVTSFY
                     YSWSLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLSWSMEAAQLVRLS
                     CMQLVEVQNFQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFWFGSTMIRKHK
                     LRIEDVITCFQSCVLLGATINGTLHQIVILQKGKVGVINVNEFLKKDEYLKEDFKNNR
                     RFYLDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGSGKSSLGN
                     LLLKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFGSKETD
                     ELVRDESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMRDTP
                     ILVLDEAVSALDIIHRGLLMNAIRNWRSEKTTIILTHDLSEIGPDDMIYLLEDGEVVE
                     QGQQRNLLLNQQGRFFNMVSLGAGTDLADSSSLITTIEIPGRFKTSTYEDSLIEYELN
                     TPRIDEDSGSLMEICSIPLDDFSHRQKDRSKAPRVTIQEKLNEKDLSSDEKGSEKDRS
                     QDLMSILEIMKRMYSSSSRKGVLYLGIVCSLYAGISNPIFSYTFSYLLNGIVPDGNSD
                     RGSSGYLLKWAFIVMGIAAADSGLTLLKEFILGYHSEIYIRTLRDDAMRKITYNRIEW
                     LTQDNNKPSELSALLMNDLRDLRTSTSNFISFVSSFVIVSSVGLIWAIVTGWKLSLVC
                     ISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEVVTGMKTIRCLQIEDHFKAK
                     FNVLKQTAKLMGQRRAIVTGFGVAVSNGLTMSIQGILYYYAIKLVIHGEYTTKKMFET
                     FTLLLFTIMTCNNLVNQIPDIRRGQRAASKIYRILEGIDESECFETEGHRIVPIVENP
                     TGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGESGCGKSTLVNIITRLYE
                     CPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENLVYGSPLGTADVDVFN
                     MLKYVGIYDFFATLPEGLETKIDSGLLSGGQNQRLCIARALLQRPKILILDECTSALD
                     TMSSHIINEIIREGPPTMLTISITHDEQMVRACNKVAVLDQGHIVEMGNREDLLRQKG
                     QLWKLVTRIGD"
     gene            complement(<173494..>176529)
                     /locus_tag="ZYRO0G02266g"
                     /db_xref="GeneID:8205889"
     mRNA            complement(<173494..>176529)
                     /locus_tag="ZYRO0G02266g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498057.1"
                     /db_xref="GeneID:8205889"
     CDS             complement(173494..176529)
                     /locus_tag="ZYRO0G02266g"
                     /note="highly similar to uniprot|P22515 Saccharomyces
                     cerevisiae YKL210W UBA1 Ubiquitin activating enzyme
                     involved in ubiquitin-mediated protein degradation and
                     essential for viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498102.1"
                     /db_xref="GeneID:8205889"
                     /db_xref="GOA:C5DZ85"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR018075"
                     /db_xref="InterPro:IPR018965"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:C5DZ85"
                     /translation="MSAGEIDESLYSRQLYVLGKEAMLKMQHSNVLIIGLKGLGAEIA
                     KNVALAGVKSLSLYDPQPVTIQDLSTQFFLTESDIGKQRATVSREKLAELNSYVPIKV
                     VDSLIDEKSLLEFEVVVATETVSLQEKVNLNNLCHAAGIGFISTETRGLFGNVFVDLG
                     DEFTVLDPTGEEPRSGIVSDIEPDGTVTMLDENRHGLEDGNYVKFSEVEGLEKLNDGS
                     LFKVEVLGPFAFRIGPVSQYGKYIKGGIFTEVKQPQKLSFKTLQQSFAEPEYLFSDFA
                     KMERTPQLHLAFQALQQFASTHGGELPRPLNASDAAEVVKHAQQIAAHEPNVLGGAPV
                     DEKVIAELSYQARGDLPGIVAFFGGLVAQEVLKACSGKFSPLKQYMYFDALEALPEQK
                     QFVRTEETTKPINSRYDNQIAVFGLEFQRKIANLSVFLVGSGAIGCEMLKNWALLGLG
                     TGSEGGIVVTDNDSIERSNLNRQFLFRPKDVGRNKSEVAAQAVAAMNPDLTGKIDAKI
                     DKVGPETESIYNDQFWESLDLVTNALDNVDARTYVDRRCVFYRKPLLESGTLGTKGNT
                     QVVVPLLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFSDAPENVNM
                     YLTQPNFVEQTLKQSGDVKSILETISDSLNHKPIKFDDCIAWARLEFQKKFNHDIQQL
                     LYNFPKDAKTSNGAPFWSGPKRAPTPLKFDINNPDHLHFIVAAANLRAFNYGLTGDSG
                     APNLEHYKQVLSKINVPEFSPRSDVKIQVNDDDPDPNSDRGENDLSVLAGSLPEPSQM
                     AGYKLDPVEFEKDDDTNHHIEFITACSNCRAENYFIEPVDRQKTKFIAGRIIPAIATT
                     TGLVTGLVNIELYKIADAKTDVEKYKNGFSNLALPFFGFSEPIHSPKGEYNGKSYDRI
                     WDRFDINGDIKLNDLIKHFQEKESLDITMLSYGVSLLYASFFPPKKLKERLNLTITEL
                     VKFITKSEVPPHVRTMILEICADDKDGEDVEVPYITIHL"
     gene            <176807..>177319
                     /locus_tag="ZYRO0G02288g"
                     /db_xref="GeneID:8205890"
     mRNA            <176807..>177319
                     /locus_tag="ZYRO0G02288g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498058.1"
                     /db_xref="GeneID:8205890"
     CDS             176807..177319
                     /locus_tag="ZYRO0G02288g"
                     /note="similar to uniprot|P47123 Saccharomyces cerevisiae
                     YJR074W MOG1 Conserved nuclear protein that interacts with
                     GTP-Gsp1p which is a Ran homolog of the Ras GTPase family
                     and stimulates nucleotide release involved in nuclear
                     protein import nucleotide release is inhibited by Yrb1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498103.1"
                     /db_xref="GeneID:8205890"
                     /db_xref="InterPro:IPR007681"
                     /db_xref="InterPro:IPR016123"
                     /db_xref="UniProtKB/TrEMBL:C5DZ86"
                     /translation="MKPVSLYGGALRTVLPPGFIDASLLRPVPDTQEVYVNGRQEGED
                     YGDGLGLNESITVDLLERIEASNDEDALKEHVTEIFDLNGSTNCQMDQLHRINSSVYA
                     CIAHDVNLVLCVGLIRLPQYGTDVVITINVPGQAVRTGEELPKEVQATNKVLTTILNQ
                     FEVVDGSLFV"
     gene            <177479..>178666
                     /locus_tag="ZYRO0G02310g"
                     /db_xref="GeneID:8205891"
     mRNA            <177479..>178666
                     /locus_tag="ZYRO0G02310g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498059.1"
                     /db_xref="GeneID:8205891"
     CDS             177479..178666
                     /locus_tag="ZYRO0G02310g"
                     /note="similar to uniprot|P47124 Saccharomyces cerevisiae
                     YJR075W HOC1 Alpha-1 6-mannosyltransferase involved in
                     cell wall mannan biosynthesis subunit of a Golgi-localized
                     complex that also contains Anp1p Mnn9p Mnn11p and Mnn10p
                     identified as a suppressor of a cell lysis sensitive
                     pkc1-371 allele"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498104.1"
                     /db_xref="GeneID:8205891"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DZ87"
                     /translation="MAKSREGVTLKRLLLFIIPSIACLVLLFRFFNNSKAADLQKLLQ
                     NLPKEISQSINLAASHQKSDADLIQSFENLANELKKKQEDQAREFERHRQELEKKLQE
                     LKLSPEHATLREKLAYNFRYDERKRFPAYIWQIGGVSGTEELKNLEEQERNWRDKNPG
                     FVHEIVTDEMMNALVRHYFSSVPDVINAYNALPSKVLKVDFFKYLILLARGGVYADID
                     TDPLQPVPNWIPENMDPANIGLIVGVEHEAESPDWRSRYVRRLQLGTWIIQAKPGHPV
                     IREVVANITETTLQRKNEGTLNINLRSDKNIMTWTGSGVWTDVIFSYLNDYLRSGNTD
                     RITWGWFNQLKEPRQIADILAFPPFSFNAPKTINNDDVNKPLYLIHHQAKKSWKTVPK
                     LEN"
     gene            complement(178700..178813)
                     /gene="SNR64"
                     /locus_tag="ZYRO0G02332r"
                     /db_xref="GeneID:8205892"
     ncRNA           complement(178700..178813)
                     /ncRNA_class="snoRNA"
                     /gene="SNR64"
                     /locus_tag="ZYRO0G02332r"
                     /product="snR64"
                     /note="C/D snoRNA monocistronic SNR64"
                     /transcript_id="XR_002648429.1"
                     /db_xref="GeneID:8205892"
     gene            complement(<179058..>180305)
                     /locus_tag="ZYRO0G02354g"
                     /db_xref="GeneID:8206807"
     mRNA            complement(<179058..>180305)
                     /locus_tag="ZYRO0G02354g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498060.1"
                     /db_xref="GeneID:8206807"
     CDS             complement(179058..180305)
                     /locus_tag="ZYRO0G02354g"
                     /note="highly similar to uniprot|P32458 Saccharomyces
                     cerevisiae YJR076C CDC11 Component of the septin ring of
                     the mother-bud neck that is required for cytokinesis
                     septins recruit proteins to the neck and can act as a
                     barrier to diffusion at the membrane and they comprise the
                     10nm filaments seen with EM"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498105.1"
                     /db_xref="GeneID:8206807"
                     /db_xref="GOA:C5DZ88"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZ88"
                     /translation="MASIIEASSTLRKRKHLKRGINFTVMVVGQSGTGRSTFINTLCG
                     QQVVDVSTTVMLPTDTSTDIELQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNTPS
                     FELISDYIRHQYDEILLEESRVRRNPRFKDGRVHACLYLINPTGHGLKEIDVEVMRQL
                     GPIVNVIPVISKSDSLTPEELKLNKRLIMDDIDKFQLPIYYFPFDEDDISDEDYRTNT
                     YLRSLTPFSIIGSNDVDELPDGTVIRGRKYPWGTLDVEDASISDFVVLRNTLLISHLH
                     ELKDYTHEILYERYRTEALSGESVPHTRSSSRTNDVDSRRGAPSQSYGTQQQHANGSD
                     HTLPPSNNESAPHRQESNSQDTYLAREEQIKLEEERLRAFEERVQQELIYKRKELLMR
                     EQELRDIEDRLEKEARMKQELDL"
     gene            <180544..>182091
                     /locus_tag="ZYRO0G02376g"
                     /db_xref="GeneID:8205893"
     mRNA            <180544..>182091
                     /locus_tag="ZYRO0G02376g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498061.1"
                     /db_xref="GeneID:8205893"
     CDS             180544..182091
                     /locus_tag="ZYRO0G02376g"
                     /note="highly similar to uniprot|P00937 Saccharomyces
                     cerevisiae YKL211C TRP3 anthranilate synthase Component II
                     and indole-3-phosphate (multifunctional enzyme)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498106.1"
                     /db_xref="GeneID:8205893"
                     /db_xref="GOA:C5DZ89"
                     /db_xref="InterPro:IPR001468"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013798"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DZ89"
                     /translation="MTNIITSMKTHQYSSILEIIPLIPPSKALHINMAARKVILIDNY
                     DSFTWNVYQYLCEGGADVEVYRNDKITVDGIIALNPDMLVISPGPGHPKTDSGISRDC
                     IRKFAGKIPIFGICMGEQCMFDVFGGQVEYAGEIVHGKTSLVNHDNKGLFKNIPQGVA
                     VTRYHSLAGSAVTVPEELEVSATLENGIIMGVRHKKYTIEGVQFHPESILTEEGHLMI
                     ENMLNVYGGTWEENEKKDTRGQSGSILDRIYAQRREDVDAQSHIAGFTTKDLETNFQL
                     GLAPTVQDFYQRLKNSPGRAAVLAEVKRASPSKGDICPDANSAQQALRYAKAGAATIS
                     VLTEPHWFKGSLQDMINVRKALDVEFSSNPKGRPCVLRKEFVFCKYQILEARLAGADT
                     VLLIVKMLSQDELVELYQYATKEMGFEPLVEVNTKQEMERALQIGAKIIGVNNRDLHS
                     FTVDLDTTSNLVDSVPKDVLLIALSGITTAQDAEKYKSEGVHGFLVGEALMRSSDPST
                     FIRQLTA"
     gene            complement(<182333..>184201)
                     /locus_tag="ZYRO0G02398g"
                     /db_xref="GeneID:8205894"
     mRNA            complement(<182333..>184201)
                     /locus_tag="ZYRO0G02398g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498062.1"
                     /db_xref="GeneID:8205894"
     CDS             complement(182333..184201)
                     /locus_tag="ZYRO0G02398g"
                     /note="similar to uniprot|P32368 Saccharomyces cerevisiae
                     YKL212W SAC1 Lipid phosphoinositide phosphatase of the ER
                     and Golgi involved in protein trafficking and secretion"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498107.1"
                     /db_xref="GeneID:8205894"
                     /db_xref="GOA:C5DZ90"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:C5DZ90"
                     /translation="MGGPLLFAKTSEGLLFRSTTPSKKDAVIHLSDQEQAVRVEGLEE
                     FPVEGNITKIPALLGFIRLKLNKYAVIASKVEEAGRINDHLIHKVVEHLIVPAKEKAR
                     IDSDESEYLRLLKLQLNKATLYFSYTYDLTNSFQRNASITKPSWKTTDSRFFWNHYLT
                     QELQELSAKDAAAGEFIQPVIYGYVKLVDYIFRSTPISVGLISRRSRFRAGTRYFRRG
                     IDEQGNVSNFNETEQVLVVQTNTASVSHLFSFLQTRGSVPVYWAEINDLKYKPQLVLK
                     EGSSLDAAEKHFAEQKALYGENYLVNLVNQSGHELPVKDAYESTVNALDDPKIHYVYF
                     DFHHECSGMKWHRVKLLIDHLSNMGLKNSDFFHAIISSEGTIKRVVNEQKSAVRTNCM
                     DCLDRTNVVQSVLAHWVLQKELETAGVIPDDEPWENSSSLLLAFQSLWADNADAVSCS
                     YSGTGALKTDFTRTGKRTKMGALNDFINSATRYYKNNLSDGPRQDSYDLFLGNFRPYM
                     ASLKSPFADSRPFSVQVIPLVLYAALTVLGATVVFPKGEFTSKKNMAFFLGASVIFAF
                     AFFNLVTDGIQYVNWPKLVDVGFLVTQHSRNKDKSHEGVKYIKNPRFMKPGASKKD"
     gene            <184509..>186686
                     /locus_tag="ZYRO0G02420g"
                     /db_xref="GeneID:8205895"
     mRNA            <184509..>186686
                     /locus_tag="ZYRO0G02420g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498063.1"
                     /db_xref="GeneID:8205895"
     CDS             184509..186686
                     /locus_tag="ZYRO0G02420g"
                     /note="similar to uniprot|P36037 Saccharomyces cerevisiae
                     YKL213C DOA1 WD repeat protein required for
                     ubiquitin-mediated protein degradation forms complex with
                     Cdc48p plays a role in controlling cellular ubiquitin
                     concentration also promotes efficient NHEJ in
                     postdiauxic/stationary phase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498108.1"
                     /db_xref="GeneID:8205895"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR015155"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DZ91"
                     /translation="MYQLSATLQGHTQDVKDVVVLSNEQLGSVSRDGSVMIWNLGTDG
                     QWQGIVVQKRDLFVNSCCYRSQDAIVFYGSKDGLINGVPVYGKLGEDPVYTLIGHGSN
                     VCCLSTDGDNVLSGSWDKTAKVWENGVVKWDLQGHSASVWDIKAIPTMPGHYLTASAD
                     KTIKLWQGSQCIKTFTGIHDDVVRHLEIINSDEFVSCSNDGKIKISNFQGVVQRTLEG
                     HESFVYSVKAFPNGDLVSCGEDRSVRIWTSSGHLKQVITVPAISVWCVDILPNNDIVV
                     GTSDSILRVFTQDEKRIASQEQIKEFQEQLQGSSINSQVMGVDESKLSPFEVLQAPGK
                     KEGQIVVVKAPNGVVEAHQYSQGQWMKVGDVVSSSGSDQKKEFQGKLYDYVFDVDIEE
                     GQPPLKLPVNANDNAYTVADQFLARYDLPASYRDQVVNFIFQNTSGVSLDPTGAPGGS
                     AVPQQPAQPTQTIQPPPLAEGLKILPVKQYLSLTNYNPDSIFMGITKLNAKEQTFSDE
                     DLAQMGTALHDLEHNWEVLYLFALTMRSKWAVKTPAYDILRLVVSKLSSSDDISEFVE
                     EGLGNKNIAIAMLTVRIFANCFQNEKWGIDLLSSPKVYNSLFETIETNFEDAKAQQLQ
                     NLAIAVATLLFNYSALIVQDPVKLADAVAPISDALNTKFGTHETFQASEEAAYRLLVA
                     FGNLSTVEPTLKQFAGSISWIKNIKAYYGNIPRFQDILVDIGA"
     gene            <186876..>187553
                     /locus_tag="ZYRO0G02442g"
                     /db_xref="GeneID:8205896"
     mRNA            join(<186876..186917,187086..>187553)
                     /locus_tag="ZYRO0G02442g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498064.1"
                     /db_xref="GeneID:8205896"
     CDS             join(186876..186917,187086..187553)
                     /locus_tag="ZYRO0G02442g"
                     /note="some similarities with uniprot|P36036 Saccharomyces
                     cerevisiae YKL214C YRA2 Member of the REF (RNA and export
                     factor binding proteins) family when overexpressed can
                     substitute for the function of Yra1p in export of poly(A)
                     mRNA from the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498109.1"
                     /db_xref="GeneID:8205896"
                     /db_xref="GOA:C5DZ92"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /translation="MSVDNVLDKLVDEKKYRRRDLRNSLASRIGIEDRPSSTPREPPK
                     KRLRFTNVPLDVSDFTLEDMVKEFAEPIYCNFYDLKDSRTAVFEFEDPSVMERVVEKY
                     NETPLNGGTVTVEIFEQERRPDRRRRTQRDNRRGNGRGSRGSHYKRQDRPAMEDELNA
                     ELEDYMKSS"
     gene            <190261..>192108
                     /locus_tag="ZYRO0G02486g"
                     /db_xref="GeneID:8205897"
     mRNA            <190261..>192108
                     /locus_tag="ZYRO0G02486g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498065.1"
                     /db_xref="GeneID:8205897"
     CDS             190261..192108
                     /locus_tag="ZYRO0G02486g"
                     /note="similar to uniprot|Q0P727 Saccharomyces paradoxus
                     HDF2 HDF2 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498110.1"
                     /db_xref="GeneID:8205897"
                     /db_xref="GOA:C5DZ93"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR005161"
                     /db_xref="InterPro:IPR006164"
                     /db_xref="InterPro:IPR016194"
                     /db_xref="InterPro:IPR024193"
                     /db_xref="UniProtKB/TrEMBL:C5DZ93"
                     /translation="MAECSGFIVDVSPHMIQHDNVSKVQAYLEYSLLEKCKRKRKTDW
                     ISCYLANCAISKNSQGIEGVFQVQDWVAPVTITETLRVLRQLQSYSQDLRDGNVTNPS
                     SSASSSMVQCLLVSSLDCRDHFHVRKMRRQLVVFTDDMEGLDLSDEEVGVLAEELNLS
                     IILVDCRVENHRNGSAVPDYGIWGKLVDVIEGSRIYHVNDLLREISSLPSGVVRPVMV
                     FSGELRLGADVAVHTDQDSQDDEHSLTIKVEGYPATKAVSSISRKMVVKREIHGKDVY
                     KPVKSVVEYEIQGDDEKSLPIQVSPKSIAKAYRYGADYVVLPSSLEDPPRKYASRPGM
                     DILGFIDQKALPRHFLHSESRFITADTRYGGVQDVVALSALVDALKESNQLAIVRFVA
                     KPTSDVQVGVLCPIHVEDNHTLVYCRLPFAEDQRVSDFPRLVNRTTTSGKKIEQDKSQ
                     GNIDSMMSKYIDAFDMDNEPQTEENHYYKLMEGPSSTNLPLPQLPAHPGRVKPDTELV
                     DEDPLIVPAIHLHRTQQVLLEWIHLCIINESKFYVPEMPDFLANKISSRYEPSPELDE
                     SIARLKKLLDIKRSRRRGSSREDQDEESDVADQDIPDLQSLLSRGQRDY"
     gene            <192411..>194120
                     /locus_tag="ZYRO0G02508g"
                     /db_xref="GeneID:8205898"
     mRNA            <192411..>194120
                     /locus_tag="ZYRO0G02508g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498066.1"
                     /db_xref="GeneID:8205898"
     CDS             192411..194120
                     /locus_tag="ZYRO0G02508g"
                     /note="highly similar to uniprot|P37012 Saccharomyces
                     cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
                     conversion from glucose-1-phosphate to glucose-6-phosphate
                     which is a key step in hexose metabolism functions as the
                     acceptor for a Glc-phosphotransferase and to YKL127W
                     uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
                     Phosphoglucomutase, minor isoform; catalyzes the
                     conversion from glucose-1-phosphate to glucose-6-
                     phosphate, which is a key step in hexose metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498111.1"
                     /db_xref="GeneID:8205898"
                     /db_xref="GOA:C5DZ94"
                     /db_xref="InterPro:IPR005841"
                     /db_xref="InterPro:IPR005843"
                     /db_xref="InterPro:IPR005844"
                     /db_xref="InterPro:IPR005845"
                     /db_xref="InterPro:IPR005846"
                     /db_xref="InterPro:IPR016055"
                     /db_xref="InterPro:IPR016066"
                     /db_xref="UniProtKB/TrEMBL:C5DZ94"
                     /translation="MSFSVETVATKAFQDQKPGTSGLRKRTKVFAEEPNYTENFIQAI
                     LEAIPEGVKDSVLLVGGDGRYYNDVVLQKIAAIGAANGVKRLVVGQNGILSTPAASHV
                     IRSYSKAKVTGGIILTASHNPGGPNNDFGIKYNLANGGPAPENVTNAMWEASKRLTSY
                     KIVTDFPHVDLSALGEKQYGSLTVDVIDSTKAYVDFLKTIFDFPLIKSFVNHQRETKN
                     WKLLFDGLNGVTGPYGRAIFADELGLPEDEVLQNCHPKPDFGGLHPDPNLTYARTLVD
                     RVDRENIAFGAASDGDGDRNMIYGAGPAFVSPGDSVAIIAEYASEIPYFQREGIYGLA
                     RSFPTSQAIDLVAKHHNLSCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHIREKD
                     GLWAIIAWLNILAIYHKRNPEKDVSIKTIQDEFWDKYGRTFFTRYDYENVSGEAANRV
                     IEFFQNFVSQPGVKGSNFPLDESLKVVDAGDFEYKDLDGSVSSNQGLFLKLSNGVRTV
                     LRLSGTGSAGATIRLYVEQYSDDASKYGLTAEEFLRPAIQQLVSFFKFQEILGTETPT
                     VKT"
     gene            <194463..>196577
                     /locus_tag="ZYRO0G02530g"
                     /db_xref="GeneID:8205899"
     mRNA            <194463..>196577
                     /locus_tag="ZYRO0G02530g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498067.1"
                     /db_xref="GeneID:8205899"
     CDS             194463..196577
                     /locus_tag="ZYRO0G02530g"
                     /note="highly similar to uniprot|P12688 Saccharomyces
                     cerevisiae YKL126W and highly similar to uniprot|P18961
                     Saccharomyces cerevisiae YMR104C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498112.1"
                     /db_xref="GeneID:8205899"
                     /db_xref="GOA:C5DZ95"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR017892"
                     /db_xref="UniProtKB/TrEMBL:C5DZ95"
                     /translation="MYYWKISKFKFGKNKDDKEAEKEKEKEKNGNHKSHNGVFHHHKD
                     SSRHNDGNDTVNGDNNNEIGSMRPSSERKETIVPSNSSIAPVRLSHDASSTSSTVRES
                     SGGRSSDDAFNSTPDTHRSDDPSPPEISITAPAQSTSTPGILTIKVYNGDGFTLPFPI
                     TSNEQILGKLLSSGVTSKRSSLSGEVDGLVSQLSRMQLQNQGPVDENLLPGDVSTRFI
                     PSTIMLPGSEHLNPLLYFTIEFDNTVATIEPEYGSMVQPVFNKISTFDVTRKLPYFKI
                     DVFARIPSILLPSKTWQQEMGARDEKLRDMFNKINTNQDIHLDSFLLPVNLKIDSAAN
                     IRLYNHHWVRLENGLGNINFSVDYKPSKNKSLSIDDFDLLKVIGKGSFGKVMQVKKKD
                     TQKVYALKAVRKSYIVSKSEVTHTLAERTVLARVECPFIVPLKFSFQSQEKLYLVLAF
                     INGGELFYHLQKEGRFDLSRARFYTAELLCALETLHGLDVIYRDLKPENILLDYQGHI
                     ALCDFGLCKLNMKDKDKTDTFCGTPEYLAPELLLGQGYSKIVDWWTLGVLLYEMLTGL
                     PPYYDEDVPKMYKKILQEPLRFPDGFDHDAKDLLIGLLSRDPKRRLGYHGAEEIRSHP
                     FFSQLSWKRLLMKGYIPPYKPPVSSAMDTSNFDQEFTREKPIDSVVDEYLSESVQKQF
                     GGWTYVGNEQLGSSMIQGRSIR"
     gene            <196897..>198798
                     /locus_tag="ZYRO0G02552g"
                     /db_xref="GeneID:8205900"
     mRNA            join(<196897..197067,197137..>198798)
                     /locus_tag="ZYRO0G02552g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498068.1"
                     /db_xref="GeneID:8205900"
     CDS             join(196897..197067,197137..198798)
                     /locus_tag="ZYRO0G02552g"
                     /note="some similarities with uniprot|P36070 Saccharomyces
                     cerevisiae YKL125W RRN3 Required for transcription of rDNA
                     by RNA Polymerase I DNA-independent RNA Polymerase I
                     transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498113.1"
                     /db_xref="GeneID:8205900"
                     /db_xref="InterPro:IPR007991"
                     /db_xref="UniProtKB/TrEMBL:C5DZ96"
                     /translation="MMAFENSGKRPGQDSMGLELKKRKVEFALPDETDDDKEFTTEMY
                     RRFLKSALGDLEKNDSSQLDMVTHRVSQPANSDSRISTENLGILLDVLAKNINKIDTS
                     KGTPLIQSIINFEKWWELPPYTLSKYILFIRILCSSIPKWWQDVSISLISGFHLPPEK
                     TEKHHSMLKYFLQMIPSSMGYIDVYLAKFFPNNNDTSKKLVNYISNILTLTTYCKELQ
                     FQAWSLIMEKTISLDVALQNELDELDDDIDDFEESEEEEEEDDDEEEEEDDEEEEDDG
                     DRIKSVQDEDDDSDEDEDAMEGEEEYNVEVSQSIKDLSTKLDNILTLVSSRLGKDVTP
                     QSLMTGEGVTIFNTLTTLFKSHVLPTYYTKSIQYIMFHISQQQAELMDAFLVTLIDIS
                     FSPTETSEKKIKSLQYLGSYIARAKKLSRTQIIFVASYLTSWLNRYVLEREEEVDQPG
                     GMERFKHFYAAFQALCYIFCFRYQMFRDPDGSWECELDKLFPRMVITKFNPLKYCNEN
                     VMLMFARIAQHEDVAFCFSIIENNNNERLRGIIGRGDSNQKSSSQPVAASTWSLATRQ
                     QFIDLQSYFPYDPLFLKHYKRMMKDYYIEWSEAGGEYESDEYED"
     gene            <199099..>200814
                     /locus_tag="ZYRO0G02574g"
                     /db_xref="GeneID:8205901"
     mRNA            <199099..>200814
                     /locus_tag="ZYRO0G02574g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498069.1"
                     /db_xref="GeneID:8205901"
     CDS             199099..200814
                     /locus_tag="ZYRO0G02574g"
                     /note="similar to uniprot|P32343 Saccharomyces cerevisiae
                     YKL124W SSH4 Suppressor of SHR3 confers leflunomide
                     resistance when overexpressed (putative) involved in ER
                     functions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498114.1"
                     /db_xref="GeneID:8205901"
                     /db_xref="InterPro:IPR001870"
                     /db_xref="InterPro:IPR003877"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="UniProtKB/TrEMBL:C5DZ97"
                     /translation="MFLPLDDESVVSFYKTELDGVNDPYPGPPIDDSGTISLAFLISL
                     SVTFALLMVVLVVVAIYVTFCGADEAEYDEETGAGSRGSNGGLQAFFSKRRSGILLDS
                     SFTSPGQFDDEAALQQQEDQELPRMSDFEVELYRHAKEFQKMNPPNVKEFGTFLNETD
                     LQFIRDRGLQSYFFLPSINDNTDADGNFLPSLLVQDKLDVTFTKFNKSSSTVLNYPLP
                     FNKKAAVYFEVKVFKHVSDSNSIFSIGLTTCPYPYFRIPGMSIYSIAYESTGKLRINN
                     PFTPSTLLPKLQEGDVVGFGYRYRTGTIFITHNGKKLMDVTQNVGIDLFISLGSMNGA
                     FTRTYTRDGLLEDPDNIELRSALAENRDIELPKDLQRVHDVRQEGDLPTDEVELNVNL
                     GQLGFVFVEANVKKYAFGSLFGEIGIPPSYNGAEIKKDTVLQKGEDLPPKYADDEDPD
                     SFFGNININVGNSVERSRQQQQLGQREEEEAEESQDEWQRNQSEISRIVNPNTNTNTN
                     ETGYERNTSAYDREHNLTDEETEPRANEEERPLIKQSKPTSGSRSNAKKKRNKNKNKK
                     KRSKK"
     gene            complement(<200939..>201391)
                     /locus_tag="ZYRO0G02596g"
                     /db_xref="GeneID:8205902"
     mRNA            complement(<200939..>201391)
                     /locus_tag="ZYRO0G02596g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498070.1"
                     /db_xref="GeneID:8205902"
     CDS             complement(200939..201391)
                     /locus_tag="ZYRO0G02596g"
                     /note="similar to uniprot|P32342 Saccharomyces cerevisiae
                     YKL122C SRP21 Component of the signal recognition particle
                     (SRP) ribonucleoprotein (RNP) complex that functions in
                     protein targeting to the endoplasmic reticulum (ER)
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498115.1"
                     /db_xref="GeneID:8205902"
                     /db_xref="UniProtKB/TrEMBL:C5DZ98"
                     /translation="MSVKPIDSFISQSVGLFEANPSQTTFAISYKNRLPAQLPQVSFK
                     THNPHLNCHYKFQTCKSKDVSRLLSALGPRGVTVTLGKVERTKKLKKLPKRHRKQSRV
                     KDVVGLSSLMVNTDVKEYVPPAVQETSGASAKPDAKKKKSKSKNKKKR"
     gene            <201987..>204629
                     /locus_tag="ZYRO0G02618g"
                     /db_xref="GeneID:8205903"
     mRNA            <201987..>204629
                     /locus_tag="ZYRO0G02618g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498071.1"
                     /db_xref="GeneID:8205903"
     CDS             201987..204629
                     /locus_tag="ZYRO0G02618g"
                     /note="similar to uniprot|Q03177 Saccharomyces cerevisiae
                     YMR102C Protein of unknown function transcription is
                     activated by paralogous transcription factors Yrm1p and
                     Yrr1p along with genes involved in multidrug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498116.1"
                     /db_xref="GeneID:8205903"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DZ99"
                     /translation="MRSNGISHHEEELSKPTFGEKFGRSSKESDLNLTSDMGKGHHRN
                     HQEKSNLNQEFPADLRPLGFKRHADPELSKTPKQPPASLAKVRERLVKNGGSNGAANA
                     GTTENIIRGVLGLIDRDQFEEYLKNPPYIKLMKKGKNLKQFRRLFLAQELRIQGENVN
                     GTVPTKGEQSDSKAIWVNKFSVNGKYMAAGSKDGSIWIWKVLSSPVERWEMDYKEEIH
                     AAVKRKTSILQQHHNSNLPSNGSSSNLSKKGQKLAEKNGKETEKLSEKLSATNLYAPV
                     FKPQPYRIYREHGSSVLDLDWSQNGFLVSASMDKAVKLWHVEREQSLKTFLHPDFVTC
                     IKFYPLDDRFFVSGCLDHKCRMWSILDDEVIFEFDCEDLITSMVLTPETGDYTILGTF
                     NGYIYILETYGLRLVSSFHVKDKETQNHHVSQGLSPGSKHHHGPRVTYLQYFKSPNDE
                     SSKLMTVSNDSRVRIFDLKTKKCVEILRGFESGASQHSAQLVTSSSQAIVVSGSNDHW
                     VYGWKLQSASIPSDKLQRNATSKRSGSIKRSGSLRNLLNKNKSKTVPESSGTDFKNDN
                     NGRHNHRTHNPLNLKNIIKHGHNNGSDQYIKNNYSISFHAHHSPVTTANLAPPETSKA
                     LSLSNDLICELSSLLYKNDDELGLVGISKNLQKSSNDTSDDSDVEPTDWDSSINLPND
                     RVVPSSIDAIGTILITTDTTGLIRIFRADMPSAIRRRVLNRLENPPQNENPHKNKSGS
                     TDSLTSIQNVARSNSLNGGINGLSSPQTANGHNSSTFSPQSASDSFNQPRPPLRNRRS
                     CSVFRNALLSQSNTSIASLKRSSLSSNPGEGDRGRSNSSVGHRLRCDVCGGTKFNLLS
                     RGSFSGRENGYYCTDCSTMNNSFR"
     gene            <205008..>205985
                     /locus_tag="ZYRO0G02640g"
                     /db_xref="GeneID:8205904"
     mRNA            <205008..>205985
                     /locus_tag="ZYRO0G02640g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498072.1"
                     /db_xref="GeneID:8205904"
     CDS             205008..205985
                     /locus_tag="ZYRO0G02640g"
                     /note="similar to uniprot|P32332 Saccharomyces cerevisiae
                     YKL120W OAC1 Mitochondrial inner membrane transporter
                     transports oxaloacetate sulfate and thiosulfate member of
                     the mitochondrial carrier family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498117.1"
                     /db_xref="GeneID:8205904"
                     /db_xref="GOA:C5DZA0"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DZA0"
                     /translation="MSGAEPPYEEMKRASELSPAQKVSKFGSFVAGGLAACVAVTVTN
                     PIELVKTRMQLQGEMSATNQQVYKNPIQAMVIIFRNEGFVSLQKGLLAAYVYQIALNG
                     SRLGLYEPSRGFVNKIFYPDEEPHKVQNPAINVFCGAAAGVFGAVLGSPLYMVKTRLQ
                     SYSSTVSIGEQTRYNGVWDGLKTVYRGEGIKGLFRGIEAAMLRTGVGSAVQLPIYNVV
                     KGFIKDNDLMREGTSLHLTASTVAGIGVGIAMNPWDVILTRIYNQKGDLYKGPIDCFI
                     KTVKIEGPGALYKGFQAQLFRIAPHTILCLTMMEKTMNLVYNIEQRTFA"
     gene            <206222..>207262
                     /locus_tag="ZYRO0G02662g"
                     /db_xref="GeneID:8205905"
     mRNA            <206222..>207262
                     /locus_tag="ZYRO0G02662g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498073.1"
                     /db_xref="GeneID:8205905"
     CDS             206222..207262
                     /locus_tag="ZYRO0G02662g"
                     /note="similar to uniprot|Q03175 Saccharomyces cerevisiae
                     YMR101C SRT1 Cis-prenyltransferase involved in dolichol
                     synthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498118.1"
                     /db_xref="GeneID:8205905"
                     /db_xref="GOA:C5DZA1"
                     /db_xref="InterPro:IPR001441"
                     /db_xref="InterPro:IPR018520"
                     /db_xref="UniProtKB/TrEMBL:C5DZA1"
                     /translation="MRVPGFVRSRIIAPSDPAAAEVSSKVLKQIYPIIDKIVSWLRAF
                     QLFIKLQQLLQNLLINILAAGPVPQHISFIMDGNRRFAKKMNMPVKRGHEAGGVTLLS
                     LCYVLKKMGVRCVSAYAFSIENFNRPPEEVNALTNMFAVKLDEFARKANDYRDPLYQS
                     RLKIVGDHSLISEEMREKIKRVEEMTNDGDEFTLFICFPYTSRNDIWHATQTSVEECV
                     QQSLEPRALTVEEFNKKMYLNDYSHKCDLLIRTSGHLRLSDYMLWQVHESGDIKFSPT
                     LWPDFKFFQLYLMILNWSFFTTIQRYIFHGSKKSQSKPAFWNRKKSSKYSLEDLPAAP
                     VAVSITGERDPS"
     gene            complement(<207259..>207888)
                     /locus_tag="ZYRO0G02684g"
                     /db_xref="GeneID:8205906"
     mRNA            complement(<207259..>207888)
                     /locus_tag="ZYRO0G02684g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498074.1"
                     /db_xref="GeneID:8205906"
     CDS             complement(207259..207888)
                     /locus_tag="ZYRO0G02684g"
                     /note="similar to uniprot|P32341 Saccharomyces cerevisiae
                     YKL119C VPH2 Protein involved in vacuolar H -ATPase
                     assembly or function required for the biogenesis of a
                     functional vacuolar ATPase (V-ATPase) but not part of the
                     final enzyme complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498119.1"
                     /db_xref="GeneID:8205906"
                     /db_xref="InterPro:IPR021013"
                     /db_xref="UniProtKB/TrEMBL:C5DZA2"
                     /translation="MFQIKLNDQLKRHIEELKKSNASNKELDMILEKDCVSIEALIKM
                     YEDHWQNRVPLSQLLKPLNFQFKPKRIARSDYKPEFKEYLENLKLQQQEKDYQQLISA
                     NRELSTYEDEDKPLTPAQINRELKEQVTTVFNILVSVVSVAFAFWYWSGSSSGMALHY
                     RVLISLFFGILILIAEVVVYNSYLQRVSDAKAKEKVKTERTKVVKRIVI"
     gene            complement(<208111..>210192)
                     /locus_tag="ZYRO0G02706g"
                     /db_xref="GeneID:8205907"
     mRNA            complement(<208111..>210192)
                     /locus_tag="ZYRO0G02706g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498075.1"
                     /db_xref="GeneID:8205907"
     CDS             complement(208111..210192)
                     /locus_tag="ZYRO0G02706g"
                     /note="similar to uniprot|Q03162 Saccharomyces cerevisiae
                     YMR100W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498120.1"
                     /db_xref="GeneID:8205907"
                     /db_xref="GOA:C5DZA3"
                     /db_xref="InterPro:IPR002893"
                     /db_xref="UniProtKB/TrEMBL:C5DZA3"
                     /translation="MRDSNHRSVLANRPVVTITSTVYDRRALDLNSNVPLINSLNHLT
                     YLTSNSGKVRETIANDGALERLVSILHGCHIPLYGLLQLDLKKISKHRRAKMVSKQKN
                     LAMCAWKWTLAFQCLVLTGTRGTEQIRKKVVLSGVVPVLATVLDNYLLYHKNYDHLKG
                     TKIDVDLRSLDSEQSYRQLRKGEDESFAEYLEYLTGREDLRLSEDPDFISEDLRSISA
                     TLPSDFADIWSTFNEHGQSSADENSGGNSNGNDDGLLDKEVSDDTCFMVDEDNKLSIS
                     IPRDFFLGRIIPKQDDVIWSLQLLAFISKYTYMKQQLQNVRLIESLSFRSVVERVHKR
                     RNGNNNNKIPTKMCSPVLSPLSNTHEFDIPILEQEEDPFLVELQELANKCKQAQREKE
                     FDGVVPIQNPYQYYNKGLPSPKVSPRIKRENQLVENFKNKWNYKNLVTDLDDETWAYS
                     SLKESLNLFPLVERYTVSSKNPHDMVYWSSVIMRNSCRKNEVTGVRQCANFACGKWED
                     YPRQFAKCRRCKRTKYCSRDCQLKAWTYHRYWCHEVGSGMNTAASNTGANTPGGSTAS
                     SSAHVPTGHNGTIMAIGNTNGTITDTEVTGTDAGVTGLGVHLRGANVGQTTDVTTTIT
                     NNVGVNRTTAIAATNATTTNTTNNSTDINNDRNSTNNPGMGTTRRIPNVALDQEDDMI
                     TTDDNDNDNFT"
     gene            210549..210621
                     /locus_tag="ZYRO0G02728r"
                     /db_xref="GeneID:8205908"
     tRNA            210549..210621
                     /locus_tag="ZYRO0G02728r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.19"
                     /db_xref="GeneID:8205908"
     gene            <210982..>211284
                     /locus_tag="ZYRO0G02750g"
                     /db_xref="GeneID:8205909"
     mRNA            <210982..>211284
                     /locus_tag="ZYRO0G02750g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498076.1"
                     /db_xref="GeneID:8205909"
     CDS             210982..211284
                     /locus_tag="ZYRO0G02750g"
                     /note="similar to uniprot|Q82BJ9 Streptomyces avermitilis
                     SAV5706 Hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498121.1"
                     /db_xref="GeneID:8205909"
                     /db_xref="InterPro:IPR007138"
                     /db_xref="InterPro:IPR011008"
                     /db_xref="UniProtKB/TrEMBL:C5DZA4"
                     /translation="MVAKVLFAQMKAVAGQQEFVAQALTKMAENVRKEPGNVRFEVYT
                     LPDGTFHVEETYKDEAAFQAHMGTQHGKEFNASIVDKVEGGGSTVVFMTPVSTTQA"
     gene            <211637..>212143
                     /locus_tag="ZYRO0G02772g"
                     /db_xref="GeneID:8205910"
     mRNA            <211637..>212143
                     /locus_tag="ZYRO0G02772g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498077.1"
                     /db_xref="GeneID:8205910"
     CDS             211637..212143
                     /locus_tag="ZYRO0G02772g"
                     /note="similar to uniprot|P28707 Saccharomyces cerevisiae
                     YKL117W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498122.1"
                     /db_xref="GeneID:8205910"
                     /db_xref="InterPro:IPR007052"
                     /db_xref="InterPro:IPR008978"
                     /db_xref="UniProtKB/TrEMBL:C5DZA5"
                     /translation="MPLTPEVLWAQRSSDSDAEKNYLLVTIAIPDCEEPKLKLEPNYL
                     EFSAKNKGHVGDEASHQYHLHIDFFKEVVPEKSLHKVENGLSYFLKIYKKDLDAEYWP
                     RLTKEKVKYTNIKTDFNKWVDEDEQETAPADAGDFGDLMGGGTPDLEALKAQLGQTGG
                     LDQGEEEE"
     gene            complement(<212229..>213119)
                     /locus_tag="ZYRO0G02794g"
                     /db_xref="GeneID:8205911"
     mRNA            complement(<212229..>213119)
                     /locus_tag="ZYRO0G02794g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498078.1"
                     /db_xref="GeneID:8205911"
     CDS             complement(212229..213119)
                     /locus_tag="ZYRO0G02794g"
                     /note="highly similar to uniprot|Q03161 Saccharomyces
                     cerevisiae YMR099C ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498123.1"
                     /db_xref="GeneID:8205911"
                     /db_xref="GOA:C5DZA6"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR025532"
                     /db_xref="UniProtKB/TrEMBL:C5DZA6"
                     /translation="MSVEDLGDRVVLTHPDDKSNTATILKYGATVFSWKLNGAEQLWL
                     SDAAKLDGSRPVRGGIPLVFPVFGKNTTDDHLSKLPQHGLARNSTWEFLGQTKSNPPT
                     VQFALSPENANKELTQLWPFDFTLLLTVQLGQDYLKTDIEVQNPSTTQELKFNWLFHT
                     YLKIEDIEGTLVSNLTGVKLYDQLLKQSYIDKHPVITVSDETDLIYQNVDENRLIQVV
                     DRGQPVHTVKRHNLPDAVVWNPWTEKAGGMADFEPKDGYLQMVCIEPGHVHDLVTLAP
                     GQSWSAYQLLYKEQLKYQAI"
     gene            complement(<213421..>214980)
                     /locus_tag="ZYRO0G02816g"
                     /db_xref="GeneID:8205912"
     mRNA            complement(<213421..>214980)
                     /locus_tag="ZYRO0G02816g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498079.1"
                     /db_xref="GeneID:8205912"
     CDS             complement(213421..214980)
                     /locus_tag="ZYRO0G02816g"
                     /note="similar to uniprot|P28708 Saccharomyces cerevisiae
                     YKL116C PRR1 Protein kinase with a possible role in MAP
                     kinase signaling in the pheromone response pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498124.1"
                     /db_xref="GeneID:8205912"
                     /db_xref="GOA:C5DZA7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="UniProtKB/TrEMBL:C5DZA7"
                     /translation="MSDEVQGPPTPRIQQQEFKTQSNPKVPTYQAPSSTSSDSPMNKE
                     PSGAHPNLLKVNTDLPVSSPQELEQQRTPLSLVISSFDNVQTLPTPMAYTPPAIQPRS
                     PIDQLHVVKRRDPNRARNLNLSPGKQQRYLSEIFPLPDSSVQRVNSLPTVSETATLDT
                     ALADSATEDEKPLLDVGEDILTGYLVDHYKEPLYWRKLDEIGSGNFSTVFRYESLDQA
                     HAELRQVAVKRIKYPEELIRGKCDDDSDTKYKELLSRLESSLTRELSVLKSLSHPCVV
                     KLFGINNPTFLQSGKPLRDLMNQNSGLPPCDMIMSYCAGGDLLTAAADCNGKIEMWLI
                     QRIFAELTLAVKYLHESHVIHRDLKLENVLLKYPLPALIGMKDSPLFLQTNFIELADF
                     GLCKRIKPGELSTARCGSEDYVSPEILMGVPYDGRLSDTWALGVILYGLLECRLPFDP
                     PPNATARQRNRATAHRIARFDWKWYQWANADIPAKEIVENTLARKTNRWMIDKIYESQ
                     FVKEAATQFAF"
     gene            complement(<215365..>216456)
                     /locus_tag="ZYRO0G02838g"
                     /db_xref="GeneID:8205913"
     mRNA            complement(<215365..>216456)
                     /locus_tag="ZYRO0G02838g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498080.1"
                     /db_xref="GeneID:8205913"
     CDS             complement(215365..216456)
                     /locus_tag="ZYRO0G02838g"
                     /note="highly similar to uniprot|P22936 Saccharomyces
                     cerevisiae YKL114C APN1 Major apurinic/apyrimidinic
                     endonuclease 3'-repair diesterase involved in repair of
                     DNA damage by oxidation and alkylating agents controls
                     spontaneous mutations"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498125.1"
                     /db_xref="GeneID:8205913"
                     /db_xref="GOA:C5DZA8"
                     /db_xref="InterPro:IPR001719"
                     /db_xref="InterPro:IPR013022"
                     /db_xref="InterPro:IPR018246"
                     /db_xref="UniProtKB/TrEMBL:C5DZA8"
                     /translation="MGKDQSEMSKFVRSTTSKYKFGAHISGAGGISNSVTNAYKVGCN
                     AFAMFLKSPRKWVSPAYSKDEIEKFKENCKKCNYNPLTDVLPHGQYFINLANPDEEKA
                     QKAYDSFIDDLSRCEQLGIGLYNLHPGSSLKGDHESQLKQLASYLNKAIKETKFVKVV
                     LENMAGTGNLIGSNLKDLKYVIDLIEDKDRIGVCVDTCHTFAAGYDIGTKEAYEKFWK
                     QFDEIIGYQYLKGIHLNDSKAPLGANRDLHEVLGEGFLGLEVFRLISHDEHLQGLPII
                     LETPQPTDEGYGDEVNLLEWLETVSIPEDEELTKKSKELQEKGSKSRKDQIAKYDAKQ
                     KKGTKRSKPDSNNDIAAHLSKQKKVSKKE"
     gene            complement(<216597..>217736)
                     /locus_tag="ZYRO0G02860g"
                     /db_xref="GeneID:8205914"
     mRNA            complement(<216597..>217736)
                     /locus_tag="ZYRO0G02860g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498081.1"
                     /db_xref="GeneID:8205914"
     CDS             complement(216597..217736)
                     /locus_tag="ZYRO0G02860g"
                     /note="highly similar to uniprot|P26793 Saccharomyces
                     cerevisiae YKL113C RAD27 5' to 3' exonuclease 5' flap
                     endonuclease required for Okazaki fragment processing and
                     maturation as well as for long-patch base-excision repair
                     member of the S. pombe RAD2/FEN1 family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498126.1"
                     /db_xref="GeneID:8205914"
                     /db_xref="GOA:C5DZA9"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR023426"
                     /db_xref="InterPro:IPR029060"
                     /translation="MGIKGLNAIISEHVPSAVRKSDIKAFFGRKVAIDASMSLYQFLI
                     AVRQQDGAQLSTESGETTSHLMGMFYRTLRMIDNGIKPCYVFDGKPPILKSFELKKRS
                     DKRVDTEKKLEEAVDQAEKLKQERRLVKVSPEHNDEAKYLLKLMGIPYIVAPCEAEAQ
                     CAQLAKDGKVYAAASEDMDTLCYKTPYLLRHLTFSEAKKEPIHEIDTELVLQGLELTQ
                     EQFVDLGIMLGCDYCESIRGIGPVTALKLIKEHGSLEKIVEFIESGQANNKWKVPEDW
                     PYNEARQLFLNPDVVNSQDINLKWNPPDEEKLIEFLCHEKKFNEERVKSGIKRLQKGL
                     KSGVQVRLDGFFQKVPKTKEQLAAATAKAKAAKKTKGKTGKVSKR"
     gene            218040..218111
                     /locus_tag="ZYRO0G02882r"
                     /db_xref="GeneID:8205915"
     tRNA            218040..218111
                     /locus_tag="ZYRO0G02882r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=55.70"
                     /db_xref="GeneID:8205915"
     gene            <220115..>221710
                     /locus_tag="ZYRO0G02904g"
                     /db_xref="GeneID:8205916"
     mRNA            <220115..>221710
                     /locus_tag="ZYRO0G02904g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498082.1"
                     /db_xref="GeneID:8205916"
     CDS             220115..221710
                     /locus_tag="ZYRO0G02904g"
                     /note="similar to uniprot|P12630 Saccharomyces cerevisiae
                     YIL015W BAR1 Aspartyl protease secreted into the
                     periplasmic space of mating type a cells, cleaves and
                     inactivates alpha factor allowing cells to recover from
                     alpha-factor-induced cell cycle arrest and to YLR121C
                     uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YLR120C
                     uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
                     Aspartic protease, attached to the plasma membrane via a
                     glycosylphosphatidylinositol (GPI) anchor and to YDR144C
                     uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
                     GPI-anchored aspartyl protease (yapsin) involved in
                     protein processing; shares functions with Yap3p and Kex2p
                     and to YIR039C uniprot|P40583 Saccharomyces cerevisiae
                     YIR039C YPS6 Putative GPI-anchored aspartic protease,
                     member on vGLC.1466."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498127.1"
                     /db_xref="GeneID:8205916"
                     /db_xref="GOA:C5DZB0"
                     /db_xref="InterPro:IPR001461"
                     /db_xref="InterPro:IPR001969"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DZB0"
                     /translation="MKWTILFAACCVLLSETVQCISVRHYLEEEEASSPKLVKFSFNK
                     HQGRTFTASEELSKRDKDVTFDLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPG
                     SDNPYCKESSSFSISNQGKENGAEGPFQTLPGGVTATNMSGGSTASATLDCKEFGTFN
                     REDSKTFHSNDTEFSVSYGDTSYAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIM
                     GIGLSNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSIL
                     FGAVDHSKYSGQLYTVPMLNLYQQQGLKDPLQLQVTLQGVGIEANNMTNTTSTTPVPA
                     LLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDCSRVDNTNLYFNFGGFNIVSN
                     MSTYVVSRSNENSCVLGLQPGGPEAAILGDMFMQHAYIVFDLDDFEISMAQANYAGGK
                     NQLEAVTQQVPSAMKAPGYSHTFSGSQGITGGGNIFYATSYSSSSGSSTSTRTWSGRN
                     AAVDLAPAPMLAFFAHFIYSFLI"
     gene            <222200..>223378
                     /locus_tag="ZYRO0G02926g"
                     /db_xref="GeneID:8205917"
     mRNA            <222200..>223378
                     /locus_tag="ZYRO0G02926g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498083.1"
                     /db_xref="GeneID:8205917"
     CDS             222200..223378
                     /locus_tag="ZYRO0G02926g"
                     /note="some similarities with uniprot|P14164 Saccharomyces
                     cerevisiae YKL112W ABF1 DNA binding protein with possible
                     chromatin-reorganizing activity involved in
                     transcriptional activation gene silencing and DNA
                     replication and repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498128.1"
                     /db_xref="GeneID:8205917"
                     /db_xref="GOA:C5DZB1"
                     /db_xref="InterPro:IPR006774"
                     /db_xref="UniProtKB/TrEMBL:C5DZB1"
                     /translation="MTSLYEYRHPIINKSLASSADENAGRRFPTLESWYQVVNDYEFQ
                     ARCPIILKNSHRNKHFTFACHLKDCPFKVLLSYCGGQRSIEEEDEDRSNGLVPLDKKD
                     GGEKLKNGNGTGAGAGGSATNPGGEDAEDDDVSAAIAAAVAAVQDSRHTKDEYEENSG
                     VRGPFVVTKIEPYHNHPLESNLTLQEFVLTKVPRILQHDLNFDQILESLCNEDDNTVS
                     KFRVSQYVEESGLLDILKERYGLTDAEIDKKLLSQISRRVTTYKARFVLKKKKNGEYG
                     TDANNFQYRQPRVRREPEILDADAQEAQAAAQAAIGEAVALKRHIDEEEETPRKRQMV
                     KLDEVMPLEDTQDDKLPRDVAEQLRLLSSHFKDVEAQTAEEKKEDISDENIQPELRGQ
                     "
     gene            <223577..>225328
                     /locus_tag="ZYRO0G02948g"
                     /db_xref="GeneID:8205918"
     mRNA            <223577..>225328
                     /locus_tag="ZYRO0G02948g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498084.1"
                     /db_xref="GeneID:8205918"
     CDS             223577..225328
                     /locus_tag="ZYRO0G02948g"
                     /note="similar to uniprot|Q03153 Saccharomyces cerevisiae
                     YMR098C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498129.1"
                     /db_xref="GeneID:8205918"
                     /db_xref="GOA:C5DZB2"
                     /db_xref="InterPro:IPR025210"
                     /db_xref="InterPro:IPR025656"
                     /translation="MLRISRALRGSRTVGLVRARSVLSSNSTSLRYFSRLPTCYQEKT
                     NNSTTTIPWYLKVGDRERALKQSIFKAQEINYPSNSPDSLRHISQYLCDELGLSDIII
                     FDLRKGEFETAAAKISDFMVIATARSPKHCQTSFDKLNSLIKQEYESVAYVEGQFNAR
                     EEKKRQRRLARKPKLSSNSTSNVPTESWFLIDCKVDKIFVNILTENRRQEINLEELYA
                     PEHERHKYERKESSVEGREAPQEDDILAGLRRLVNQRRQYSTVAPSVVLCRQLLANLE
                     SSDFNGAISLINNNREYSLNFMKTIHDWVSGLEIDAAKEIPWKKWVTTFESCWPLVLP
                     EESASLYWSLRMNFFKMINIADKEHYNINQFFNDYLLAKKSLGYPITSQDLIEFFKLT
                     IINVRGDGEKSRGYWEIVNRNALVSRALRLVEDVKDGNSIVQDGTLVSMLLRTMVSGE
                     EEVPNHMLHATYEVIDYLVDTFGAAMDPTAIGGVLEVLAAARSWNKYMAFWEAGVGGL
                     VPGEDHRPWSQFIKLVVDSGDSEMIRKLLSEGHLLWLKRFEVKMTDDIKEQLDRLFEK
                     GYSQGLWFEELKEHIYV"
     gene            complement(<225370..>226311)
                     /locus_tag="ZYRO0G02970g"
                     /db_xref="GeneID:8205919"
     mRNA            complement(<225370..>226311)
                     /locus_tag="ZYRO0G02970g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498085.1"
                     /db_xref="GeneID:8205919"
     CDS             complement(225370..226311)
                     /locus_tag="ZYRO0G02970g"
                     /note="similar to uniprot|P34253 Saccharomyces cerevisiae
                     YKL110C KTI12 Protein associated with the RNA polymerase
                     II Elongator complex involved in sensitivity to G1 arrest
                     induced by Kluyveromyces lactis toxin zymocin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498130.1"
                     /db_xref="GeneID:8205919"
                     /db_xref="InterPro:IPR013641"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZB3"
                     /translation="MPLVLFTGFPSTGKSTKARELVELLQKRIQNDPSLASKNYKVIL
                     HSDESLGIKHSDYSTSQGERKLRSEIFSAVRRDLSKSNVVVVDSLNYIKGFRYQLHCE
                     VKGSSTTYCLINTMCPIDSIHDWNKNRKDPWDEDLLEQLIQRYEEPNANNRWDSPLFP
                     ILSTQDSMESWIDDICSALFRTAAGKGSSDHRDPLSKALQAPNNATILKPASQSNFIQ
                     ILDSQTGNVVKKIMDHVRLLNSLGGSSGGERIIVSEVTDINDEKCCFVDLPPQSVTLP
                     HLQRLKRQFVNFNKLRDLDQDRIVPLFAEYLNKNLND"
     gene            <226466..>227461
                     /locus_tag="ZYRO0G02992g"
                     /db_xref="GeneID:8205920"
     mRNA            <226466..>227461
                     /locus_tag="ZYRO0G02992g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498086.1"
                     /db_xref="GeneID:8205920"
     CDS             226466..227461
                     /locus_tag="ZYRO0G02992g"
                     /note="similar to uniprot|Q03151 Saccharomyces cerevisiae
                     YMR097C MTG1 Peripheral GTPase of the mitochondrial inner
                     membrane essential for respiratory competence likely
                     functions in assembly of the large ribosomal subunit has
                     homologs in plants and animals"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498131.1"
                     /db_xref="GeneID:8205920"
                     /db_xref="GOA:C5DZB4"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZB4"
                     /translation="MPKFIPRFDFPRYNIPIADFKGHQLKALRRFEKLKPQFHLVLEL
                     RDLRAPLSTRNVLLDQVVDKRHHERLVIYTKRDCFPSSSPYLDRLAQWHAELEENFLM
                     VDSRHRNASNHILRCIHWHHELHREKNYGLAPPLGFKVLVTGMPNVGKSTLINSMRGS
                     SGKVARTGSEAGVTRSTSESIKIGQDGNGVYLIDTPGVGLPARLSDANRMLALTLCGC
                     VKRSLVDPWIQADYLLYLMNLQLPYGTDNIKEAERKLSTYPGALEEPTNDLEVVLNRL
                     RRHPRESDTSVALRWLEEPRSGLVLDPELLLPCADFSMSQHVKQELKHARKAMRK"
     gene            <228069..>228239
                     /locus_tag="ZYRO0G03014g"
                     /db_xref="GeneID:8205921"
     mRNA            <228069..>228239
                     /locus_tag="ZYRO0G03014g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498087.1"
                     /db_xref="GeneID:8205921"
     CDS             228069..228239
                     /locus_tag="ZYRO0G03014g"
                     /note="weakly similar to uniprot|P41902 Saccharomyces
                     cerevisiae YOR031W CRS5 Copper-binding metallothionein
                     required for wild-type copper resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498132.1"
                     /db_xref="GeneID:8205921"
                     /db_xref="UniProtKB/TrEMBL:C5DZB5"
                     /translation="MLSEILNQACVSCKDSCQCGSSCCDNCTKCPCSNKPQCQSCGTN
                     CTCTNGKSCGCH"
     gene            <231742..>233376
                     /locus_tag="ZYRO0G03036g"
                     /db_xref="GeneID:8205922"
     mRNA            <231742..>233376
                     /locus_tag="ZYRO0G03036g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498088.1"
                     /db_xref="GeneID:8205922"
     CDS             231742..233376
                     /locus_tag="ZYRO0G03036g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498133.1"
                     /db_xref="GeneID:8205922"
                     /db_xref="GOA:C5DZB6"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="UniProtKB/TrEMBL:C5DZB6"
                     /translation="MVVVKHLPPIQPYPVQHDAPVHIAPSDNGLGSDQAKRRQGGSRK
                     GLVIRTSKHWVLPPRPKPGRKPSERRRTAPSATAGATAPAATTPAPVTIPAPASATST
                     LASAPTVPTSVPVSASTSSPSAAVPPSTPVSPGTSSIKKDLSKLPIKNINQSSKAHPS
                     ANTASASVSESGCNNNNRDYTNTDDQSANSLTPCVSPSPPKRTKTSLKREIQHIKSEN
                     TKLKQELGLLVGNLQDLKQKCRRVEAHEDSRNNDENVHCNRKRPLDESLAFLKFEEDE
                     ETLPPLLSSNKMKTSSSVSSRTNLTDDEDLLTASSSTPNSLFSLDLQHSHSSSSSCSR
                     SHSKSSPSNEKSQLRFLDTFEQSEFNDKHAEKSMTAPAITATTSANPPTMAPSVELPL
                     SSIKEEESDQFPWIDPAKEEASILDFLQTQQEIYTDPINDKDFFDNSITNNNGNDIND
                     KNDEANGDDNYNNDVTNHNNNTENDDLFQNLSLAAPPTATTTTTACYVPPSLEELMEE
                     QDGGFVNNSNANTTLTNVNDYDDDFDMLRTQVFDMA"
     gene            complement(<233580..>234464)
                     /locus_tag="ZYRO0G03058g"
                     /db_xref="GeneID:8205923"
     mRNA            complement(<233580..>234464)
                     /locus_tag="ZYRO0G03058g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498089.1"
                     /db_xref="GeneID:8205923"
     CDS             complement(233580..234464)
                     /locus_tag="ZYRO0G03058g"
                     /note="highly similar to uniprot|P43545 Saccharomyces
                     cerevisiae YFL059W SNZ3 Member of a stationary
                     phase-induced gene family transcription of SNZ2 is induced
                     prior to diauxic shift and also in the absence of thiamin
                     in a Thi2p-dependent manner forms a coregulated gene pair
                     with SNO3 and uniprot|P53824 Saccharomyces cerevisiae
                     YNL333W SNZ2 and YMR096W uniprot|Q03148 Saccharomyces
                     cerevisiae YMR096W SNZ1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498134.1"
                     /db_xref="GeneID:8205923"
                     /db_xref="GOA:C5DZB7"
                     /db_xref="InterPro:IPR001852"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DZB7"
                     /translation="MSEFKIKSGLAQMLKGGVIMDVVTPEQAKIAERAGACAVMALER
                     IPADMRKSGQVCRMSDPKMIKEIMANVSIPVMAKVRIGHLVEAQILQALEVDYIDESE
                     VLTPADWAHHIAKNEFKVPFVCGAKDLGEALRRIDEGAAMIRTKGEAGTGDVSEAVKH
                     ISKIRGQIQELKKELKTEEQFAQAAKEMRVPVELLKSTLEAGKLPVVNFAAGGVATPA
                     DAALLMQLGCEGVFVGSGIFKSSNPERLARAIVEATTHYNDPLKLLEVSSDLGELMSG
                     QTVDGIRQHGKQLANIGW"
     gene            <235025..>235684
                     /locus_tag="ZYRO0G03080g"
                     /db_xref="GeneID:8205924"
     mRNA            <235025..>235684
                     /locus_tag="ZYRO0G03080g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498090.1"
                     /db_xref="GeneID:8205924"
     CDS             235025..235684
                     /locus_tag="ZYRO0G03080g"
                     /note="similar to uniprot|P43544 Saccharomyces cerevisiae
                     YFL060C SNO3 Protein of unknown function nearly identical
                     to Sno2p expression is induced before the diauxic shift
                     and also in the absence of thiamin and uniprot|P53823
                     Saccharomyces cerevisiae YNL334C SNO2 and uniprot|Q03144
                     Saccharomyces cerevisiae YMR095C SNO1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498135.1"
                     /db_xref="GeneID:8205924"
                     /db_xref="GOA:C5DZB8"
                     /db_xref="InterPro:IPR002161"
                     /db_xref="InterPro:IPR021196"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DZB8"
                     /translation="MTTSNTQGPQSSKTIGVLALQGAFIEHIQHLNRCIEQNSYNLKV
                     IAVRTAEELNQCDALVIPGGESTSMSLIAQRTGMYQPLYEFVHNPSKAIWGTCAGLIY
                     ISKEVSNEKDLLKPLELLEVKVKRNAFGRQAQSFIKDCDFSSFAPGVHDFPAVFIRAP
                     VIEEILDPKHVKPLYSLDNGLIVAAVQNENILATSFHPELAEDDIRFHDWFIKRFVIK
                     Q"
     gene            complement(<235674..>236951)
                     /locus_tag="ZYRO0G03102g"
                     /db_xref="GeneID:8205925"
     mRNA            complement(<235674..>236951)
                     /locus_tag="ZYRO0G03102g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498091.1"
                     /db_xref="GeneID:8205925"
     CDS             complement(235674..236951)
                     /locus_tag="ZYRO0G03102g"
                     /note="similar to uniprot|P35203 Saccharomyces cerevisiae
                     YMR094W CTF13 Subunit of the CBF3 complex which binds to
                     the CDE III element of centromeres bending the DNA upon
                     binding and may be involved in sister chromatid cohesion
                     during mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498136.1"
                     /db_xref="GeneID:8205925"
                     /db_xref="UniProtKB/TrEMBL:C5DZB9"
                     /translation="MDVAFFLGLPIDIRKQVYFHLDGQFVDLGPDIVQGLYFADVIKL
                     PAEPYKPSRHQQLLRKRLYSIFEPYLNIFDYVPSLVDRWLEYSLWLRYDCIVLDCMRL
                     NHLYEGELIGPINLIYLDGRVRVSFFDKNYMLWNWYTYREYAKWIDDENDQIELTYLK
                     LNLEYLRYDLVARILHDMQRDKVLDFVNQIQFEQEDEDDEPIEIDDQDDFETASYRIK
                     DPTVIKVIQTMDLMKGLQRLIFRGDRLYESLVNFHGVRDNPGKTINYMAKKRIVFLQL
                     LQAGSLCKTGVADFTRWENLRELKLVRVGEIDFNKMLLPPNCRLLTVRGAQTLYWWDV
                     VDRIEQMVGDCYTSEVHGNVCHRTLDPKSMNIETFFQCQIIVKDSFQHLNFIKLQDIY
                     ELKGRKIVVPRSLFYNKRILMSGEIGADQIIIV"
     gene            <237122..>238213
                     /locus_tag="ZYRO0G03124g"
                     /db_xref="GeneID:8205926"
     mRNA            <237122..>238213
                     /locus_tag="ZYRO0G03124g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498092.1"
                     /db_xref="GeneID:8205926"
     CDS             237122..238213
                     /locus_tag="ZYRO0G03124g"
                     /note="similar to uniprot|Q75DR2 Ashbya gossypii ABL045W
                     ABL045Wp and weakly similar to YKL108W uniprot|P34252
                     Saccharomyces cerevisiae YKL108W SLD2 Protein required for
                     DNA replication phosphorylated in S phase by S-phase
                     cyclin-dependent kinases (Cdks) phosphorylation is
                     essential for DNA replication and for complex formation
                     with Dpb11p potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498137.1"
                     /db_xref="GeneID:8205926"
                     /db_xref="InterPro:IPR021110"
                     /db_xref="UniProtKB/TrEMBL:C5DZC0"
                     /translation="MSLDQLKIELKTWEYEFQNKNERPPTKDDIKRLPEIKKMYKQYQ
                     ALKRQNTDVSQVPKVVVMPSKNDTSPKKAVTTKKNDFNNVELGPTPQIYGKAISIFEM
                     KLSPVKKALNFEEINETSSDQPVDAVQDDTKRQLEFPSNTPNSSPFKKPKPVELKYYG
                     PNSPLKLEEENIRLSIRNGSPLKRTPQKNMNSNNDLTSFSPSPLVKRPLTKSLLELAK
                     EHEEFLREFNENNGKENIFTQETEDSSDEQHEDDGQVEYQEKKTKKRKILRRLVTSEE
                     SKVVPKDISKELLKLKKQQVNEFLGNEAAEEDEENDHNDTDKANETQTPAPKPKPRKR
                     ASKYNLVSNNFRRLKLPRKHAGNRRWPRR"
     gene            complement(<238354..>239886)
                     /locus_tag="ZYRO0G03146g"
                     /db_xref="GeneID:8205927"
     mRNA            complement(<238354..>239886)
                     /locus_tag="ZYRO0G03146g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498093.1"
                     /db_xref="GeneID:8205927"
     CDS             complement(238354..239886)
                     /locus_tag="ZYRO0G03146g"
                     /note="highly similar to uniprot|Q04305 Saccharomyces
                     cerevisiae YMR093W UTP15 Nucleolar protein component of
                     the small subunit (SSU) processome containing the U3
                     snoRNA that is involved in processing of pre-18S rRNA"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498138.1"
                     /db_xref="GeneID:8205927"
                     /db_xref="GOA:C5DZC1"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR018983"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DZC1"
                     /translation="MSSTRPRIVTAKAPVLPQQTTPEQRYWRQYSSAQLVKEHNSVTH
                     IAFNPVHPHDFAVTSSTRVQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDAT
                     GLVSVYDSYNPRALLVSINASTHPTHVTKFHSHDSKSLVTASDDRITRVWDISQSYEP
                     QLELKGASDYVRSVNFVPAAPHLVMTGSYDGHVRLYDTRVNGAAPVYSLDHGVPVEDI
                     VAVSPTQVASCGGSNFKVWDLTSNKKLYERGNFNKTVTCLDYVESSDSAAQSTLLASS
                     LDGHVKVFDPLDNYRVKFGWKFSGAVLSCALSPGDAQGTKHLVAGMSSGLLAIRTKGK
                     NKQADSLPSTAPRATKSNNYQRMMRGSEYQGDQEYIIHNDKLRQTQRIRAFEKNINQF
                     KWAEALDSAFIPGMAKELTLTVLQELRKRGKIRVALYGRDEASLEPLLNWCLKGIEDV
                     RSAPVVADWIAVVLEMYGSALENSIVLRELVLSLKDKVRQEVYNAKEAQKIEGMLQLL
                     TN"
     gene            <241103..>242923
                     /locus_tag="ZYRO0G03168g"
                     /db_xref="GeneID:8205928"
     mRNA            <241103..>242923
                     /locus_tag="ZYRO0G03168g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498094.1"
                     /db_xref="GeneID:8205928"
     CDS             241103..242923
                     /locus_tag="ZYRO0G03168g"
                     /note="similar to uniprot|P46680 Saccharomyces cerevisiae
                     YMR092C AIP1 Actin cortical patch component probable
                     binding site on actin lies on front surface of subdomains
                     3 and 4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498139.1"
                     /db_xref="GeneID:8205928"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013979"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DZC2"
                     /translation="MSAIELKSVIPPQPSTERNFTTHLSYNESKNAIAYPCGKSAFIR
                     FLGEDEDAVVQFVGHATANVNVVRFSPIPGSEYVASGDDFGKVIVWSFLRDEKTGEFE
                     TKIKAEFEVLAGPISDISWDFEGRRLCVVGEGRDRFGAFISWDTGNSLGEISGHSQKI
                     NACHFKQSRPMRAFTVGDDGSVVFYQGPPFKFTASDRTHHDSGKFVRDVQFSPGAGEH
                     AVTVGYDRRIVCFDGKTGEFIKYIEDQDEPVQGGLFALSWLDATRFVTASADFTLRLW
                     SVTESKCLQKWTLPQSLGHQQVGVVTAKDDQIISLSLDGTLHFFQVGKEGVVKSLKGH
                     NKGITALAVNPLVSGSFDGRVMTWNSEPSEMHSDHTNLVLAIDNSKHPDYATIAWDDT
                     LKVSGTAKHQFKDQPRVAQVASGEGVVAVVTTGESLLIINSFTGEVIQETKLSEPATA
                     VGIGKQFVAIALERSKYIEVFKASDLSVSYKLPTALRAAGSYISFSPSEKYLAVGEVM
                     GKITLFDLETKEIKTSRWAFHTSRINAISWQPSEKEDLVATGSLDTNIFIYSVEKPMK
                     VIKRLNAHKDDITAVLWENPETLVSAGSDACIKKWAVKFE"
     gene            <243282..>244610
                     /locus_tag="ZYRO0G03190g"
                     /db_xref="GeneID:8205929"
     mRNA            <243282..>244610
                     /locus_tag="ZYRO0G03190g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498095.1"
                     /db_xref="GeneID:8205929"
     CDS             243282..244610
                     /locus_tag="ZYRO0G03190g"
                     /note="similar to uniprot|P32832 Saccharomyces cerevisiae
                     YMR091C NPL6 Nuclear protein that may have a role in
                     nuclear protein import"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498140.1"
                     /db_xref="GeneID:8205929"
                     /db_xref="InterPro:IPR013933"
                     /db_xref="UniProtKB/TrEMBL:C5DZC3"
                     /translation="MSDEKELENSIGPQAEEEARPRSRSASARPDYKVDNEEFDLKEE
                     DDDDEYHENEDIDAEENIGDEDADDDFEDKRSRSHKRARADDENKSETEDSRGGSVLP
                     GTPSGIKKPHYSIPVDDMGAPLPVVNEEYDLPDDEEGETKITKNGELLGGRQFLVRSF
                     TLLDKGRRRFMLSTEPARAVGFRDSYLFFQYHPNLYKYIISQEQKNDLIDRSILPYSY
                     RNRQIALVTARSVFKEFGAKIIVNGKNITDDYYATRLREEGHVVEGTYAREPPKKVVR
                     PTDSLDYAIGAINPAKNAVEFFDKRHQTHNSAAAGAASTNKVTATNWLYQHAAACSRF
                     NSDLFYDRVRVLLIEQHGIRDPYTNTLHIPLSTQSTSVVGVRKLPIKRDSRDNDQDYQ
                     IKHETLIADPDLTRIKTGLLGIPSEIYEDVVSDEVKEAIREQQKFEKTLL"
     gene            <245037..>247529
                     /locus_tag="ZYRO0G03212g"
                     /db_xref="GeneID:8205930"
     mRNA            <245037..>247529
                     /locus_tag="ZYRO0G03212g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498096.1"
                     /db_xref="GeneID:8205930"
     CDS             245037..247529
                     /locus_tag="ZYRO0G03212g"
                     /note="similar to uniprot|P40341 Saccharomyces cerevisiae
                     YMR089C YTA12 Component with Afg3p of the mitochondrial
                     inner membrane m-AAA protease that mediates degradation of
                     misfolded or unassembled proteins and is also required for
                     correct assembly of mitochondrial enzyme complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498141.1"
                     /db_xref="GeneID:8205930"
                     /db_xref="GOA:C5DZC4"
                     /db_xref="InterPro:IPR000642"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR005936"
                     /db_xref="InterPro:IPR011546"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZC4"
                     /translation="MLAISRPCLKLLTRSHARPVISRTLAVRPLLVRNFHPASTLLLR
                     KNSPRNNKNNSGDKDQDNNRHEDATDEDLERVRQEVEKYINSVKDNKNVSLEERRKRI
                     DEGVRRLEETITRQEARDQASQTYETEGEEDRKVKNGNPFTFESKKTDEAHEKTNKKK
                     DNEERKNEEMNAFNDPNGSMSNNIGLFQLGLVFLILSFVLSFFNDVEENREITWQDFH
                     SKLLSKGFVSKLIVINKSYVKVLLNDAGKNQAEHNGHDYYHFTLGSVDSFEHKLQKAQ
                     DDLKIEQDFRVPVVYVQEGNWSRAMMQLLPTALMIAGIIWLTRKSASAAGGGRGGIFG
                     MGRSKAKQFNTETDVKVKFKDVAGCDEAKEEIEEFVSFLKEPSRYEKMGAKIPRGAIL
                     SGAPGTGKTLLAKATAGEAGVPFYFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMI
                     FVDEIDAIGKARQKGNFSGANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDR
                     ALLRPGRFDRHVNIDKPELSGRQAIFEVHLKKIKLAGDIFDLKNRLAALTPGFSGADI
                     ANACNEAALIAARNESDSVKLVHFEQAIERVIGGVERNTKLLSPEEKKIVAYHEAGHA
                     VCGWFLKFADPLLKVSIIPRGQGALGYAQYLPGDIYLLSEQQLKDRMTMALGGRVSEE
                     LHFSSVTSGASDDLKKVTRMATAMVTQLGMSPKIGWINYQRKDESDLTKPFSSETGDV
                     IDSEVFRIVQECHDRCTQLLKEQASSVEKVAQLLLEKEVLTREDMISMLGKRPFPERS
                     DAFDKYLNENETRKIEEKEQENTDGEKPNSPA"
     gene            <247798..>249486
                     /locus_tag="ZYRO0G03234g"
                     /db_xref="GeneID:8205931"
     mRNA            <247798..>249486
                     /locus_tag="ZYRO0G03234g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498097.1"
                     /db_xref="GeneID:8205931"
     CDS             247798..249486
                     /locus_tag="ZYRO0G03234g"
                     /note="similar to uniprot|Q04301 Saccharomyces cerevisiae
                     YMR088C VBA1 Permease of basic amino acids in the vacuolar
                     membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498142.1"
                     /db_xref="GeneID:8205931"
                     /db_xref="GOA:C5DZC5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DZC5"
                     /translation="MDDDTAPLIPPESRDEESLEAEYHRYNLSLPKLPILTSLWLGSF
                     IGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALL
                     TAHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKERGSYQG
                     YANIVFGTGQMLGGPIGGLLIDTIGWRAIFAVQVPIIMFCSFLTYKNITIKLSHIPPV
                     SERFTWMNLSRIDIMGSSSLVVVICGILFICSTNWNKVILSTFTIVGFLFFIVTETYF
                     AKECILPLKLLKGASGLCSLVTVLSSFITFGEIFRAPIYYQVVQDMSVTKTGLFVLFP
                     AVSVAVGSVVTGTALRHTKLDLGHYCYLIILRSIFTQLIGLLLAYVVINGTEPTIGAS
                     SSTFAVHWFQFSSDSIWWKILLVSAGCMVSYGYSGLLVATLVSIVCSVEKSEQATLTG
                     IFYLWRSIGSVLGTSLTLVIYENSLTKSLWGAMFGSRNDDSYHYTKKEYYNLIGDSSY
                     LRSHFPVQSIEYLLKAYRGSFLISYLPSIGLAILGIVTSWVLITVNRFSRQKTF"
     gene            complement(<249502..>250284)
                     /locus_tag="ZYRO0G03256g"
                     /db_xref="GeneID:8205932"
     mRNA            complement(<249502..>250284)
                     /locus_tag="ZYRO0G03256g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498098.1"
                     /db_xref="GeneID:8205932"
     CDS             complement(249502..250284)
                     /locus_tag="ZYRO0G03256g"
                     /note="similar to uniprot|Q04299 Saccharomyces cerevisiae
                     YMR087W Putative ADP-ribose-1''-monophosphatase that
                     converts ADP-ribose-1''-monophosphate to ADP-ribose may
                     have a role in tRNA splicing contains an A1pp domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498143.1"
                     /db_xref="GeneID:8205932"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="InterPro:IPR028071"
                     /db_xref="UniProtKB/TrEMBL:C5DZC6"
                     /translation="MKVILCDTNEAICKSWVKFLGRNIRSSSEARFQFHIHHGSLEPL
                     LKGESSTNCAVVSPGNSFGYLGGGFDLAIRNYLGGEKFESWFRQQIGPGYHHVGSSTV
                     VDLGVGSGSGSQIWGNRGIRYIIHVPTMVAPSKPLYDPNFPMRTGYEPVFNATWNSLA
                     SSISLNVDTLIIPGLCSGWVGVPVEVTCKSMCFALRLYAMRNQMSVDLQNALIMYFLK
                     YPFKPFMRSSFKEECRELNINVNQLKNFDAERDSIESIMPGM"
     gene            <250775..>252088
                     /locus_tag="ZYRO0G03278g"
                     /db_xref="GeneID:8205933"
     mRNA            <250775..>252088
                     /locus_tag="ZYRO0G03278g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498099.1"
                     /db_xref="GeneID:8205933"
     CDS             250775..252088
                     /locus_tag="ZYRO0G03278g"
                     /note="similar to uniprot|Q01802 Saccharomyces cerevisiae
                     YKL106W AAT1 Mitochondrial aspartate aminotransferase
                     catalyzes the conversion of oxaloacetate to aspartate in
                     aspartate and asparagine biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498144.1"
                     /db_xref="GeneID:8205933"
                     /db_xref="GOA:C5DZC7"
                     /db_xref="InterPro:IPR000796"
                     /db_xref="InterPro:IPR004838"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DZC7"
                     /translation="MSNWLQCSRRCFWNRTNYGTRALSSFDKIPRAPPDKILGLTEQF
                     SKDKNAKKVNLTVGVYKDNQGLVTTFPTVAKAQKILDQDENMNSDLSYLPIIGSPAYR
                     KSTLNFLFRDSCPESGPKLLEQERVSFVQTLSGTGALVVAADLLAQFVSRTVWIPNLS
                     WPNHTNIFKRHGFNDVRQYSYYENGKLTVDKWIDNLKKNVKKNDGSRHCIILHACCHN
                     PTGVDPTVEQWRKILDAVRELEMIPIIDMAYQGLVSGNPAKDAYVLRMCLDESRYGNW
                     PHGLFLCQSFAKNMGLYGERVGSLSVVVPPNQPESKGNVESQLKQIVRSMYSSPPAYG
                     CRVATLVLSSDDFKRDWYKDVESMVQRLLNVRQGMYDRLGWEGLINFEQQHGMFFYTG
                     LKPHALNRLRDEYSIYMTMDGRLSLSGVNDHNIDYVCDAFKAILD"
     gene            complement(<252293..>255502)
                     /locus_tag="ZYRO0G03300g"
                     /db_xref="GeneID:8205934"
     mRNA            complement(<252293..>255502)
                     /locus_tag="ZYRO0G03300g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498100.1"
                     /db_xref="GeneID:8205934"
     CDS             complement(252293..255502)
                     /locus_tag="ZYRO0G03300g"
                     /note="some similarities with uniprot|Q04279 Saccharomyces
                     cerevisiae YMR086W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498145.1"
                     /db_xref="GeneID:8205934"
                     /db_xref="UniProtKB/TrEMBL:C5DZC8"
                     /translation="MISQKRLSRGLEKPVDGEAVKAASVIGKAMNHNGKVLGQNNHFR
                     APASRSGSLMGNSNNSNNNQVRRTFSMTGSRQSSLRSPSMNSSSGAVRTRSVMRSDPR
                     QKDTGVSRSYSLTVPKRNVTQQDAQSAFDEFGGPQHRGVIHRSPSVSSIPKGAKTVRK
                     YVPSAKGLIAIDVPVEEAQQQEQLAQQQIQRNRSLTRSNSRNYSLTKNNSRTNSLTGS
                     RTNSLTGPRSVSLNSARTNSIRRSSSRTSSLTGSKPNLQPPKRYSSLTSASLVNGSRR
                     DQFMSTPLEEEEEDVKPPVRTQTKPGQTKPGQMNPGQTKPGQMNPGQTKFGQTKPGQT
                     KTGQTKFGQTVSGNSTVSPRTVTTKTVSKKPLGAPEPSGRAKTIPTVKNKVPTTVHST
                     ERAPLHKPLSSSSPPASETSDLSMNHHEKESHEQAGESQDTILEDEREDHYDDSGNRL
                     WDDKLENVIKQGFEDGPQQATSTSTPVSSPTPVENSKPSILPSAPAEEHAKQPIPQEL
                     QQPMEEKAPVTKGREDESRKENENDEDYKPQEHKNLDEPKPQGNHREDSSNREEIHDQ
                     SEKTPAVTVGQVNDKTTAVSQPPVNESSQNRLKDYLQGEDEQLENSGIESVASDQNPN
                     ESLVQPLKISSRESPQADTSTSAQEDELAKEVRQELDIMGHNSSNDNSDQNSDDLFVD
                     SREDILDDFDANGNQAGRKVPSLPERNPKRGNGNKAQADGGVLKTTSPIKSALKKTTS
                     ENSNPSMYTESSPANQAYLSLTTAENTRLNAQLTGSDTIPRKSSLKSINRSRTMLNNR
                     ATHSLSPPPREALVPKRHSHHVGNKTSADRKATGTPPARSRNSMLNAPSRSQKPLKGE
                     SSNSAAKSKLNNPILYPREPPQKRSSFEKTRNKDNNVGMSKLSLRDGALLENNYQQSS
                     LDNHFRGATAAPSVPSSGTENGNSTALFSSSGFKSRFQDSDSEDEGLPVNGVGGKPDQ
                     QANATNSNGNGFSLFKHKDSGESEGFGKKLGKLSLKSSNGSDQGVDYSTTKRFGNGGG
                     VESKVRTLRDEIPADNELADGGKKNAFGKKLKKLFGRHK"
     gene            complement(<255923..>258088)
                     /locus_tag="ZYRO0G03322g"
                     /db_xref="GeneID:8205935"
     mRNA            complement(<255923..>258088)
                     /locus_tag="ZYRO0G03322g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498101.1"
                     /db_xref="GeneID:8205935"
     CDS             complement(255923..258088)
                     /locus_tag="ZYRO0G03322g"
                     /note="highly similar to uniprot|P14742 Saccharomyces
                     cerevisiae YKL104C GFA1 Glutamine-fructose-6-phosphate
                     amidotransferase catalyzes the formation of
                     glucosamine-6-P and glutamate from fructose-6-P and
                     glutamine in the first step of chitin biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498146.1"
                     /db_xref="GeneID:8205935"
                     /db_xref="GOA:C5DZC9"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="InterPro:IPR005855"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DZC9"
                     /translation="MCGIFGYCNYLVERSRGDIIDTLVEGLQRLEYRGYDSTGIAIDG
                     DTPESTLLYKQIGKVDALKQEIARDAPERSTTFASHCGIAHTRWATHGEPRQINCHPQ
                     RSDPQNEFTVVHNGIITNFRELRTLLANRGYTFESDTDTECIAILFKHLYDENLSNGH
                     ELDFHELTKLVLTELEGSYGLLCKSVHYPEEVIATRKGSPLLIGVKSDKKLKVDFVDI
                     EFPDDAAGKPDTPLGSKSGTPNASSRNLLNANRRTRPYEGNNFLPLAANEFNLRHSQS
                     RAFLSEDGTPNPVEFFVSSDAASVIKHTKKVLFLEDDDIAHIYDGELHIHRSRRPEVG
                     ASMTRSIQTLEMELAQIMKGPYKHFMQKEIFEQPDSALNTMRGRIDFENGTVMLGGLK
                     AWLPAVRRARRLIMIACGTSYHSCLATRAIFEELSEIPVSVELASDFLDRKCPVFRDD
                     VCCFVSQSGETADTMLALNYCLERGALTLGIVNSVGSSISRATHCGVHINAGPEIGVA
                     STKAYTSQYIALVMLALSLSDDRVSKIERRKDIIRGLHKIPDQIKEVLKLETRIKELC
                     HNDLKDHKSLLLLGRGYQFASALEGALKIKEISYMHSEGVLAGELKHGVLALVDEQLP
                     IIAFGTRDSLFPKVVSSIEQVTARKGRPIIICNTNDEVWAKKAETNKLLTLEVPQTVD
                     CLQGLLNIIPLQLISYWLAVNRGIDVDFPRNLAKSVTVE"
     gene            complement(<258593..>260107)
                     /locus_tag="ZYRO0G03344g"
                     /db_xref="GeneID:8205936"
     mRNA            complement(<258593..>260107)
                     /locus_tag="ZYRO0G03344g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498102.1"
                     /db_xref="GeneID:8205936"
     CDS             complement(258593..260107)
                     /locus_tag="ZYRO0G03344g"
                     /note="similar to uniprot|P14904 YKL103C Saccharomyces
                     cerevisiae LAP4 Vacuolar aminopeptidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498147.1"
                     /db_xref="GeneID:8205936"
                     /db_xref="GOA:C5DZD0"
                     /db_xref="InterPro:IPR001948"
                     /db_xref="InterPro:IPR023358"
                     /db_xref="UniProtKB/TrEMBL:C5DZD0"
                     /translation="MSDQRAIIDHLTKTLELLSVEKSQPQQQKSVPEPRRVDTQDLVE
                     YSHSYIDFTYDNPTIYHLTASLSQKLEKAGFTYLSEKENWQDKLTKGQGGKFYTVRNG
                     TNLSAFVVGDKWDQYKGVGAIGAHADSLTAKLKPLSKKKSVEGYELLGVAPYGGTLND
                     LWFDRDLGIGGRVLYKDGDQFKSKLISSAPHPIARIPSLAPHFGAPALPPFDKETQAV
                     PVVGFSQGEEEEAATEQEKGSVLFGKHSLQLLRYVAQLAGLDVAQLVQLDLDLFDVQK
                     GTIGGIKNDFLFAPRIDDRICSYASLIALLEYAANVDLANSDTFALVALFDNEEIGSL
                     SRQGAIGGLLKTTVERSARAFHEGPVDFHSLWANSIILSADVNHLFNPNFAEVYLENH
                     RPKPNVGVTLSIDTNQHMVTDVIGTTFAEELGRINGDRVQYFHIKNNSRSGGTIGPYI
                     ASQTGARTIDLGIPQLSMHSIRATTGSKDVGLGVKFFRGFFKNWRPVLDRFGDL"
     gene            <261014..>265864
                     /locus_tag="ZYRO0G03366g"
                     /db_xref="GeneID:8205937"
     mRNA            <261014..>265864
                     /locus_tag="ZYRO0G03366g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498103.1"
                     /db_xref="GeneID:8205937"
     CDS             261014..265864
                     /locus_tag="ZYRO0G03366g"
                     /note="similar to uniprot|P34244 Saccharomyces cerevisiae
                     YKL101W HSL1 Nim1p-related protein kinase that regulates
                     the morphogenesis and septin checkpoints associates with
                     the assembled septin filament required along with Hsl7p
                     for bud neck recruitment phosphorylation and degradation
                     of Swe1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498148.1"
                     /db_xref="GeneID:8205937"
                     /db_xref="GOA:C5DZD1"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DZD1"
                     /translation="MPAPMGNRYATRSQRSSNVAKKAARNAMMKVPGGTANTNVKTAV
                     NTDTNDPTAGVTQNQLDRVVQSVNDATNRLSQPESAFSISTTTKSSKRRSRDTVGPWK
                     LGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFSATMNT
                     TTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKSELY
                     LVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLLD
                     KKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILF
                     ALLTGHLPFNDDNIKKLLLKVQSGKFHMPQNLSAEAKDLMSKILVVNPFKRIATEEIL
                     NHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSI
                     VSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYKEKHSPKPESEAPPQFEPTQ
                     PTDEIQQPQLAPLQPPSLEPTLAPEVVQQSLPAQDEEDEEELTKSQTTNEEDSSQLNE
                     SQDTSAPKLPQKSQFSASSIDQHSMSGFSSMQSAALSGVPSVPANSLPPAMPIFTAPS
                     SRTFKNSGPALSIPSKKSLKHSASKTSLNHSASKKSLHHSASRKSLVHASPSTTSLHN
                     SASKKSLHNSPPKKTLQNSASKRSLYSQTSISKRSLNLSEYVATENAVISEMEQQLKP
                     NLPSSESNGDFEKLCEQILFGNALEKILEEEEDDGASATTSNTSQRTLTKVDASQRSP
                     HSSDSKNKTPAAKTIPPAFELNTPESEEEQQLRASAHKNLLAEENNRYPFKDITNNPT
                     LAPSDSKPSKSKRDVSQKSDLSEVLNSNQFGGSTFSSNDVLRNNSRKSEFKPSLRVTN
                     DVRSASENQSKPVQPSYSLDPRRNATQPVNPKVVASLLKRAKTKKNIRDARKSGDWSY
                     ISGSHFNTNTDINFDDKLENIFDHGFNNRLDGNLERGLVDSGLKRASEDTRSSLWQPS
                     LRDSHVESDAEHNTSGTNEFFDTSDVNVLAHSSIIQKPNDVTRQPSLLSHTGTFKNLS
                     EYLHKEGNANNIANRSHEENPSNVMRKKSTELNLAPRSTLTAALDPKDRSMYTNSFMS
                     NMSDMSYVMEMPSRTYEAQAIEVSNNSSADDITDLPVNSDREFGQSSSQGQHTTATFE
                     DNNVNIFEDAPVDSDSSDTASEDSQQNVRRKAVSIDTLHTTNVLTPATNVRVSLYLNN
                     NNHTESPLKRETTEEIISKFKLSPEKSSQPLVQKRYSALAANRNSDIHSTMTMFKDLE
                     EEQDAEDISQWKPSESPAGEGQEKPNRVTMLFDNEEEMPQLEHQITPTPEVPQKNENR
                     SVPDTKSTRASEEKSMKSIDEGLQKAEELPHTNESSKQLKEPPMHAPPQPKSKVKSSG
                     SPLPAKSKKSKPMKEKSQTATAASTATPSAPPNVSNSAAATPSSASPAPRKQNWFTKL
                     FGGFKSQKSDLGRLQQDHFTKISFDDAHLLTLHEFDKNAVEYHLKSLDHKLHDEKVEY
                     DCKFPTGFAFKIKITTTVLGQKNSTILTVKKKGRNTSSDVKGAFQMFNQNVANVIREA
                     EMGYNV"
     gene            complement(<265952..>267064)
                     /locus_tag="ZYRO0G03388g"
                     /db_xref="GeneID:8205938"
     mRNA            complement(<265952..>267064)
                     /locus_tag="ZYRO0G03388g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498104.1"
                     /db_xref="GeneID:8205938"
     CDS             complement(265952..267064)
                     /locus_tag="ZYRO0G03388g"
                     /note="similar to uniprot|P07246 Saccharomyces cerevisiae
                     YMR083W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498149.1"
                     /db_xref="GeneID:8205938"
                     /db_xref="GOA:C5DZD2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DZD2"
                     /translation="MLRTRTLLSRFGPFGQLRLSSTISIPSTQKGVIFYESGGKLHYK
                     DLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGVVVAKGENV
                     KNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHADLSGYTHDGTFQQYATADAIQAA
                     HIPKGTDLAGVAPILCAGVTVYKALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL
                     RVVGIDGGEDKAKLFKSLGGEIFIDFTKEKDIPAAILEATQGGAHGVINVSVSEKAMS
                     QSVEYVRPQGTVVLVGLPANAVIKSNVFNHVVKSFSIKGSYVGNRADSREAVEFFSRG
                     LVKSPIKIVGLSELPKIYELMEAGKILGRYVVDTSK"
     gene            complement(<269170..>270291)
                     /locus_tag="ZYRO0G03410g"
                     /db_xref="GeneID:8205939"
     mRNA            complement(<269170..>270291)
                     /locus_tag="ZYRO0G03410g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498105.1"
                     /db_xref="GeneID:8205939"
     CDS             complement(269170..270291)
                     /locus_tag="ZYRO0G03410g"
                     /note="similar to uniprot|P07246 Saccharomyces cerevisiae
                     YMR083W ADH3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498150.1"
                     /db_xref="GeneID:8205939"
                     /db_xref="GOA:C5DZD3"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DZD3"
                     /translation="MLRFSQTLSGLKRVGQLRLQSSFTIPKVQKGVIFNKFGGPLLYR
                     EDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGKD
                     VKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMSGSSHDGTFQQYVAIDALQA
                     PPLPANVDLAAVAPIFCAGVSVYKALKNGNLQTNQWVAIFGATGGLGSIAVQYAKAMG
                     YRVLGIDGPGEERKQLFHSLGGEVFLDYTQVDNIPAAVKQATQGGAHCVLNVTASLAA
                     YDQTIKCVRPLGTVVPVGVPPDSGLLKTDIFTIVQHGFSIKGSASGSRADTREAVDFF
                     TRGLIKSPIKILGLSELPKAFELLESGQTTGRLVLDTSK"
     gene            complement(270661..270732)
                     /locus_tag="ZYRO0G03432r"
                     /db_xref="GeneID:8205940"
     tRNA            complement(270661..270732)
                     /locus_tag="ZYRO0G03432r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (TTC) cove score=60.23"
                     /db_xref="GeneID:8205940"
     gene            complement(<271038..>272471)
                     /locus_tag="ZYRO0G03454g"
                     /db_xref="GeneID:8205941"
     mRNA            complement(<271038..>272471)
                     /locus_tag="ZYRO0G03454g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498106.1"
                     /db_xref="GeneID:8205941"
     CDS             complement(271038..272471)
                     /locus_tag="ZYRO0G03454g"
                     /note="some similarities with uniprot|P32945 Saccharomyces
                     cerevisiae YPL179W PPQ1 Putative protein serine/threonine
                     phosphatase null mutation enhances efficiency of
                     translational suppressors"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498151.1"
                     /db_xref="GeneID:8205941"
                     /db_xref="GOA:C5DZD4"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DZD4"
                     /translation="MGNSPSRSNNNFAVPSASNGILQTSDDNNNEPNEPDDSGPTKSI
                     DIGIGNNGTSNGNGNGMGCNRERYRRCSADSGTTMVGGSGSSSNRNNGGGDIGEKGFL
                     LNVGISTAKAFGGAGSVGSDSASSENTLISPRQNRTCSYDSQGSSYGSTSIPNYRSKQ
                     HRVVLQRYPNDPSNNECLDLDDAIEKLLQIGETRHYKSRDFPFRTWEIQLICCHAREI
                     LLSQPSLLQLQAPIKVVGDIHGQFTDLLRIFKLSGVPPETNYLFLGDYVDRGKQSLET
                     ILLLLCYKVKYKDNFFMLRGNHESANVTKIYGFYDECKRRTSSKVWKTFVDVFNTLPF
                     AAIIQDKIFCVHGGISPDLKSLQRIAQIARPTDIPEEGLLTDLLWSDPDSQISNWSDN
                     DRGVSFTFGKKNVLDFCSQFNFDLVIRGHMVVEDGYEFFAKKKLVTVFSAPNYCGEFN
                     NWGAVMSVTTGLMCSFELLKPHGRRKS"
     gene            <273211..>274854
                     /locus_tag="ZYRO0G03476g"
                     /db_xref="GeneID:8205942"
     mRNA            <273211..>274854
                     /locus_tag="ZYRO0G03476g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498107.1"
                     /db_xref="GeneID:8205942"
     CDS             273211..274854
                     /locus_tag="ZYRO0G03476g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498152.1"
                     /db_xref="GeneID:8205942"
                     /db_xref="GOA:C5DZD5"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="UniProtKB/TrEMBL:C5DZD5"
                     /translation="MSSKPNFLIIVADDLGFTDVGQFGGEIDTPNLDALTGDGLRFTG
                     FHTASACSPTRSMLFSGTDNHLAGLGQMAEFARDFPEKFGGKPGYEGYLNFKVAALSE
                     ILSPEYYTILSGKWHLGLDEPYWPDKRGFEQSFSLLPGAGNHYKFNLQEKQFLPSIYQ
                     ENGRLLDAEKELPDDFYSTDYFTTKFLDYLEDEKRKDRPFLGLLTYTAPHWPLQAPPK
                     TIEKYKGVYDKGPLELRKKRLQRAQELGIVPPDVVPHLVETISEAGWDELDEKTKAYS
                     SRVMETYAAMVDELDQHIGRVINHLKKTGEFENTVIMFLSDNGAEGMMMEALPFGGKL
                     FKDRISAKYDNSYENIGRGDSFVYYGDMWAQAATAPRYMYKMWASEGGINCPLIFHYP
                     KLHGEGGKITEQFTTVMDILPTVLDLSNVPHPGTTFQGRQVYKPKGKSWVPYLAKSSD
                     RIHDEDTVTGWELFGQRAIRRGPFKALYIPKPFGSGAWQLFDASKDLGEINDLSGQLP
                     EILEELLGHWSTYCAETGLVELEELPSKDNVKFRVIQDN"
     gene            <275243..>276802
                     /locus_tag="ZYRO0G03498g"
                     /db_xref="GeneID:8205943"
     mRNA            <275243..>276802
                     /locus_tag="ZYRO0G03498g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498108.1"
                     /db_xref="GeneID:8205943"
     CDS             275243..276802
                     /locus_tag="ZYRO0G03498g"
                     /note="weakly similar to uniprot|Q6B1X3 Saccharomyces
                     cerevisiae YPL181W CTI6 Protein that relieves
                     transcriptional repression by binding to the Cyc8p-Tup1p
                     corepressor and recruiting the SAGA complex to the
                     repressed promoter contains a PHD finger domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498153.1"
                     /db_xref="GeneID:8205943"
                     /db_xref="GOA:C5DZD6"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR019786"
                     /db_xref="InterPro:IPR019787"
                     /db_xref="UniProtKB/TrEMBL:C5DZD6"
                     /translation="MDQDDSEQAMPGVKQEIPHESSPDGISEPQDTEGGDEEGETRCI
                     CKELDPPDDSGLYIQCEQCGAWQHGYCVGISDGEDSYLEKYWCEQCKPELHRLYTVDS
                     AGTLRSLYQPIQEKRRHIRRNSRQRPNSNPTSGSQLEDSQHDSSNSSLRETPEKNPTD
                     DSRESRSRSSRSRRSLEKSIGNDIREADQDQENDGNNGHNNTNDNGKRNNSNSELDRL
                     GESPLSEDPIEDGDEDDKKLQDRKRATFSAREEKHYQWMLEKAIRESRRTSKHEDDSH
                     DAGDGQKLGLEADLTNEEVPDQAQESKESRTHQGRNDYWHNGEENVAVTENEHSQSPP
                     VNLQEFHGYGASNSAANSGTSASGAAASATNRTRDDPLLSRSASMNSNSEDDSKRPKK
                     SKRGPNRGNRSSGNGNGARASTPPKGKLELGVNKPMKPRLPSQRTSLNEMRRRVGAIL
                     EFISRTQWELSEDQSSRDDLIRFVENQQFVQQVDTIFESHDHTLKLMDDLTRSLLLWE
                     KKYSNGPTIQD"
     gene            complement(<276847..>278595)
                     /locus_tag="ZYRO0G03520g"
                     /db_xref="GeneID:8205944"
     mRNA            complement(<276847..>278595)
                     /locus_tag="ZYRO0G03520g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498109.1"
                     /db_xref="GeneID:8205944"
     CDS             complement(276847..278595)
                     /locus_tag="ZYRO0G03520g"
                     /note="similar to uniprot|P38932 Saccharomyces cerevisiae
                     YGL095C VPS45 Protein of the Sec1p family essential for
                     vacuolar protein sorting required for the function of both
                     Pep12p and the early endosome/late Golgi SNARE Tlg2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498154.1"
                     /db_xref="GeneID:8205944"
                     /db_xref="GOA:C5DZD7"
                     /db_xref="InterPro:IPR001619"
                     /db_xref="InterPro:IPR027482"
                     /db_xref="UniProtKB/TrEMBL:C5DZD7"
                     /translation="MDLFTVADFYINRLVNSQARAGSTSLVEQNRIKALILDKDTTST
                     ISMCATQSELLNHEIYLVDTIENDNRDVMRHLRCLVYVKPTEETIQALIRELENPRYG
                     DYHIFFNNTVTKSQLERLAEADSMECVSKVEEIFQDYFILNEDLFSFDLPPENLFTNS
                     LLWDEVGLTDCTKSLTSLLLSLKLKPEIRFDAPSRLCGKLAKEISYEINQNERSLFDF
                     PPMDSPPVLVLLDRKTDPLTPLLQPWTYQSMINEYIGVKRNMVDLSKVPDIDKDLQKV
                     TLSPRQDSFFKDTMYLNFGELGDKIKQYVDNYKDKTNTNSQINSIEDIKNFIEKYPEF
                     RKLSGSVAKHMAIVGELDRQLQMRDVWEVSEVEQNLSVHKDDPEDFRDLVKILESPKI
                     DKYYKLKLACIYALRQGNNNSQLNEIVQILQKQPLFPVDDINLFHKFRRIFGQNQAVD
                     EGQGRYWERDDLLSELTKRFNSKVRNADSGNVFMQHIPKISKLLTDFSKNKVPKEQFK
                     TLEETETSRNANASPPSQDLIVFVVGGVTFEEARFVHEFNETMRGKMRVILGGTSVIS
                     THEYMESIRQTNNSGI"
     gene            <278843..>281212
                     /locus_tag="ZYRO0G03542g"
                     /db_xref="GeneID:8205945"
     mRNA            <278843..>281212
                     /locus_tag="ZYRO0G03542g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498110.1"
                     /db_xref="GeneID:8205945"
     CDS             278843..281212
                     /locus_tag="ZYRO0G03542g"
                     /note="similar to uniprot|Q08921 Saccharomyces cerevisiae
                     YPL180W TCO89 Tor Complex One"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498155.1"
                     /db_xref="GeneID:8205945"
                     /db_xref="InterPro:IPR018857"
                     /db_xref="UniProtKB/TrEMBL:C5DZD8"
                     /translation="MGHKNKIRSELDSMAAQSSSKGLQNMTSNSASGHTTRPFRQFST
                     KSRAKSTASFKGLHRITPHDSGSDADSHHSGESVFRKSGSSDSLYRKRAISGLNMTAL
                     TRVKSNPSQMPGSRSSSVNSSTSYSLGAVSTGLKPSTSKPTHSVVGLHGDDKDIDNDT
                     TTDEEVEYFSDEEENENGKSQKSSPIGENMPRENSNNKVKRTPEENKMLSKSFSELTL
                     PYERAENEAPHLVNQPSYKAPSSLINPQQEQLLSNSYKEVNDGNNDTNTENNDGGNAK
                     PESNELKRQESDETANDKILHDDGDDRIDNNNLYPAAVDTSMEAGAHSLKRQGKNFQD
                     PQENGLSLMGEDESPRGTGNYISQRRNSDHEQYIPSMILSQSTGVERRFDQPASIQNS
                     LANNYQVMPPLEEAQNGAIKEYNMGLNKENQIIDSPSFQNVNRDQLLQQQQHQQQEEQ
                     HQQPQPPQPPPLQQQPSQRQPHFQHFHQPQLQQHSQVPPQQYQQPQQHHLSRQKQANN
                     TNSNTQHSFSTSISSLTSSLQKMAPENVYNTSRKSHLLRKKPSQISFLGSSFRGSNAE
                     VPNSYLHRESPPASSDINNFAQFLKSDNMDGESRTQRKLWLQRENSILDLSSQHEASD
                     SIFMASNIEVKREFERISHEYTNVRRFSNPIEEALARVDSEQKHTVIKSTTSQDSEML
                     DSLIPRPINEGKEIDELLPKSQSAKLHKVLQSIWREESALFNKDTNPVNRNKSPISGH
                     VTNTSRTSLKNVMNPGSALQHQRVINSLQPTTRAVNRRMENALHNQQRL"
     gene            complement(<281481..>284786)
                     /locus_tag="ZYRO0G03564g"
                     /db_xref="GeneID:8205946"
     mRNA            complement(<281481..>284786)
                     /locus_tag="ZYRO0G03564g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498111.1"
                     /db_xref="GeneID:8205946"
     CDS             complement(281481..284786)
                     /locus_tag="ZYRO0G03564g"
                     /note="similar to uniprot|P53010 Saccharomyces cerevisiae
                     YGL094C PAN2 Essential subunit of the Pan2p-Pan3p
                     poly(A)-ribonuclease complex which acts to control poly(A)
                     tail length and regulate the stoichiometry and activity of
                     postreplication repair complexes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498156.1"
                     /db_xref="GeneID:8205946"
                     /db_xref="GOA:C5DZD9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR028881"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DZD9"
                     /translation="MNNWKPSLTDFLDLTEHLKKPFYRHDSREKEASKVVFDDLSNLI
                     WVGDSYARVSSYYGGSLSLYSRYTANIGGLPVNDILTHREGILSLNEDSLHFANRRGV
                     TMMNLTSVDVAAFSGLRSMCFGGAEYVNHVYCAGTNPNSGIVRIDLNRGTPSSVISYP
                     HKVKHMCSNNKVISVGKQTGGVDILDPRSNSVVRTFSAHSGTISSMDSKDYTLVTVGK
                     SKRFNNMYADPFVNVYDLRTMQQLPPISFSKGTTMGAGGADFVQLHSLLPTVMVVGSA
                     SGSFDFVDLANPTLRTQYIHPSQSIKSMALSPNGDYLAFTGDDNTLTTWNRTDDSHNF
                     TNTPIPLEYSDFVDDGLLPHLTDVDDQSYHLSSVGMPYYSQQLISAWPNSIFRSPGTI
                     PTPLDEHMPITKPRPKSNPGAYPLQKYDRSKYGRRNALESYVCLKEIRKKFASGIIPS
                     DMLKYKSTEECEVPKAYMKLPLTHGRYGTDNFDFQAFNQTSYSTLDNDVDNVYTNSIL
                     QLYRFVPELFNFVVGSLKDENFGLHSLLTELGYLYDMMDRSKGKVCRSANFQSTLNSI
                     DGFKEQGLTTPLSTDLTFLERLKINDEPITSPSMERLRKSLVQKFNEFVLHRLMNEES
                     EKVPSTVTLKELYGFQLDSTIRTSCNYQEVLKSVEPTLTVLSPTRNSIKYANKKMNSQ
                     TILPYIESSMRRVKHTTSTCSKCNKQELTTYERVMRNLPPILSLDILLSESEWAVVKS
                     VKNWLSKEFFAAMTKEKALLQSSPQELRGISPIFKYELNGYVARISDRNGESRLVTFI
                     RKYESEENIFKWYMFNGYLAVEVDEEEALNISYWWKTPETIIYCDAEEIRKPFFSVDT
                     YRINYDVLYRNHFANGVGITAKTQYELLCKEEAPKPGTLVAIDAEFVVLSEELSEIDC
                     TGVKTIVKPKKTALARLSVLRCEEGAQFGVPFIDDYIFNKEHIENYLTRYSGISPGDL
                     DLEKSDKPLVSREVTYRKVWLLMQLGCVFVGHGLSNDFKHININVPKEQIRDTALYFL
                     RGKRFLSLRYLAYALLDKNVQEGNHDSIEDAYTALILYKKYLDLKEKGTLEHVLDTIY
                     AEGRASNYRVPFQ"
     gene            <285054..>287969
                     /locus_tag="ZYRO0G03586g"
                     /db_xref="GeneID:8205947"
     mRNA            <285054..>287969
                     /locus_tag="ZYRO0G03586g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498112.1"
                     /db_xref="GeneID:8205947"
     CDS             285054..287969
                     /locus_tag="ZYRO0G03586g"
                     /note="similar to uniprot|Q08924 Saccharomyces cerevisiae
                     YPL183C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498157.1"
                     /db_xref="GeneID:8205947"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR021717"
                     /db_xref="UniProtKB/TrEMBL:C5DZE0"
                     /translation="MHSVSHYGPALSVKFLDRFVYAGYGPFLHVYEYATGKLANKCLI
                     FNKNKVHGVRIGDNGLILCYGSRSVNLTSIQDVHEKSSIVESEKHTSEWIISGEFNSD
                     CSQFYLLTCYDRVLTCDLECHVVKKSAVYGERSILYSGSIKVVSEDKVFINAGTVMGG
                     IIVWELFSETLVANLLGHSGSIFYVEMNRDGSLIASCSDDRSVRLWDLKSQKELSVGW
                     AHTARIWHLLFYNNDTRLISVSEDCTCRVWDIQSGKLLQSAIHEVHLTKNVWCVDVNE
                     KDQLAITSGNDGRLRLISLTEQESLQRNFTIKQISDDSKVPFAKQEIIKGFHWFSFGL
                     VAITSEGKILQYGNQWKFLMQNPQFKSYSMTNGISKDNIVIFSNNKCNLLILKFNSEG
                     SEIVASRELHVDTLTKSQNCMVCRHHDRNEFFVTLESPNPHDPFMCLKFDTDSLNLRG
                     QFGLKKPESFASSCLEIYESFLLVGSRFSVIAIFDLNNTSQESLVSRRLTPGDTTTSI
                     HLVEFSIGGPVFVVTNRDGYYNFIRLKLGNPIEELEIIHSNRTARGFLEGAYYDNNGD
                     LITYGFKSELFYIYNETQCYEKAVRVCGGAHRQWELARTPEGFMLVFIRASDLHFTRV
                     IEPKVPEVLQCGTHGREIRDIALLKDFKYKNGHLFCTASEDTTIKLCHVHESTGQVTT
                     FWTLRKHVSGLQRCKFLSSKLMISSSAREELFLWELTTDCNTKPYIKFRQALPISGNN
                     PDLRITDFSVKFEGSNFILAAVYSDSAVKLWRYNHLQNRFQLAVEGHYKTCCILNASL
                     FEFKNQSYLMLSATDGHLSLYNLTNTMNGGTVCPLPSVESSIQIHQSSIKAMNISVDD
                     QNDAVRVYTGGDDNALAICAFHWESQTKRLLPHLKDVQRSAASSTITSSELINDDKQL
                     VTASVDQIVRIWDTENDKLVLQEQKYTTVADTGSLDAVSNLLLIGGVGLSVWKTEHH"
     gene            <288530..>289138
                     /locus_tag="ZYRO0G03608g"
                     /db_xref="GeneID:8205948"
     mRNA            <288530..>289138
                     /locus_tag="ZYRO0G03608g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498113.1"
                     /db_xref="GeneID:8205948"
     CDS             288530..289138
                     /locus_tag="ZYRO0G03608g"
                     /note="similar to uniprot|Q07843 Saccharomyces cerevisiae
                     YLL033W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498158.1"
                     /db_xref="GeneID:8205948"
                     /db_xref="GOA:C5DZE1"
                     /translation="MAGRTILTRNAVINSTHTLIKCPEKYLLPSLEVSNLPSFVRMAY
                     RRLFRLQSFISNRKMVRDTYGEYLRYKFKKENYDTKRSIVVGDTPKAPLREEIRNSVM
                     FVVKAVSHLPETKDSKFAIARDNTTCRQVLKNLLTIEYEKQSLIARYRPPTKRRDMVG
                     PYQIYRKDFTHMQELNKSAQWRVFGEFDICTVYLNEILQTRL"
     gene            complement(<289222..>291534)
                     /locus_tag="ZYRO0G03630g"
                     /db_xref="GeneID:8205949"
     mRNA            complement(<289222..>291534)
                     /locus_tag="ZYRO0G03630g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498114.1"
                     /db_xref="GeneID:8205949"
     CDS             complement(289222..291534)
                     /locus_tag="ZYRO0G03630g"
                     /note="similar to uniprot|Q07834 Saccharomyces cerevisiae
                     YLL032C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498159.1"
                     /db_xref="GeneID:8205949"
                     /db_xref="GOA:C5DZE2"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C5DZE2"
                     /translation="MHIYTHFNSSAFVELPHVFQTGRLWKSNKDKSAAWGSAVWGNSR
                     CLVNGVPQDAKCVSVVRREDQQGVYTIQGVTEVCDTEPVVCTAIPVRDLATNVESFLG
                     ELRQRLIELANEFDVEIVVTKEPVYGASQLAGNFPLYVHILGFQSHVVAGEIHLWSLV
                     ELYRSSRGAGPALFVEYLDLDAHSLLPSVAGIDMANLKYVQQAFQTQAYVSALTLPMD
                     RDSGRESRFRPQVVLCGKVYSLVLAAKDFLAHMAQRPPQSPVYFRRFNSLSSGKLLYI
                     QKHYRLELNRLMIKYQSLVKVTDSCIEFRSTCLPLLEALIKAFTINILHRILEVQVTM
                     DKNFQFNEDSIRQVVMEDLIVVTIPSKENQLLVIGNHSPTATDHTSTIFKQVAAIHPA
                     SAVRQLRAIFEIHMDYEDFISGKKNGKLTRVMETVHCLIKLERLEDDDNMFLTLIADS
                     TPEFIRACNLVINELPAEEAFFIPEIYHRPVIGPGGSVIQATMKKYNVFVQFSSTFFL
                     PQNDLSCTRYDNVVIRCPYKNVSAIPQAREELALLAQECSKLRPLALVKLSRGQYRFL
                     LSSSSPSIAQTIANIEKNHKAFVDFPTEEPTDNYLLEVRGTDNNCLQAAKELISGSYG
                     CETIVKLDQPMVLDHDFYNSIVIPFKHAMGIEVTASSDTIRLVYKRGNGSLNKSLEVL
                     SDYVRSHRRKVMTTELERNFLVTFEDQQENQKKAIDETTANAIKLQQFHIDSQLAVLP
                     PLYHRDMQYLQKSEDSREPLNLVQYGYTAR"
     gene            292070..292143
                     /locus_tag="ZYRO0G03652r"
                     /db_xref="GeneID:8205950"
     tRNA            292070..292143
                     /locus_tag="ZYRO0G03652r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=67.58"
                     /db_xref="GeneID:8205950"
     gene            292557..292643
                     /locus_tag="ZYRO0G03674r"
                     /db_xref="GeneID:8205951"
     tRNA            join(292557..292593,292608..292643)
                     /locus_tag="ZYRO0G03674r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (TTT) cove"
                     /db_xref="GeneID:8205951"
     gene            <292925..>293920
                     /locus_tag="ZYRO0G03696g"
                     /db_xref="GeneID:8205952"
     mRNA            <292925..>293920
                     /locus_tag="ZYRO0G03696g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498115.1"
                     /db_xref="GeneID:8205952"
     CDS             292925..293920
                     /locus_tag="ZYRO0G03696g"
                     /note="similar to uniprot|P28321 Saccharomyces cerevisiae
                     YKL094W YJU3 Protein of unknown function localizes to
                     lipid particles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498160.1"
                     /db_xref="GeneID:8205952"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="InterPro:IPR029059"
                     /db_xref="UniProtKB/TrEMBL:C5DZE3"
                     /translation="MPILRNPLRRSKTASSMPQTQGYPTSSEFPYPYKPKTEIPAKKF
                     IEFNDANFATLFWPSVSKPKGRVLIVHGFGEYSRLQHRLMDQLALNGYESWTFDQRGA
                     GETSEGKERGRTNEFHVFNDLDHFIELNYKETQEKGIPLILFGHSMGGGITLNYGIRG
                     THKEKIAAYSTTGPLVVLHPHSAPSSAIILVAPLLATFLPNFQINSGLDVDAIAGDPQ
                     YKKFLLHDEPLGMPLIGTLRQIYDFLQRGKQLDENSDGYVTKFVKRPLFIMHGANDTI
                     NDPAATKRFYNNSTLTDKKLEVYPGMVHSLLSLENDENFAKVFDDYREWLDSKFA"
     gene            <294505..>294996
                     /locus_tag="ZYRO0G03718g"
                     /db_xref="GeneID:8205953"
     mRNA            <294505..>294996
                     /locus_tag="ZYRO0G03718g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498116.1"
                     /db_xref="GeneID:8205953"
     CDS             294505..294996
                     /locus_tag="ZYRO0G03718g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498161.1"
                     /db_xref="GeneID:8205953"
                     /db_xref="UniProtKB/TrEMBL:C5DZE4"
                     /translation="MSVTPSVGISFHELVLQEEYLMSLRPILMYASTKRPTSCRSQDI
                     FERAVQDPFGWSSEDSPPSFSGFNGFSKSDSFNGFDRWCMGGNNGSDSSTSSTKDGNG
                     VPKSSQSPPRSNSIPTHLFGLERYVSSGLDELSARDCAPLGKQRKKSFIEMSLASSFS
                     RDE"
     gene            <296534..>299368
                     /locus_tag="ZYRO0G03740g"
                     /db_xref="GeneID:8205954"
     mRNA            <296534..>299368
                     /locus_tag="ZYRO0G03740g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498117.1"
                     /db_xref="GeneID:8205954"
     CDS             296534..299368
                     /locus_tag="ZYRO0G03740g"
                     /note="similar to uniprot|P30771 Saccharomyces cerevisiae
                     YMR080C NAM7 ATP-dependent RNA helicase of the SFI
                     superfamily required for nonsense mediated mRNA decay and
                     for efficient translation termination at nonsense codons"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498162.1"
                     /db_xref="GeneID:8205954"
                     /db_xref="GOA:C5DZE5"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR018999"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZE5"
                     /translation="MSHNASSESDNGFDDIQDVDVDVLDAQDVPDVDVPEMQAQDAQD
                     VLGTLDQQASSEHACAYCGIDSPSCVVKCNSCRRWFCNSKNGASTSHIVNHLVLAHHN
                     VVSLHPESDLGDTVLECYNCGCKNVFLLGFVSARGEAVVVLLCRIPCAQAKNANWDTE
                     QWQPLIENRQFLNWVAEEPNDEERLEARLITPTQISKLEAKWKSDKNATINDIDAPEE
                     QEEIPSALLRYQDAYEYQRSYGPLIKLEADYDKTLKESQALEHISVTWSLGLNNRHLA
                     SFALSTFESNELKIAVGDEMILRYSGSLHPEWHGRGYIVRPPNSFQDEFTLELKPSKT
                     PPPTHLGTGFTAEFIWKGTSYDRMQDALKKFALDKKSISGFLYYKILGHQVVDIAFDV
                     PLPKEFSIPFFAPLNASQSHAVEHALQRPLSLIQGPPGTGKTVTSATIVYHLSKLHKD
                     RILVCAPSNVAVDHLAAKLRMLGLKVVRLTARSREDVESSVSDLALHNLVSRSAKGEL
                     KKLLKLKEEVGELSVKDTKKFVKMVKIAESDILKKADVVCCTCVGAGDRRLGAKFKTV
                     LIDESTQASEPECLIPIVKGAIQVILVGDHQQLGPVILERKAGDAGLKQSLFERLISL
                     GHVPLRLEVQYRMNPHLSEFPSNMFYEGSLQNGVTIEQRTVPNSTFPWPIHEVPMMFW
                     ANYGREEISANGTSYLNRIEAMNCERIITRLFKDGVKPEQIGVITPYEGQRAYILQYM
                     QMNGSLDTDLYVNVEVASVDAFQGREKDYIILSCVRANDQQSIGFLSDSRRMNVGLTR
                     AKYGLVILGNPRALSTNVLWNNLLIHFREKGCLVEGSLNNLQLCTVQLTRVRQHKKGR
                     QDKFPFNLGPEVGEFSSSNDFDTQSLMSFGGQADTFNDVYAATNELASYLNNEAWNAK
                     EYRPSTDKKSTQQKEDVTAELNKQVESLNI"
     gene            complement(<299653..>302688)
                     /locus_tag="ZYRO0G03762g"
                     /db_xref="GeneID:8205955"
     mRNA            complement(<299653..>302688)
                     /locus_tag="ZYRO0G03762g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498118.1"
                     /db_xref="GeneID:8205955"
     CDS             complement(299653..302688)
                     /locus_tag="ZYRO0G03762g"
                     /note="similar to uniprot|P33314 Saccharomyces cerevisiae
                     YKL092C BUD2 GTPase activating factor for Rsr1p/Bud1p
                     required for both axial and bipolar budding patterns
                     mutants exhibit random budding in all cell types"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498163.1"
                     /db_xref="GeneID:8205955"
                     /db_xref="GOA:C5DZE6"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR001936"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="InterPro:IPR023152"
                     /db_xref="UniProtKB/TrEMBL:C5DZE6"
                     /translation="MSDSSVRSSFSRARFDLDKFLSTMQSLRGSFGGDVYWSYDLHSS
                     NSWNKNRCQITDVGSLRCCKETDESDLIDHLQNCKVKFIEKHNGVFPTIQVSVGLKKI
                     YLRVQDASTFEELVCALMWWSGLRKNGIFEKFTPQKPVLDGDDGATNLLVSQLYVFGP
                     VLNKIVPVDNKLNKPDFLPNSEIEEGWFPAMGVLKSNGVLDLLLQQDGTLIYSLNIAV
                     LLRSEIRIPDSSLGTENYLFLKAIPSLRKSLKLVRNQKFIHTSKHAHNSAILLKFPLK
                     IDVEDWFVALKSFAIAENFSLIAADKSNHVRVSNSFSLSILEGRFKESEVDDELPSLY
                     VELSMWGYKCGRTPVVDQSYSPFWREIFKFHESLLVNDLRLDIKKRSFDAKTPDKTIG
                     YIELSQENINDPKLIKETRLPVMSAIRKNEEIGTLCIKIVSSLILVLPSSNFTRMEKL
                     LQIVDPEELCGLVQDFSDGVDVKIDNISDIFLDIFQALNRENDWFGALLKRELSVVDS
                     SIARNTIQNKTSSHIYSTLFRGNSVLTISMEKYFYRVGHEYLDKSIGDVLRDVIDKQV
                     SCELDPARIEERDPALVQEIVARNKETLSHYVGQLWHRIYTTSNDLPMSIREQMRTFR
                     KKLELICMEDDFNTTLNCVSGVLFLRFFCPVILNPKLFNWVSEHLDETSQRNLTLICK
                     VLLNLSNITYFGNKEPFMILMNEFIESHKSELLDYIDKVTLKKIDFSPKKLKLAGCVA
                     RPNLTMNKEELKELPMNPYLIDKHLRETEIFTFLASITIRKEGNLHLLKNMKFGTDDV
                     ICDRPVMGQKLMIRGLEFEKITENNTEIFGSDLLKYLEGGETPTSDDNKPHENPNLNE
                     DIIEQLKQESMLLYHKIGNLTQMLTDYEYPSEVVLNQPNYSEFLADNTYFTKDKKLIA
                     NLRGDLGDLKGLEKLFDFKTKKSALFDNIVTWGGIDCLDTTDGPPVYASTSESSSSLS
                     RNITRLKSKRLPKIIPGSSKEKNRDKSPGKLKRLFKRST"
     gene            complement(<303087..>304082)
                     /locus_tag="ZYRO0G03784g"
                     /db_xref="GeneID:8205956"
     mRNA            complement(join(<303087..303992,304074..>304082))
                     /locus_tag="ZYRO0G03784g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498119.1"
                     /db_xref="GeneID:8205956"
     CDS             complement(join(303087..303992,304074..304082))
                     /locus_tag="ZYRO0G03784g"
                     /note="highly similar to uniprot|P24280 Saccharomyces
                     cerevisiae YMR079W SEC14
                     Phosphatidylinositol/phosphatidylcholine transfer protein
                     involved in coordinate regulation of PtdIns and PtdCho
                     metabolism products of which are regulators in Golgi to
                     plasma membrane transport functionally homologous to
                     mammalian PITPs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498164.1"
                     /db_xref="GeneID:8205956"
                     /db_xref="GOA:C5DZE7"
                     /db_xref="InterPro:IPR001071"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:C5DZE7"
                     /translation="MVTAAEKEIFESYPQSCRPEAGSGTPGNLDDAQKKALAELRSIL
                     ESAGYTERTDDSTLLRFLRARKFDVKLAKEMYVNCENWRKENGVDTILKDFRYDEKPL
                     VAKYYPQYYHKTDVDGRPVYFEELGSVNLTEMYKITTQERMIKNLIWEYESFCKYRLP
                     ACSRYSGYLQETSCTIMDLKGISISSAYQVLSYVKEASNIGQNYYPERMGKFYLINAP
                     FGFSTAFKLFKPFLDPVTVSKIFILSSSYQKDLLKQIPAENLPEKFGGKSKVSESEGG
                     LYLSDVGPWRDPKYIGPEGEGPKMFSMN"
     gene            <304402..>306522
                     /locus_tag="ZYRO0G03806g"
                     /db_xref="GeneID:8205957"
     mRNA            <304402..>306522
                     /locus_tag="ZYRO0G03806g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498120.1"
                     /db_xref="GeneID:8205957"
     CDS             304402..306522
                     /locus_tag="ZYRO0G03806g"
                     /note="similar to uniprot|P49956 Saccharomyces cerevisiae
                     YMR078C CTF18 Subunit of a complex with Ctf8p that shares
                     some subunits with Replication Factor C and is required
                     for sister chromatid cohesion may have overlapping
                     functions with Rad24p in the DNA damage replication
                     checkpoint"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498165.1"
                     /db_xref="GeneID:8205957"
                     /db_xref="GOA:C5DZE8"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZE8"
                     /translation="MDSTVPNCTSIGESFLFGGSGGEKESVKEVGKNDSNNGDREFVS
                     GSGKVVRLRKRVNSSVENYGGSLWREDETYGININALLDKIESESASNGHHQDEKASN
                     LHDNELWVEKWRPRRFIDLVGNEKTNRRVLRWLRQWSPAVFQESLPQPLYENEFDPLQ
                     RPAKRILLLHGPPGIGKTSVAHVIAKQAGYTVAEINASDERGGWQVRDKILNTLFNHT
                     FNQSPVCLVADEIDGTLESGFIKVLIDVVNSDARATRKMGVPKKGKKNRDKLLLRPII
                     AVCNNLYAPALEKLKPLCEIVPFKRPSDFSLNERLDTICRVEGVKIHSKSLKDLIDLS
                     QGDVRNCVNNLQFWATGTSSQASSSSMDTDPMGKDFSSSWYGLVNSIFQRDPHRESRD
                     QLSSLSQQIELNGNYDRIVQGCHSIFPRVKYSDNGVIKPSRIADWLYFHDLMNKSLYQ
                     HNGELMRYCAAVPLQFAHMFGDIANKEDIQVKNSQYEFNELRKFTMDITNCIAHQTLK
                     RSPAVQTFTSRQSLIFETLPYLDSMISADVSKCKNLKVKQAIYDNLAELLNFYQLNVV
                     ARNHDSLEGKKILSIDPPLDQIVLLDNKRKQEVLSKRPGSLNFLLAKFEENKARKRHV
                     DQTMEKREREDEVRVKRSKTAMASGNTVDFFKTQYGINEPNKLDTEVPISKHQEDEIR
                     TWVRYKEGFSDAVRKNVAWSSLWS"
     gene            <306789..>307433
                     /locus_tag="ZYRO0G03828g"
                     /db_xref="GeneID:8205958"
     mRNA            <306789..>307433
                     /locus_tag="ZYRO0G03828g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498121.1"
                     /db_xref="GeneID:8205958"
     CDS             306789..307433
                     /locus_tag="ZYRO0G03828g"
                     /note="similar to uniprot|Q04272 Saccharomyces cerevisiae
                     YMR077C VPS20 vaculolar protein sorting (putative)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498166.1"
                     /db_xref="GeneID:8205958"
                     /db_xref="GOA:C5DZE9"
                     /db_xref="InterPro:IPR005024"
                     /db_xref="UniProtKB/TrEMBL:C5DZE9"
                     /translation="MGQRPSRVKITKNDRAILQLKRSKDEIHKFAKRTDNLIASERVR
                     LKTMIQEDPKHYKENPKIRFLLKRIHYQNHLLEQAGDQLINLENLVSTLEFKLVELQF
                     VKGLEHGNEILSKLNKEFKGADQLMDNVQSQTSYQNEINDVLARSVVGVDDFEEELDK
                     ELDQLEEQFILKKEPQKEPEIQMPSTEGLPDLKSEEQDSAEHASEEIIGERALA"
     gene            complement(<307633..>308889)
                     /locus_tag="ZYRO0G03850g"
                     /db_xref="GeneID:8205959"
     mRNA            complement(<307633..>308889)
                     /locus_tag="ZYRO0G03850g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498122.1"
                     /db_xref="GeneID:8205959"
     CDS             complement(307633..308889)
                     /locus_tag="ZYRO0G03850g"
                     /note="similar to gnl|GLV|CAGL0J01936g Candida glabrata
                     CAGL0J01936g and some similarites with uniprot|P40564
                     YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
                     J-domain-containing protein, required for peroxisomal
                     protein import"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498167.1"
                     /db_xref="GeneID:8205959"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:C5DZF0"
                     /translation="MVVDTEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAA
                     TERFQSISEAYQVLSNKDLRANYDKSGKEKAIPKGGFEDAAEQFSVIFGGEAFAAYIG
                     ELTLLKNLQKQEELHAEEEAEKEKEKEKKEDEKKKQKEKEEEIKQKGDNIDQLNKDMS
                     HLTVYDEQNQPKDTAKKSKLAEFEEELKAEKEKNNEKLVKILIDRLSILTESAYDNDC
                     KRSFERKFEEEANLLKMESFGLDILHTIGSVYVERAKIYLASHKAFGLGGMFQSMKAR
                     GGVFMDTLRTVSAAIDAQSSMKELESMKEASESTTPQHDKQGNEISKPTPEEVAHQEE
                     ILMGKVLSAAWYGSKYEIMSTLRTVCDRVLEDESYDKLTRDRRAEALILLGKVFQRTY
                     RTKVEQEEAQIFEQLVAEATKKKRHT"
     gene            complement(<309117..>312716)
                     /locus_tag="ZYRO0G03872g"
                     /db_xref="GeneID:8205960"
     mRNA            complement(<309117..>312716)
                     /locus_tag="ZYRO0G03872g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498123.1"
                     /db_xref="GeneID:8205960"
     CDS             complement(309117..312716)
                     /locus_tag="ZYRO0G03872g"
                     /note="some similarities with uniprot|P40563 Saccharomyces
                     cerevisiae YIR003W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498168.1"
                     /db_xref="GeneID:8205960"
                     /db_xref="InterPro:IPR021582"
                     /db_xref="UniProtKB/TrEMBL:C5DZF1"
                     /translation="MSSEELPPVPSRPQRQAGSPSPIPTIPARPNSKSPPPQVPTRRP
                     TRVKTSDLKDLMQNTDDQLEQMQNLIQKRSDDSKVHSEQLRNQEDSWQRGKEDLIGTN
                     EMEFELQEEKERLLKKKEIELKERNIHQANREKELEMLERRREELMREREKERQQELK
                     RQQQLELEDQRQRELERKQELELEAKRKELEQLEREQQLAREKAVKLQETKHQFEEKR
                     TLDTESKEKTTSDNEPVLEKADEDFGIRNETKEEPEIPRIPERPRRSQSPTDTESKSN
                     VEIPKIPGIPERPKRSQSPTDTESKSDVEIPKIPERRPRPIGRRSIETPVVAEKRPES
                     LENKLGEPPVVPGKRPESLEEKVSEPLASLEQKPEFLERKVSEPLASLEQKPESLEEK
                     VNEPLTAPENKLESIKKEASTEFPSVPAKRPEHLKKELPDEFTAPLEKKPEPFEKEPS
                     EFSFLPEEKPNSLEKKLSNESSLSQKNPEPIGKKPSAELSVASEERPEPVEKNSTSES
                     LVLPEKRPEALEKELSTGINAQSEKELETLKKEPSNDSTTVPERTTESEEKKSSTEPL
                     KKESTASSLESEKRISVESKPEFPSVPDRKPEFNERNSTFDEPGFAEKTPELSSKPEA
                     EQPYSEDWKTTSSNVSKQASIESPVNSEKLQEKPGIEDNNSKLSTSDINENKRDSDIK
                     HQEKKSEESAKEPVKKKAPPVPKKPSSRIVAFQEMLRKQQMEEMQGSHRKGPEPVNEA
                     PKDSKNGADSSESSQPSLPQRPARQPINAERSKFANNLNGLFALPGMSPMGGLPQSFA
                     KKLDPAASTPGPEEKKENQATPPSVSNVRSSRARGPRGRKLPSNVASVEKVNSESKTN
                     EIEIFKTWKTVVHKKEEPAVPERPPSLSKKPTESGNEKAVDVTNPTHFDLDNDKAVRP
                     LEETTKAKDHDDNSHGTDDILTSPKEDTRIIEEKLEESKTSGNPSSLEESQESKNQTE
                     KPLVPERPSKNQEKKHPLVPERPLTSESARSDELAQNSEPLVSERPVKHDEKEHELAE
                     EPSILERSSKNQEEKHPLVPERPLTSESLKSDEPAKNSEPLVSERPAKHEKQEHKHAE
                     EPSILERPKKHTEESEKPSKPALPEEQLEYEKSLDFPKKFPEATEPVPETTFAFGTEN
                     NSKESSNVDLLSAVKDTGQSQLEHSDSELNQFTKDSDLAEKLKQELKQEDKEE"
     gene            complement(<312974..>313351)
                     /locus_tag="ZYRO0G03894g"
                     /db_xref="GeneID:8205961"
     mRNA            complement(<312974..>313351)
                     /locus_tag="ZYRO0G03894g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498124.1"
                     /db_xref="GeneID:8205961"
     CDS             complement(312974..313351)
                     /locus_tag="ZYRO0G03894g"
                     /note="highly similar to uniprot|P33331 Saccharomyces
                     cerevisiae YER009W NTF2 Nuclear envelope protein interacts
                     with GDP-bound Gsp1p and with proteins of the nuclear pore
                     to transport Gsp1p into the nucleus where it is an
                     essential player in nucleocytoplasmic transport"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498169.1"
                     /db_xref="GeneID:8205961"
                     /db_xref="GOA:C5DZF2"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:C5DZF2"
                     /translation="MSLDFSTLAQQFTQFYYNQFDTDRSQLGNLYRDESMLTFETSQL
                     QGTKNIVEKLVSLPFQKVGHRITTLDAQPASPNGDVLVMITGDLLIDEEQNPQRFSQV
                     FHLIPDGSSYYVFNDIFRLNYSA"
     gene            <313613..>317911
                     /locus_tag="ZYRO0G03916g"
                     /db_xref="GeneID:8205962"
     mRNA            <313613..>317911
                     /locus_tag="ZYRO0G03916g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498125.1"
                     /db_xref="GeneID:8205962"
     CDS             313613..317911
                     /locus_tag="ZYRO0G03916g"
                     /note="weakly similar to uniprot|P33332 YER008C
                     Saccharomyces cerevisiae SEC3 Non-essential subunit of the
                     exocyst complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p
                     Exo70p Exo84p)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498170.1"
                     /db_xref="GeneID:8205962"
                     /db_xref="InterPro:IPR019160"
                     /db_xref="InterPro:IPR028258"
                     /db_xref="UniProtKB/TrEMBL:C5DZF3"
                     /translation="MMKSARSPFKKKSHSRDNSVEDRGFFHRRSTSGSNIPSAQHSRQ
                     ASNGGLNMGPPVSGNNATAHKRTVSNSSRSSQSSNFLAEQYERDRRGILASCFSNDGK
                     SSGPPNSYITHVRIIEDARYPSSRPALDSKLENKKKRVLILSSKANNPKAVQLHKGRE
                     NADGRFQVGRTWSLKELLAIERDVEVNEGFMLTMSKKYYWETNSAKERVVFIKSLVNT
                     YMQAFDGHVPELVNWDLSMFYLDERAYQRAVIRNRNARPTVTPPVGSVSGSSSGTGSP
                     GAPLSNLNTRIANPDPAVPSPRSPTRAFGGSSSFNDHFAQNKQAAPVKPSPNMSGYSN
                     SPTLSNEGNNSYDQHHEQKQQQQQQQQRQAVAQQKMWQQEQDQQQQQAHQAHLAWKSH
                     QAQKDQQVRKEQVLRQQEQMRQQELARQQELARKEEQQRQHMARQAQFEREALQAQEA
                     TVESDPFYPYPVAHGNRDFLPGTSPRELSNKSSFAGLNSAHNSPNMAGSPSLNSPQQF
                     PAKQPQIATSEIPQIKQNPVKQGSPVSMGSAGEMGDVPRKGSASQNKQDNLLEDLNNV
                     LAGPSSAHALPDAHSSVSQDRSEELYNGVPSGKGVSSMDIPSLSIPQTEPLNTKSTPT
                     SEMVDADDMAGDLNASSMDAQQDNSNDLSFERGDEASFSTNLAPNPPHVYHEVSTIQE
                     EAPPVDGQKKSVIAPGAIDESSEDQKRDMKKDAAYIEDEELLGILTDINWEMGDAADD
                     LIEKLTIKMAETAYTLNNGLLSLEDVGPSLLPYEKQVDEVCDKMNPVFSLFLMEMGNV
                     AEDIEYIEGQKNGLQIESANKKNLWSTLTELMNTVSLDDATLNELLNSPVSEKTLLRM
                     ESQLKSLFRALKAISGESEEENYDLGNMQALKERRETYERVTEVFLKRLVDAFSGMFV
                     NIYKDNTTEDYLTSFLNRLLVFSSLTLFCKDVDRESYNIILDKWITSIQVVYNHICEK
                     MISNLRKYKLDKREQPAVANENALGNLLIQWESYKKTRTLPEVVPSSAKSVAHLKSSL
                     ESLGKLCVCYQNFIDSFFHVSSSLDFEAYLEQYGDPTTRIVPLYSVKPMQSDRESALK
                     EANLVSRIFRPNITKMNSYFTTILRADCSRAPAIMLFLEEKIKSLESSNQEFLLTAMS
                     QMLDQVKQLWSEYIEDEVVHLERAVINMSSRSLSPSVLGFVLFVKNSNDYISYAQSQS
                     ELKSIQSLEAIKIFESDSGKLGNAIIKLLSRKDGGASMLAGVRGAAAEASSTDRIVTL
                     LLNCYWLIEVLSMLNVRGSFDSTIQSAKKIFDSEKEVYAAFLLRDAMPKLTSFVHGAS
                     SLVGTSSQGGDSNLVKSAAYSRQNLDNILAGYTSSEVDVLVKRLYQQMIRHLSHESND
                     LMKGTLGDRLWSSIQGQTVSLYLKLYTLIEKHYKGALVRFTKNDIITAFERYKE"
     gene            <318186..>321206
                     /locus_tag="ZYRO0G03938g"
                     /db_xref="GeneID:8205963"
     mRNA            <318186..>321206
                     /locus_tag="ZYRO0G03938g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498126.1"
                     /db_xref="GeneID:8205963"
     CDS             318186..321206
                     /locus_tag="ZYRO0G03938g"
                     /note="similar to uniprot|P40562 YIR002C Saccharomyces
                     cerevisiae MPH1 Member of the DEAH family of helicases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498171.1"
                     /db_xref="GeneID:8205963"
                     /db_xref="GOA:C5DZF4"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZF4"
                     /translation="MAPFGGEDSDLDDYELDSLSRQGVNRVVKETVTKKNIPVQRDLL
                     GQILPGQNSYYEEIKRDVTFRPTHHALNEKNLSHYVYPTNYEVRDYQYDIVKKALFQN
                     VLCAIPTGMGKTFIASTVMLNFFLWTIRGKIIFMAPTRPLVAQQIKACLGMTGIPHDQ
                     TAILLDKSRKNREEIWDTKRVFFTTPQVVENDLKRGALNPKDIVCLVIDEAHRATGSY
                     AYTNVVKFIDRFSTSYRLLALTATPGTDLESVQEVIKNLDISKVEIRTEESMDIVKYM
                     KRRIQEKIQVEPLFEMLEIVEQLGIAILPVLRQAVELGIYENCDPAQINAFKAMQQSQ
                     KIVANPNIPEGIKWRNFFILQLLNHVGQMLKRINIYGIRTFYNYFSDKSLEFTTKYGM
                     GKSSNKTAAEFYYHPILKNMTTQCENLLADPKFLGHGKLRHVRDELVDFFARGKSDSR
                     VIIFTELRESALEIVRCVDAMDYRHIVPHIFIGQAKGKEGFDEVSFTRNNKAKGRKKV
                     DRLKRQEEDQQIEEEKKKRKKQEALERVSRRTGSSEEAQANGMTQKQQKEVIQKFKDG
                     EYNVLVCTSIGEEGLDIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGRIILLFSSNE
                     SNKFDQAMKDYANLQKVITQNILEYQKSDRIIPADVDPQCREQFITISEEDQEVNDMD
                     DSEEVIRFATDCMLGKQRKSKRNAKVGQPKKQKRFFMPDEVETGIITADKLVRKVKKP
                     KKELPLLDNLENDSLELSSPVKSEFEGSQATMPTITDAQLKPTDPLPLPDSPPSIKRE
                     RSPSQDARVPSFSPDRPVTSNLNLGPPPPVKVKAEPFSPEQTTSDLIDFVSVGQKIDS
                     DENRHSSPPLNRRGQDKIFDDFSNNNGGLLTPQEREYFQRNYSVNDTVAIDTLPDFSQ
                     YTKTAHIPHSTRNQGFLNLFQDMKRNEKARIIEMNRTRCIARGLQNGVLNQAKELVDP
                     NQHAVLQNNGIQPLSREGTRLEDLDEILGSDSDF"
     gene            321336..321490
                     /gene="SNR14"
                     /locus_tag="ZYRO0G03960r"
                     /db_xref="GeneID:8205964"
     ncRNA           321336..321490
                     /ncRNA_class="snRNA"
                     /gene="SNR14"
                     /locus_tag="ZYRO0G03960r"
                     /product="U4 RNA"
                     /note="SNR14 (U4 RNA)"
                     /transcript_id="XR_002648430.1"
                     /db_xref="GeneID:8205964"
     gene            <322285..>327141
                     /locus_tag="ZYRO0G03982g"
                     /db_xref="GeneID:8206799"
     mRNA            <322285..>327141
                     /locus_tag="ZYRO0G03982g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498127.1"
                     /db_xref="GeneID:8206799"
     CDS             322285..327141
                     /locus_tag="ZYRO0G03982g"
                     /note="some similarities with uniprot|P32521 YIR006C
                     Saccharomyces cerevisiae PAN1 Part of actin
                     cytoskeleton-regulatory complex Pan1p-Sla1p-End3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498172.1"
                     /db_xref="GeneID:8206799"
                     /db_xref="GOA:C5DZF5"
                     /db_xref="InterPro:IPR000261"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="InterPro:IPR011992"
                     /db_xref="InterPro:IPR013182"
                     /db_xref="InterPro:IPR018247"
                     /db_xref="InterPro:IPR026812"
                     /db_xref="UniProtKB/TrEMBL:C5DZF5"
                     /translation="MYNPYQNTGYFQQQPQQQQQQQQQQHSFGQQNPQASGFGGMPGS
                     LSSTPMNFPQLQAQQQPSRFGGANTAVNPTGMSNLMPQSQSSFGSQQNTGMMGMPGPS
                     NTASATSNQGNFVNQPQQQHPQSTGYFQSNALPLQQPQLQSQPTGFQNPLLSNPTGGM
                     QPLLPQSTGFYHPTGGMPQAPLEPLKPTATGLVNSFANGGLNHDIKIPARRLSFITSN
                     DQAKFETLFRSIVPKGSNTISGEDCKKIFLKSGLQASELAKIWKLSDTTRAGELLFPE
                     FALAMHLVNDVLQGDSIPYELDTKTKNEVGSFVDAINLSIARGDGDPGPKTPFDDLMM
                     GGLKPQSTGFMPPTSFGMPLQGQVTGGGAGLLNPQRTGFMPQTSFGMPMQPTGGAQFN
                     PMGNMGGNAGVGIQSTGFMPQTSFGAPLQSQLTGGAVQRQPTGGFQNNFMPNMQPQNT
                     GGFAALQPQKIQPQATGSLLPQGTGGLRPQTTGSFQQQQQQQQQLGGFQPQPTGGFQP
                     QPTDGFQPQLNGGLQPQGTGGFQQQGFGGGIQPQLTGGFQQPQPSGGFQQPQPTGGFQ
                     QPQPSGGFQQPQPSGGFQQPQPSGGFQQPQPSGGFQQPQPSGGFQQAQPSGGFQQPQP
                     TGGLQPQSTGPLQPQGTGFGQQGGGVPPLQPQGTGSFNGNLPQQPNGGFQGVPPPQQQ
                     PQLTGGLMPQATGGASTAVPIQQTGLSTQSTGFLPPSGFNPTQPLSAQKTGFGNNEIY
                     TQSSFSQDFNGQNLDDILPEEKSLFYKIFQTYDTDKRGILDASKAVEIFRKSGLNRGD
                     LEHIWALCDINNTGQLNKQEFALGMHLVYRKLNGFQLPNRLPLNLIPSSTKILDDVKN
                     QIKSSVGTEDRRSSTKTDALSYKNNDDEDVLPSFRNRRKVFGANAPPATTNQDASAPA
                     ASASASAASQQAKPNVSDLKRAINERRQRLDTEKARLQTTTSDDDLRFISSLKSQIGE
                     LPSISVVNDSVPADLKERYETLLVKLPNLFVQIDEIDTQIRNAKLQLFKMKNPFSISG
                     SGPNGEITDEDRKKAKSKALLKSRMNALTGKPSGPIGSFEEEEVKYNEEIKKINAGCN
                     SNKEIIGDIKSSIADIAASLESGLSGGSIHANPGDFEVWEFGTRLEPEVRDFVYSLRT
                     KTSQREQGNSSTVSAEANYSQQNYSQPAAQDVSRQTYGNLPQSTSNGYSQQPVDNNST
                     PVTSSNSQSYNFTDPSGNYRSQATVNSYSYSSNGNRSDNYNSGGSNQTSRQPSYAGGT
                     SHNQPSSNEVVNGDDGEDEEEKQLRDKLEMLKLKKKSEKEKRLADLRRQIEEAKADGD
                     EEAEVAALQNVANQRSTSSISISQDPAPSAASPALNQGRDGHPNVNSSHPSYGSAPAA
                     HAGVNATRSSTVMSASPVSSVASPQPSGQGGRNAFFKQTPSTSSSFDLRAAETQRRLQ
                     RGLDDDESEGWSDDDNANAQTASPPKEPVPSAPYQQAPTPVAPAPVAPAPVAPAPVAP
                     SNEEPKPMAPSLPQVKDDGPPVPVAPPLPQVQHQGPPVPVAPPLPQMQSESKPFFAGP
                     PPLMPNEDENGGHGHGHGHEEEKHYADENDDDDDSLSIPESVGSDEDNFEMAHSAPSN
                     IPPPPPLP"
     gene            complement(<327232..>327735)
                     /locus_tag="ZYRO0G04004g"
                     /db_xref="GeneID:8205965"
     mRNA            complement(<327232..>327735)
                     /locus_tag="ZYRO0G04004g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498128.1"
                     /db_xref="GeneID:8205965"
     CDS             complement(327232..327735)
                     /locus_tag="ZYRO0G04004g"
                     /note="similar to uniprot|P40565 YIR005W Saccharomyces
                     cerevisiae IST3 Component of the U2 snRNP required for the
                     first catalytic step of splicing and for spliceosomal
                     assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498173.1"
                     /db_xref="GeneID:8205965"
                     /db_xref="GOA:C5DZF6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DZF6"
                     /translation="MNQIKAIERINEAELSQGILTHEQSWHYEYRNQAYIFIGGLHKE
                     LTEADVLTVFSQYGVPVDLKLVRDRENGESRGFAYLKYEDQRSTVLAVDNLNGAIVAG
                     RRIRVDHALYEPRDDDWDYREAVREELDKDKVLVPGERQLPSREDDKNHRDQSQEDDE
                     LADPMGS"
     gene            <327866..>328720
                     /locus_tag="ZYRO0G04026g"
                     /db_xref="GeneID:8205966"
     mRNA            <327866..>328720
                     /locus_tag="ZYRO0G04026g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498129.1"
                     /db_xref="GeneID:8205966"
     CDS             327866..328720
                     /locus_tag="ZYRO0G04026g"
                     /note="similar to uniprot|P40011 Saccharomyces cerevisiae
                     YER010C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498174.1"
                     /db_xref="GeneID:8205966"
                     /db_xref="InterPro:IPR005493"
                     /db_xref="UniProtKB/TrEMBL:C5DZF7"
                     /translation="MLRTYNAPLVRIYWKILSRPARTGLDICKPVVDGYVQQGSVRTF
                     IPSSRLNKMSDPRFDELTPCDVSDGLLNKYKIDNGGYLPNLTQWSGHSKGTIHGKAYT
                     VLFAPANDTRPSVNYIDSVPQGAFLVIALTRDLQLPYAPYVKPTQAVYGGLMSTRAQY
                     LKAAGTLVFGRIRDLKEHKSLEHPVFSYGVGSCAAKAAVKPIGINVPLEILTSNGEVE
                     IIKPGDYMVGDANGIVKVPSEVELDSLVGYVRKSVEADELVTTDIKNGRPAKEAQKDR
                     RATLKNYL"
     gene            complement(<328792..>330717)
                     /locus_tag="ZYRO0G04048g"
                     /db_xref="GeneID:8205967"
     mRNA            complement(<328792..>330717)
                     /locus_tag="ZYRO0G04048g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498130.1"
                     /db_xref="GeneID:8205967"
     CDS             complement(328792..330717)
                     /locus_tag="ZYRO0G04048g"
                     /note="similar to uniprot|P40549 Saccharomyces cerevisiae
                     YIL014W MNT3 Alpha-1 3-mannosyltransferase adds the fourth
                     and fifth alpha-1 3-linked mannose residues to O-linked
                     glycans during protein O-glycosylation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498175.1"
                     /db_xref="GeneID:8205967"
                     /db_xref="GOA:C5DZF8"
                     /db_xref="InterPro:IPR022751"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DZF8"
                     /translation="MIKRFLHPRSLRRYAFLIIFVLIVYSITTASSRSQFKLETGLGP
                     NVSGRRRANALSAFSWIDNRRKHTLELVNGSKNSRSPFDLLPWGKEDNKVSEAEQNLL
                     VKLEDAPLDMKCRYMIDAIYVAHKGWNNQQMTKYHSSEEANDMLASLLGERVRLFDHC
                     FISGGLKVKDVMNMDSLVSEDKLGSPEDFIERMFPFLQQGNLVWPKMYDLRRGKELKM
                     PAVAQDTYANFWNNWIKLSKGKGIAATFNPTELTLFHRQLRVLSKLNNTLPIQVVTSG
                     FEFTRAQVDQLSQYARDTDQEVTLIDCSTILIKEFTQNNVEKFVNKWLAALFNTFEEV
                     LLLDVDTVPFVDVEEFFKEPQYRATGMALFKDRAMMDEHTYGYCLETLAGLEPSHEEN
                     KLMGTKLLFESTQKELPQTEAASVYRRFFHDGVLHHVDSGLVPVNKVKNFGGLLFSFM
                     INLDTKIQGCVHGDKEFFWLGQLYAGKNYAIYPQDAGVIGLIEDKPMEALTQTSYTIC
                     GSQLAHTFYSLTKEAHQLVWTNGGLSTCKVPHGAEMDFQRLPDYFMARYGDVETTKQV
                     YAAPLHIQAMIIPDSEKSTWLQLRECGDSAFCASAVEDTADGRNSVSTLIQFTPEEQD
                     FLDSISFAWNGRTFTDG"
     gene            complement(331258..331330)
                     /locus_tag="ZYRO0G04070r"
                     /db_xref="GeneID:8205968"
     tRNA            complement(331258..331330)
                     /locus_tag="ZYRO0G04070r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8205968"
     gene            <331742..>332374
                     /locus_tag="ZYRO0G04092g"
                     /db_xref="GeneID:8205969"
     mRNA            <331742..>332374
                     /locus_tag="ZYRO0G04092g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498131.1"
                     /db_xref="GeneID:8205969"
     CDS             331742..332374
                     /locus_tag="ZYRO0G04092g"
                     /note="weakly similar to uniprot|P40573 Saccharomyces
                     cerevisiae YIR017C MET28 Transcriptional activator in the
                     Cbf1p-Met4p-Met28p complex participates in the regulation
                     of sulfur metabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498176.1"
                     /db_xref="GeneID:8205969"
                     /db_xref="GOA:C5DZF9"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C5DZF9"
                     /translation="MALIPMSEDTDAVNISQYLQDLISSNSELGSRLLSLLLVSSGNG
                     KEIMDAINKGDLGSIRNLDLAVDLKMPNGGENRDIKTSNARQQLALISNGGKSQQQEQ
                     PSFQKSQGQAQEENGTDSSSDTLNNPKGEKRKKNTEASARFRIRKKQKEQERLNKLKE
                     LNIKITGLYKRIDVLLEENQHWKQKLEELNERKSREMLDRIRKRNANSPL"
     gene            complement(<332525..>334720)
                     /locus_tag="ZYRO0G04114g"
                     /db_xref="GeneID:8205970"
     mRNA            complement(<332525..>334720)
                     /locus_tag="ZYRO0G04114g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498132.1"
                     /db_xref="GeneID:8205970"
     CDS             complement(332525..334720)
                     /locus_tag="ZYRO0G04114g"
                     /note="some similarities with uniprot|Q08206 Saccharomyces
                     cerevisiae YOL036W Protein of unknown function potential
                     Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498177.1"
                     /db_xref="GeneID:8205970"
                     /db_xref="UniProtKB/TrEMBL:C5DZG0"
                     /translation="MSAKEHKSNNSAEGSPTVSNGCGSSNAHLQDIKEEDDGVKEDLL
                     LPPLPCSIEKNESDPFDLSKALEIPCSVTSRDNNSVSGGNNVNNAHSVKENSEGNNIS
                     SGGSGVSLSSPRISLKKKFSNALLNTGESSPVPFPSESSFSEFDAGTLVRPVSEFRSQ
                     SSSNANSFQHILPTLNKAIDDGNADTSNSSSNNTTSSEAHLAQFFDIRKPSRKFSTSS
                     SSNSSHSDTSVSEEFFQKIPSPKMSFKSRSRSRSNSNSNLISTSLSLEGGGTTPTTVM
                     NTPNSSSNNIYGRDVEAKRTPLLRRASSAILRKNSRRNVVATGPGGVSIVGNGTSGNS
                     ASSTPILQQSAFFEMADPIQRTPPRDRIFSNSTDDTDYWPSERSILPDDDDSMNYVTK
                     LGRTTSRNPSIGSKVKRGFSRIMSSGGSMRKAVSSTSLRSDYKFAQQQQQQQQHQHQQ
                     QQQQYPQQQYPQQQQQQQQQQQQQQQRQSFENIFNRGGSNIPRNSLAGVLDSGVNNIN
                     SSSSGNVTPISTSTIMSPKSNHWPRNSQGHPNQFNETPQPTMGLGMEWKSTGDSMPKE
                     KTNYLSNSLHPSGSPDSMKSDITVDLDKLTKTVPVITVTDDLRTEGCTPIQIQSNISL
                     DEVFTRNDAGARSGNFKNAHNNNSSSDEFTNTNISTEKPEMMSLTDYIRVLVKQQQVE
                     DERLAIIEKNFKDSGWCSKDDLKNLRLKRVIISKKWAERISHYQSRLDS"
     gene            complement(<335007..>335771)
                     /locus_tag="ZYRO0G04136g"
                     /db_xref="GeneID:8205971"
     mRNA            complement(<335007..>335771)
                     /locus_tag="ZYRO0G04136g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498133.1"
                     /db_xref="GeneID:8205971"
     CDS             complement(335007..335771)
                     /locus_tag="ZYRO0G04136g"
                     /note="highly similar to uniprot|P40303 Saccharomyces
                     cerevisiae YOL038W PRE6 20S proteasome alpha-type subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498178.1"
                     /db_xref="GeneID:8205971"
                     /db_xref="GOA:C5DZG1"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DZG1"
                     /translation="MSGYDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVL
                     GCERRSTLKLQDSRITPSKISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLED
                     PVSVEYLTRYVAGVQQRYTQSGGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWT
                     AQTIGRNSKTVREFLEKNYNRDEPPATADECVRLTTRSLLEVVQTGAKNIEITVVRPG
                     SKIEILSSEQIGKYVEEIEQEKKEHQEQLARKKRRD"
     gene            <336548..>336814
                     /locus_tag="ZYRO0G04158g"
                     /db_xref="GeneID:8205972"
     mRNA            <336548..>336814
                     /locus_tag="ZYRO0G04158g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498134.1"
                     /db_xref="GeneID:8205972"
     CDS             336548..336814
                     /locus_tag="ZYRO0G04158g"
                     /note="some similarities with uniprot|Q08176 Saccharomyces
                     cerevisiae YOL026C MIM1 Mitochondrial outer membrane
                     protein that mediates assembly of mitochondrial
                     beta-barrel proteins also proposed to be involved in
                     mitochondrial import"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498179.1"
                     /db_xref="GeneID:8205972"
                     /db_xref="GOA:C5DZG2"
                     /db_xref="InterPro:IPR013262"
                     /db_xref="UniProtKB/TrEMBL:C5DZG2"
                     /translation="MTEATPIEPGKDLTLPDEPLETIEESPSALSRVGSFTASCAINL
                     VLPFINGLMLGFGELLAHEVCWRKSIFPPTNRGYQIYPERRKFL"
     gene            complement(<336864..>337295)
                     /locus_tag="ZYRO0G04180g"
                     /db_xref="GeneID:8205973"
     mRNA            complement(<336864..>337295)
                     /locus_tag="ZYRO0G04180g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498135.1"
                     /db_xref="GeneID:8205973"
     CDS             complement(336864..337295)
                     /locus_tag="ZYRO0G04180g"
                     /note="similar to uniprot|P40571 Saccharomyces cerevisiae
                     YIR015W RPR2 Subunit of nuclear RNase P which cleaves tRNA
                     precursors to generate mature 5' ends not shared between
                     Rnase MRP and Rnase P in contrast to all other Rnase P
                     protein subunits"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498180.1"
                     /db_xref="GeneID:8205973"
                     /db_xref="InterPro:IPR007175"
                     /db_xref="UniProtKB/TrEMBL:C5DZG3"
                     /translation="MSYNITNPMAKGSNRVENGVLLTPPPRNVGNKEHYQRMNYLYQL
                     AMWNTMSGNDGGEQALARLYAKNMDLVSKRTRAEMLPQLKRTICKKCHRVLVPKKTMR
                     VQTDSGSLQLVCSCGAVRNFPIHLNGGYRCYAERDENLISM"
     gene            complement(<337325..>337939)
                     /locus_tag="ZYRO0G04202g"
                     /db_xref="GeneID:8205974"
     mRNA            complement(<337325..>337939)
                     /locus_tag="ZYRO0G04202g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498136.1"
                     /db_xref="GeneID:8205974"
     CDS             complement(337325..337939)
                     /locus_tag="ZYRO0G04202g"
                     /note="weakly similar to uniprot|P40570 Saccharomyces
                     cerevisiae YIR014W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498181.1"
                     /db_xref="GeneID:8205974"
                     /db_xref="UniProtKB/TrEMBL:C5DZG4"
                     /translation="MVNSGGPVSMKQLTVISYLCVYIRFVKDGSLLLALLAWATVNLG
                     EFMGSVMSAYQDSVDSDAEDMEGAGRLSVVKAVMHKGLKYTQAILMLQVIYAVSYHMK
                     MDLEGDFCRRRGAYILLLLVGEQECGRGGRWMLLALDWVILLMQLVLITMELTPDDGR
                     NCHELDQLDTDRYGALAILQFNPYSEPSSMPELPVTRGNHYGSI"
     gene            <338031..>339875
                     /locus_tag="ZYRO0G04224g"
                     /db_xref="GeneID:8205975"
     mRNA            <338031..>339875
                     /locus_tag="ZYRO0G04224g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498137.1"
                     /db_xref="GeneID:8205975"
     CDS             338031..339875
                     /locus_tag="ZYRO0G04224g"
                     /note="some similarites with uniprot|Q08179 Saccharomyces
                     cerevisiae YOL027C MDM38 Mitochondrial Distribution and
                     Morphology"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498182.1"
                     /db_xref="GeneID:8205975"
                     /db_xref="InterPro:IPR011685"
                     /db_xref="UniProtKB/TrEMBL:C5DZG5"
                     /translation="MAKRISQKLSFISTTIHSWIRSVTFKVGPRHFQIFYKSIFIMLS
                     TKIIGSVRPAARVVPLYPLRYSQLQRYQSNVKQNSSSNSGVNANTTTNATKAAKPKPK
                     EPLSQRIKHEVKHYVNGTKLLGYEIKISAKLLFKFMQGYELSRRETNQLRRTTSDVFR
                     LVPFSAFILVPFAELLLPIALKIFPNLLPSTYESGTDKQKKTDSLIDVRRKTSNFLRE
                     TLEESNLLSYNSIETAEKKKKFLTFFKKLYSPKDGKTNVFTHDEILLVAQMFKNDSVL
                     DNLSRPQLVAMSKFMSITPFGNDNVLRYRIRHKLKQIMEDDRIIDYEGIGSLSEYEIY
                     QACVSRGVKAYGVSKEELVDNLKVWLELRLRHKVPSVLLVLSSTFTFGGLEKKQVLDS
                     KAYSPQVEHKEQKSRYDELMDLYYDGILHVLSSIPDPVYNVAKLDVSESKQPSATVTK
                     EAALARAQAAESALQSAIEKQAPEGIERAKRAVTEANEELAKAEAAAQETPSQPAPEA
                     EPATKEKPEVKEPAPAAEKVKTEAEPKPEEKEEEEEEVVPTTDDNEFKLRVLKEQEEL
                     IKKETEDAKARKTAEHLSDDITLDEEDKPTTPIPAEEGAKKSVIEKKN"
     gene            <340188..>341492
                     /locus_tag="ZYRO0G04246g"
                     /db_xref="GeneID:8205976"
     mRNA            <340188..>341492
                     /locus_tag="ZYRO0G04246g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498138.1"
                     /db_xref="GeneID:8205976"
     CDS             340188..341492
                     /locus_tag="ZYRO0G04246g"
                     /note="similar to uniprot|P40574 Saccharomyces cerevisiae
                     YIR018W YAP5 bZIP transcription factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498183.1"
                     /db_xref="GeneID:8205976"
                     /db_xref="GOA:C5DZG6"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR018287"
                     /db_xref="InterPro:IPR027328"
                     /db_xref="UniProtKB/TrEMBL:C5DZG6"
                     /translation="MMDTDRSDTALDKFPKLQPKSSPDDELTISKVHISKNWKLPPRL
                     KPGRRPQIKLKDLDEDECSTPEDETKKKKQNRDAQRAYRERRANRLQELEDTVNTLRN
                     AMKNWKRRCMDLEAELQDARKDNSSLKHQLDMIRSNLCNDCLKDPCICHNESVTLLQD
                     PFLQNMVKNFKPMKAVNLKKRKLSSSKLSESPAPQQHIVSVASGGCGFCSDRTTCVCK
                     DLEVSDTEQHEIQQQQHLEESVTATLGHCSSNDKGHCKNCSDIDKSCISTESAPAPAK
                     TTQKSTSANWEPGSCAQCQADPASKVFCKSICNSANIIAAVEVGGKKDDCSSNLAFEP
                     GSCSQCQVDPQHKEFCEAVFSNGEQQLNADEKADTDLIPVSHAYQRIKNYMTDGNIEN
                     VHSNLSLPPMKQIASGIRIRGREVESKSVDDALRDMDKNALG"
     gene            complement(<341614..>343077)
                     /locus_tag="ZYRO0G04268g"
                     /db_xref="GeneID:8205977"
     mRNA            complement(<341614..>343077)
                     /locus_tag="ZYRO0G04268g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498139.1"
                     /db_xref="GeneID:8205977"
     CDS             complement(341614..343077)
                     /locus_tag="ZYRO0G04268g"
                     /note="similar to uniprot|Q08193 Saccharomyces cerevisiae
                     YOL030W GAS5 Putative 1,3-beta-glucanosyltransferase has
                     similarity to Gas1p localizes to the cell wall"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498184.1"
                     /db_xref="GeneID:8205977"
                     /db_xref="GOA:C5DZG7"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DZG7"
                     /translation="MKISTIGTVIAAAVFSSSVVQADSSDLPPIKIDGNAFFNSKNGQ
                     RFYIRGVDYQPGGSSKLQDPLADSDNCKRDIPVFKDLGINTIRVYSVDNSKDHSDCME
                     QLQEAGIYLVLDVNTPQASLSRLDPKCSYNANYLQNVFATIDAFAKYDNVLGFFAGNE
                     VINDVNNTFTAPYVKAVVRDMKKYMKSQNYRQIPVGYSAADIASNRELAAQYFNCGDE
                     DDARIDMFGVNDYSWCGDSSFEKSGYSTKVETYENYSIPIFLSEFGCNQGVSDGRPFT
                     EIGAIYSDKMSSVFSGGLVYEYSGEANGYGLVDIDGDSVSKNQDYQNLKKQYAAQSNP
                     SGDGGYSTSKKHSDCPSYKKDVWEANNTIPDMPSAASAYFKKGAGTPQGTKASTQNDC
                     GSDVHVVPAGGSDSSDSGNGNNSTSSSGGSSSSTSTSSSTSGISSHKSSSSASITTST
                     KGDASTKGKNNKSVGAGAVLQVPSFFRAMAQVVDLVL"
     gene            complement(343479..343551)
                     /locus_tag="ZYRO0G04290r"
                     /db_xref="GeneID:8205978"
     tRNA            complement(343479..343551)
                     /locus_tag="ZYRO0G04290r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (AGT) cove score=74.49"
                     /db_xref="GeneID:8205978"
     gene            <344316..>345917
                     /locus_tag="ZYRO0G04312g"
                     /db_xref="GeneID:8205979"
     mRNA            <344316..>345917
                     /locus_tag="ZYRO0G04312g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498140.1"
                     /db_xref="GeneID:8205979"
     CDS             344316..345917
                     /locus_tag="ZYRO0G04312g"
                     /note="weakly similar to uniprot|Q08157 Saccharomyces
                     cerevisiae YOL019W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery and vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498185.1"
                     /db_xref="GeneID:8205979"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:C5DZG8"
                     /translation="MLSPLLAGITLLQFVAMAFLVIACLTAPVFHQIGLSNQSGTTYG
                     VFGYCGDITGCSKAKAQYSVPTVQALGDNWLFNKNARQKLGHLLIATPVAAGLNFFAF
                     LSLMMTLMSALMSRKNSSSSAVAFFINLFLIVLAFLGSTFVCLVCFFTFWPHVTWVTW
                     ILIPAAVLPLIEIPTVFLAHARGNADGSGFIKHRRPINLEEPDDKFASNEPRDDDSFA
                     EDKPLVLPDYAKRQNPEPVFKVDTASSDKSWKEKHAAEERTRELSREHSYENSYENSY
                     ENLYDEPLAVSNNPQQAASVIRSDSQLGSPEKQAHSMLSMGSSEYSEPVQRNTDSRAV
                     LEDIIKDTLGTGDQHTEVSDHQDAESNFTSISQRATARSAGPETAAMLQQQQQQPMPQ
                     ALPGQGAIHRNYMGPPPQQRAGYGYQPQWYPPRPHTHPRHMYGRPNGYMMPPRLAQPH
                     PMAMRNSGYGPAPHPMAMRGPQQHPMMAPSAGPPSQMAAPAAGVPMGSAPANGPHYKP
                     AYKKRMGAQNAIPSAAALNNTYGFR"
     gene            complement(<346017..>347096)
                     /locus_tag="ZYRO0G04334g"
                     /db_xref="GeneID:8205980"
     mRNA            complement(<346017..>347096)
                     /locus_tag="ZYRO0G04334g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498141.1"
                     /db_xref="GeneID:8205980"
     CDS             complement(346017..347096)
                     /locus_tag="ZYRO0G04334g"
                     /note="similar to uniprot|Q08144 Saccharomyces cerevisiae
                     YOL018C TLG2 member of the syntaxin family of t-SNAREs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498186.1"
                     /db_xref="GeneID:8205980"
                     /db_xref="GOA:C5DZG9"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR006011"
                     /db_xref="InterPro:IPR006012"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C5DZG9"
                     /translation="MFRDRTNLFLSYRRTFPHNARFSSSRRSLEDPFADEDEEAYPMQ
                     ELGVKSSDALPPSFVDMTQEVDESLAEVDRLMVQLSKLYRKNALPGFEDKSHDEKEIE
                     SLSFKLIQLFQRCYGVMKRLQRVEEDQQYMGRQLQRDDLVILENLRKRYAQKIQIQSN
                     KFRVLQNNYLKFLNKDDSKPVFPKSEGTSQLLLEEEEEEKGQNRDIEAYSRQTLQRQR
                     TSNQNATQQFLRERDEEITQLAKGVLEVSVIFREMQELIIDQGTIVDRIDYNLENTVI
                     ELRSAERELKSATRYQKKTQKCKIILLLSLCVFALFLFVMLKPHNSTKTIRPPPEAPV
                     PAQHPDVPERPELPPKADPEARNLD"
     gene            <347602..>349968
                     /locus_tag="ZYRO0G04356g"
                     /db_xref="GeneID:8205981"
     mRNA            <347602..>349968
                     /locus_tag="ZYRO0G04356g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498142.1"
                     /db_xref="GeneID:8205981"
     CDS             347602..349968
                     /locus_tag="ZYRO0G04356g"
                     /note="weakly similar to uniprot|Q92274 Saccharomyces
                     cerevisiae YOR129C Putative component of the outer plaque
                     of the spindle pole body may be involved in cation
                     homeostasis or multidrug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498187.1"
                     /db_xref="GeneID:8205981"
                     /db_xref="InterPro:IPR012860"
                     /db_xref="UniProtKB/TrEMBL:C5DZH0"
                     /translation="MSTPCTANVDYLLTAEFDNRFGPVVRDQYPSVIPGFEYEMREGH
                     SQNNAVFNLASLMIPNNAEYNTGDEPDTTVFMLYRNRETVKYELFPSKQVDQVICFVN
                     VVYAQEDKSNSRGTNIKAVALGTTMVDFIAFKPFVLECLHKFMKLKNKDDITPMLKSC
                     FKLLNRAELSFVKRLHSNPIRQSLLRSLGDDTRLEKWIDEASFGRFMFKGLLRCHHHD
                     KYTNRITLRRGKISIKLQGYRPKREFADLSKIPLEFDAVTWGSINWNVKYDTKISKFL
                     LNFIPLLHKRDANDSFHFKLVIYSSQYKGSGLSQFAIALSNLMGLTNGTRSFSNKPCL
                     TLPFVDVSIIGPLKEYLALQDRGIFLIMGTTNPIFKSQDGLYDYYYDLDNELISEAAN
                     GEGKITPITSNKWDMTAFKRLLTINSISPTSSIETPRIGFLQKIIESIDEKAINFSEI
                     VLAFQKVNVMQLLQLDCRMENINPGDLFDEYITKYRDGVVFQEIFEAESFRILQLLRT
                     INDIMSRLYQLNLPLLDRTDLLCLLDDLFSEIYSFINTDEDHLEKFLAACLRYPFVFP
                     CSQYNLQEDNLVKVNLKQELKNCFKEDKFWLSLVEDPMEQSSILSKFIKDRSLSLICL
                     PLLFNPNIKVKKSPASEPSEAVITPPANVSVRRRKSVSIKQMLNIGKNRESIAETSPL
                     RSNSEASTTSNTSINGRFFRSESSSVPPSKLDHVDVNKKTKNIRSLAYKIICVIQVHF
                     IGKPIIDQSLAPFFKSVLASFQSEQSVKEGTPSSSDSSDTRSSTTTRE"
     gene            complement(<350070..>351911)
                     /locus_tag="ZYRO0G04378g"
                     /db_xref="GeneID:8205982"
     mRNA            complement(<350070..>351911)
                     /locus_tag="ZYRO0G04378g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498143.1"
                     /db_xref="GeneID:8205982"
     CDS             complement(350070..351911)
                     /locus_tag="ZYRO0G04378g"
                     /note="similar to uniprot|Q06408 Saccharomyces cerevisiae
                     YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
                     decarboxylation of phenylpyruvate to phenylacetaldehyde
                     which is the first specific step in the Ehrlich pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498188.1"
                     /db_xref="GeneID:8205982"
                     /db_xref="GOA:C5DZH1"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DZH1"
                     /translation="MGPVSYESQDIRTKRIPFGEYLFKKLVQSGSKSIFGVPGDYNLP
                     LLEHLYDDSVKDIGCRWIACCNELNAAYAADGYSRYTNKLATLITTYGVGELSAINGV
                     AGSSAENVKVLHIVGVVKSDAPECNYHHLIPQLQHSNFIGPNRKICYDMVKDRVACSA
                     EYLEDIETAPEKVDKVITEIYKHSKPGYLFVPADFADKLVDTTCLNNEINLCNSIERT
                     PSEKLDSIVDGVLQWIYQSQTPAILADGNVDRFGLISQLNQFIERTQMVNFTTIMGKS
                     IIDETNPRYQGLYAGKSCTDLVRSKFLSCDLILHFGVEKNEVNYCAQGFPYGPQAKVI
                     EFHQSYIRLFDTLNGDEQLFENVNFVDVLTALHQRIDISKLNLQYDKAIFTTYEPSQL
                     NLPEEDTSDVTQIYLQKKFPEILAPGDILVSDTGSFQFGVRDYKLPTQSKFMAQSTWL
                     SIGMGLPAALGVGIGMQDYPRIHICDQSKVPAGYKPKLVLGVGDGAAQMTVQELTTML
                     RYHVDINVFVWNNNGYTIERAIMGENSDYNDIMPWRWTKLFEAFGDFDGKYSNSSLVK
                     TRQELDQKIEDINKGGKGIELVEVKLGVMDYPAQLQMMLSNMKNAKK"
     gene            <352778..>354490
                     /locus_tag="ZYRO0G04400g"
                     /db_xref="GeneID:8205983"
     mRNA            <352778..>354490
                     /locus_tag="ZYRO0G04400g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498144.1"
                     /db_xref="GeneID:8205983"
     CDS             352778..354490
                     /locus_tag="ZYRO0G04400g"
                     /note="uniprot|Q9UVE6 Zygosaccharomyces rouxii ade2
                     Phosphoribosylaminoimidazole carboxylase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498189.1"
                     /db_xref="GeneID:8205983"
                     /db_xref="GOA:C5DZH2"
                     /db_xref="InterPro:IPR000031"
                     /db_xref="InterPro:IPR003135"
                     /db_xref="InterPro:IPR005875"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR016301"
                     /db_xref="UniProtKB/TrEMBL:C5DZH2"
                     /translation="MNSQTVGILGGGQLGRMVVEAANRLNIKTIILDAPNSPAKQINA
                     LNEHVDGSFSNPADIEKLAEKCDVLTVEIEHVDVPTLKKLQSKHPNLKIYPSPETIGL
                     IQDKYVQKNHLVANNIAVAESIPIESTTSEGLALAGRQLGYPYMLKSRTMAYDGRGNF
                     VVKSEESIPKALEFLKDRPLYAEKWAPFTKELAVMIVRSIDGRVFSYPTVETIHKDNI
                     CFLCYAPARVPDSVQLKAKLLAENAVRAFPGCGIFGVEMFYLETGELLINEIAPRPHN
                     SGHYTIDACITSQFEAHLRAILDLPMPKDFSSLSTSCTNAIMLNVLGEDVKNQELQTC
                     ERALETPGASVYLYGKESRPKRKLGHINVVTSSMEECERRLSFITGETSEPVKITVAQ
                     KIDSESNGKPVVGIIMGSDSDLPVMSKACAILEEFEVPFEVTIVSAHRTPQRMNKYAS
                     EASSRGLKAIIAGAGGAAHLPGMVAAMTPLPVIGVPVKGSSLDGVDSLHSIVQMPRGV
                     PVATVAINNSTNAALLAVRFIGAFEPKYHKKMQQYLLKQEVEVLEKAKKLENSGYKNY
                     MGLE"
     gene            <354683..>354922
                     /locus_tag="ZYRO0G04422g"
                     /db_xref="GeneID:8205984"
     mRNA            <354683..>354922
                     /locus_tag="ZYRO0G04422g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498145.1"
                     /db_xref="GeneID:8205984"
     CDS             354683..354922
                     /locus_tag="ZYRO0G04422g"
                     /note="highly similar to uniprot|Q3E785 Saccharomyces
                     cerevisiae YDR379C-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498190.1"
                     /db_xref="GeneID:8205984"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:C5DZH3"
                     /translation="MAKRLSGLQKEVLHLYRASVRVAHTKPKQNQPHFINYIREEFGK
                     HKDLPKRDFTTIEHLLRVGNKRINLYSSPELKDIN"
     gene            complement(<355149..>358784)
                     /locus_tag="ZYRO0G04444g"
                     /db_xref="GeneID:8205985"
     mRNA            complement(<355149..>358784)
                     /locus_tag="ZYRO0G04444g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498146.1"
                     /db_xref="GeneID:8205985"
     CDS             complement(355149..358784)
                     /locus_tag="ZYRO0G04444g"
                     /note="uniprot|Q9P8F2 Zygosaccharomyces rouxii rga1
                     Pheromone response protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498191.1"
                     /db_xref="GeneID:8205985"
                     /db_xref="GOA:C5DZH4"
                     /db_xref="InterPro:IPR000198"
                     /db_xref="InterPro:IPR001781"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5DZH4"
                     /translation="MDLGTSLTEFTTANGNQFPNCVRCQDEITSGHAYELGDDRWHTH
                     CFSCYRCEKPLSCDSDFLVLGTGTLICFDCSDACRSCGKKIDDLAIILSSSNEAYCSE
                     CFKCCKCSSKIRDLRYAKTRKGLFCISCHEKLLAKRKCYEERKRRLRKDLPELPPELS
                     TPPSIPVKSPRRPQYDLPQRSMKSNSESVISQYLDDIDSKVSGDPNEDSNPIETRDSR
                     ASTQESLGSEREKVEAAKENQQDGVAAPATKGKNRHHRQVSIDDILNSTLEEPDAFGL
                     RNSIGGLSKTPLRNQDSSEHLAKSPVRFRHGMVVNDDDDDDHEDDDDDDDDDDDQDME
                     EGLGQVKQRKQFQLIPDLSNDDISELTEEEEKKPLENKGLALNLPSQKKDEDTLTLGL
                     DDVPASPPSKIKAPQSSWSETKAIPEIKSTPEKKSPPENKLTSPQPKTSVSRHTPTVK
                     SSPRYSPKPSSSSSSIKHAHSPRQPPSSISSISTPGNPSSASTASTLQGSSTGGNNLA
                     PNFLIAEEKSKGGGSKLGRSLSMKSKHLVHNLKSRTTGILDPKPIPSSPPSHNREKLG
                     FSAFPSSPSNYSISDATTKAESDTHTGWGVTNEKASIPRSPSMHRTTPKGKSDSNVHS
                     GSVSPNINHNRSTSGAELPDHRRARSHASVSSSTATNVSMYRTPPLENNPVFGKLTNS
                     SAKSHHRNFSWQAANEVVKEEDSSASQEADITNNSESSENEHFLKKELAEAELSLRRV
                     KLELRELESKKRHLTSDVDHLKTTKEGLTRDIEGLKSEKERYILESLGQLQHQQQREQ
                     REPHHPQREQSQREQTQREQTQREQPQREQPQREQPQREQPQNHSQQSNSTVPQQQHR
                     QQSQQHLQTPSLTNSGLSGNKQDISIDDISPPRQADTASIARPASKPRFWKIFSGGGK
                     QAATPTHTPQHQNYSSQPAANSSTGAASIHNGGSNNNSKLEISNPVLQNPHEFSDMKL
                     FPITNSNSESSSRTSPSRSDGSMLYGSNLVSRCAYEQNDIPMIVTVCVSHIESNENYM
                     KAEGIYRKSGSQLLIEDIEKAFADCYAKPSPEVLKLMSEDIHAVASVLKRYLRKLPNP
                     VLTFQIYEPLIKLVREHRLLNTLPLKSGGNTDKNPLYLNALESVTKILKNLPREHYDL
                     LRYLSRHISKITSYSEWNLMNLYNLSLVFAPGLIRDYNGDKDILDMKERNYIVGFLLG
                     NYKDIFD"
     gene            complement(<359309..>360262)
                     /locus_tag="ZYRO0G04466g"
                     /db_xref="GeneID:8205986"
     mRNA            complement(<359309..>360262)
                     /locus_tag="ZYRO0G04466g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498147.1"
                     /db_xref="GeneID:8205986"
     CDS             complement(359309..360262)
                     /locus_tag="ZYRO0G04466g"
                     /note="some similarities with uniprot|P17106 Saccharomyces
                     cerevisiae YJR060W CBF1 Helix-loop-helix protein that
                     binds the motif CACRTG (R"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498192.1"
                     /db_xref="GeneID:8205986"
                     /db_xref="GOA:C5DZH5"
                     /db_xref="InterPro:IPR011598"
                     /db_xref="UniProtKB/TrEMBL:C5DZH5"
                     /translation="MSKREHGEEDDESIKRQKQDDNIDAALLNEGEAQSGSQQYETAA
                     TAAAVAHAAYGDLIQHPGDEGKSGGAGDDDDDDEGAENHGSAGVHAHTGAEGGAGDNE
                     GGEDEEEDEEEEEDVDDQIKDPDHVPEDDDDENRGKQSHRRSSGSIKSGLGGNTSARS
                     GSGSADVDLEDAAGADDDVDDDEKKMFARRARRAPAATGSDEWRKQRKDSHKEVERRR
                     RENINTAINKLSELLPVKESSKATVLARAAEYIQKLKETESANIDKWTLQKLLSEQNQ
                     SRLSTANERLQDELGRAYKEIESLRQKLKEAGIEVETSNEN"
     gene            complement(<360635..>362545)
                     /locus_tag="ZYRO0G04488g"
                     /db_xref="GeneID:8205987"
     mRNA            complement(<360635..>362545)
                     /locus_tag="ZYRO0G04488g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498148.1"
                     /db_xref="GeneID:8205987"
     CDS             complement(360635..362545)
                     /locus_tag="ZYRO0G04488g"
                     /note="similar to uniprot|P47116 Saccharomyces cerevisiae
                     YJR059W PTK2 Putative serine/threonine protein kinase
                     involved in regulation of ion transport across plasma
                     membrane enhances spermine uptake"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498193.1"
                     /db_xref="GeneID:8205987"
                     /db_xref="GOA:C5DZH6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DZH6"
                     /translation="MPQKAESMNPFRALGKKLKEHAEGKNHASGGSSRADSPDKNGRN
                     RSASFASKKGTPVPNAPHNLKPANSSASLQNIMAHNHNPFAAHQDPQRSGVPARRNTH
                     SSDKKHPARQASHPVLSHEKMVYNPYGLNNPRNGGSMNGGHGNNDLSFYMHDGDAHVR
                     VLPLPISDPNGFLPEDMKQISVALTDNFTFDSDNQALGSGGSSEVRKIRSSHHPRNLY
                     ALKKLNMIYDETPEKFYKRCSKEFVIGKHLSHSVHVANTYCLVKVPTTTYTTRGWGFV
                     IEICAKDLFQLMERSGWRTVPLSEKYCIFKQIANGVKFCHEQGIAHRDLKPENVLLTH
                     DGVCKLTDFGISDWYHTDPQDPNSPVKTCEGMIGSSPYAPPEVMVYDSKKNFPQSAQK
                     PFDPLLMDSYALGIILMSLVNNVLPFFESCNVDSRYRDYATAYEQYVHYQNSHFRDKG
                     CHRPGPGAEYLLARNFNSSDAARVAWRLADPKASTRYTMEDLFNDPWFQSIETCVDPE
                     EEPTLNAPELRAPASQISTNGTAGSINTSGPSAEEPTKPRSMVDIAESPTAPSAHNNI
                     AQITRKMSDISVSSSNHSIQQSTSMAHQNSSVSLRSQATSRPKKRRLQHNHLEVPASI
                     APSSSARAMSSR"
     gene            complement(<363004..>366159)
                     /locus_tag="ZYRO0G04510g"
                     /db_xref="GeneID:8205988"
     mRNA            complement(<363004..>366159)
                     /locus_tag="ZYRO0G04510g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498149.1"
                     /db_xref="GeneID:8205988"
     CDS             complement(363004..366159)
                     /locus_tag="ZYRO0G04510g"
                     /note="similar to uniprot|P24004 Saccharomyces cerevisiae
                     YKL197C PEX1 AAA-family ATPase peroxin required for
                     peroxisome biogenesis contains two 230 amino acid
                     ATP-binding AAA cassettes upregulated in anaerobiosis
                     Pex1p and Pex6p interact via their N-terminal
                     AAA-cassettes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498194.1"
                     /db_xref="GeneID:8205988"
                     /db_xref="GOA:C5DZH7"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR015342"
                     /db_xref="InterPro:IPR025653"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:C5DZH7"
                     /translation="MTASKAGELHFSGIRVVSANDIKGNFVRLPSSIVQTLESTGISI
                     QEFGISIVRESKEILHTGWDGYESQGYANGQSTIDINPILAREFGLVMGSLVDLTICK
                     YGASQTATEVHVEPESSDDWEIIESNSMFFQDEILHQTRIVTVGEVLICYIDNVVSKF
                     RINRIFPETLKSARINTGSLIVIAPRENRARHPVENVKARELNKPMDTVARLRRTIIT
                     TDSTELQGLQARVHPGELESEYALVSILYNSLDMKHLQALKKASGKYASDIACTVAID
                     GTVPSGHIMLSPLVWDCLCTAPENGIKLKIEFCLGQNFANDSSNSVKVLVKSLVSEEE
                     AAKRDKRRVLHSSNLQKGPSQTILDLMGKLQTTVLTHKMIFAKENVTIELLVENSGKH
                     PIITDFNENPIGDNWQYLPLEEVKLPLNELNYKLEGSTFVKKSMELDSLVTTDLIKQL
                     SNFLTLPVTPSSCAMLEGGSGMGKTTLLQQLAKELILKHGKYVKYVDCDSLMESSNLT
                     RMKQFLQDCCSLCYWHGPSVLLLDNASTLFPNMKSEDPQQQAQLQRGGPTSTKLAMTL
                     IHGIQMISRKNSEAVRVVICDKNKHELNGSFFDKHFVSETFKIKALDTDGRTNMIQFF
                     IKKTHTELADDLQFRDIALETEGYSPLDLELLVEKMFYNLTILQSHQNSEGLLDKKLF
                     QETLKSFTPSSLQGVKLTKSTGVKWDDIGALKAPKRLLLETLEWPVKYAPIFANCPLQ
                     LRSGVLLYGYPGCGKTLLASAVAQQCGLNFITVKGPEILDKYIGASEQNVRELFERAQ
                     SVKPCILFFDEFDSIAPKRGHDSTGVTDRIVNQLLTQMDGVEGLDGVYVLAATSRPDL
                     IDPALLRPGRIDKSVLCNIPSLVDRHDILRAITSKMDILQGTDLYPVAQQTEGHTGAD
                     LQGLCYSAYLKAVHRELDEHEKSQEADQNQDKDSTQDIVHSVINGGDPSSLLQNVRLF
                     TSKQNSDLQYGKGTTDQKLPKPKISLKDLLDAAKETKSSISTHELYKLRSIYDRFQDN
                     RDGQMPNGEGSVETGTRTSLA"
     gene            <366337..>366780
                     /locus_tag="ZYRO0G04532g"
                     /db_xref="GeneID:8205989"
     mRNA            <366337..>366780
                     /locus_tag="ZYRO0G04532g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498150.1"
                     /db_xref="GeneID:8205989"
     CDS             366337..366780
                     /locus_tag="ZYRO0G04532g"
                     /note="highly similar to uniprot|Q00381 Saccharomyces
                     cerevisiae YJR058C APS2 Small subunit of the
                     clathrin-associated adaptor complex AP-2 which is involved
                     in protein sorting at the plasma membrane related to the
                     sigma subunit of the mammalian plasma membrane
                     clathrin-associated protein (AP-2) complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498195.1"
                     /db_xref="GeneID:8205989"
                     /db_xref="GOA:C5DZH8"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027156"
                     /db_xref="UniProtKB/TrEMBL:C5DZH8"
                     /translation="MAIKFILCFNKQGIVRLVRWFELSASEAQRTQDVMVQIYRLISS
                     RDHKHQSNFVEFSDSTKLVYKRYAGLFFVMGVGLQDEEPIYLSHIHLFVEVLDAFFGN
                     VCELDIVFNFYKAYMVMDEMFIGGEIQEISKDMLLERLSTMDRLE"
     gene            complement(<366792..>367448)
                     /locus_tag="ZYRO0G04554g"
                     /db_xref="GeneID:8205990"
     mRNA            complement(<366792..>367448)
                     /locus_tag="ZYRO0G04554g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498151.1"
                     /db_xref="GeneID:8205990"
     CDS             complement(366792..367448)
                     /locus_tag="ZYRO0G04554g"
                     /note="similar to uniprot|P00572 Saccharomyces cerevisiae
                     YJR057W CDC8 Thymidylate and uridylate kinase functions in
                     de novo biosynthesis of pyrimidine deoxyribonucleotides
                     converts dTMP to dTDP and dUMP to dUTP essential for
                     mitotic and meiotic DNA replication homologous to S. pombe
                     Tmp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498196.1"
                     /db_xref="GeneID:8205990"
                     /db_xref="GOA:C5DZH9"
                     /db_xref="InterPro:IPR018094"
                     /db_xref="InterPro:IPR018095"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZH9"
                     /translation="MARGLLILVEGLDRTGKSTQASILLDKLKPNAELVKFPDRTTPI
                     GQLINRYLTDESFQLPDQSIHLLFSANRWELSQSLQNTLLSGKHVIMDRYVYSGIAYS
                     LAKGIDGMDFDWCIQPDKGLIKPDLLFFLSNRDSLDTASREGFGQERYESLAFQEKVR
                     DQFYRVLERLENYSQGTDSNRLQMINVTNQSIDQVSITIWEIVNRKLQNEPPTDFAFF
                     "
     gene            367722..367807
                     /locus_tag="ZYRO0G04576r"
                     /db_xref="GeneID:8205991"
     tRNA            join(367722..367760,367772..367807)
                     /locus_tag="ZYRO0G04576r"
                     /product="tRNA-Tyr"
                     /note="tRNA-Tyr (GTA) cove"
                     /db_xref="GeneID:8205991"
     gene            complement(<367996..>368337)
                     /locus_tag="ZYRO0G04598g"
                     /db_xref="GeneID:8205992"
     mRNA            complement(<367996..>368337)
                     /locus_tag="ZYRO0G04598g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498152.1"
                     /db_xref="GeneID:8205992"
     CDS             complement(367996..368337)
                     /locus_tag="ZYRO0G04598g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498197.1"
                     /db_xref="GeneID:8205992"
                     /db_xref="UniProtKB/TrEMBL:C5DZI0"
                     /translation="MADCLCENFPNYNFMGSKRTADFEDRSQEECVVRYNKKIKREPL
                     TPPRESSCEVENKGCSPYWEVEEYMVRGYESIQDVQCSLYDLTPEEELERQCDDDDGE
                     VPRIDCDIDMM"
     gene            <368774..>369502
                     /locus_tag="ZYRO0G04620g"
                     /db_xref="GeneID:8205993"
     mRNA            <368774..>369502
                     /locus_tag="ZYRO0G04620g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498153.1"
                     /db_xref="GeneID:8205993"
     CDS             368774..369502
                     /locus_tag="ZYRO0G04620g"
                     /note="similar to uniprot|P47115 Saccharomyces cerevisiae
                     YJR056C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498198.1"
                     /db_xref="GeneID:8205993"
                     /db_xref="UniProtKB/TrEMBL:C5DZI1"
                     /translation="MERLNTLGSSLPPEQPPTNQVIESLSSELSQEFKLAANAVTKLY
                     RVANERNSLLKHQGYLQCLEDILSIMGQNPSASTDVIHLWCLKQKNEMLSHGSGISPD
                     SSATTNSNKFDFNFDNPNVSNINNTDVSVPKFRLSNPPPSVEHTTTNHKPKKTRWIKR
                     QPTWAKEDKILRDDESIGDDQRSPHRKSDSDKVQEHHIYHPHHHHHHYYNDNNDRTKM
                     GTEPETDLGPKKKQRLDKTDSIGD"
     gene            <370067..>371029
                     /locus_tag="ZYRO0G04642g"
                     /db_xref="GeneID:8205994"
     mRNA            <370067..>371029
                     /locus_tag="ZYRO0G04642g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498154.1"
                     /db_xref="GeneID:8205994"
     CDS             370067..371029
                     /locus_tag="ZYRO0G04642g"
                     /note="weakly similar to uniprot|P54003 Saccharomyces
                     cerevisiae YML052W SUR7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498199.1"
                     /db_xref="GeneID:8205994"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DZI2"
                     /translation="MGLLSISNWILRFSTILFFAGNVLLLILIIISGGSNNYPISRFY
                     WVEGDTSGIPHAPNVTRWTYWGACSRSDGHTHCGGTLGPAYPISPVDNFGTKTNVPSK
                     FISRRSSLYYLTRLSFSFFWIALSFISTSFLIYAGSWFSHGVSYVTWVLTFVGCIFNI
                     LAVIFQTAASVMARDAFTDAHRHGKLGAPLFGMAWASVFLCLIEIASVVVTHFLGRRP
                     DGTIPQDQENYDYERAQLPNVKGPSRRTTHPFRSFFSRPQNDSGNEYHEDVNDEEKLR
                     HPDTSSVEQPEVHSNVANGEHAHGDDLNFSNVKRHQDADSLQSV"
     gene            <372009..>373322
                     /locus_tag="ZYRO0G04664g"
                     /db_xref="GeneID:8205995"
     mRNA            <372009..>373322
                     /locus_tag="ZYRO0G04664g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498155.1"
                     /db_xref="GeneID:8205995"
     CDS             372009..373322
                     /locus_tag="ZYRO0G04664g"
                     /note="similar to uniprot|P04387 Saccharomyces cerevisiae
                     YML051W GAL80 Transcriptional regulator involved in the
                     repression of GAL genes in the absence of galactose
                     inhibits transcriptional activation by Gal4p inhibition
                     relieved by Gal3p or Gal1p binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498200.1"
                     /db_xref="GeneID:8205995"
                     /db_xref="GOA:C5DZI3"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DZI3"
                     /translation="MYHNKRSAVSTVPNEDPIRVGFIGLSFSKGWALKTHRPAILQLS
                     SQFVITAVYDEDEKMAIDTIERLKLVHAKPFTDLESFSTFENVDMIVVSVQASQQYEI
                     VMPLLEFSRRNSNLKYLFIEWAFASNLQQAEKVYQAAAIRGLQTIIALQGRKSPYIQR
                     AKELIHENNIGEINSIEISCNACWYGYERSRKVANGMFEMGNGLDLVTTTFGHTIDLL
                     QYITESYFSKINALIFNNIPEQMLVDDLGNPMGRTSPKTVPDHLLFHGCLQRGNVPVS
                     CTIKGDKPTKKFTKNFIIDIHGTRGDIKIEGDAGFAEMSNLVLYYSGIRVNDIPIASD
                     NGHPVQPSLDQGKEFMEVYHLRNYDAVHGNVFRLYQSIADFHFNTKNIPNLPSQFVMQ
                     GFEFEGFPTLMDGLIIRRLIDSVYRSNSMGATLDVTHILQFPSSV"
     gene            complement(<373311..>373799)
                     /locus_tag="ZYRO0G04686g"
                     /db_xref="GeneID:8205996"
     mRNA            complement(<373311..>373799)
                     /locus_tag="ZYRO0G04686g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498156.1"
                     /db_xref="GeneID:8205996"
     CDS             complement(373311..373799)
                     /locus_tag="ZYRO0G04686g"
                     /note="similar to uniprot|P46973 Saccharomyces cerevisiae
                     YJR055W HIT1 Protein of unknown function required for
                     growth at high temperature"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498201.1"
                     /db_xref="GeneID:8205996"
                     /db_xref="InterPro:IPR007529"
                     /db_xref="UniProtKB/TrEMBL:C5DZI4"
                     /translation="MGPKIAEKCGICHDNDAKYKCPKCGIKYCSLTCYKDEARHKDPV
                     DSTDQKEEQIGKNEKPANSAKPPQLASPEYSKIYTETPEIQELLKYNTVKFHLSKVHR
                     ILSSEVADPNESNMNNEMKRQLAVDYLNTLRYGGIHYNEAIEEFCQLSLSKLNNPDQS
                     NA"
     gene            <373979..>374959
                     /locus_tag="ZYRO0G04708g"
                     /db_xref="GeneID:8205997"
     mRNA            <373979..>374959
                     /locus_tag="ZYRO0G04708g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498157.1"
                     /db_xref="GeneID:8205997"
     CDS             373979..374959
                     /locus_tag="ZYRO0G04708g"
                     /note="similar to uniprot|Q04689 Saccharomyces cerevisiae
                     YML050W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498202.1"
                     /db_xref="GeneID:8205997"
                     /db_xref="InterPro:IPR009737"
                     /db_xref="InterPro:IPR012336"
                     /translation="MVFHYRSILKYQVFRAYFHRQYEQVRIHTGGSQLLTCDCQNYSS
                     RLNQSLPNEFKLDVDSPLPSKVPSYKKHALVLSLQNKSADELEWMTNWQSKLELNPMW
                     PYSIIGDLKTHLKHTKFGSDVLVNAISIHSGNLSAPSRDPHERAHIFVIPDMKLYKIS
                     PQDVVSFAHFLGGGHTRQVADHQLSFADFLKGADNVVNKTELVSEPSNADHAFPHEDC
                     KRDWILVCGHNQRDRRCGILGKELINEISAKGLDKDKNVALISHVGGHKFAGNLILYN
                     YVGTNEKTGENQLDSLWFSRVLPPNLGTLLEHVDAKKIPQEYYRGGTSMN"
     gene            complement(<374995..>378903)
                     /locus_tag="ZYRO0G04730g"
                     /db_xref="GeneID:8205998"
     mRNA            complement(<374995..>378903)
                     /locus_tag="ZYRO0G04730g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498158.1"
                     /db_xref="GeneID:8205998"
     CDS             complement(374995..378903)
                     /locus_tag="ZYRO0G04730g"
                     /note="similar to uniprot|Q04693 Saccharomyces cerevisiae
                     YML049C RSE1 RNA splicing and ER to Golgi transport
                     involved in secretion and RNA splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498203.1"
                     /db_xref="GeneID:8205998"
                     /db_xref="GOA:C5DZI6"
                     /db_xref="InterPro:IPR004871"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DZI6"
                     /translation="MFGENDELILFHLTLQRQTNYVHSCIGHFIDVNDDSSQEVTGSK
                     VNRKRHLQLCISTQTHLELYDVSEGSLRSLAVVPLFATITAMETLNLENSPSSFLALT
                     SDSGNLTISRFASIEPQGKIVLQALINQPLTRSGLRRLSPISHLQVDLHGRCLFLSAI
                     ERNKLCFVANQIGQDGISIQDPLEALVPNTLTLDTAVCDVRYDNPCFASLELQQGNHH
                     LVFYVLDLGLNHIVKRASYKIDETANFLMGLPDLSKYRISTYMDSNEHHHGDYDEINP
                     FVLVGFEDFVMIKDLHGFYNIKVPIPRRKDVSMPTTIICFAIQTLKNNFFVLLQSNHG
                     DLFKLKIEPNKEDSNRPVAFISYFDTIPQATDLHIFKNGFLFANVEFYDNRLFQFESL
                     GDDTPIEGTFEPSSTLRNLSLVETQKNLNPLISSQVTSTTPLTLAANSMNKTRFMVNG
                     VDFDVHVSSGVNVDARELWSIKFPSDNYHRLLFLASHDLTMILETEAGAMGELAGEQH
                     EFKTKSDRTVFVGSMGSKSVVQVCVNELRQVVFNADSKKYEKKLEWFPPAGIRVVAAD
                     CNYSQLAVGLSNGEICYFEIDTESLSDSLHELQNRVEIDEQIKGLAMIPEPRSDYLAV
                     GTKEANLKVLSLKKNDMDNFLEVVSLQALMAPVSDLKITRTERDVELHIGLINGLYSR
                     SKLNRYDGQLYDVRNKFLGPKEVTLSVLPSMSFLKKTSDEEEEEEEDDEDEDEGTETT
                     KQHDDIEKDAKTGAKGPCVMLHSIKTWVSYEHDSLLYIRPMLLRHPGNFVKMCQFSTE
                     NLKINGCCAIDTISSGASLTIGALENFVFRDKWFQTKDKICLPVGAVEEDHEDNEERI
                     WPRLYDGCKIITFDDDRKMNLFIENSYDGNQVRVSLARSQKFFNSQVSNSQFEILENM
                     RAITAAITKFSSNTYYLVVSTTHNQLYTFELIIRRAPKDKSIRDCVGEFHMKLLHKTP
                     TEDKVHAMVGFRDKLLIPVFGSLILYGLGKKQLLKRSISSTTASITKISSLANWKNQR
                     IAVGDNRESATILQFDSTNNIFVPIADDVVKRHVTALTFIDQSTVIGGDKFGNIWTLR
                     LSREQESLIRSNFPHSLDRLQQYADLKNKAPNIMACPLKLSLINHFYVNDIPTGFYLA
                     EAVQVSDRPIILYCGLQGTIGSLVPLLTKSEVNSLRSLENVMSDADDIFYLEQENQNG
                     SSTDQPVDEDGLDKDVARPLGSSSNAVRIPEGAYSIVGRDSFKYRSYYAPVRNVIDGD
                     LCETFLNLSLSEQTKLCKETSGSNPEGVCKQLNDIRTNYI"
     gene            <379677..>380894
                     /locus_tag="ZYRO0G04752g"
                     /db_xref="GeneID:8205999"
     mRNA            <379677..>380894
                     /locus_tag="ZYRO0G04752g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498159.1"
                     /db_xref="GeneID:8205999"
     CDS             379677..380894
                     /locus_tag="ZYRO0G04752g"
                     /note="similar to uniprot|Q04697 Saccharomyces cerevisiae
                     YML048W GSF2 ER localized integral membrane protein that
                     may promote secretion of certain hexose transporters
                     including Gal2p involved in glucose-dependent repression"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498204.1"
                     /db_xref="GeneID:8205999"
                     /db_xref="InterPro:IPR022757"
                     /db_xref="UniProtKB/TrEMBL:C5DZI7"
                     /translation="MEVSVRFNADVEKDFAFQVDREDRLRDKIARIFRKNGTGMGHFM
                     VLRPTIFHKEEPAGYYKSMHPGYMTEGGCILYDYDADSSEYMQLLDEEKPVFEQVWPS
                     QLILPKWDVSKVNVFTYAFIMLAWLYTDLPDCISPTPGICLTNCMSKLLIPVLDYLEL
                     YDLSSHLRLEVTPGYSSLLAQWGFFTFHVFKVLLITLFFAVGLCNPVSFNPFKVMRIT
                     KMDLTQPSIKNLVKSLGWVGIRKGTQEQYQATFYEYIMKQYGNTVKASKAGKLRVAIN
                     PGVPLSDGEGFQTPLSQRFEIDTFEKAEKEGKFYFSEAYFIELENNLKSNVEKCRGDI
                     GLMNAEVKRFRRYGLFEPNAKIERLVEIRKRTFEKLHEEEEAEIERKRLEKVAKRREG
                     ERIKEEKETKKIR"
     gene            complement(381107..381178)
                     /locus_tag="ZYRO0G04774r"
                     /db_xref="GeneID:8206000"
     tRNA            complement(381107..381178)
                     /locus_tag="ZYRO0G04774r"
                     /product="tRNA-Arg"
                     /note="tRNA-Arg (CCT) cove score=74.84"
                     /db_xref="GeneID:8206000"
     gene            complement(<381313..>382842)
                     /locus_tag="ZYRO0G04796g"
                     /db_xref="GeneID:8206001"
     mRNA            complement(<381313..>382842)
                     /locus_tag="ZYRO0G04796g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498160.1"
                     /db_xref="GeneID:8206001"
     CDS             complement(381313..382842)
                     /locus_tag="ZYRO0G04796g"
                     /note="some similarities with uniprot|P47114 Saccharomyces
                     cerevisiae YJR054W Vacuolar protein of unknown function
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498205.1"
                     /db_xref="GeneID:8206001"
                     /db_xref="UniProtKB/TrEMBL:C5DZI8"
                     /translation="MFRNDWKYTANAKTFESIDLSLFRNTKFWTVLNCIIFVWGIIIL
                     KFLLFASDIYTCIKLLAFNSWSNNIIQPYLPFRISKWLFSSCILASVILLIWEFIRGI
                     RIYRTRNISLTYVNNFSRTAYSMFDYSKYCIYFKITPKGKFQKSAFFTFFELKDSLRL
                     LFADTPRQVINGLTLWSVLITVNNENSNIAHGHLESFNGLITKLKTIAKTNHEEAVIL
                     SFMLFSFAIWAIFITKLAIAMIMSVYVYYKLIQGQQYSGLKEFVCVTINHNVDALVEK
                     QKKKKGLMSQPYRLSTLSRSSIFDDDIENKAATFATSSETALSNLHNDSTTALIDSGN
                     FNDHKNPGLAKIPTNGSWDSRYDQEVDLSQEPLKTTSMIYENDRDRDRVVMFDVAKHL
                     KGPRYNIVAMHSSDSLPSSESLVSQQALLRQKSLSSSTSSHRARPPPPPLLGAQNSYM
                     RLAQDENPEYERIYTPLRAYTRDGETRNNRFPDRYNSLLDRRERIANEDYGHYLNRHK
                     Y"
     gene            complement(<383195..>385003)
                     /locus_tag="ZYRO0G04818g"
                     /db_xref="GeneID:8206002"
     mRNA            complement(<383195..>385003)
                     /locus_tag="ZYRO0G04818g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498161.1"
                     /db_xref="GeneID:8206002"
     CDS             complement(383195..385003)
                     /locus_tag="ZYRO0G04818g"
                     /note="similar to uniprot|P47113 Saccharomyces cerevisiae
                     YJR053W BFA1 Component of the GTPase-activating
                     Bfa1p-Bub2p complex involved in multiple cell cycle
                     checkpoint pathways that control exit from mitosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498206.1"
                     /db_xref="GeneID:8206002"
                     /db_xref="UniProtKB/TrEMBL:C5DZI9"
                     /translation="MSIRPVNLDEFPETSFEDMESTFGKINTNQDQEPAPVSPLGRNH
                     GVLPTPSSASSNGTTFSISKGKRLSVGSSSRTDEEGEEDEDDFLNDFQEFQGKKDDID
                     DAFKTYFNLNDNDNNTNNNNNDNNNKDNSGPRKRKSIDFIKDFDEKLNLRSSRGSSRL
                     RQRQSMMELKPHLKPSSSFSRIPNSLSAGDLRIRPNASVRFKKSMPALSNFNGMIREE
                     DELEDDLPTLKRPQRFLDNFEEAREEEEQDDKDFVFDESLIQPQFLNRAPESPLRLSP
                     SQYDIIRDDTLLTPRLHRRHRDWNSKDQLDSFKERRKSEQQQQHQQKQRRKGYHHHNR
                     PQTASRIQIIKQEIDQNTPIKNGSMYYNPKTMKWEGNEHILDKFNKLESQDEKPLLIR
                     ARTSAQEPLNSATDGSHIEKISKRNSNRGKSKQSHQRIVGKMMFDEENLKWVNIDEDE
                     EDADPFANVEDVAPLPTAPGFDGAHDENTLKAPSSGANNNGNKHISPFLRSHSQILPS
                     GANSLDRLNSSATTRYHSVGFTRSDNTNPQFQLNSRQLEKFWHEENKWNRKVGAWFIM
                     GDSSDAQPGDLADFNEVKNPRSFMYEIRNMVLNSTR"
     gene            <385234..>387135
                     /locus_tag="ZYRO0G04840g"
                     /db_xref="GeneID:8206003"
     mRNA            <385234..>387135
                     /locus_tag="ZYRO0G04840g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498162.1"
                     /db_xref="GeneID:8206003"
     CDS             385234..387135
                     /locus_tag="ZYRO0G04840g"
                     /note="similar to uniprot|P39682 Saccharomyces cerevisiae
                     YML046W PRP39 U1 snRNP protein involved in splicing
                     contains multiple tetriatricopeptide repeats"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498207.1"
                     /db_xref="GeneID:8206003"
                     /db_xref="GOA:C5DZJ0"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ0"
                     /translation="METVIGIDDGNQSVSNALAELDPSFLKENPLLVNAYTKIKWDDT
                     NSLNALISAVEQIVVKYKDPNVTIKGTIEKIYDQLLGKYPLFFGYWKRFTAVEYQLFG
                     LQKSIDTLTRAVETFPTSIELWCDYLNVLCANNPNEIDLIRRKFRTAKSLVGYQFLSH
                     TFWDKYIEFETKHEEWGNLGNIYQELVTIALHQYAKYGAAYKAYLRSGNAAFQDPDVD
                     AKLRKTQNLVNAIWPFESKIKQSFFNLTPVAQTELQNWDQYLDFILSNRQKFNFTNPF
                     IISVFERCLIPCFYYEHFWIRYVSWFEDWEELPHVVELYQRGSAVLPLNCKTFRIRFL
                     GFLKKSFRINKDYVYSLFEETAASYMERFPSDAFIMTDYLALLKRHQFLSSIDQNDEE
                     ILQKQVCYAKYLETAITNYLQSKIAKDIPLQEMLNDINIPIVVVELIKITWLVLKNTM
                     QARKYFIFYSKNPLMKSSVTYWLTYYKFEKWCQNYTKLNRFINDLGTKIFLPTAIVND
                     LLEDYRNFYLANSNVMHFQNFVQSTNERKEMDPILLTEFKMNDPNWLPGIHRESNDWH
                     KTREFRENGHPGIIDERPQITNLICQYKSKFFDNQPPSIPAFRNLEKINQPLKYNDYL
                     TKEYLGIGD"
     gene            complement(<387238..>388368)
                     /locus_tag="ZYRO0G04862g"
                     /db_xref="GeneID:8206004"
     mRNA            complement(<387238..>388368)
                     /locus_tag="ZYRO0G04862g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498163.1"
                     /db_xref="GeneID:8206004"
     CDS             complement(387238..388368)
                     /locus_tag="ZYRO0G04862g"
                     /note="highly similar to gnl|GLV|CAGL0J11154g Candida
                     glabrata CAGL0J11154g and similar to YNL175C
                     uniprot|P53883 Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498208.1"
                     /db_xref="GeneID:8206004"
                     /db_xref="GOA:C5DZJ1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ1"
                     /translation="MTEETKPANEEQLQQALQDPTKKRKAEDEIEIDLERSVPLSKKQ
                     KRLLRRGKVTIEELNAKYNLDPASVEQYKKESSEADKESTGPDEEEGKTDPKKKEKGY
                     GVWIGNLSFDTSKEDITRFLVAKTRELEESDQISENAILRIHMPFAQNDGKKIKNKGF
                     CYVDFKTIEQMESAVKLSESQLNGRNLLIKNSKNFEGRPDKDDLVAASKNPPSRILFV
                     GNLSFDTSDDLLRKHFQHCGDIIKVRMATFQDSGKCKGFAFVDFKEEQGATNALKDKS
                     CRKIAGRSIRMEYGEDRSKRQVRRKPESSSSSSTEKPFDLPNQVHSNDASNSEERKPT
                     RKPFTKRPVDSNHRPKSSVALASAQRASSAIVPSEGKKVTFD"
     gene            complement(<389014..>392835)
                     /locus_tag="ZYRO0G04884g"
                     /db_xref="GeneID:8206005"
     mRNA            complement(<389014..>392835)
                     /locus_tag="ZYRO0G04884g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498164.1"
                     /db_xref="GeneID:8206005"
     CDS             complement(389014..392835)
                     /locus_tag="ZYRO0G04884g"
                     /note="some similarities with uniprot|P38845 Saccharomyces
                     cerevisiae YHR146W CRP1 Protein that binds to cruciform
                     DNA structures"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498209.1"
                     /db_xref="GeneID:8206005"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ2"
                     /translation="MSTVNYSFSWPSGPKDVVVTGEFDEWKSIFHLEKSPTTGEFEIT
                     LPIKIPEEKDRVFFKFIVDGQWVTSGFYKIGTDPAGIENNYISKQELHHLVEKKDEKN
                     EKHKSDIAAGIATTASPKPTKTRSAAAPQQGDTPEAVVARSSKNLNVKPSTPQTASPS
                     AHPQKPQSSHSHEHEHAAATTTPTASNDPLAATAAASALRKVKIKRKIKINKKTGERI
                     VVSEERIPLDEDDEAVLGSTTFEEEELSPAGKASTNSSAQGTPGLSNAAAGAAGIPPS
                     VTGTTTPTPTRQRQKQQQQPRTPLGSVNSPSNSPSVRKTRPLSTSGAPKSSSGIRSRS
                     GSTKERPVSTVGRPTSPSRSKSSTPMSSSGSAAASAGATAATAAAARKDRPTSAAIGD
                     STPSSALKTVSRGGSTKKNTNESANAEVTGPLGTRLPDNAGEETFHILPIETPSGGDQ
                     AAFKSLAGEPGPFVPSNQEQLKAFSEVNDNVDPQAFNERLNKQFKAEHNTPEKKASEK
                     LDKKIDSQANTENLDKQKSLDDLDKKANESKLEQISKGDAVGKLKNDDELQKLGKDSL
                     QGKEDKKDAFDTLKNDKGNLTDAGKSLASDAKKSASGPGADTGADSSDAKDTFGKLGE
                     DDTLKQLGKDAAEGKVNKDDALDKLGKDSTLKDTGEGVAAGALGGASSGKNKNKNKKK
                     NKNKKNKNKAEKSSEKESKEKTGTSDASISGDLESGERQIPGDYNTEKVTQENKGVKS
                     DLSETGDLSSTDGIRGANEHGYVPGKAGPELDENDSSAHGGVSAQGSTPGSTGQVVGK
                     DAAPLRSSAQGETAGVTGPSASKGATESLAPGAAAGAAGAAGATGISTTNAGEKELGN
                     EATEYGKKTGLDDKTDLDKEISALGGKTELDQDANLLSKEAVPLSEDKTSATGAAAGT
                     SITKVPADKEKEVTQDYPKKNEPSELQNKGETEEKKSKEVKRTGSQKKEAALPTLDPR
                     ARKSAGDPNSGARPTSSQQYVDTDNDEKNKDYSDPLTKDTSEIAGQHAPKAATTTGGS
                     AAGVAGVAGAAGAAVSSKDTTKTSKSTPPPNKSAETNGTTPTKANRHSVADAEAKPSK
                     SAHSKSTRPKSVAGSVKKESKGSTAKGTPGSAGSAGTTSAKSKKEIATDALKKGKSKA
                     EVSKGKNTKDTAADLVKTGKSGVEDGKSRKEVAKDALKQGKSEAGSAKGKNAKEAVSD
                     AAKSCKKEVGASKGKGVANETANAGKSESGAAAAAEQKPPGQSTLANAANRTDKKKKI
                     GLWARIKRILK"
     gene            394040..394111
                     /locus_tag="ZYRO0G04906r"
                     /db_xref="GeneID:8206006"
     tRNA            394040..394111
                     /locus_tag="ZYRO0G04906r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove score=66.07"
                     /db_xref="GeneID:8206006"
     gene            <394534..>399576
                     /locus_tag="ZYRO0G04928g"
                     /db_xref="GeneID:8206007"
     mRNA            <394534..>399576
                     /locus_tag="ZYRO0G04928g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498165.1"
                     /db_xref="GeneID:8206007"
     CDS             394534..399576
                     /locus_tag="ZYRO0G04928g"
                     /note="similar to uniprot|P53886 Saccharomyces cerevisiae
                     YNL172W APC1 Largest subunit of the Anaphase-Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin-protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498210.1"
                     /db_xref="GeneID:8206007"
                     /db_xref="GOA:C5DZJ3"
                     /db_xref="InterPro:IPR024990"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ3"
                     /translation="MNDILNLDESDDGGIDASSKENFYWDRNNRGDIWISSDRKTVEW
                     QVANQCIRRFYFQQPVIKANFVDFEKAPNCLVIVLKDVAHVYYISQGDSTIVCFPFPI
                     ANVFWYSQGLVLERKVTGTNWGENDNHRFITLSDPMLPFGFLGFSTHQRHGSDLKDIR
                     MVLFPEDDNLKITVLFDNCQKKLHFYYTQVTGRSNDHSSNGSFNRRDQHLLGGGMNNN
                     PLLANNSGSIISSGSSSDAKKNLRKISILNRRATSATLGTGDSSEIPSSSLKSADSLS
                     SSHKTNGGTRRSLSATLDRMSSGLASPVAEFSNSSIPQSHNDALHQRISTRDVTLTKI
                     SSMTLPQHLAHRIKCLKCISLKLQNREAVAIFDPNTRFYKLWMTDLLPEVINSLSFKV
                     YGNSPNDMIRLSNFNVDAPIIDMCIYHSYHFPGTLALVHESNHISLYNPFFELASPKI
                     QLPQQGGPQKLYYISDDRMVLDKTTISSTNIGLSLFPYPKKSSVILCFEAMKWICSPS
                     IFQAVVFLWQFSLQLNDKHICHMEAEFSALEYTLTALMLPPTEEADNFKDIHESSAYI
                     FLAKFGLPYLLPKIIMGLHLIREEMTLNVLQKNDVLRWGKFLQYATTIMDWPILWREY
                     YATSGSQSIATDCDPLPGVFAHPLDEPPSIMKSLYSVTENSYTPITPFITFSRLVEMD
                     SKIDHLITPRSYKVIRFYEMTHASDYSDEFLLQVLTRLEITKQEINTFPLGLLAPLCK
                     MLAKIEEKLCQVDVNLDLSVISRHDLERCVFTIRQLRNDTAMAEDQSKSLNPYRAPLK
                     LSQNNTKVSPKDIYTVLAEVVKSTNRFTLERGSIEENADMDDFDEGYTLKKNAGLIFS
                     DDRRFYHVLSLLVYYKPRKIQFLSSETEYTKLLKQKKSIARVMSLRTCTSGIGFGAVA
                     YATEKPLATQKWIKASLDFTYLFPDNTKVSIDPDELDQETLLWGEFHSGVSSGLRISK
                     KSKDINGSWIAFNKPKELDAQHGGFLLGLGLNGHLKGLEEWHVYNYLSPKKTHISIGL
                     LLGMSASMKGTMDLKLTKVLSVHIVALLPPGSSDLNINLKVQTAGLIGIGLLYQRSQH
                     RRMCDVLFSQLKSLIVVNEEQVSDESYRLAAGISLGLINLGVGDLASGDDLNDIPDDI
                     DVPEPLPIGGMGPDEKITRGLLEIITKNRDVEEDWIPENSFIGAIMALMLTFLKTGNL
                     NVAESIKPDLKYIPTKVDYRPEIFMYREWAYHMILWETIGTDISFIMSDFTNIFDSEI
                     NTDKLPVYYTMAGRVLSIGIRYASSGDIRIRDCLLYLVDKFLPFYQYPGDARLDFKLT
                     ILGINALLNVLLVSTSLVMCGTGDLETFRRTRYLHEIVLGKHSDVFKSQAPTKKTSSD
                     KGAETADAEMSIEEVENSEEASAPEVVINETNDDQEELPDVTAETEEKTDDENQYSKY
                     IATSMSLGFLFLGSGQYALKTSSLECLSYLIISVLPTYKRDAPLQETKHFWSMAVEPR
                     CLVIRDAETEKSISNIPIEITVRMTDSLKEEMRELVAPCLLPDVRKIRCLRVKSPLYY
                     PLEINFDHEIQSTEFFKNGTILYVQRRRPQSDKPPHYRSIDDIQLALRKRMDHSEDET
                     DTATNLSFADKLFKNLECTDSTMMELEKEVETPSNEQNYNLEMLCSDINSGDVTDCQL
                     ELWKRKHRTLIE"
     gene            complement(<399715..>401187)
                     /locus_tag="ZYRO0G04950g"
                     /db_xref="GeneID:8206008"
     mRNA            complement(<399715..>401187)
                     /locus_tag="ZYRO0G04950g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498166.1"
                     /db_xref="GeneID:8206008"
     CDS             complement(399715..401187)
                     /locus_tag="ZYRO0G04950g"
                     /note="highly similar to uniprot|P39006 Saccharomyces
                     cerevisiae YNL169C PSD1 Phosphatidylserine decarboxylase
                     of the mitochondrial inner membrane converts
                     phosphatidylserine to phosphatidylethanolamine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498211.1"
                     /db_xref="GeneID:8206008"
                     /db_xref="GOA:C5DZJ4"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ4"
                     /translation="MLPVKSALSQGRTIITMPMGRIITKIQLRNRTALIWNRGFSSKS
                     LVPQKHRSDEFARPPQNSEVRVRSSMIKWAVLTSVTIVIGTILLRAQNEKQRLEDVEE
                     EKESIKKRQRIRIFDNNWLFFCYSTLPLNAISRLWGQVNSLTLPLWMRPWGYKCYSYM
                     FGVNLDEMVDPELTHYANLSEFFYRNIRPECRPIAPGTSVIACPSDGKVLQLGVIDSE
                     RGEIEQVKGLTYSIKDFLGTHSRQGVSRSSSTIDLSSEEDKHREFAKVNNFQIKGPDD
                     DHPITIRNEGDKAVEQPFLPVTKTLKLLSELSITTTPLKKTFQEPIDTELYYAVIYLA
                     PGDYHHFHSPVDWVCQVRRHFPGDLFSVAPYFQRNFPNLFVLNERVATLGHWTHGFFS
                     MTAVGATNVGSIKLSFDKELVTNMKRNKHAEPYTCYEATYDNSSKVLGGMPLIKGDEM
                     GGFMLGSTVVLCFEAPKDFKFSINVGDQVKMGQKLGAPEK"
     gene            <401728..>402804
                     /locus_tag="ZYRO0G04972g"
                     /db_xref="GeneID:8206009"
     mRNA            <401728..>402804
                     /locus_tag="ZYRO0G04972g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498167.1"
                     /db_xref="GeneID:8206009"
     CDS             401728..402804
                     /locus_tag="ZYRO0G04972g"
                     /note="similar to uniprot|P06773 Saccharomyces cerevisiae
                     YHR144C DCD1 Deaminase required for dCTP and dTTP
                     synthesis expression is cell cycle regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498212.1"
                     /db_xref="GeneID:8206009"
                     /db_xref="GOA:C5DZJ5"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ5"
                     /translation="MIYVYPKLRDSILFLGIARNALKFESRCREKSSKTATCQYNKEI
                     PHDIMFVIISGTKYSGVDIAVTALVNNHGFQRIYEDANEDELISYVTKNYVKDLVMSC
                     TNLSLVEKLDKRPSAVHFSLDAPVAIRMKNFQRLAPGKDVNQFFAELDSYDFNPNSIE
                     LRERSHIKIKCMNKDIANFETRISDAINQQLESLREPNDTLNPPLRPSWDTYFMKLAT
                     LAASRSNCMKRKVGCVIVRERRVIATGYNGTPRHLTNCFNGGCPRCNDGDSQNLHTCL
                     CLHAEENALLEAGRDRIGAHATLYCDTCPCLTCSVKIVQTGITEVVYSQSYRMDEASF
                     KVLISAGIRVRQFSFVKEPKLVMI"
     gene            complement(<402843..>403628)
                     /locus_tag="ZYRO0G04994g"
                     /db_xref="GeneID:8206010"
     mRNA            complement(<402843..>403628)
                     /locus_tag="ZYRO0G04994g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498168.1"
                     /db_xref="GeneID:8206010"
     CDS             complement(402843..403628)
                     /locus_tag="ZYRO0G04994g"
                     /note="highly similar to uniprot|P53889 Saccharomyces
                     cerevisiae YNL168C FMP41 The authentic non-tagged protein
                     was localized to mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498213.1"
                     /db_xref="GeneID:8206010"
                     /db_xref="GOA:C5DZJ6"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ6"
                     /translation="MSFNYLKNAKKIICIGRNYAAHIKELNNPTPKQPFFFLKPLSSV
                     VTPITQSQRRKSLPNGFSYRGLNEDGTNPSPILVPNGVTVHHEIELALIMDKYISNVS
                     PGDFKPQDVYDSISGVSLALDLTARNVQDEAKKKGLPWSIGKGFDTFCPISQFIPKEQ
                     FKSDSQNLQDLFRLTCSVNGVKKQDGTSDLMLNSLHKIIQHISTMISLEPGDIILTGT
                     PAGVGELHPGDNIQGKLYYHDKKLVDMAFDCEARPGPYLYKET"
     gene            complement(<403936..>406116)
                     /locus_tag="ZYRO0G05016g"
                     /db_xref="GeneID:8206011"
     mRNA            complement(<403936..>406116)
                     /locus_tag="ZYRO0G05016g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498169.1"
                     /db_xref="GeneID:8206011"
     CDS             complement(403936..406116)
                     /locus_tag="ZYRO0G05016g"
                     /note="some similarities with uniprot|Q02100 Saccharomyces
                     cerevisiae YNL167C SKO1 Basic leucine zipper (bZIP)
                     transcription factor of the ATF/CREB family that forms a
                     complex with Tup1p and Ssn6p to both activate and repress
                     transcription cytosolic and nuclear protein involved in
                     the osmotic and oxidative stress responses"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498214.1"
                     /db_xref="GeneID:8206011"
                     /db_xref="GOA:C5DZJ7"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR020956"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ7"
                     /translation="MSTTNQKNGVSAFDLEPNPFEQSFASTKEQQSEGSSAPPSQAYL
                     PQDSQHFQQRPESRPPVNVGRGADGKSPFLYGSQKPNILSPPLLTPGGFRRLPPLLLS
                     PSCVPSQNSGANNNNNNNNNNNNHPHNHNHNNNNNNNNNNGVGVGPVSASQTSGIAVN
                     NSNNTSSTSTGGGANNGSVSIKAEPSRTPSFFLNLSKTGLTPNESSLRTGLTPGILAP
                     GQQHHHYPALPALNGANQVHPQAKPGSVVSGGVTPAPFTPCLGSLLGFPGTASPGHVG
                     RPPLNLEGSYAAAAEPTMDQDNSAHLAREPNNGQHLQHHLQQHQHPPPIAQQHHQQQL
                     RNPQQLQQQQQQQHLKRSPPQPDSPQAQQQPLSTGRKRNTSNASKSSKAAKKSQSSTP
                     NLAETRRLSKNEDIRPTMDESGDMNEEDQERKRKEFLERNRVAASKFRKRKKEYIKRV
                     EMDLQFYQNEYEDMGRALDKLCGIIPGSPTPAASSSLISLLENSISHNDVPSSLSLLA
                     HMKQVVYETRYFQRNGRNPRREMESNHMHDTDDEDRHRTDNDSIGNVRSMNGSTTDPT
                     ELNRMKRSSSINYPGSVPANFTNTGLQSQHQSQQQLQQPRQEQPPHTAPITTGSLPNF
                     PPESGSFQGMIKNETTAPSMLPVSLIDARQSRSEQEVANTIGTIGSLPDVISSRPAAH
                     INDVHAQGPSHADNMSDLKHNSLVDLANQSIRAEPMLPKYPNTE"
     gene            complement(<406658..>406870)
                     /locus_tag="ZYRO0G05038g"
                     /db_xref="GeneID:8206012"
     mRNA            complement(<406658..>406870)
                     /locus_tag="ZYRO0G05038g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498170.1"
                     /db_xref="GeneID:8206012"
     CDS             complement(406658..406870)
                     /locus_tag="ZYRO0G05038g"
                     /note="highly similar to uniprot|P40422 Saccharomyces
                     cerevisiae YHR143W-A RPC10 RNA polymerase subunit
                     ABC10-alpha common to RNA polymerases I II and III"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498215.1"
                     /db_xref="GeneID:8206012"
                     /db_xref="GOA:C5DZJ8"
                     /db_xref="InterPro:IPR006591"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ8"
                     /translation="MSREGFQIPSNLDVAAAGTSQARSATLKYICAECSSKLSLSRTD
                     PVRCKDCGHRILLKARTKRMVQFEAR"
     gene            complement(<407068..>409065)
                     /locus_tag="ZYRO0G05060g"
                     /db_xref="GeneID:8206013"
     mRNA            complement(<407068..>409065)
                     /locus_tag="ZYRO0G05060g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498171.1"
                     /db_xref="GeneID:8206013"
     CDS             complement(407068..409065)
                     /locus_tag="ZYRO0G05060g"
                     /note="similar to uniprot|P53890 Saccharomyces cerevisiae
                     YNL166C BNI5 Protein involved in organization of septins
                     at the mother-bud neck may interact directly with the
                     Cdc11p septin localizes to bud neck in a septin-dependent
                     manner"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498216.1"
                     /db_xref="GeneID:8206013"
                     /db_xref="UniProtKB/TrEMBL:C5DZJ9"
                     /translation="MGLDKASIEKRVSRIELDIDHMNQMIDENLKLNEAGDRLEQDSR
                     GQHAEDNQHLGSAATHQGELSREDSVQNSATSVYSEADGHGSITREDSLHKPSGASEA
                     VYDSQEAPVARSEASNDEYYGWSEDQQEQDEQAYTTGQSEADTEYDNEEEDPEETFQA
                     PEERESQEHVNGGMQLHKRQFSEQYPESNDEWEDEVEEPKPEYENENENENESEKENK
                     VQPEATPKATPRIPQAAALPEQETPRTINYETQTDIKPDIPPESQSETHSETQSDIKQ
                     NEQELPTTHPYPQEIHNHQHTHETDAQELDHKEYSHETETQEPEHRDHSYATETQEPE
                     HKDYSYATEQYKEVPNPPRGMEFVETREDESLDYSYEPAHQDSPETHKRTIGATQNHN
                     SNGNSLPDTTQSVMGQGTSGEKFSDSLYDKYDDQPGLQYHQELGQEASDLPQARSSVG
                     PYHINEPQNDPYDYSYETFETAEPAEPAPPHTANTSQDSNGSTDNPFTSDKVYERSTS
                     GSTDTDDFIHIPKNSAQRPATTSNTPVTSRRPTNPFRVVSVGVVGPDGRTSRKTSAGT
                     FSSYKDSNVDGPAILQKKLDHLVKKCTKLQREIDYLTKMNTASSLPIEDSRKLSRAVD
                     KLQEYLDKKNKEKYDVGVLLSRQLRREIDRGENGQFWVGTK"
     gene            <409501..>410625
                     /locus_tag="ZYRO0G05082g"
                     /db_xref="GeneID:8206014"
     mRNA            <409501..>410625
                     /locus_tag="ZYRO0G05082g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498172.1"
                     /db_xref="GeneID:8206014"
     CDS             409501..410625
                     /locus_tag="ZYRO0G05082g"
                     /note="similar to uniprot|P53891 Saccharomyces cerevisiae
                     YNL165W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498217.1"
                     /db_xref="GeneID:8206014"
                     /db_xref="UniProtKB/TrEMBL:C5DZK0"
                     /translation="MNRVRELIGGQHSSRNERTRSQRQDVPQPGMSTREGEDQETLFE
                     NDTDDGDGLDDTETLNTVASGGDTIGDFQRQGFVNRCPRFTHHRMIPFILVLLTKGFF
                     CFPSEKSFKKYIENKRKFDKLDGIEGLGIPLFHAVPLGVVKTIFSPKSPIMKIYKYVI
                     IDSERDKPPPDAEQISVDGSLTLYKYLFCSILEEINNDAGRVEHKFNFTRLDNDGPLP
                     QVLTMANMIHLRNTDTTLNGLNLRWYGTSGFASPFGTGNIKLLVLDDNMASFMDQKTV
                     EEYEHHYRNNRTRPLGRLPIWAKYSNEGSTVIPKKRTLRMAKLQMGEYQSIAHSDGIF
                     NVPWETQALTCMCMVLHEYESRKDRRRTGGLTLGPDMIFM"
     gene            complement(<410797..>412200)
                     /locus_tag="ZYRO0G05104g"
                     /db_xref="GeneID:8206015"
     mRNA            complement(<410797..>412200)
                     /locus_tag="ZYRO0G05104g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498173.1"
                     /db_xref="GeneID:8206015"
     CDS             complement(410797..412200)
                     /locus_tag="ZYRO0G05104g"
                     /note="some similarities with uniprot|P38844 Saccharomyces
                     cerevisiae YHR143W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498218.1"
                     /db_xref="GeneID:8206015"
                     /db_xref="InterPro:IPR026225"
                     /db_xref="UniProtKB/TrEMBL:C5DZK1"
                     /translation="MFIQLSTILSIFYISSLPFVGADQEYITSDGVVYGDALVTSTIK
                     PPKVYVTTSYFTATQVRPVTLDNLSVTATTEAVVEGTTMSKSDPGSLSTAGSDSSGSQ
                     SFGGNPSTSSPSVTTPSVSSSCSSTTPSTTPSSSTPSSSTPSSSTPSSSTPSSSTPSS
                     STPSSSTPSSSTPSSSTPSSSTPSSNSPSSSSPSTSAPSSSSPSSSSQVYSTSSSDSQ
                     SSNSRFTLQPSSTYSITSNTAVSASNSDSTSGSTNSGSSLSSSSSVPSGSANSDNSLS
                     SSPSVPSGSANSGSSLSSSSSAPSGSANSDNSLSSSSSVSSSGSASPISVSSSGSSSV
                     TAISSTSPSSLASGSGSSVYSSPSASASSIPSTSFSSSSITASPSSSGSFSTSSSSST
                     ISGSSSSSSLPSSSFSLASGMTPYSTVKGSDSTCTVYYDDADYYSTVYLTSPGQSVDA
                     ATTLTSTKTVYKTVTRV"
     gene            complement(<412920..>413660)
                     /locus_tag="ZYRO0G05126g"
                     /db_xref="GeneID:8206016"
     mRNA            complement(<412920..>413660)
                     /locus_tag="ZYRO0G05126g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498174.1"
                     /db_xref="GeneID:8206016"
     CDS             complement(412920..413660)
                     /locus_tag="ZYRO0G05126g"
                     /note="some similarities with uniprot|P53892 Saccharomyces
                     cerevisiae YNL164C IBD2 Component of the BUB2-dependent
                     spindle checkpoint pathway interacts with Bfa1p and
                     functions upstream of Bub2p and Bfa1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498219.1"
                     /db_xref="GeneID:8206016"
                     /db_xref="UniProtKB/TrEMBL:C5DZK2"
                     /translation="MTSSTNVSIELTNEEALMMQPDVSKFLQNLDFSSNGAISQNDGH
                     GHGEDQLVIGQTATPVDDSELHFDVDKGDVIFDYGTQEITGTPDKIGEHISQILESVL
                     PNGLQKEAQGRLQAVVNQNHTNNDQSAQPTKSESLLELQDAMGNLQRIQKVKQLRQQI
                     PESKTNEREICETAGTFKDYGDPPSRPPNFSVLISEKRPVCLFCEYCMVFGEPPRNMI
                     KWYNRVNRYDNLPREGERKNKHSRKRNR"
     gene            complement(<413934..>417206)
                     /locus_tag="ZYRO0G05148g"
                     /db_xref="GeneID:8206017"
     mRNA            complement(<413934..>417206)
                     /locus_tag="ZYRO0G05148g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498175.1"
                     /db_xref="GeneID:8206017"
     CDS             complement(413934..417206)
                     /locus_tag="ZYRO0G05148g"
                     /note="similar to uniprot|P53893 Saccharomyces cerevisiae
                     YNL163C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498220.1"
                     /db_xref="GeneID:8206017"
                     /db_xref="GOA:C5DZK3"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR005517"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZK3"
                     /translation="MPRVDSNTFVRLQNDPSSVRNICIMAHVDHGKTSLSDSLLASNG
                     IISQRMAGKIRYLDARQDEQIRGITMESSAVSLYFRVLRKQEGSSDPLVNEHLINLID
                     SPGHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTVTVLRQCWTEKLKPILVLNKIDR
                     LIVELQFTPQEAYVHLSKLIEQVNSVIGSFFAGERQLDDYSYREQLEQNSDAQYVEKD
                     DSDIYFDPANNNIIFASATDGWGFSISQMAKFYEQKLGAKRDNLQKVLWGDFYMDPKT
                     KKITNNKGLKGRSLKPLFVSLILDNIWKIYENVTVSKNLEVIEKITKTLGINVLPRDL
                     SSKDDKQLLRKIMSQWLPVSTAILLTVIEKLPSPLQSQADRLDTILPNTQDTKKVDPR
                     LLSAMEQCDRNGPASAYVSKILSIPRDELPIQSAGDPVQDEIARRTKEAREAAMKVAR
                     QAELEAKLSKVNVNGDDGKKEEEELYQRAKDTVITPEINFSGEKKSEVKAPLEAEFEY
                     EEDDADFQNDHSLAAEFTPSVDPNDPLASMFEYEEEDPFATNEPNAANGQEVTEDPIE
                     DIFDERDEVLIAFARIYSGTLRVGQEIAILGPKYDPSNPDEHIQTVTITSLYLFMGKE
                     LIPLESCPSGNIVGIGGLAGKILKNGTLIEKGVRGINLAGVNFQTFPIVRVAVEPQNP
                     MEMNKLVRGLKLLEQADPCVQTYVEDNGEQILCTAGELHLERCLKDLRERFSGIELTS
                     SEPVIPYRETFLNTSEMNPPKDAQLGRGVEQLLQGPYKLKLKTLPLLESTTKFLADHQ
                     SIIQNFHNIQLSDQESFFNKLKDVTKEDKSLAEVLGDNVTKIASFGPKRVGPNIIISE
                     KELLGNFANSSSPKFEFADSVINGFQLAVNEGPLAREPVQGMCVVVEDIVEMSPEEIN
                     SIEDPQYQKDKVNISGRLITSVRDVIHAGFLDWSPRMMWAVYTCDVQTSVEVLGKVYS
                     VVQQRRGRIESEEMKEGTPFFQIQAILPVVEAFGFSEDIRKKTSGAAQPQLAFAGFEC
                     IDLDPFWVPTTEEELEELGDTADKENIARRHMNNVRRRKGLFVDEKVIQNAEKQRTLK
                     KN"
     gene            complement(<417702..>418646)
                     /locus_tag="ZYRO0G05170g"
                     /db_xref="GeneID:8206018"
     mRNA            complement(<417702..>418646)
                     /locus_tag="ZYRO0G05170g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498176.1"
                     /db_xref="GeneID:8206018"
     CDS             complement(417702..418646)
                     /locus_tag="ZYRO0G05170g"
                     /note="highly similar to uniprot|P38843 Saccharomyces
                     cerevisiae YHR142W CHS7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498221.1"
                     /db_xref="GeneID:8206018"
                     /db_xref="InterPro:IPR022057"
                     /db_xref="UniProtKB/TrEMBL:C5DZK4"
                     /translation="MFDFETICSKTPLPLCSVIKSGSHLILSNSTTIHDFNPQNLHTG
                     ILPRCYARSIDVANTMIFNVGNAFVNIGALGVLLVILYNIRQKFTAIGRAEYLHFFQL
                     ALLMIIFTLIVNTGASPPGSGSYPYFVAIQIGLAGACCWNLLVNAFLGFNLWEDGTKK
                     SMLLTRGAAFLGFVANFLVAILTFKTATTTGKIDKTHTLALFIITYVVSGTMLVVYTI
                     CQLLVSVFVVQNLWVAGAVMLGVFFFVAGQVLVYGVSDKVCMGANHYIDGLFCGSLCN
                     LFTLMMVYKIWDMTTDDDLEFSVTIHNEDGVVYNNALK"
     gene            <419543..>419932
                     /locus_tag="ZYRO0G05192g"
                     /db_xref="GeneID:8206019"
     mRNA            join(<419543..419546,419616..>419932)
                     /locus_tag="ZYRO0G05192g"
                     /product="60S ribosomal protein L42"
                     /transcript_id="XM_002498177.1"
                     /db_xref="GeneID:8206019"
     CDS             join(419543..419546,419616..419932)
                     /locus_tag="ZYRO0G05192g"
                     /note="highly similar to uniprot|P02405 Saccharomyces
                     cerevisiae YHR141C RPL42B Proteins component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="XP_002498222.1"
                     /db_xref="GeneID:8206019"
                     /db_xref="GOA:C5DZK5"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:C5DZK5"
                     /translation="MVNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYD
                     RKQRGFGGQTKPIFRRKAKTTKKVVLRLECVQCKTRAQLSLKRCKHFELGGEKKQKGQ
                     ALQF"
     gene            <420482..>422980
                     /locus_tag="ZYRO0G05214g"
                     /db_xref="GeneID:8206020"
     mRNA            <420482..>422980
                     /locus_tag="ZYRO0G05214g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498178.1"
                     /db_xref="GeneID:8206020"
     CDS             420482..422980
                     /locus_tag="ZYRO0G05214g"
                     /note="some similarities with uniprot|P53894 Saccharomyces
                     cerevisiae YNL161W CBK1 Protein kinase involved in cell
                     wall biosynthesis required for efficient apical growth
                     proper mating projection morphology bipolar bud site
                     selection in diploid cells and cell separation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498223.1"
                     /db_xref="GeneID:8206020"
                     /db_xref="GOA:C5DZK6"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DZK6"
                     /translation="MFGENPYAQAYQKQSQQQHQMPHQFSPQQHQQQQQHQQRYPDDM
                     ASISRPPAATFSSNYMRLQGSHPSLQEQLQRDQQQQQQQQQGMMPNGFTDVPSLGYPA
                     TPPTQHSYMQNSPLIHSPPPTASGLYMHKNNSRNQVANSGNITPQHSIHGGPQYSPSQ
                     FSQDSEHFINSRSSSPLRYHSQQPQQHAFGSYGSQVPPPMGYNSGQASPVKSIRSLHR
                     VQAQAQAQQQAQAQQQAQAQAIAQAQAAQAQAQAQAQAQAQAQAQAAQAQAAQAQAIA
                     QAQAAQAQAQAQAQAQAQAQAQAYRQGIPQQQPHAFQEATQGSSTSSSAGSPVPNYMY
                     FERRPDLLSKTTQDKAAAAKLKIENFYQSSVKYAIERNQRRVELESQLSMQDWSDERR
                     NRELSSLGRKESQFLRLRRTRLSLDDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKTL
                     LKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTML
                     IRWQLFTEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTG
                     FHKTHDSNYYKKLLQQDEQQSQNGGLPKPGQLGGSGDNTGNQNNRQTMLVDAIHLTMS
                     NRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPP
                     FCSETPQETYRKIMNFEHTLQFPDDIHISYEAEDLIRTLLSHADQRLGRHGGADEIKR
                     HAFFRGVDWDTIRHVEAPYIPKLNSITDTRFFPTDELENVPDSPAMAQANRQREQMMK
                     QGNGNGNKPPVKEDLPFIGYTYSRFDYLTRKNAL"
     gene            complement(<423639..>424457)
                     /locus_tag="ZYRO0G05236g"
                     /db_xref="GeneID:8206021"
     mRNA            complement(<423639..>424457)
                     /locus_tag="ZYRO0G05236g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498179.1"
                     /db_xref="GeneID:8206021"
     CDS             complement(423639..424457)
                     /locus_tag="ZYRO0G05236g"
                     /note="similar to uniprot|P38842 Saccharomyces cerevisiae
                     YHR140W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498224.1"
                     /db_xref="GeneID:8206021"
                     /db_xref="GOA:C5DZK7"
                     /db_xref="InterPro:IPR006838"
                     /db_xref="UniProtKB/TrEMBL:C5DZK7"
                     /translation="MDRSLLINVASLITSSYGLIRCTHIKLPPSLAQAGQKQFLTNIS
                     LAATISHNVVTIVSHVAKRIKKHRSQKKRQEKAYARAIASAEELRDLKLEPNEKRLQQ
                     QDDSPDSDGCALSLLTLINRHVTLPLALVLESVVATVYWPLRLFAIGLILQGAKRKSP
                     VPLHIDVSIHLLPILYMLSDYYFTDASERFKIGLAQSWGIISAVGLAYKSYLSALIDT
                     STGQKYPYPFLDVPEPYKSVIFVVVTSFGWLFYVAYRALPPRDKVSKKERSKMD"
     gene            <425580..>426989
                     /locus_tag="ZYRO0G05258g"
                     /db_xref="GeneID:8206022"
     mRNA            <425580..>426989
                     /locus_tag="ZYRO0G05258g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498180.1"
                     /db_xref="GeneID:8206022"
     CDS             425580..426989
                     /locus_tag="ZYRO0G05258g"
                     /note="weakly similar to uniprot|P38616 Saccharomyces
                     cerevisiae YNL160W YGP1 may be involved in cellular
                     adaptations prior to stationary phase YGP1 encodes gp37 a
                     glycoprotein synthesized in response to nutrient
                     limitation which is homologous to the sporulation-specific
                     SPS100 gene"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498225.1"
                     /db_xref="GeneID:8206022"
                     /db_xref="GOA:C5DZK8"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="UniProtKB/TrEMBL:C5DZK8"
                     /translation="MKLSVLATALAVCSAVLANPVNPAQDLLHKRVDSASAVGGSAAT
                     TADAAAGSASPVSGSMPATATTPAVVSGSGIASSISPSSTGGVGSNTTAPAAAAGSSN
                     TTAPAAAAGSSNTTAPAAAAGSSNTTAPAAAAGSSNTTAPAAGGYSNTTAAAGSSNTT
                     APAAAAGSSNTTVPAAGYSNTTAAAGSSNTSSVPGKVVVFVTGGTVGLKNSSDVSIIT
                     LFNSSQALNITQLYSLAARVNATLGLATTQSVVIVSNEESLEPLGIFTSLLFNTDKPL
                     VIAQNGAVGVPIAKQSSSSARGPLVIGDNKLIYPGVFAPSGDDSSSCAAVGIASDFTN
                     ATWFFEYSVPALVSPSSVVKQNYSNFTNYNITNTPVVPIIYDGDYSSQLISSLPSASG
                     FVVVSSGSNSTLSTVRNSSSPIVFAEAGSSLRYVGKEDVPSGTIPAGYLSPIKAQILL
                     SVAAANGVRDQQALSSLFP"
     gene            <427759..>429255
                     /locus_tag="ZYRO0G05280g"
                     /db_xref="GeneID:8206023"
     mRNA            <427759..>429255
                     /locus_tag="ZYRO0G05280g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498181.1"
                     /db_xref="GeneID:8206023"
     CDS             427759..429255
                     /locus_tag="ZYRO0G05280g"
                     /note="similar to uniprot|P41948 Saccharomyces cerevisiae
                     YNL142W MEP2 Ammonium permease involved in regulation of
                     pseudohyphal growth belongs to a ubiquitous family of
                     cytoplasmic membrane proteins that transport only ammonium
                     (NH4) expression is under the nitrogen catabolite
                     repression regulation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498226.1"
                     /db_xref="GeneID:8206023"
                     /db_xref="GOA:C5DZK9"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:C5DZK9"
                     /translation="MSMNFTGTPTGTGTGGNSLTTDLNQQFDLANMAWVGVAAAGVWI
                     MVPGVGLLYSGMSRKKHALSLLWASMMTVSLVIFYWFFWGYSLAFSHTTRGNGFLGTL
                     KFFGFKNVLGAPASVDSLPDILFAVYQGMFAAVTGALMLGGACERARLLPMMIFLFLW
                     MTIVYSPLACWTWNAEGWLATLGSLDYAGGGPVHISSGHGALIYALILGKRNDPVAKP
                     GMPKYKPHSVTSIVLGTVFLWFGWQFFNPGSAGNATIRAWYSAMNTNLAAAAGGLTWM
                     FIDFFRFGGKWTTVGLCSGIISGLVGITPAAGFVPIWSSFIIGVVSGAGCNLATDLKN
                     FLHIDDGLDVWALHGVGGSIGCVFTGIFAADYVNSTAGSYTAPIAGGWINHHWKQVGY
                     QLAAMCSVIAWTVTCTAILLFSMNLVPFLRLRLKPEEEELGTDEAQIGEFTYHEDTLY
                     IPEPVRSKNSVAPPMENIDDKIAQTVEEGGNSSTAESGVESGQPQNEK"
     gene            <429444..>429749
                     /locus_tag="ZYRO0G05302g"
                     /db_xref="GeneID:8206024"
     mRNA            <429444..>429749
                     /locus_tag="ZYRO0G05302g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498182.1"
                     /db_xref="GeneID:8206024"
     CDS             429444..429749
                     /locus_tag="ZYRO0G05302g"
                     /note="similar to uniprot|P38841 Saccharomyces cerevisiae
                     YHR138C Homologous to PBI2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498227.1"
                     /db_xref="GeneID:8206024"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:C5DZL0"
                     /translation="MKLSAIIGFISAVHAATTSYIITIEQTDVPSSFLDSLKEKVHDV
                     GGYVTHEFSLIKGFTAELDDTEVSKLQGQIKQAELKSGYSVHIEKDSEVHTFARHEH"
     gene            complement(<429815..>430204)
                     /locus_tag="ZYRO0G05324g"
                     /db_xref="GeneID:8206025"
     mRNA            complement(<429815..>430204)
                     /locus_tag="ZYRO0G05324g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498183.1"
                     /db_xref="GeneID:8206025"
     CDS             complement(429815..430204)
                     /locus_tag="ZYRO0G05324g"
                     /note="highly similar to uniprot|P53900 Saccharomyces
                     cerevisiae YNL153C GIM3 Subunit of the heterohexameric
                     cochaperone prefoldin complex which binds specifically to
                     cytosolic chaperonin and transfers target proteins to it"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498228.1"
                     /db_xref="GeneID:8206025"
                     /db_xref="GOA:C5DZL1"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="UniProtKB/TrEMBL:C5DZL1"
                     /translation="MELLPEGQKNNTNVTFEDQQKINQFSKLIMRKDAIEQELNIQRQ
                     EKEYSDDVSLELELIDEDEPVQYKVGVIFLHLKQKEAVEQLEKDMESTQGRIDELESE
                     QDGLDAQLKELKSILYAKFGDNINLER"
     gene            complement(<430373..>431887)
                     /locus_tag="ZYRO0G05346g"
                     /db_xref="GeneID:8206026"
     mRNA            complement(<430373..>431887)
                     /locus_tag="ZYRO0G05346g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498184.1"
                     /db_xref="GeneID:8206026"
     CDS             complement(430373..431887)
                     /locus_tag="ZYRO0G05346g"
                     /note="similar to uniprot|P38840 Saccharomyces cerevisiae
                     YHR137W ARO9 Aromatic aminotransferase catalyzes the first
                     step of tryptophan phenylalanine and tyrosine catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498229.1"
                     /db_xref="GeneID:8206026"
                     /db_xref="GOA:C5DZL2"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DZL2"
                     /translation="MTQFDFGTLKSRYTSFLSRRDAAKELVKFWDNPPGPGVIELAGG
                     MPNAGFFPIDSIDLHVVSHPFEKNHGKNGLKVHMDKQEPKDMPLSMSLQYTNTEGMGP
                     LVSFAKKMIERINPPAYGGWNVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPVIS
                     NIKLQGASVVPVKMQLSADPEQQGIDVDRLADLLDNWSVGPYKHLNKPKALYTVATGQ
                     NPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPYGYLFFPPYNPKEPMNNAYWDDKSLTV
                     QKYVDDYLVKSFLTIDTDARVIRLETFSKLYAPGLRLSFVVANEFLIERIFNMSEVTT
                     RAPSGVSQALVYGVVKEMGKKYSSESEPSLDSMVTGWMEWPMKVAGYYTHRRNVAFKA
                     LYETEGYSKGLYQVMEPSAGMFIDLKPCWPQNELSRPDHYDLIIEKMDKLNQTLLKTG
                     VQVVLGYRMAVDVKASKDTCDFVRITIAYANDDQQIVEACHRIGKGFEAYFSHI"
     gene            <432802..>433110
                     /locus_tag="ZYRO0G05368g"
                     /db_xref="GeneID:8206027"
     mRNA            <432802..>433110
                     /locus_tag="ZYRO0G05368g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498185.1"
                     /db_xref="GeneID:8206027"
     CDS             432802..433110
                     /locus_tag="ZYRO0G05368g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498230.1"
                     /db_xref="GeneID:8206027"
                     /db_xref="UniProtKB/TrEMBL:C5DZL3"
                     /translation="MSALEDDLLFQFSPQVPGISYREASSGSQCMPYTVPTMTADALK
                     VPPPRIPQPSEVRDQRQFKLHELIEQRKKLEEMTNKYWLRDGEISESMFESSSDEEDA
                     "
     gene            complement(<433107..>434156)
                     /locus_tag="ZYRO0G05390g"
                     /db_xref="GeneID:8206028"
     mRNA            complement(<433107..>434156)
                     /locus_tag="ZYRO0G05390g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498186.1"
                     /db_xref="GeneID:8206028"
     CDS             complement(433107..434156)
                     /locus_tag="ZYRO0G05390g"
                     /note="highly similar to uniprot|P53909 Saccharomyces
                     cerevisiae YNL141W AAH1 Adenine deaminase (adenine
                     aminohydrolase) involved in purine salvage and nitrogen
                     catabolism"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498231.1"
                     /db_xref="GeneID:8206028"
                     /db_xref="GOA:C5DZL4"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="InterPro:IPR028892"
                     /db_xref="UniProtKB/TrEMBL:C5DZL4"
                     /translation="MVSQDFLKELPKCEHHLHLEGTLEPDLLFPLAKRNGITLPQEFP
                     QTVAELETRYGQFKDLQDFLDYYYIGTSVLIDEQDFHDLAWAYFQKVHSQGLVHAEVF
                     YDPQSHTTRGIPIEVVTRGFETACQRAERELGITSKLIMCLLRHMDPQECLQTIEDAN
                     KLISNGTIHGIGLDSAERPFPPELFVECYEKARSINPEIQLTAHAGEEGPAKYVSNSL
                     DLLQVSRIDHGVNSVHDEELMQRLAQEKIMLTVCPLSNVKLQVVSRVSQIPLQKLLDA
                     NVPFSLNSDDPAYFGGYILDNYYKVAEEFPHWDHKVWSTICRNSIEGSWCDAKRKNEL
                     LSRLDQVVAKYYPLN"
     gene            <435657..>437408
                     /locus_tag="ZYRO0G05412g"
                     /db_xref="GeneID:8206029"
     mRNA            <435657..>437408
                     /locus_tag="ZYRO0G05412g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498187.1"
                     /db_xref="GeneID:8206029"
     CDS             435657..437408
                     /locus_tag="ZYRO0G05412g"
                     /note="similar to uniprot|P23292 Saccharomyces cerevisiae
                     YNL154C YCK2 membrane-bound casein kinase I homolog"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498232.1"
                     /db_xref="GeneID:8206029"
                     /db_xref="GOA:C5DZL5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DZL5"
                     /translation="MTTAANTAMAVNHLTNTGNLNRMSNVNSAANINMVNGIGGSNSN
                     HAAGLNATGAAGGGTGGLATNGTTAVAGGGTNSSARDDSTIVGLHYKIGKKIGEGSFG
                     VLFEGTNMINGVPVAIKFEPRKTEAPQLKDEYRTYKILAGTLGIPQAYYFGQEGLHNI
                     LVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMVTLIEDLHARDLIYRDIKPDNFLVG
                     RPQQPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRR
                     DDMEAMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRTTNVYDLSQGLPIQFGRY
                     LELVRNLSFEETPDYEGYRRLLLSVLDDLGQTADGEYDWMRLNGGRGWDLAINKKPNL
                     HGYGHPNPPNEKARRHRSKMAGAGVHHQMMQSPHNQQQVLQQAPIPTAQAAPLPQVNM
                     ANLNANDDPLARNSAAMNNQFAQAKLDPTSYEAYQQQTQKKYAQQLQYQQQQQQTAAV
                     PAQSNNQARFQPSKGANGFGSSGGVPPQATNKYNYQKQPKAIPQQHSGASGRQQKNLD
                     NASFDTGKGFFSKFGCC"
     gene            complement(<437660..>438445)
                     /locus_tag="ZYRO0G05434g"
                     /db_xref="GeneID:8206030"
     mRNA            complement(<437660..>438445)
                     /locus_tag="ZYRO0G05434g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498188.1"
                     /db_xref="GeneID:8206030"
     CDS             complement(437660..438445)
                     /locus_tag="ZYRO0G05434g"
                     /note="similar to uniprot|P53899 Saccharomyces cerevisiae
                     YNL155W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498233.1"
                     /db_xref="GeneID:8206030"
                     /db_xref="GOA:C5DZL6"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:C5DZL6"
                     /translation="MQVEMTRETGMLDVGTHCSFCRQLDFLPFHCKLCNLDFCENHRT
                     KESHHCQWLLDQEKNNHKVPSPPSRNNDEKFFKSLLPEKGYIRVQQQQQRSPHNPQSE
                     PIKSRISQGTLDKLARFFKRSTVHKSTAKKSSSNKLVLLTQLKKTAVGDQRIPVSNRI
                     YIWCYVVHDEERDKDAKRESFYVNKIWPIGRVLDAIAQQFGVPNRNDNFKTKQEDKLS
                     LYKIDQGTGEMIQLDTSGRVANQISDLDTLYLIRGTEAPALRV"
     gene            complement(<438570..>439280)
                     /locus_tag="ZYRO0G05456g"
                     /db_xref="GeneID:8206031"
     mRNA            complement(<438570..>439280)
                     /locus_tag="ZYRO0G05456g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498189.1"
                     /db_xref="GeneID:8206031"
     CDS             complement(438570..439280)
                     /locus_tag="ZYRO0G05456g"
                     /note="similar to uniprot|P38838 Saccharomyces cerevisiae
                     YHR134W WSS1 weak suppressor of smt3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498234.1"
                     /db_xref="GeneID:8206031"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="UniProtKB/TrEMBL:C5DZL7"
                     /translation="MTGDLENHANPHIQRVAVLQRKPSRDDALSLLKEIAKRVSYLMK
                     ENKFRVGMLVEFCPRDKRLLGMNVNRGTKILLRLRNPNDEFRFLPMESIMGTMLHELT
                     HNLHGPHDNRFYAKLDDLLARQWVIEQQGLFDTFLGQGSRLGGSTRLPPLQQQLQKRP
                     TRSRGRKLGGSRAPRGTPREMAALAAQRRAQDSRSCGDASSYQHEQEDVIIIDEGRNG
                     ENKLELEPKPKLEVIDLT"
     gene            <439541..>440347
                     /locus_tag="ZYRO0G05478g"
                     /db_xref="GeneID:8206032"
     mRNA            <439541..>440347
                     /locus_tag="ZYRO0G05478g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498190.1"
                     /db_xref="GeneID:8206032"
     CDS             439541..440347
                     /locus_tag="ZYRO0G05478g"
                     /note="similar to uniprot|P53898 Saccharomyces cerevisiae
                     YNL156C NSG2 Protein of unknown function potential homolog
                     of mammalian Insig 1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498235.1"
                     /db_xref="GeneID:8206032"
                     /db_xref="InterPro:IPR025929"
                     /db_xref="UniProtKB/TrEMBL:C5DZL8"
                     /translation="MASEKSNNPLTGKEKSTESISNLTRPQLFSLYDEDITKSADSED
                     YERIRSRGSAGSFSRPASSNSQMEPGPTPAKKRWAPFFRFVFAMVVLSLAGIAYHELS
                     RHLHDNHKLHPELASRPLLVGVQLSQFFTGNMAPDWAVYAFEGIFFGSCIPLIDYIFS
                     IKTRHASWLSILKTVNAMLGVTFGIRKVQWSSSLQAAIAWGLLNIILWLFFDGTISMF
                     ITCSTLGLLSCATCYSDITDKSQLLYFVDFYFLGLLLFGELGRYLFSTSF"
     gene            complement(<440471..>440842)
                     /locus_tag="ZYRO0G05500g"
                     /db_xref="GeneID:8206033"
     mRNA            complement(<440471..>440842)
                     /locus_tag="ZYRO0G05500g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498191.1"
                     /db_xref="GeneID:8206033"
     CDS             complement(440471..440842)
                     /locus_tag="ZYRO0G05500g"
                     /note="highly similar to uniprot|Q9P305 Saccharomyces
                     cerevisiae YHR132W-A Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498236.1"
                     /db_xref="GeneID:8206033"
                     /db_xref="InterPro:IPR006760"
                     /db_xref="UniProtKB/TrEMBL:C5DZL9"
                     /translation="MSDISPTSSNVDLTSLDSKGVDISQLTPQELKLYKMYGRLPSKK
                     DLFKHKMQERKYFDSGDYALNKAGKGETDAVTSNNNLPVTNPSGLRESIIRRRMSNSA
                     GDSISRQGSISSGPPSKSPTK"
     gene            <441250..>442554
                     /locus_tag="ZYRO0G05522g"
                     /db_xref="GeneID:8206034"
     mRNA            <441250..>442554
                     /locus_tag="ZYRO0G05522g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498192.1"
                     /db_xref="GeneID:8206034"
     CDS             441250..442554
                     /locus_tag="ZYRO0G05522g"
                     /note="similar to uniprot|P38836 Saccharomyces cerevisiae
                     YHR132C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498237.1"
                     /db_xref="GeneID:8206034"
                     /db_xref="GOA:C5DZM0"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="UniProtKB/TrEMBL:C5DZM0"
                     /translation="MVAKFNWGRMVLTVATILIPLAAGWQRGYQDYRVCRFHEQDYET
                     VMSRIKSGTPMDYDVWARNSEFVDVRLPKWLGQVEGCEVIIEDLDDAIEATMSQEVEG
                     NGDSLSDQTAFKFDNGDFFFQGFRDLETIYTWYDLLERAFPNLVKVEVVGETWEGRAL
                     KALHISTNNPETNPEKKTIVITGGVHAREWISVSSACWTVHQLLTRYGQSKRETKYLD
                     YLDFLIIPVFNPDGYAYTWQHDRLWRKNRQETYWPNCPGIDIDHSFDFQWNSTEEFPC
                     SEDYSGERAFEAIEADSWNNFLNGTKGQYKIHGYLDFHSYSQEVLYPYAYSCDALPRD
                     YENLLELSFGLAKAIRNKSGKHYKVISACEDRGSDLSPGLGSGSALDFMYHHRAHWAF
                     QLKLRDTGNLGFLLPSKYIEPVGKEIYAAVSYFCSFILNPEL"
     gene            complement(<442549..>443103)
                     /locus_tag="ZYRO0G05544g"
                     /db_xref="GeneID:8206035"
     mRNA            complement(<442549..>443103)
                     /locus_tag="ZYRO0G05544g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498193.1"
                     /db_xref="GeneID:8206035"
     CDS             complement(442549..443103)
                     /locus_tag="ZYRO0G05544g"
                     /note="similar to uniprot|P53896 Saccharomyces cerevisiae
                     YNL158W Essential protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     nuclear periphery"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498238.1"
                     /db_xref="GeneID:8206035"
                     /db_xref="InterPro:IPR019433"
                     /db_xref="UniProtKB/TrEMBL:C5DZM1"
                     /translation="MNLILWLQILFVATVSANTESFLLHVPSDFPLRKNSDEPSSYPR
                     YISLHNSNLAKTTFFSGIEGPTYIELKSLQVDETYQIKICWTALDPVSITDIDWIVIP
                     HSTEFQNTKSDEARIFIKFNVVADSWPPLNQLTKIPINVSVINTKLGIPVDLYKIIIY
                     IGLVMTITFWINGRTNLYELLKNL"
     gene            <443318..>444118
                     /locus_tag="ZYRO0G05566g"
                     /db_xref="GeneID:8206036"
     mRNA            <443318..>444118
                     /locus_tag="ZYRO0G05566g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498194.1"
                     /db_xref="GeneID:8206036"
     CDS             443318..444118
                     /locus_tag="ZYRO0G05566g"
                     /note="similar to uniprot|P53895 Saccharomyces cerevisiae
                     YNL159C ASI2 Predicted membrane protein genetic
                     interactions suggest a role in negative regulation of
                     amino acid uptake"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498239.1"
                     /db_xref="GeneID:8206036"
                     /db_xref="UniProtKB/TrEMBL:C5DZM2"
                     /translation="MSEELGDDDDYLFEKFVAETNARSAREQAHETQQSDEELQQELR
                     VAIDNIIHTLEREMQREPHPMRDVQPRTRDENGNNNQESLFVQRRPYLRLLITNLLLF
                     DYFVVVLLFPFSLYNILRCGFSIMTLSENDFFSEVVTYCRHVKIFGDDGKSLLVYGES
                     NLGLLGKFHNIVVFYTSPLARYLAKWVPVASDHLIRQIYVKFYQYLVKSSTVFVYLTY
                     GVGGTVYLAMAGFFFAVCIAITLIRRYKNVHRMVAGSLETATRIPGVW"
     gene            444420..444521
                     /locus_tag="ZYRO0G05588r"
                     /db_xref="GeneID:8206037"
     tRNA            join(444420..444456,444478..444521)
                     /locus_tag="ZYRO0G05588r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (TAG) cove"
                     /db_xref="GeneID:8206037"
     gene            <444743..>445837
                     /locus_tag="ZYRO0G05610g"
                     /db_xref="GeneID:8206038"
     mRNA            <444743..>445837
                     /locus_tag="ZYRO0G05610g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498195.1"
                     /db_xref="GeneID:8206038"
     CDS             444743..445837
                     /locus_tag="ZYRO0G05610g"
                     /note="some similarities with uniprot|P00812 Saccharomyces
                     cerevisiae YPL111W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498240.1"
                     /db_xref="GeneID:8206038"
                     /db_xref="GOA:C5DZM3"
                     /db_xref="InterPro:IPR005925"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:C5DZM3"
                     /translation="MRFSTLASLAALFEFTTAGRWTEDWPFAGFPSFAKLPFHTCLVD
                     NPEFDIALIGVPFDTAVSFRPGARFGPQAIRRASQRQNGLRGFNARAGINPYDNWAHI
                     IDCGDIPVTPMDNQLALEQMNAAYDELVNGTTTSGNTAGALPRLVSLGGDHSVILPAL
                     RALHKHYGPISVIHLDSHLDTWSPDSYPSYWHSNTSEFTHGSMLWLAAQEGLINKGHC
                     VHGGLRTRLSGDDWSDYEEDDRVGFHRIHADEMMEIGPRGIAERIKQIVPKNVPVYLS
                     VDIDVLDPSAAPGTGTVEPGGWLTRELISLIRQLQDLPLVGADVVEVSPPFDHADVTA
                     MAAAQVAYEIITNMVKTPLELETRKFFSNM"
     gene            <446414..>448534
                     /locus_tag="ZYRO0G05632g"
                     /db_xref="GeneID:8206039"
     mRNA            <446414..>448534
                     /locus_tag="ZYRO0G05632g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498196.1"
                     /db_xref="GeneID:8206039"
     CDS             446414..448534
                     /locus_tag="ZYRO0G05632g"
                     /note="similar to uniprot|P38835 Saccharomyces cerevisiae
                     YHR131C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498241.1"
                     /db_xref="GeneID:8206039"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DZM4"
                     /translation="MPSLARSIQSETSRSIKSDEMPHLADEGNEFLQVIDGEPAKPPP
                     YQAVNPNRRVCFPVYEYEETRSLPPSYKPTVEECTVVSVKWEWSTPYELSPVKHWHNY
                     LLEINSTQLNFYDIDPELTQGIKNYSNGSDEAQHSHYRFSLSKGGAYQFNRSDQENIT
                     ARLQRNKPKFLHPSKLCKSFSLQCAKVGVPTDYTKKTFLLRLRCEQEQFMVNFAHVDD
                     MIMWSVYLQTGIHVSLDLDLREYPSYRVVPRRRRTRASNGGRSSSGSGGGSRSSTRFP
                     RPEGPQRSQSMGKLLLSASPSSTRGSGSGSPTPTSGSRIKPQRSTSSGLLPTLHKRHT
                     SSGSFPQVPSNASHSRKVSPGASNITGEESPHSIKSKFKHLFKNEDPPKLVSSRSSGN
                     LSTLHKEPRIKSSPPKRPPLNSNDTKTKFHVGDLNSVQEDVETENQNMSESKTSPMHH
                     SVLQRPTARRMVSSPLLSVPGQSLDMRSPASSARASPTSTPTPPNESISPLPRTPTQR
                     EAEEVQQVRREHNDPVSADFHAGIRASLADDDDEEGELEDTELISSRNSRGSRNSGGS
                     IYLEEGIFPENDDDYVYTRRPQQSPRGKCGSSGKWNPPIKEPSRGRYIRDSLRCIKSL
                     NDDDKWMGKVVFRPYRPPDFPTNNLPLPYGLTPNIPNRHTKINPWETVDYKRTRNHYL
                     RPYIVGPTGLVKASTKPHNMYEEV"
     gene            <450272..>452092
                     /locus_tag="ZYRO0G05654g"
                     /db_xref="GeneID:8206040"
     mRNA            <450272..>452092
                     /locus_tag="ZYRO0G05654g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498197.1"
                     /db_xref="GeneID:8206040"
     CDS             450272..452092
                     /locus_tag="ZYRO0G05654g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498242.1"
                     /db_xref="GeneID:8206040"
                     /db_xref="GOA:C5DZM5"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:C5DZM5"
                     /translation="MSNSKRSLKEILDFEYVEDSEEGEDSNLNDDLSGDDDEESQHDV
                     NMCNECKDMQAEIICNDCEEHFCVVCFEMLHRGGKRRKHEYVKTTEDKGESPQQQHPQ
                     QPQQQPAEENKVESAPSPENDSNQEDSIDVKLLSHLKDSATYIPMRLTFEERHLLRLL
                     EAALQVSEYTDRVDILSYKSKPKRIVEQLKEICSVLSGLVVASNMKIGQKLLEMKNFS
                     DNAKWFQAVFEIGRRYKIMNPERMRDTYGKLCYMVMDSRLPQIEEHMEFHLYKPIKTV
                     KSFLVSKQEDNGRVLQMFDDKLILYATSSVSPVGKSRPQINKLIKQKEYAIETLASKY
                     SSKYYSKEDIRQALYSIGDYNAYINMNRKPIIRMLARLDLFRQPEIAKKYSIGIQFGR
                     QGARLTHDHERQWHYVQQSLMLWSIIQREMMRLWYLADIDQFDGSQYRLASTGHGLNR
                     IKPCPSIYKEMHKIINECRSKTHTWVGSSVVHLGDDAVPNALFFLDKYTQVPTILIPF
                     DQTLLKINDLVGNDEYLLEYVNKEYGSVDGLKLTILQDAFAHMFDGSGADNFFMSGSC
                     IDGRLTSAWNHCNEISKKKYYNIFLLTGFTGFNGSEGFSA"
     gene            <452257..>453402
                     /locus_tag="ZYRO0G05676g"
                     /db_xref="GeneID:8206041"
     mRNA            <452257..>453402
                     /locus_tag="ZYRO0G05676g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498198.1"
                     /db_xref="GeneID:8206041"
     CDS             452257..453402
                     /locus_tag="ZYRO0G05676g"
                     /note="similar to uniprot|P38696 Saccharomyces cerevisiae
                     YHR129C ARP1 Actin-related protein of the dynactin complex
                     required for spindle orientation and nuclear migration
                     putative ortholog of mammalian centractin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498243.1"
                     /db_xref="GeneID:8206041"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:C5DZM6"
                     /translation="MLDPNAVLYSQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSPR
                     HGYVNDSSKDDTFVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKD
                     VDEHPVLITEAPLNPVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDC
                     GDGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMI
                     KEKSCYVAVDLDIEEEKCNYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISS
                     EVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFGNRLVQELDKLNQAQSRV
                     KIWAPPERKYTSWIGGSILAELSTFQKIIVTKSQWQEDPSIIHTKCG"
     gene            complement(<453459..>454109)
                     /locus_tag="ZYRO0G05698g"
                     /db_xref="GeneID:8206042"
     mRNA            complement(<453459..>454109)
                     /locus_tag="ZYRO0G05698g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498199.1"
                     /db_xref="GeneID:8206042"
     CDS             complement(453459..454109)
                     /locus_tag="ZYRO0G05698g"
                     /note="highly similar to uniprot|P18562 Saccharomyces
                     cerevisiae YHR128W FUR1 Uracil phosphoribosyltransferase
                     synthesizes UMP from uracil involved in the pyrimidine
                     salvage pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498244.1"
                     /db_xref="GeneID:8206042"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DZM7"
                     /translation="MSTEPYKNVHLLNQSNQLVGLYTIIRDKNTARPDFIFYSDRIIR
                     LLVEEGLNHLPVEPLTVRTHTDKPFDGVSFIGKICGVSIVRAGESMEEGLRDCCRSVR
                     IGKILIQRDEETAKPKLFFEKLPEDIAQRYVFLLDPMLATGGSAIMATDVLIKRGVKP
                     ERIYFLNLICSKEGIDKYHAAFPDVKIVTGAIDQGLDENRYLIPGLGDFGDRYYCL"
     gene            complement(<454504..>454918)
                     /locus_tag="ZYRO0G05720g"
                     /db_xref="GeneID:8206043"
     mRNA            complement(join(<454504..454842,454907..>454918))
                     /locus_tag="ZYRO0G05720g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498200.1"
                     /db_xref="GeneID:8206043"
     CDS             complement(join(454504..454842,454907..454918))
                     /locus_tag="ZYRO0G05720g"
                     /note="highly similar to uniprot|P53905 Saccharomyces
                     cerevisiae YNL147W LSM7 Component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing
                     splicing and decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498245.1"
                     /db_xref="GeneID:8206043"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR017132"
                     /db_xref="UniProtKB/TrEMBL:C5DZM8"
                     /translation="MSESTEPRQDPPPQQQRKKFEGPKREAILNLAKYKDTKVRVKLM
                     GGRLVVGVLKGYDQLMNLVLDETIEYMRDPEDSSFILKDKTRELGLIVIRGTVLLSLS
                     PQDGSEIVSIQDTD"
     gene            <455073..>455786
                     /locus_tag="ZYRO0G05742g"
                     /db_xref="GeneID:8206044"
     mRNA            <455073..>455786
                     /locus_tag="ZYRO0G05742g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498201.1"
                     /db_xref="GeneID:8206044"
     CDS             455073..455786
                     /locus_tag="ZYRO0G05742g"
                     /note="similar to uniprot|Q754L8 Ashbya gossypii AFR054W
                     AFR054Wp and weakly similar to YNL148C uniprot|P53904
                     Saccharomyces cerevisiae YNL148C ALF1 alpha-tubulin foldin
                     protein implicated in folding of alpha tubulin cofactor B"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498246.1"
                     /db_xref="GeneID:8206044"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:C5DZM9"
                     /translation="MVRTSVVSSLCSVTKEWDENISYLQLCQRIESFTGIEPCYMRLS
                     FEFDDGKKLEILESSNPYPFKTYPHVSMILVEDLNENSVVNQLQNSNGTESNFHLSDE
                     EYAKRTDSVLQWKMKNNYGRFNSDSKRSQESNKQLQQQRIAELQIDQRCSVESEGQLE
                     RRGWLRFIGRIGEINDQDIWCGVEFDDPVGKNDGSFKGHIYFGPVKTNHGGFVKPLAV
                     KTGPEFLPMTKNDQSDDEI"
     gene            <456033..>456449
                     /locus_tag="ZYRO0G05764g"
                     /db_xref="GeneID:8206045"
     mRNA            <456033..>456449
                     /locus_tag="ZYRO0G05764g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498202.1"
                     /db_xref="GeneID:8206045"
     CDS             456033..456449
                     /locus_tag="ZYRO0G05764g"
                     /note="similar to gnl|GLV|KLLA0A11506g Kluyveromyces
                     lactis KLLA0A11506g and weakly similar to YNL149C
                     uniprot|P53903 Saccharomyces cerevisiae YNL149C Protein
                     required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498247.1"
                     /db_xref="GeneID:8206045"
                     /db_xref="InterPro:IPR011431"
                     /db_xref="UniProtKB/TrEMBL:C5DZN0"
                     /translation="MSDAAMNVTSSPSIWNTLYERTKTNLAETIGDLDVKKGLRLVII
                     VGGYILIRGIAQRELAKRKLDNDVRRSEQENAAKMQEKLVDQPGSTAAMPFGWGNKTR
                     RRRKQQEEAFADIVERVNQKKNSGDDVEDIEDLLED"
     gene            <456751..>457497
                     /locus_tag="ZYRO0G05786g"
                     /db_xref="GeneID:8206046"
     mRNA            <456751..>457497
                     /locus_tag="ZYRO0G05786g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498203.1"
                     /db_xref="GeneID:8206046"
     CDS             456751..457497
                     /locus_tag="ZYRO0G05786g"
                     /note="similar to uniprot|P17890 Saccharomyces cerevisiae
                     YNL151C RPC31 RNA polymerase III subunit C31 contains
                     HMG-like C-terminal domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498248.1"
                     /db_xref="GeneID:8206046"
                     /db_xref="InterPro:IPR016264"
                     /db_xref="InterPro:IPR024661"
                     /db_xref="UniProtKB/TrEMBL:C5DZN1"
                     /translation="MSFGRGRGGGGNNPTRNLPFGLGFNDVGVNETTEFPSIPLPVNN
                     PVNSRERSLAITYIKFGQTVKDGPFYTGSLSLAVDDSAEGNNKNSNGKKKKQSLIEEE
                     GHMDGIERYSDRYLKKRKIGTSIDEHPYHLEVFPRELYNVMGIDKKKLLVISEFNNKD
                     DIFTGGKQDENAGLSMIEKWKQLAEDEDDDNDEENEKNKENAGGDEDVDEDFEEEEDD
                     DDDYNAEKYFNDGDDDEYGDEEDMGDEPAF"
     gene            complement(<457574..>458794)
                     /locus_tag="ZYRO0G05808g"
                     /db_xref="GeneID:8206047"
     mRNA            complement(<457574..>458794)
                     /locus_tag="ZYRO0G05808g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498204.1"
                     /db_xref="GeneID:8206047"
     CDS             complement(457574..458794)
                     /locus_tag="ZYRO0G05808g"
                     /note="similar to uniprot|P53901 Saccharomyces cerevisiae
                     YNL152W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498249.1"
                     /db_xref="GeneID:8206047"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:C5DZN2"
                     /translation="MATEVWSGNQGTLCVFVSKARDLPNLTKLDKQNVMLRLRIAHMT
                     RESNTLFRAGQNPVFNYLEKYSITPDVKPIMQVEAYCDRKKKPPILIGRCEVDLLNGM
                     RADPKEGYCCWYELKRDRNEFAGTIFIELSFNPGLPNLRKEERSKDTEAMDATVRSRP
                     VPPLPGDSTSIISTEQDDDYYHRSYMEPYTHGSAMREITPAAGGAWDNRPDFSRSSLP
                     GSIGVGAPPVFNSSVGTSTTISSEETNATEATSTSDTKFHFANLKKLKERLNVFKNPN
                     NSTNNQQSETPVDIEALQKAIGVTSLDDEEGYVSRSHSSHALAANLNDADDRHPSLPP
                     LPPSISHGSRSHSKSPRRPPLPRPFESNDNESVEFDLPSHRNGTPKLPPLPTAASPRN
                     KSRSPRRRPPPVSN"
     gene            complement(<458995..>463731)
                     /locus_tag="ZYRO0G05830g"
                     /db_xref="GeneID:8206048"
     mRNA            complement(<458995..>463731)
                     /locus_tag="ZYRO0G05830g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498205.1"
                     /db_xref="GeneID:8206048"
     CDS             complement(458995..463731)
                     /locus_tag="ZYRO0G05830g"
                     /note="similar to uniprot|P53552 Saccharomyces cerevisiae
                     YNL139C RLR1 Required for LacZ RNA expression from certain
                     plasmids suppressor of the Transcriptional (T) defect of
                     Hpr1 (H) by Overexpression (O) plays a role in
                     transcription elongation by RNA polymerase II Involved in
                     transcription"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498250.1"
                     /db_xref="GeneID:8206048"
                     /db_xref="InterPro:IPR021418"
                     /db_xref="InterPro:IPR021726"
                     /db_xref="UniProtKB/TrEMBL:C5DZN3"
                     /translation="MSESVSASIDKLAATHITFPQGHKIFNQEFADNWNTKSQELCAQ
                     FKELEGTDQRQSWLKDVFREIFELIYDQNTKGSPTMPQISRLLEDIVSSGTQDIKDSE
                     LLSMVGKVFVSVSQEYSDEDDNVVLALARITKSLHKEMFKFSRLSTKLMNQGQTVLLK
                     HLLKKSKYELKKFNLLMECSTGYIQLVTLLWAAYYDPDRMNKVPYFIQEFQQLAGKYS
                     LDPMRCLDVILDVSSEFITEGYEFMIRFLKISDYWPKTSPANNFDYQSLNQGGNAIAS
                     HLISLHLNQEDVGKDTAYLDMVCILIREGFVSFLPIWDNIKPNDETLSAFFENFDNEL
                     EAESMKGVTNPLAMADALTAADDNDGDEKMEDVNTDGKDSSAKAEEKKALEQKQEALE
                     KENIKNSVLNGSKLEFLKRLLVHGVLMPAFYIFKTHPQCVYINDMLPRLIGRLFENML
                     DPLYQSLVFSGSQNLQSASLITTLDNGLLSKKTRLVSERKSHNPFPLLEMRTRFVFYY
                     AEWCKDLGELHTVEELFTKSNEFFTILGPSLGKVPQLISKLCRIGVADIETAAADKKE
                     ETINKWIDYVRKFIFPAIPVLEVNPVITSEIYQLMKFFPFKRRYFLYNELITRTSQDL
                     LLPKVGFNKAERSAKSILKSLSMDTIETESRKLANLVSTNPLATLVPVIKQIENYDKV
                     SELVVITTKYFNSFACDVLQFIILLRLTHNRPAIQTDGVNQNTWVQRLSVYISGLAKD
                     CPKMDITNILVFIVKTLHEGNMVAVSILRELITTVGGIRDLNEVNTTRLIMLNSGEPL
                     KYEARKLIFDTRDDNRELALKLVNQLAKQKTISELILLLYNLNREANTQTLHYKILST
                     RCDEMNTLLWSFIELVKYCFTLEEFGDNVLPLEVLTNDFHLSTSWVFHIWRNYIDQKF
                     READPSSDVMLQNAVFEGVDYSYITKELFLTFWKLSLYDVQFDKALYDKKKAGLEEEL
                     SKSSSTKKKNEYSKQIKDILVSCISHQKTFNNTKRLISEQSQSWAKDLSNERIMSFFQ
                     YCIVPRVLFSPPDALFSSHFLLKSFDLKDLMKILGVFMSSRILSALLFCCTRSEAGNM
                     GIFFSQLLGSLEEMRVSEDQEFLYQRELYECNSLLTEQIVELLFNRNYMSIRNGIEFM
                     KHVSHVFPIIDTQILVACKALERILESEEREDIKLPSNALFGHLKARLKNSCKPEEFC
                     EMTEDEKREKGKYVSELEEINHYESLLANEKKEIELRKQLEFNKKQRAEAEKAKELEE
                     AKKAEKEAEKKEDARDKFKGIPSGPSGGKQAARPQSSTWPFGKVIRFMDEVCFHLGRN
                     NLNRAADCISDPTENQTLKRLSKESMPIRDLRTGVFEVFERFFRSLVYNPNNADFARK
                     LDEIKAAVKYVSNDTPRARGDMYSEATPTEPAKKPSRYNNEPPSGPSNDRDTKTDSHE
                     GTPSGWNRPYDSRNRQALPPGPQRMDNKRSNTTPRPMNFPDRPSQPRSETPRNGNKVY
                     SARDQGSSGNNNNNRMRPKHEAPPASDERLTKRYRADDGRNKMRSPQNDSRSKYNNNN
                     NGKRGNTQGLPQGPKGSGEYVSRYQR"
     gene            <463906..>464243
                     /locus_tag="ZYRO0G05852g"
                     /db_xref="GeneID:8206049"
     mRNA            join(<463906..463908,463998..>464243)
                     /locus_tag="ZYRO0G05852g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498206.1"
                     /db_xref="GeneID:8206049"
     CDS             join(463906..463908,463998..464243)
                     /locus_tag="ZYRO0G05852g"
                     /note="similar to uniprot|P0C074 Saccharomyces cerevisiae
                     YNL138W-A RCP10 Component of the U2 snRNP associated with
                     the SF3b complex conserved in Ashbya gossypii"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498251.1"
                     /db_xref="GeneID:8206049"
                     /db_xref="InterPro:IPR009846"
                     /db_xref="UniProtKB/TrEMBL:C5DZN4"
                     /translation="MSEVQGQQRYQVLKHKYVGLGREHTTQEEWLSNVHRDTYHSLQA
                     HSGLLEYLALAQGSSSKRQTKIQLIKKMDQNKSRPNES"
     gene            complement(<464306..>464881)
                     /locus_tag="ZYRO0G05874g"
                     /db_xref="GeneID:8206050"
     mRNA            complement(<464306..>464881)
                     /locus_tag="ZYRO0G05874g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498207.1"
                     /db_xref="GeneID:8206050"
     CDS             complement(464306..464881)
                     /locus_tag="ZYRO0G05874g"
                     /note="similar to gnl|GLV|CAGL0H09086g Candida glabrata
                     CAGL0H09086g and some similarites with YHR127W
                     uniprot|P38833 Saccharomyces cerevisiae YHR127W (H)igh
                     copy (S)uppressor of (N)34 dominant negative allele of
                     SEC4. Suppression is very specific to this allele. It has
                     no affect on the analogous YPT1 allele. No homology or
                     known function."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498252.1"
                     /db_xref="GeneID:8206050"
                     /db_xref="UniProtKB/TrEMBL:C5DZN5"
                     /translation="MAPNNKSHRRHNSGKKLVDRITPVGESKPERPLPKEGFKTVNGR
                     LVSANDVGVLLREASSKLEAKKKRKSPKGKPHKTGPAPSRPKGKPSKGNPLVIHTNSD
                     ASDKLLVFYNLALGVNQDSLKTVLQKLSHTRIGKVRVRDLPSGSATANVWLVKRTTEE
                     LERVRKLFDGALVDGRTIRVTTVSDTQTMSY"
     gene            <465145..>466791
                     /locus_tag="ZYRO0G05896g"
                     /db_xref="GeneID:8206051"
     mRNA            <465145..>466791
                     /locus_tag="ZYRO0G05896g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498208.1"
                     /db_xref="GeneID:8206051"
     CDS             465145..466791
                     /locus_tag="ZYRO0G05896g"
                     /note="similar to uniprot|P17555 Saccharomyces cerevisiae
                     YNL138W SRV2 Adenylyl cyclase-associated protein
                     N-terminal domain appears to be involved in cellular
                     responsiveness to RAS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498253.1"
                     /db_xref="GeneID:8206051"
                     /db_xref="GOA:C5DZN6"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR013992"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR018106"
                     /db_xref="InterPro:IPR028419"
                     /db_xref="UniProtKB/TrEMBL:C5DZN6"
                     /translation="MSDSGKFNVQSYTLVKLLKRLEAATTRLEDVTIYQEGYIESRIA
                     ENAAAGGISSNEMSAMSSAGPSAAIPANQANKSPEAIESEPVPAGAAGVEQPSEAITQ
                     FDQVIQGKVVPLVQLSTKIDPTVAAVVQVFKETFDRQLDFLEIALKSKKPDYSSKEFA
                     ESLLPINQAILKIGDLKDQNRQSKFFPYLNSVAEGAALFSWVAVETPVSLVADFKDAS
                     QFWTNRVLKEFKESDPNAASWVSLFLSIFDQLKSYVKEFHPTGVTWSKDGEDFGTALA
                     QFKGGSANTAPPTPAPVAAGGAPPPPPPPAPPASVFESKPDEKPAGGSGGIDAVFAEL
                     NQGEDITRSLKKVDKSQQTHKNPELRGSSAVPAEQAGGKTPPPVKPKKPNMFKTKKPP
                     RKELVGNKWFVENYENHAEPIVIEGKHDEAIFIGNCSSVLIQVKGKVNAITVNQSDST
                     NVVLDSCISGLELIKCNKFGAQVEQSLPQITLDKCDGGNIFLSAESMNASLYTSCTTA
                     INVNLPVGEDGDFVEFPVPEQMVHTFGNGKINTTIYEHAG"
     gene            complement(<466947..>468386)
                     /locus_tag="ZYRO0G05918g"
                     /db_xref="GeneID:8206052"
     mRNA            complement(<466947..>468386)
                     /locus_tag="ZYRO0G05918g"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_002498209.1"
                     /db_xref="GeneID:8206052"
     CDS             complement(466947..468386)
                     /locus_tag="ZYRO0G05918g"
                     /note="similar to uniprot|P27929 Saccharomyces cerevisiae
                     YNL137C NAM9 Mitochondrial ribosomal component of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_002498254.1"
                     /db_xref="GeneID:8206052"
                     /db_xref="GOA:C5DZN7"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:C5DZN7"
                     /translation="MPRRATLLKSLSRGRVRTSFNKYNLFNLYKKGQVDFRSKTLYQQ
                     KWTAKQETRAYHGEHLTEKRWQFFFNPKLDSVAQLDASLKGGKEEETPFLLQTFAVLE
                     KRLDFAVFRAMFASSVRQARQFILQGNVFVNGIKIAHPNYTLKPGDVFRVRPSKVLEA
                     LGAKKPSVQESLKVDKVQVTLWNKYVKEAKSNPRAVWNKKLNKYREMDNSNPQKQQFL
                     EQVKDYNKDLEQQELKALNSCTPTNMLTQILTVYSKSEKEPESLTVDDFASVVNGDLK
                     LANLALECFQEVNKSKEFTKESLQNGKIDELSHRLLAPTEEMKNKMSDGSKVSIRSAK
                     KHLSELTKLFSSALRESFDKRKGDQNAVDVPYDENWSSKLHYHPRIDPKELVEDEKKA
                     QEFISLPWQQHLYGRANPKRPYFTPWKPRPFLAPFAILPHHLEISFKTCHAVYLRDPV
                     ARPGHSEVISPFDLPVHERAYMYYVRRGK"
     gene            <468594..>469469
                     /locus_tag="ZYRO0G05940g"
                     /db_xref="GeneID:8206053"
     mRNA            <468594..>469469
                     /locus_tag="ZYRO0G05940g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498210.1"
                     /db_xref="GeneID:8206053"
     CDS             468594..469469
                     /locus_tag="ZYRO0G05940g"
                     /note="some similarities with uniprot|P53911 Saccharomyces
                     cerevisiae YNL136W EAF7 Subunit of the NuA4 histone
                     acetyltransferase complex which acetylates the N-terminal
                     tails of histones H4 and H2A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498255.1"
                     /db_xref="GeneID:8206053"
                     /db_xref="GOA:C5DZN8"
                     /db_xref="InterPro:IPR012423"
                     /db_xref="UniProtKB/TrEMBL:C5DZN8"
                     /translation="MAVDWTKVDEIRLLRWVAEFKPAGLHKHFHMYCIVERMNHPDKY
                     PVVLLQKESVKSGKIFTASEIWEKLNQYYNFEMMDKIEDHEQFNEHRDFELPWDEYGD
                     LILDHAKGEEESEEEKEENGGVKREEQPKVAEATYLHDSEKEDSANTSSGNINNMKRR
                     STRLRKSSRLHHSRSGSDEEDASNAVSGDSESDGEDEEALNDNNENENENKGKKNDQP
                     LAKRTRHSSSATTNVTNNDISPKRKKRKLEETTPPLPQPVQQQQQQETSPESAQAMPP
                     VRTSSRVSSRLRNKK"
     gene            complement(<469535..>469879)
                     /locus_tag="ZYRO0G05962g"
                     /db_xref="GeneID:8206054"
     mRNA            complement(<469535..>469879)
                     /locus_tag="ZYRO0G05962g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498211.1"
                     /db_xref="GeneID:8206054"
     CDS             complement(469535..469879)
                     /locus_tag="ZYRO0G05962g"
                     /note="highly similar to uniprot|P20081 Saccharomyces
                     cerevisiae YNL135C FPR1 Peptidyl-prolyl cis-trans
                     isomerase (PPIase) binds to the drugs FK506 and rapamycin
                     also binds to the nonhistone chromatin binding protein
                     Hmo1p and may regulate its assembly or function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498256.1"
                     /db_xref="GeneID:8206054"
                     /db_xref="GOA:C5DZN9"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:C5DZN9"
                     /translation="MSEVVDGNVRIDRVSPGDGATFPKAGDLVTIHYTGTLENGQKFD
                     SSVDRGSPFQCNIGVGQVIKGWDVGIPRLSVGEKARLTIPGSYAYGPRGFPGLIPPNA
                     TLVFDVELLKVN"
     gene            <470636..>471751
                     /locus_tag="ZYRO0G05984g"
                     /db_xref="GeneID:8206055"
     mRNA            <470636..>471751
                     /locus_tag="ZYRO0G05984g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498212.1"
                     /db_xref="GeneID:8206055"
     CDS             470636..471751
                     /locus_tag="ZYRO0G05984g"
                     /note="similar to uniprot|P53912 Saccharomyces cerevisiae
                     YNL134C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498257.1"
                     /db_xref="GeneID:8206055"
                     /db_xref="GOA:C5DZP0"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DZP0"
                     /translation="MSIPTSMKAVVIEGVNAVVKENVPLPPLKEGQVLVKTLAAAVNP
                     TDWKHIEYKLGPQSSISGCDAAGQVVKLGANVKNVAEGDVVAGFAHGASVKHPENGAF
                     AEYVAIDSELLWKLQSSSDSRVLSGKQELPSGPVSNIEGLVTFPISLNTAGVVLVNNL
                     KIDLSWKSSKPQRDEPVIVWGGATAFGQCFIQLAKQLNAFSKIITVASRKHEPSLKKY
                     GADQLFDYHDSDVVEQIKKEYPEAPVVVDGVSSPETYPQIYKVTADTKPSVIINLIYL
                     DDKNVEKPKSNVRHESTMLYLMTGFDIPYGSLHLPKDLEYRKKAIEFIKWVQPKIDAG
                     DIYHLPVKISNGLESIPKLLDDVRTGKNSGVKLVAVL"
     gene            complement(<472026..>472352)
                     /locus_tag="ZYRO0G06006g"
                     /db_xref="GeneID:8206056"
     mRNA            complement(<472026..>472352)
                     /locus_tag="ZYRO0G06006g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498213.1"
                     /db_xref="GeneID:8206056"
     CDS             complement(472026..472352)
                     /locus_tag="ZYRO0G06006g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498258.1"
                     /db_xref="GeneID:8206056"
                     /db_xref="GOA:C5DZP1"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C5DZP1"
                     /translation="MQFSVVALSMLSAVAVKAADNISQIGDGQIQATAPASSAASASS
                     AAPTSSAAPASSAAPASSVSSEAPRSTAGASNSTAVLPQSVNGGNQLAGGAYIAGLVA
                     AGALLI"
     gene            complement(<473650..>475506)
                     /locus_tag="ZYRO0G06028g"
                     /db_xref="GeneID:8206057"
     mRNA            complement(<473650..>475506)
                     /locus_tag="ZYRO0G06028g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498214.1"
                     /db_xref="GeneID:8206057"
     CDS             complement(473650..475506)
                     /locus_tag="ZYRO0G06028g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498259.1"
                     /db_xref="GeneID:8206057"
                     /db_xref="UniProtKB/TrEMBL:C5DZP2"
                     /translation="MMLYVIGFALYGVIRNGTSRDNDLNSIRFIEYIRRQDFDGIRFL
                     FSYSPSSYQTNITSKAFFTGRKFAMLASLPLLLSCVSASVIPLFERNDNSLTNVGADT
                     VVSHLTDPFDIRSSKRDTPPYIGSDVVNAISGSIDNTISIPYFNNTQILNEIENSINS
                     QLDALNQGLEALDPLHIFQVVEQSVQNLPSDIDQFKNGLIQNIQGTVGNLFGIHLGKR
                     DGIPSIGSDVINAISGAIERVIPLPSGNRTQILQDIEHGINSQLGDLQQGLEFLDPLH
                     IFQVIENAVKSLPSDIDQFKNGLVQAIQGTVGNLFGIHLGKRDGTPSIGSDVINAISG
                     AIERIIPLPSGNRTQILQDIEHSINSQLGDLQQGLEFLDPLHIFQVIENAVKSLPSDI
                     DQFKNGLVQAIQGTVGNLFGIHLGKRDGTPSIGSDVINAISGAIERIIPLPSGNRTQI
                     LQDIEHSINSQLGDLQQGLEFLDPLHIFQVIENAVKSLPSDIDQFKNGLVQAIQGTVG
                     NLFGIHLGKRDGIFSIGSDVVNAISGAIERVIPLPSGNRTQILQDIEHGINSQLGDLQ
                     QGLEFLDPLHIFQVIENAVKSLPSDIDQFKNGLVQAIQGTVGNLFGIHPSKK"
     gene            complement(<478718..>480589)
                     /locus_tag="ZYRO0G06072g"
                     /db_xref="GeneID:8206058"
     mRNA            complement(<478718..>480589)
                     /locus_tag="ZYRO0G06072g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498215.1"
                     /db_xref="GeneID:8206058"
     CDS             complement(478718..480589)
                     /locus_tag="ZYRO0G06072g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498260.1"
                     /db_xref="GeneID:8206058"
                     /db_xref="UniProtKB/TrEMBL:C5DZP3"
                     /translation="MLFSLLSLCSLAFALPATITPTVEEKLYKPTSLGSVDLGNLQRR
                     NAFGGVEDTVGDLERREILINGIPANQTNGTFDLSTTNITIGSGTPANLTGNSNGSIT
                     IFKHKREILINGIPVNQTNGTFDLSKTNITIGSGTPANLTGNSNGSITFFKREEGIRV
                     GGNATGNKTVYFNNGNLTIPTGSTINITGNGNGSITISKRAANLLLSGKPGNETTGPI
                     SPDRANITLGGYGPLNITGHANGSVTFFKREDTSGNTSNSSVYLYKGNVTADKGNRFN
                     LTGHSNGSITIGRGPGITVGGNATGNKTVYFNNGNLTIPEGSSINITGNSNGSITISK
                     RAANLLLSGKPGNETTGPISPDRANITLGGYGPLNITGHANGSVTFFKREDTSGNTSN
                     SSVYLYKGNVTADKGNRFNLTGHSNGSITIGRGPGITVGGNATGNKTVYFNNGNLTIP
                     EGSSINITGNSNGSITISKRAANLLLSGKPGNETTGPISPDRANITLGGYGPLNITGH
                     ANGSVTFFKRANTSGNTSNSSVYLHKGNVTVDQGTPFNLTGHANGSITISRAFRREIL
                     INGIPANQTNGTIDLTKANITIGSGSLANLTGNANGSITISKRDLENRPRTVLQPVH"
     gene            482377..482448
                     /locus_tag="ZYRO0G06094r"
                     /db_xref="GeneID:8206059"
     tRNA            482377..482448
                     /locus_tag="ZYRO0G06094r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (AGG) cove score=64.64"
                     /db_xref="GeneID:8206059"
     gene            complement(<482666..>483184)
                     /locus_tag="ZYRO0G06116g"
                     /db_xref="GeneID:8206060"
     mRNA            complement(<482666..>483184)
                     /locus_tag="ZYRO0G06116g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498216.1"
                     /db_xref="GeneID:8206060"
     CDS             complement(482666..483184)
                     /locus_tag="ZYRO0G06116g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498261.1"
                     /db_xref="GeneID:8206060"
                     /db_xref="UniProtKB/TrEMBL:C5DZP4"
                     /translation="MRFSTALTSALALLPFGATALQNKNGPFVLELEKDSISDLKNNF
                     LTQVDADVFNGLARPLKGVFDGVGDILVSVIGLLGEVVGTVFYLSGDGVLFTQGSDPS
                     NGVPGFSLNDQDQLLYEGRQLLGGFEGLNFKLSKDSDAAKRDLIDDINLNLFLPVSIN
                     AFDTNPSAPSLL"
     gene            484601..484691
                     /locus_tag="ZYRO0G06138r"
                     /db_xref="GeneID:8206061"
     tRNA            join(484601..484637,484656..484691)
                     /locus_tag="ZYRO0G06138r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8206061"
     gene            complement(<485315..>487417)
                     /locus_tag="ZYRO0G06160g"
                     /db_xref="GeneID:8206062"
     mRNA            complement(<485315..>487417)
                     /locus_tag="ZYRO0G06160g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498217.1"
                     /db_xref="GeneID:8206062"
     CDS             complement(485315..487417)
                     /locus_tag="ZYRO0G06160g"
                     /note="some similarities with uniprot|P38830 Saccharomyces
                     cerevisiae YHR124W NDT80 Meiosis-specific transcription
                     factor required for exit from pachytene and for full
                     meiotic recombination activates middle sporulation genes
                     competes with Sum1p for binding to promoters containing
                     middle sporulation elements (MSE)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498262.1"
                     /db_xref="GeneID:8206062"
                     /db_xref="GOA:C5DZP5"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="UniProtKB/TrEMBL:C5DZP5"
                     /translation="MSSNYGLVEEQFRNISQHDDIFGEEELGEDGEPVIQTHVNEDGT
                     TSSYFDKRKLKIAPRSTLQFKVGPTFEFVGNYYKVTERYTGRVLDLSIIPRIDRGFDF
                     IDGEWVGYKRNYFTLVSSFEALGWDLDEFLNSCFELHGDTGQRCHIKYFAINIKAKSD
                     DDHTEISLVQHTAKRDKGPQFPPAMAPLIPSALPNHQIIREASNVRNTTKMKKYDATF
                     YFHRDDPVNSTAYSEKSVINSYPGDCIQRVARYERVQFASSINLKKPAQQNRHFRLHV
                     VLGAIIPKGFNHYHHGSDGIHGDIVETGIDAQRDLFIPLQEVRTPPLIIRGRSPSNYT
                     SSQRISVRTSSYNCSYKPEPSVSIGPPNPMLASQNSAPSQTPMTISPNKPRPGRPSKR
                     KSRVLYVPPPLGSPPQPLPQLLEPPLAELLHEEPPSAAVLSIAKKVETLENIENFFHT
                     QGPLALKTLDHQNFNPDMEDKTYKPTLLSRQNSVDPRDIELKCDKEFQENLRTVGPLQ
                     ILATLKSQNSNTGKPDDNNKNNYADAGVSRKKRKLNGTSTTTALELSLEDTKELFDDD
                     ALKTNVNYAQSDSPVSPLSSRNIEPNPMEELSFGEGLNSISFSLLADSSSNYCHVPNT
                     TLSEMENVPRIFDSRVIGAQDTSNRNDHNDYNKDSSREQTTAGMLVSKEARDAMNGLP
                     SQMADMGELYEELSFYRH"
     gene            <488273..>491440
                     /locus_tag="ZYRO0G06182g"
                     /db_xref="GeneID:8206063"
     mRNA            <488273..>491440
                     /locus_tag="ZYRO0G06182g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498218.1"
                     /db_xref="GeneID:8206063"
     CDS             488273..491440
                     /locus_tag="ZYRO0G06182g"
                     /note="highly similar to uniprot|P53914 Saccharomyces
                     cerevisiae YNL132W KRE33 Essential protein of unknown
                     function heterozygous mutant shows haploinsufficiency in
                     K1 killer toxin resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498263.1"
                     /db_xref="GeneID:8206063"
                     /db_xref="GOA:C5DZP6"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="UniProtKB/TrEMBL:C5DZP6"
                     /translation="MVKKAIDSRIPTLIRNDVQTKQRSFFVIVGDRARNQLPNLHYLM
                     MSADLKMNKSVLWAYKNKLLGFTSHRKKRENKIKKEIKRGTREANDQDPFEAFISNQN
                     IRYVYYKDTEKILGNTYGMCVLQDFEALTPNLLARTVETVEGGGIVVILLKSMASLKQ
                     LYTMTMDVHSRYRTEAHTDVVARFNERFILSLGSNENCLVVDDELNVLPISGGRNVKP
                     LPPKDDDERTPSEIELAELKESLQDVQPAGSLVGLSRTVNQAHAILSFIDVISEKTLD
                     TTAALTAGRGRGKSAALGVAIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGY
                     QEHIDYDIIQSTNPDFNRAIVRVDIRRDHRQTIQYILPQDSHVLGQAELVVIDEAAAI
                     PLQIVKNLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRQQANLNDTGNSQTVVTSRD
                     SKASGSIRTGNRQLREILLDEPIRYTRGDPVEKWLNKLLCLDVTLMKNARFAAKGTPH
                     PSQCNLFVVNRDTLFSYHPVSESFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVL
                     LPPIDPKEGGRIPDPLCVVQVALEGEISKEHVRSSFARGHRAGGDLIPWLVSQQFQDE
                     EFAGLSGARVVRIATNQEYASMGYGSRAIELLRDYFEGKFTDLSEDTTPKDFSIKRVS
                     DKELQNANLLTDEVKLRDAKKLPPLLMKLSEQPPHFLHYLGVSYGLTPSLLKFWKRNQ
                     FVPVYLRQTANDLTGEHSCVMLSVLEGREHRWLSEFARDFHKRFLSLLSYDFRKFTAV
                     HALSLIESSQKAEKESADEKPVKRLNKEQLDDLFSPFDLKRLDSYSNNLLDYHVIVDM
                     LPTLAILYFGGRMEGSVNLSGVQSAIFLAIGLQRKNIDDISKELNLPSNQAIAMFAKI
                     MRKISVYFRQLQAESIGKSLPNAAQDEQIAEMNGEEIKGYDAAEALDQMDEDLEEAGS
                     EAVQAMRERQREFINSLDLNKYAIAENEEEWNQNQKSLEKAAQSKGTASIKTGTKRST
                     ENAENIYKQEMGAVKRGKKTKKRSG"
     gene            <491950..>492393
                     /locus_tag="ZYRO0G06204g"
                     /db_xref="GeneID:8206064"
     mRNA            <491950..>492393
                     /locus_tag="ZYRO0G06204g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498219.1"
                     /db_xref="GeneID:8206064"
     CDS             491950..492393
                     /locus_tag="ZYRO0G06204g"
                     /note="similar to uniprot|P49334 Saccharomyces cerevisiae
                     YNL131W TOM22 Translocase of Outer Mitochondrial membrane
                     Mitochondrial import receptor complex protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498264.1"
                     /db_xref="GeneID:8206064"
                     /db_xref="GOA:C5DZP7"
                     /db_xref="InterPro:IPR005683"
                     /db_xref="UniProtKB/TrEMBL:C5DZP7"
                     /translation="MVELTDITDESKNFKTPKEQQPAANDDKAGDLSDDEYGSDFEDD
                     YDENETIADRLVALKDIIPPKQRQNISSLFNTASSLVKSFFSKSGNVAWTVTTSALLL
                     GVPLSLSILGEQQLIEMEKSFDLQKDANDLLAQGDNNGQSAPATA"
     gene            complement(<492639..>493915)
                     /locus_tag="ZYRO0G06226g"
                     /db_xref="GeneID:8206065"
     mRNA            complement(join(<492639..493614,493866..>493915))
                     /locus_tag="ZYRO0G06226g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498220.1"
                     /db_xref="GeneID:8206065"
     CDS             complement(join(492639..493614,493866..493915))
                     /locus_tag="ZYRO0G06226g"
                     /note="similar to uniprot|P17898 Saccharomyces cerevisiae
                     YNL130C CPT1 and similar to uniprot|P22140 Saccharomyces
                     cerevisiae YHR123w Cholinephosphotransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498265.1"
                     /db_xref="GeneID:8206065"
                     /db_xref="GOA:C5DZP8"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014472"
                     /db_xref="UniProtKB/TrEMBL:C5DZP8"
                     /translation="MGFYVPHENLESLKAYHLNQESPRWTYISYAVGLFLYQLFDACD
                     GMHARRTGQSGPLGELFDHCIDSLNTTLSLFPFCSAVGISYNYMMVITQLACLCNFYL
                     STWEEYHTHKLFLSEFSGPVEGILMICIGYILTGIYGPQKIWHTELTTFDFNGYHFKV
                     ESLDIMLVFSGIGLMFNVLSARQNVIDYYNEQPKAQEIVGKKVKGHSPQCEAMKGLLP
                     FFSYYISVFSLVIIEPDFISFPFVLSTGFAMAFVVGRIITAHLTKQPFPMVNAPMLVP
                     SAQLVLYVLVVNLLGYEKSTVINALLWTGCGLTLGIHGTFINDIIYDFTSYLDIYALS
                     IKHHKVA"
     gene            complement(<494072..>494749)
                     /locus_tag="ZYRO0G06248g"
                     /db_xref="GeneID:8206066"
     mRNA            complement(<494072..>494749)
                     /locus_tag="ZYRO0G06248g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498221.1"
                     /db_xref="GeneID:8206066"
     CDS             complement(494072..494749)
                     /locus_tag="ZYRO0G06248g"
                     /note="similar to uniprot|P38829 Saccharomyces cerevisiae
                     YHR122W Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498266.1"
                     /db_xref="GeneID:8206066"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="UniProtKB/TrEMBL:C5DZP9"
                     /translation="MSEFINETPTVLEDNQLPTRGEDTDGNLLLGTDVTKESLHRTKL
                     LLKIDNSLQSPVLQNVELLTKLLQLNQAPELTTDESDEDTDDMADELGVPADPIDPQE
                     IYDLIAHISDPEHPLTLGQLAVVNLKDIEVHDEGYKDRMAEVIVKITPTITHCSLATL
                     IGLGIRVRLERALPARFRITIFVKEGSHQSENQVNKQLNDKERVAAACENDQLLGVIS
                     KMLSTCK"
     gene            <494886..>495665
                     /locus_tag="ZYRO0G06270g"
                     /db_xref="GeneID:8206067"
     mRNA            join(<494886..494939,495003..>495665)
                     /locus_tag="ZYRO0G06270g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498222.1"
                     /db_xref="GeneID:8206067"
     CDS             join(494886..494939,495003..495665)
                     /locus_tag="ZYRO0G06270g"
                     /note="similar to uniprot|P53915 Saccharomyces cerevisiae
                     YNL129W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498267.1"
                     /db_xref="GeneID:8206067"
                     /db_xref="GOA:C5DZQ0"
                     /db_xref="InterPro:IPR026681"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ0"
                     /translation="MANIFLVALSGCSSSGKSTIAKVIAQICPDITLIHEDDFYKHDD
                     EIPFNEKRGISNWDSPEALDLAHFEAELDSIKETGQISSQLVHNNNVDDISKFQLDPN
                     FLQTLRHKLEPISRSTRIVLVDGFMIYNSPKLASKFDLKLFVRAPYEVLKARRNARPG
                     YQTLDSYWVDPPYYFDEFVYDSYRSSHAHLFIDGDVEGSLNPQTAAGIKEFTNGSGTP
                     LTEALTWTTNEICEAVSAAH"
     gene            <495765..>496991
                     /locus_tag="ZYRO0G06292g"
                     /db_xref="GeneID:8206068"
     mRNA            <495765..>496991
                     /locus_tag="ZYRO0G06292g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498223.1"
                     /db_xref="GeneID:8206068"
     CDS             495765..496991
                     /locus_tag="ZYRO0G06292g"
                     /note="uniprot|Q6RI82 Zygosaccharomyces rouxii TEP1 TEP1
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498268.1"
                     /db_xref="GeneID:8206068"
                     /db_xref="GOA:C5DZQ1"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029023"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ1"
                     /translation="MTIRIHHQAKPTNLLKSIYATPLNVHKNNSGLTLDLSYITNQVI
                     VCSYPVTRYPKLMYRNSLEDLVTFLNIQHGPESWKLYNFKIEGGRSDYRDEELMELVG
                     AQKTKCIPPNCDGSTLAADLDQFLNRVGWMDHSPPPFLLLQNIIDDIQDQLIKSGSSV
                     AVLHCKMGKGRSGTICIAYLMKYLESPLSESRDIFMNGRFKPGVSRGVTILSQLRWLR
                     YHEMFLYYEPGLRPDILDQLSQSKFKLHTIQLNEPSSILFARPCSACIKIQTFNESRD
                     SVTDLATLETDEELLCRSDEDKTITICFPLELHISDIRLEFGISARSPTVMNNFTALA
                     SYAHCWLNLYWETLKCSRIGSKDHYMLSKLLHEQDSGQNFDFVIKWRELDGTGGTSNR
                     GLKLFESLTMKWSLIL"
     gene            complement(<497083..>497649)
                     /locus_tag="ZYRO0G06314g"
                     /db_xref="GeneID:8206069"
     mRNA            complement(<497083..>497649)
                     /locus_tag="ZYRO0G06314g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498224.1"
                     /db_xref="GeneID:8206069"
     CDS             complement(497083..497649)
                     /locus_tag="ZYRO0G06314g"
                     /note="uniprot|Q6RI83 Zygosaccharomyces rouxii similar to
                     YHR121W uniprot|P38828 Saccharomyces cerevisiae YHR121W
                     LSM12 Protein containing an Lsm domain and an AD domain
                     may bind RNA and have a role in RNA processing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498269.1"
                     /db_xref="GeneID:8206069"
                     /db_xref="InterPro:IPR016521"
                     /db_xref="InterPro:IPR019181"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ2"
                     /translation="MSISLENILGFKVKVVNVLDVVTEGKVYSFNSSNNTLTLQTSKK
                     VQQPQSFKVIKCSFIKNLEVIGERPSTNLFKKQPIKPAYVHVDRVNQLLQEKMKESAK
                     KNELSGKGVSSEGQFLFDMAYKTVSDTRWVDKNIVVLDSVEIFPPYKPENIKLINGSK
                     AEAVTMVQRILQRGWQKLNESEETKKGG"
     gene            <497875..>500748
                     /locus_tag="ZYRO0G06336g"
                     /db_xref="GeneID:8206070"
     mRNA            <497875..>500748
                     /locus_tag="ZYRO0G06336g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498225.1"
                     /db_xref="GeneID:8206070"
     CDS             497875..500748
                     /locus_tag="ZYRO0G06336g"
                     /note="similar to uniprot|P53917 Saccharomyces cerevisiae
                     YNL127W FAR11 Protein involved in G1 cell cycle arrest in
                     response to pheromone in a pathway different from the
                     Far1p-dependent pathway interacts with Far3p Far7p Far8p
                     Far9p and Far10p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498270.1"
                     /db_xref="GeneID:8206070"
                     /db_xref="InterPro:IPR012486"
                     /db_xref="InterPro:IPR021819"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ3"
                     /translation="MNGNGRPDLPIRSVSLDNLRPKSSLRKRLKFIDDTPTRMSSSAS
                     GSPERSRESGNELLLDLNNILRAKLTIDDPRNRNNGSNSGSDHRTSHNNKDEEFKKKL
                     GLESDVITRVYGNGNEGTNECEENDEEADDNDDVPEVNSRATKEHRLSDEQDSDEMGD
                     EEDEEEDEFANVDEIDGPISGKQKDNKSEAKGLDIDYNMPIDEEYKKSLDERAAEFDK
                     VSRFQPISQPRIEWSLQDFCSLQDELAEWFCTSDFSQLAQTKSQFDKKVDEPQRFLKD
                     DDYALKIMDQLCQDTNKNLLALTYISMGTFALVTSLDEQLQNIRRNNLMLCSHLNSIV
                     DVFKKVAIACRDNVTNLKRETTLFFYSCTILFFMTNVCIEQRDNDSNTVKNAIKILHD
                     AQLLPFLTHYIEHWRWNSRLSMRIRNVINLLFRLLVLQFGDKTVWKRSKAFLYNLHNL
                     KQPHRSEKGQILTISPLHYQAFREDITARFPDHRTPLAGLPPEVDNSNSLSQFLEIPR
                     SKAKNPVNLTLATPQQHIATPAPSPPGSPNLLQMDAIRHRKSFQTNMAYPCLYPSDDE
                     EGEDELSKKMSLDDYDRRTEVFVPYSIQEATNILSNSVHIKLSVQQLWYERDLFISTE
                     RGWKVDQGEDKYNYSSMENTSQEESIDIMKRVDSFYDECFSSLNSLVFVLLQTVESNL
                     SNVDFRNSDIPADTKIDPLIPRLEITRAKELAMKSSFGILYLLLRWFKLNHVLKQEHL
                     CVLLHDSRYIQVCCSLLSKYSENYPDKAFNRMLSSPGSIWRECSNYNSTYQQSLLDQQ
                     DTEKSQNYDTVTLSSLAYMLKVLRRIVGNKTERLKELPLNIGLLFKRYYRIFNIDIYH
                     PILRIIKELTPFKNKRWKAEHMELISGVFLYEELELIDNWVTGKDVSGELGDACGQEI
                     AMRALLQFYNFLHYEKSMEDLGYSQRSTTNLSLLNKESEYLGM"
     gene            <501008..>503569
                     /locus_tag="ZYRO0G06358g"
                     /db_xref="GeneID:8206071"
     mRNA            <501008..>503569
                     /locus_tag="ZYRO0G06358g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498226.1"
                     /db_xref="GeneID:8206071"
     CDS             501008..503569
                     /locus_tag="ZYRO0G06358g"
                     /note="similar to uniprot|P53540 Saccharomyces cerevisiae
                     YNL126W SPC98 Component of the microtubule-nucleating
                     Tub4p (gamma-tubulin) complex interacts with Spc110p at
                     the spindle pole body (SPB) inner plaque and with Spc72p
                     at the SPB outer plaque"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498271.1"
                     /db_xref="GeneID:8206071"
                     /db_xref="GOA:C5DZQ4"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="InterPro:IPR015697"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ4"
                     /translation="MDLEVALYPVVEALAPHTLSDGLTNSLTHELAQLLQSPSRSLGQ
                     LQNTIDSFKLKVPYSPDGVIRWQKLINVIQLLFGIDRKENVIKYLSTFQSMLMENSTI
                     PSPDMDRNHVMSLNMNGLDTHDKLLSPLRPQSLQAESFENLDKFSDRRSLLSSQKGYA
                     LSREYNSVSLHMLSNQYYYKMISEEEILKVISYTLLATMTELFPLEFNKINIPKEVTN
                     SESGLLHLIFEAVLLYQNLKLKVDEQKHKNVSPMKKALLVQVESALQNYVKVVNSLSA
                     FARVDSLKQLYYEFYDHIIALRFHYRYMENFEETSGDSFLTRFNDLQSHGDVLVRRLC
                     TEIFKNLLSLYYEYLIDWLTMGKLEATYREFFIVAHESEDPLPLKLVKNKVPKFIPMS
                     VANEIFIIGKTFLLLSKYCKELHWTNEISKKYSFKYQQLVHHVQLTDFYSLVHSHYEE
                     MVKFANNTLLHKFYYKQVLYTLKDILLMGKSDLIDILIQKAQDILAMPSASLSGYRLT
                     RFLQEAVQQSSMRNLLNKSDKNFVINGLDARILDLGHGSLGWDVFTLDYLIDVPLSTV
                     LNVNRNGGKKEYLRIFNFLWRFKKNNFFYNQEWLKSNQLIRNFRKMDRHGPLIRDLTS
                     KLSKVNILRNQIQHFSQKLEAFCFRSIIDKNFQEFERKVVITSDKNDNTDDDEQGMND
                     LQAVRLRNGVLMLNGILRPRSSRSPLLSSILQATATTETFCKEPNIDELDSLHDGYLQ
                     KILLHKLLNSSNGQKTVGGLSGQPYSSSSIILLNIAFEFITFQSALNDVAHELLIQLN
                     LDTQPQLGVLLSRFNSVLRDLVPRYKLFKENLRIFIKDLKMDGDDELCSLSRFLR"
     gene            complement(<503630..>505399)
                     /locus_tag="ZYRO0G06380g"
                     /db_xref="GeneID:8206072"
     mRNA            complement(<503630..>505399)
                     /locus_tag="ZYRO0G06380g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498227.1"
                     /db_xref="GeneID:8206072"
     CDS             complement(503630..505399)
                     /locus_tag="ZYRO0G06380g"
                     /note="some similarities with uniprot|P53918 Saccharomyces
                     cerevisiae YNL125C ESBP6 Protein with similarity to
                     monocarboxylate permeases appears not to be involved in
                     transport of monocarboxylates such as lactate pyruvate or
                     acetate across the plasma membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498272.1"
                     /db_xref="GeneID:8206072"
                     /db_xref="GOA:C5DZQ5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ5"
                     /translation="MSKTQSIGHLPPSTGSDVSRSEPQWSWKEDNDEDTGIAEKPHTV
                     TSADTYSSGSVGSGEDEVELDRALTSYFDVADAMRIQTNEGSRGQIKLEDSESGNEEG
                     AKEYDGNDLDDDDNLKKVFTNHSTGEIDLPPDGGYGWVVTLCVFLVMFSTWGCNSGFG
                     IFLAFYLKSGAFAGANKFDYATIAGITVACGQGFAPFVVVCYRVIGCKPTMLIGTVFM
                     FAGFLMASFAKSLWELYLTQGLLVGLSISFSYVPATVVLPGWFLKKRAYAIGISYMGT
                     GCGGVTYGLAVNKMINNSHSTRWALRVLCISCTCSMLVAIALLKQRNPLPITGIKRWG
                     PIWEQFKIVFNIKVAKNPISLTIAIWFGFSLFGYNLMMYTLSSYAQARGLSAHDGSTL
                     TAITNAAQVVGRPIMGLLGDRFGRTNTTIVLSALLTIFLFAFWIPSHTFVQLIFFCIC
                     MGSCVGVAQVMVTVLIADLVGPEAFLASWAFANAGPAPYLLCCEIIAQALVTNSKSSP
                     YLHTQCYGGACFAISLILIFILRERAVRLKLGKMAEQEGVGFNGKNDIEVHSDVNFTH
                     DYSSLLGKSPTKYLRRLTYPMRI"
     gene            <505987..>507273
                     /locus_tag="ZYRO0G06402g"
                     /db_xref="GeneID:8206073"
     mRNA            <505987..>507273
                     /locus_tag="ZYRO0G06402g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498228.1"
                     /db_xref="GeneID:8206073"
     CDS             505987..507273
                     /locus_tag="ZYRO0G06402g"
                     /note="some similarities with uniprot|P53919 Saccharomyces
                     cerevisiae YNL124W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498273.1"
                     /db_xref="GeneID:8206073"
                     /db_xref="GOA:C5DZQ6"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ6"
                     /translation="MTDAFDQALENPETASQIHLPTNDVDLGDLGSDESSSSSYESED
                     SDEEEEEVAEYGDAEEEEEGGGGDVIKSKHEVTEEQVPDLPDDYEIPESATISPIGKI
                     KSAFDNNIIIEAVVSGEKRVLKEGSILCLEDKSLIGILCEVFGPLQKPFYRVALPVSK
                     KERFDQLKEQLGSNVCIVVPEAHWVDTFELKKLKGTDASNGYDEELPEEEQEFSDDEK
                     EAISKKMKKEQNKKKKENGKPKQPRSGGVDKIPNNLQSMKVPQAMTSVSYRSRNSRQA
                     PQQSPPAAYEQPHHQYQPPRPRPQAIPQPQLPPQTQQPIYQPPPTPYNYGVPYVQQSP
                     SFQQPPSFQQPPSFQPFVSPYPQPQPLYQAPMYYPPQPQPQFPMPGPAPGPGPAPAPV
                     QQNMQQVLQLHQLLVQQQQQQQQQQQGQNQHFNYDD"
     gene            complement(<507306..>510170)
                     /locus_tag="ZYRO0G06424g"
                     /db_xref="GeneID:8206074"
     mRNA            complement(<507306..>510170)
                     /locus_tag="ZYRO0G06424g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498229.1"
                     /db_xref="GeneID:8206074"
     CDS             complement(507306..510170)
                     /locus_tag="ZYRO0G06424g"
                     /note="similar to uniprot|P25846 Saccharomyces cerevisiae
                     YHR120W MSH1 DNA-binding protein of the mitochondria
                     involved in repair of mitochondrial DNA has ATPase
                     activity and binds to DNA mismatches has homology to E.
                     coli MutS transcription is induced during meiosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498274.1"
                     /db_xref="GeneID:8206074"
                     /db_xref="GOA:C5DZQ7"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ7"
                     /translation="MLWSGRINPLCFQVRYTLRTYISKPKVTKLSLTLDNKESNYPTE
                     ENAIDTSSPPIAFKRSKSSNLSEQSTDLRKKSQTQLPPSLQYARDLMDRYKSHVVLTQ
                     MGSFYELYFEHATMYAPQLNISLTSKNYTFGKVPFAGFPVPQLNRHLKVLVNNYGYSV
                     TIADQFKRDTPADNDVNKFYRRVTRIVTPGTFIDEAFENLQENTHLLNIEFPENCMKN
                     LADPDMKIGLCWCDVSTGEISVQQILLKDLASAITRIQPREILLDEELAQFNLESGYW
                     YSELVELKKYFMKYQKLPQRHRTMDTFYGLFTAGNSKEGINQLKITFQQFTQKEIAAL
                     RNILIYVSEHLPDFHMNFQVPQRKITASIMQIDSRTSAALELHTSVRDNRKRGTLLST
                     VRRTVTPVGARLLVQWLSGPSMDLKEIKNRQRIVKFFKASNDCTDTLIFLLKKTHDLA
                     RILQKFSFGRGEALEIIQLARSIQVALDIGYHLQKESQNSDSSSKRIIETLVLQLKFD
                     RQIISDVLTGLNEEELVKSENLTQDGEAAEESAELEETGATELQQEGNLKESWVVNVD
                     YSQRLKDLHKRYAELRDQKCSLQRTYQSYFIDEWGCKSVLLRRKQNGDYALRVTGGIN
                     HLKRVVELAKQNSFHVLQKSSQTVWFTHESWTKLGTELEMAVFKIRKEEINIMNEFKK
                     RFIEKSNEVRAISDILGYLDILSSFAVLARERNLVCPIVDQSDRLEIVGGRHLVVEDA
                     ISNRSLEKFTENDCQLNAGELWVVSGPNMGGKSTFLRQNAVIVLLAQMGCFVPCKSAR
                     IGLVDKIFSRVGSADDLYNEMSTFMVEMVETSFILKGATNRSLAILDEIGRGTSGKEG
                     ISIAYATLRHLIKNNVCRSLFATHFGQELNDILQRRSEGDLTEKIQFYKSGVVETLEG
                     DFYYDHKLKPGICETSDALRVAETAGFPGDALEIAKEVLS"
     gene            complement(<510394..>513441)
                     /locus_tag="ZYRO0G06446g"
                     /db_xref="GeneID:8206075"
     mRNA            complement(<510394..>513441)
                     /locus_tag="ZYRO0G06446g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498230.1"
                     /db_xref="GeneID:8206075"
     CDS             complement(510394..513441)
                     /locus_tag="ZYRO0G06446g"
                     /note="similar to uniprot|P38827 Saccharomyces cerevisiae
                     YHR119W SET1 Histone methyltransferase subunit of the
                     COMPASS complex which methylates histone H3 on lysine 4
                     and is required in transcriptional silencing near
                     telomeres contains a SET domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498275.1"
                     /db_xref="GeneID:8206075"
                     /db_xref="GOA:C5DZQ8"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR017111"
                     /db_xref="InterPro:IPR024636"
                     /db_xref="InterPro:IPR024657"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ8"
                     /translation="MSGYYRRSYPIPPTGPQRSNFWHESSGSDYNHKPYFNGGYKRYG
                     RYGNFVDNDVSSRNHRNRREEVNDGSSSSYESPLLNHEEDTKRPIPRVKWDTEELKAK
                     YHYFDVREKKLIHMEEMTNWNKDSKYPPNGYVLVQENNMGQPRPVFKQRVPQEKAVDP
                     RVEQRQQQQQQQVIPPTYRKLRSKLALLPHIVYDKFSVGPPPPNEIVLSLLSNVATVQ
                     DISIKNYFKRYGEISHFEAFSDPNSALPLHIYLIRYGSYSGKLDDAARAAYMAFKDHE
                     GRGCSILGTKFNCTLNKNNILEKTISRTVTDNLNRVRKITNDMKKMEKRQKEEEKKES
                     QAYSERKIPLDLAKQINGRPVLVVSKSFALHHGLRVEDFKVKLRRYRWSRILDHSSGL
                     YVVFNDLEHARNCQKVESGKMLITSRAKRAPVDVRFQLIAPTVDKQPTNDINGNHAAL
                     PKSSNQLPTYKTKEELISAATSYILKDLENALHVDIRKRIIGPAVFDTLNPASFPDLI
                     AKKEVKEKERKEVVAKKAEELKKKQSTNNDFDIFSLYSGGVTQSNRNRLKRRGSEVID
                     ILPSGRRKLFKGVKPMAHMLNDDSLSKEQTPVAPSTSSPFDESEDEEMTSSDATEYES
                     GEDDNVEQKKMIKVETESTTPEIDHAEKPLFVSKKAEEIMRIPEPYRPSVGGLPKPIQ
                     PDDTIRPNLFIDDLQKTVTDMEDLFILKKVLGLDEPNQNDEKSEHDGTLEYRIWKLRS
                     QAQNFRVDQENQLRLLGAPLDSLLLTGNGSFKAQGYRKIPEKLKSCYLPHRRKPHQPL
                     NTVSYHSETKDGTPEVEREESENLEEPESVPQEISSSRDNRASNRRFQQDIEAQRAAI
                     GTESELLSLNQLNKRKKPVTFARSTIHNWGLYALEPIAAKEMIIEYVGERIRQPVAEM
                     REIRYLKSGIGSSYLFRIDENTVIDATKKGGIARFINHCCEPSCTAKIIKVGGMKRIV
                     IYALRDIGANEELTYDYKFEREIDAEERLPCLCGAPSCKGFLN"
     gene            <513793..>515067
                     /locus_tag="ZYRO0G06468g"
                     /db_xref="GeneID:8206076"
     mRNA            <513793..>515067
                     /locus_tag="ZYRO0G06468g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498231.1"
                     /db_xref="GeneID:8206076"
     CDS             513793..515067
                     /locus_tag="ZYRO0G06468g"
                     /note="similar to uniprot|P38826 Saccharomyces cerevisiae
                     YHR118C ORC6 Subunit of the origin recognition complex
                     which directs DNA replication by binding to replication
                     origins and is also involved in transcriptional silencing
                     may be phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498276.1"
                     /db_xref="GeneID:8206076"
                     /db_xref="GOA:C5DZQ9"
                     /db_xref="InterPro:IPR008721"
                     /db_xref="InterPro:IPR016811"
                     /db_xref="UniProtKB/TrEMBL:C5DZQ9"
                     /translation="MSNHQIQRCIRDILGINQEEKLDWSQSHFKKLLSATSTLHTASL
                     NKVMLKQDEETARLHLCAYIASERLADKHMPELSYYMDRVPLEPRKARKLMELIKQNV
                     FQLSPVKNIQWTPSPKKRNGTSPLKNGDRFTAQDPQILRKQLFDTPTKGNSPVGDPVK
                     NAQVVNPPSATASPSKARRKLAFEEEDEMENPVPASNQSLDTLAQLSLVANERLNNEE
                     EEEELKKKPRSNKRSQQQQEQEQEQPAPKRRKETGRSRSEMCLLQKRYYKVTPAEIIN
                     LCNQFEIPKDVAYSILDQFMSYASYLVCPWKLACGLVLNATFVVFTERRRKDPRVDHL
                     ILEKMCGITKAPQLEDITECINLVKELIEGEKWYRDLQIKHNYYNGACFDEAISTKLG
                     SMLQPNNILVSNEQFTSWKRKIEQDLSLKDMH"
     gene            complement(<515132..>515410)
                     /locus_tag="ZYRO0G06490g"
                     /db_xref="GeneID:8206077"
     mRNA            complement(<515132..>515410)
                     /locus_tag="ZYRO0G06490g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498232.1"
                     /db_xref="GeneID:8206077"
     CDS             complement(515132..515410)
                     /locus_tag="ZYRO0G06490g"
                     /note="similar to uniprot|Q75D91 Ashbya gossypii ABR133W
                     50S ribosomal protein L35 and some similarites with
                     YNL122C uniprot|P53921 Saccharomyces cerevisiae YNL122C
                     Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498277.1"
                     /db_xref="GeneID:8206077"
                     /db_xref="GOA:C5DZR0"
                     /db_xref="InterPro:IPR021137"
                     /db_xref="UniProtKB/TrEMBL:C5DZR0"
                     /translation="MFFNSIVGLGSRSAFASFGGFNSSSLVFTRNLMKTHKGTAKRWK
                     KTADGFKRGKAGRNHGNVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY"
     gene            complement(<515759..>517573)
                     /locus_tag="ZYRO0G06512g"
                     /db_xref="GeneID:8206078"
     mRNA            complement(<515759..>517573)
                     /locus_tag="ZYRO0G06512g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498233.1"
                     /db_xref="GeneID:8206078"
     CDS             complement(515759..517573)
                     /locus_tag="ZYRO0G06512g"
                     /note="similar to uniprot|P07213 Saccharomyces cerevisiae
                     YNL121C TOM70 Translocase of Outer Mitochondrial membrane
                     70 kDa mitochondrial specialized import receptor of the
                     outer membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498278.1"
                     /db_xref="GeneID:8206078"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DZR1"
                     /translation="MSSDNSVAGFISRNKTAIITTAAAGTAAVGAYLYYRQLQDAAGS
                     DDKKGESPDGTAASKKKRKNKKKKQGSSPSPSAAVSYPVDEKGEPKLDNVAEMSEEQK
                     ESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPVFYSNISACYVSMNQLDKVVE
                     NSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLSLNGDFGGSSIEPMLERNL
                     NKQAMTVLKDKLGQQKNQLLPSDTALASFFGIFTPETEFANYDETSEADQKLKAGLEN
                     LYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAIALEHRGIFRFLKNDPL
                     GAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIKLDPKNAAVYYHRGQ
                     MYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCETLFSEAKRKFAT
                     APEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGKATLLARQPSV
                     ENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASLARTVDEKL
                     QATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI"
     gene            complement(<518228..>518566)
                     /locus_tag="ZYRO0G06534g"
                     /db_xref="GeneID:8206079"
     mRNA            complement(<518228..>518566)
                     /locus_tag="ZYRO0G06534g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498234.1"
                     /db_xref="GeneID:8206079"
     CDS             complement(518228..518566)
                     /locus_tag="ZYRO0G06534g"
                     /note="similar to uniprot|P38824 Saccharomyces cerevisiae
                     YHR116W COX23 Mitochondrial intermembrane space protein
                     that functions in mitochondrial"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498279.1"
                     /db_xref="GeneID:8206079"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR027179"
                     /db_xref="UniProtKB/TrEMBL:C5DZR2"
                     /translation="MADGDKDNLREGNLDPQLVVEPKKVDYAPQGDSPDKFQYYPDKP
                     ESSLSRYRFAVKDASQYFDPCQESSRMSFNCLDRNNYDREMCKEYFDAYRECKKQWLR
                     ARRENRSLWE"
     gene            <518731..>519870
                     /locus_tag="ZYRO0G06556g"
                     /db_xref="GeneID:8206080"
     mRNA            <518731..>519870
                     /locus_tag="ZYRO0G06556g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498235.1"
                     /db_xref="GeneID:8206080"
     CDS             518731..519870
                     /locus_tag="ZYRO0G06556g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498280.1"
                     /db_xref="GeneID:8206080"
                     /db_xref="GOA:C5DZR3"
                     /db_xref="InterPro:IPR001206"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="UniProtKB/TrEMBL:C5DZR3"
                     /translation="MASKESLGIFGEFEYYVTFAKDGSKYTSFQLEKSHAKQSSRAST
                     RSDDSTLIVLDSLKSGIGRTENNDFYSIVIAPILEELNWNHNYIKTTSHDSVSQFAQS
                     LDPLQDYEIWIISGDTTISEFCNNLPNKKITRNPLRILPLPMGTGNAWANSLGFDSPI
                     TAFRNYLNHNLKPRDIPLYRAALPNGYSIIFFMIFSLGFHANLLHACEDPKYAKMGAE
                     RFQIAAQSILESYSLDLDISLDGLRRSYAYFALINTPNLEATYKPSPRSNPLERELRL
                     LGYSSSLGRQELVEKIMQGYQNKPNGDLPTNEDMIYKSITHDFTLVLNDSLEDSSMHK
                     FEICCDGILLNLLDYQSPDKHKPSNEIRFQFLNDYSGFQLQVYSL"
     gene            complement(<519877..>521586)
                     /locus_tag="ZYRO0G06578g"
                     /db_xref="GeneID:8206081"
     mRNA            complement(<519877..>521586)
                     /locus_tag="ZYRO0G06578g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498236.1"
                     /db_xref="GeneID:8206081"
     CDS             complement(519877..521586)
                     /locus_tag="ZYRO0G06578g"
                     /note="similar to uniprot|P32354 Saccharomyces cerevisiae
                     YIL150C MCM10 Essential chromatin-associated protein
                     involved in the initiation of DNA replication required for
                     the association of the MCM2-7 complex with replication
                     origins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498281.1"
                     /db_xref="GeneID:8206081"
                     /db_xref="GOA:C5DZR4"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR015408"
                     /db_xref="UniProtKB/TrEMBL:C5DZR4"
                     /translation="MRDPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRL
                     NVKKTNPKPLDPNLSHIQVESSPKKVTNSVLPPTVQQQEPRGEVRNENLNELKAQSQE
                     QIPANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEE
                     FSNLWISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKG
                     EVKFTSAASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWR
                     PSGTKAHIKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCE
                     YHRELKFRSTNAKRVELSGTYALGAPTRIDAQPALYRGGSSQKNLNYNIITNGADGGS
                     NKEINPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRDNRKSNILNRELK
                     KNSELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVFKHQRSDSDKKP
                     LTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFGSGGDEKDDSDSDLE
                     IVS"
     gene            complement(<521893..>527355)
                     /locus_tag="ZYRO0G06600g"
                     /db_xref="GeneID:8206082"
     mRNA            complement(<521893..>527355)
                     /locus_tag="ZYRO0G06600g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498237.1"
                     /db_xref="GeneID:8206082"
     CDS             complement(521893..527355)
                     /locus_tag="ZYRO0G06600g"
                     /note="some similarities with uniprot|Q02455 Saccharomyces
                     cerevisiae YKR095W MLP1 Myosin-like protein associated
                     with the nuclear envelope, connects the nuclear pore
                     complex with the nuclear interior; involved in the Tel1p
                     pathway that controls telomere length; involved in the
                     retention of unspliced mRNAs in the nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498282.1"
                     /db_xref="GeneID:8206082"
                     /db_xref="GOA:C5DZR5"
                     /db_xref="InterPro:IPR012929"
                     /db_xref="UniProtKB/TrEMBL:C5DZR5"
                     /translation="MSEGETGVANIVTSGDNHNDVSLGKLSAFYGVPEDQLVLIDGGI
                     LTILENKVLDFNELKSQNLRLNVTIDEIKTVSSKREEGLKNEIENLMKDNDSIRLERS
                     QAQEESTQSSRDKQKIQNEVESLQEKLSDLDQERETLKQDKREVVAVLEEKIKELESF
                     RTESRKSLDDSKRLRQQVLELETTVQNLKSKELRDQSEIQTITQRLTILQKNSQWLEE
                     EVTSKTEQLISTRRKNDDELDRLTSESLSCKNELQLEKSRNQVITTKNEELTKSLQEK
                     LMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQVKSLQGELNASLDKDNVELLASG
                     ERNTENEKLIQELITLKENFEESERERLRLEALVQELIPGDDSQDDINNTSSFISLRN
                     KDSSLRDMGILKKELIKERHQKERLQRQVESFIVELEYKIPVINSFKERTSMLEKELN
                     DVALLLDHTSNEKEKREREFEALSKKVKDSESSIHTLTRQRTDLAHQVQFLLMNISVQ
                     VDSGGLLSAEEVSFIKRIVNNDDPNSESDSQRVISERLVEFNNIATLQEKNMELLKTV
                     RKLAEKLESEEKDVNKKIQTFENDTIKEAKEAIVSLQDYNANLESKVEILTKECDAFK
                     AICSRNGSDQNGSLSANGTQGNRNGSSDEEKLRTLEARLTSLTVESSQNNKMLNNEIH
                     ELYRSKTQISIELEKERSSKTLTEERLKLIQHTLELTRNENQQLVKRSQNLQSIFDRQ
                     DSRTAETVNELIACNSKLAVLETKVANLETEKELLQSSERTSRENYLKLSEERNSLRI
                     MVSQLQTLQSEREKFLKEIQTTYKENLDSLEQEKADARARLDAKTKEAEDMENSKRTQ
                     IQWYQDKLDSVVAESQHLKQELQTKTFLVTDLESEVRKLEKQVEESEARIQSYQVLSG
                     SEVETSPESSLRKELEKTKINLSDTYAEIDQYKNLLSTTEESLSQLTQDYASGKQELQ
                     LQVETLQNEKSQLQDVVAKLNESVTKLEESLQDANKAAENEKNTLQKKIATLETESKG
                     SHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEEELQKDSNVSKTISELREQSQKDR
                     IAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLETSRQHLEDLSTQNSLLYDQIEL
                     FSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQREEQTLRGSLASVENELDTT
                     KRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITLRNAAEEENKKNRELQEE
                     LNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERSQEILHKHDRIDPEDH
                     KELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELRE
                     AKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHSRELEQNLSATL
                     QQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEISEDLSNVVESMRRSFEEEKINF
                     LKEKTEELKKLEEEKHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKRIAEAEENL
                     KKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNNSDLKKQLEKDLQE
                     KFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSSETSSVPK
                     PNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGGNPFTSSPQNNDT
                     MGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESSNTA
                     MTPTPGEGASTPSKRAAEDDDNEVGSESKKPREENA"
     gene            <527968..>528421
                     /locus_tag="ZYRO0G06622g"
                     /db_xref="GeneID:8206083"
     mRNA            join(<527968..527975,528043..>528421)
                     /locus_tag="ZYRO0G06622g"
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /transcript_id="XM_002498238.1"
                     /db_xref="GeneID:8206083"
     CDS             join(527968..527975,528043..528421)
                     /locus_tag="ZYRO0G06622g"
                     /note="highly similar to uniprot|P14796 Saccharomyces
                     cerevisiae YKR094C RPL40B"
                     /codon_start=1
                     /product="ubiquitin-60S ribosomal protein L40 fusion
                     protein"
                     /protein_id="XP_002498283.1"
                     /db_xref="GeneID:8206083"
                     /db_xref="GOA:C5DZR6"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR001975"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DZR6"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLKALASKYNCEKSVCRQCYAR
                     LPPRATNCRKRKCGHTNQLRPKKKLK"
     gene            complement(<528671..>532171)
                     /locus_tag="ZYRO0G06644g"
                     /db_xref="GeneID:8206084"
     mRNA            complement(<528671..>532171)
                     /locus_tag="ZYRO0G06644g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498239.1"
                     /db_xref="GeneID:8206084"
     CDS             complement(528671..532171)
                     /locus_tag="ZYRO0G06644g"
                     /note="similar to uniprot|P39928 Saccharomyces cerevisiae
                     YIL147C SLN1 Histidine kinase osmosensor that regulates a
                     MAP kinase cascade; transmembrane protein with an
                     intracellular kinase domain that signals to Ypd1p and
                     Ssk1p, thereby forming a phosphorelay system similar to
                     bacterial two-component regulators"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498284.1"
                     /db_xref="GeneID:8206084"
                     /db_xref="GOA:C5DZR7"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR003661"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR009082"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:C5DZR7"
                     /translation="MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGV
                     YFTDNYKNLRSERLYMAAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKT
                     YANWVDSGNVIQKFLTSSGLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLS
                     GNKPLPSSLQSEGILTNPVLNGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADS
                     LKNVFDDTTALEKSNVAILSAVYDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFL
                     SSALRQGKGGALERTKFLYTKKVAVGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKI
                     ISGTVVGIGVFVCLVTFPLAHWAVKPIVRLQKATELITEGRGLRASSPGAGSSNVSRR
                     SSFFHRPSNCGSSIRSRVTDNHNEKGHDLHGEQIQHGFFAMNGSINHSLAASIASSGN
                     EALSDKSKGLTTSANLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVR
                     ARTRQLEAAKIDAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSL
                     KLIFRSGELLLHILTELLTFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVR
                     LSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERS
                     ENENHKKVYVIPGTEPKGNDEKDKGGIEEKERFSIENTPNDTSSNSSNKHSDTETTPG
                     LNDTDEKQASDDMDGGEEDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSEE
                     LGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICR
                     QLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVK
                     FKIAKSLKSKRSKSSLMTVGPKSSSSDKSLSQLKLTDSDRSVRLDRPFLQSTGTASSN
                     TNLGTTSTINKILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGE
                     HYNLIFMDVQMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLA
                     KPIKRAQLRKIIEEFCPDKQPQEQDKEPKSSENDNSQLLQQDPQQSKEQKQQQQLLPI
                     ITTTTSSSSSGRETKNKDPQ"
     gene            complement(<532862..>534373)
                     /locus_tag="ZYRO0G06666g"
                     /db_xref="GeneID:8206085"
     mRNA            complement(<532862..>534373)
                     /locus_tag="ZYRO0G06666g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498240.1"
                     /db_xref="GeneID:8206085"
     CDS             complement(532862..534373)
                     /locus_tag="ZYRO0G06666g"
                     /note="similar to uniprot|P40458 Saccharomyces cerevisiae
                     YIL146C ECM37 Non-essential protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498285.1"
                     /db_xref="GeneID:8206085"
                     /db_xref="GOA:C5DZR8"
                     /translation="MTSTEGTGGGDGKGISGFSDIERRSILDPHLSVLELLRRPSDTR
                     PHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHRNDSCLSVVPERCPSQATAAGIL
                     SSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLEDYRSLNVGIPLVLPEDSNNINN
                     NNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKLSLSQKTQKFRILVLGRPGLKFY
                     HSIPKKYQHMFELPRSHDPAEFKQYTGILVVFQELKEMVSLLNRVCQCNPNRPVIPVC
                     QSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQPDLLGMFRFLQELSKTVSDNSDMDA
                     EEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKRHNNEKVNRWVLWGVSLTLGVGV
                     GYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLGEMDMDSDHPFGHALF
                     LFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRVLALGYVML"
     gene            complement(<535282..>537123)
                     /locus_tag="ZYRO0G06688g"
                     /db_xref="GeneID:8206086"
     mRNA            complement(<535282..>537123)
                     /locus_tag="ZYRO0G06688g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498241.1"
                     /db_xref="GeneID:8206086"
     CDS             complement(535282..537123)
                     /locus_tag="ZYRO0G06688g"
                     /note="similar to uniprot|P32901 Saccharomyces cerevisiae
                     YKR093W PTR2 Functions in transport of small peptides into
                     the cell Peptide transporter"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498286.1"
                     /db_xref="GeneID:8206086"
                     /db_xref="GOA:C5DZR9"
                     /db_xref="InterPro:IPR000109"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR018456"
                     /db_xref="UniProtKB/TrEMBL:C5DZR9"
                     /translation="MNSASPSITGPEKNKVIIEDKSLEVSGSHERGELDFDEYEVPND
                     DEPTEEELRSLRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGV
                     LDLKSQGATGLAYFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITS
                     LPSVDSKNTALGGFITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIE
                     DPNITIQNVFMFFYLMINIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGR
                     KSYVRPPVGDKVIAKSFRVLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALK
                     ACKVFMFYPIYWVPYGQMTSTFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWL
                     YPFIRRYTPFKPITKIFFGFMWCSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIH
                     IGWQVPAYVLIAFSEIFASITGLEYAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSP
                     VDTDPKYLWMFTGLAVASFISGCLFWLTFHHLNDTEEEMNAMDYEENQEKIDDGLQKG
                     TSDLEFEPAGADDKLDHIGSHGATGFRHDGELGEEGELSPYMSPKSL"
     gene            complement(<537970..>539724)
                     /locus_tag="ZYRO0G06710g"
                     /db_xref="GeneID:8206087"
     mRNA            complement(<537970..>539724)
                     /locus_tag="ZYRO0G06710g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498242.1"
                     /db_xref="GeneID:8206087"
     CDS             complement(537970..539724)
                     /locus_tag="ZYRO0G06710g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498287.1"
                     /db_xref="GeneID:8206087"
                     /db_xref="GOA:C5DZS0"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DZS0"
                     /translation="MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVS
                     GREIISDEHRKQPRQLPLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSP
                     TKLDSQRMMRIAKAYSVFFLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGG
                     WLLNHCFCKVDSNNYPIRTFSDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQA
                     VSQMLIVNRGKDNFCFTVDILVWALLCMIAGQISSLGKFAHIANSAVWMNIAICICTM
                     VGVAVGGPYYGIFQQYGKGPPYYYPDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWG
                     GATIFCEVMAEMKRPMDFWKGMLCAQSLILVVYLFYGLFVYTYNGQFCYVTANQAIAS
                     VGLQNAGNVLTIVSGLIAMVLYGNVAIKVIYQGFLVADLGFPHLTTRKGTIAWGLFVI
                     AYWAVAYILGTAIPSISALVQIVGAFCILNFSYTFPFLFGFCLLCRQDASLADKFDLK
                     TLTVEKADSYLRNLSRWKRAIAHGGTRRILIKCSLFLLFLASLATCGLCSYSAITGAI
                     QAYQTNTAHAFTCTSPVG"
     gene            complement(<540069..>540923)
                     /locus_tag="ZYRO0G06732g"
                     /db_xref="GeneID:8206088"
     mRNA            complement(<540069..>540923)
                     /locus_tag="ZYRO0G06732g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498243.1"
                     /db_xref="GeneID:8206088"
     CDS             complement(540069..540923)
                     /locus_tag="ZYRO0G06732g"
                     /note="similar to uniprot|P40459 Saccharomyces cerevisiae
                     YIL145C PAN6 Pantothenate synthase also known as
                     pantoate-beta-alanine ligase required for pantothenic acid
                     biosynthesis deletion causes pantothenic acid auxotrophy
                     homologous to E. coli panC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498288.1"
                     /db_xref="GeneID:8206088"
                     /db_xref="GOA:C5DZS1"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DZS1"
                     /translation="MITITTVSQLEQYRDSLDGTIGFVPTMGALHEGHFSLVRRSIAN
                     NDHTVVSIFVNPTQFGPTEDLETYPRDIARDAAQLEKLGVECLFAPISPSEIYPLGRE
                     RGPFVDVKLGWATEGLEARTRPGFFKGVATVVTKLLLLVRPGTAYFGQKDWQQLAVVR
                     ALCEGLFLRVKIESVETAREPNGLALSSRNSYLEPSARSAASDIYKGLLKAAKCATLG
                     MKKEYLFEQIEQSWQQRLTSGQFQIDYLELCTPELKPIDTVHSNCVVLCAVYVNGVRL
                     IDNILITA"
     gene            <542611..>543186
                     /locus_tag="ZYRO0G06754g"
                     /db_xref="GeneID:8206089"
     mRNA            <542611..>543186
                     /locus_tag="ZYRO0G06754g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498244.1"
                     /db_xref="GeneID:8206089"
     CDS             542611..543186
                     /locus_tag="ZYRO0G06754g"
                     /note="highly similar to gnl|GLV|CAGL0G05291g Candida
                     glabrata CAGL0G05291g and similar to YDR071C
                     uniprot|Q12447 Saccharomyces cerevisiae YDR071C PAA1
                     Polyamine acetyltransferase acetylates polyamines such as
                     putrescine spermidine and spermine may be involved in
                     transcription initiation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498289.1"
                     /db_xref="GeneID:8206089"
                     /db_xref="GOA:C5DZS2"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DZS2"
                     /translation="MTSTLPLHMYIRPIILEDAQQVIDLEARGFPPSERASPQNVEFR
                     LNTCPELCSGLFIREFNSDTKEVQSETLIGHIMGTKISRNGFIRLEDMKLTHNESSDT
                     IAIHSLVIDKNYQKKNLATLLLTDYIQKLSNQEIGERIVIIAHEPLIPFYERVGFKVH
                     GENRDVIKDPEFASSKWIDMVRELVKEEYEN"
     gene            <543464..>543757
                     /locus_tag="ZYRO0G06776g"
                     /db_xref="GeneID:8206090"
     mRNA            <543464..>543757
                     /locus_tag="ZYRO0G06776g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498245.1"
                     /db_xref="GeneID:8206090"
     CDS             543464..543757
                     /locus_tag="ZYRO0G06776g"
                     /note="similar to uniprot|Q12497 Saccharomyces cerevisiae
                     YDR070C FMP16 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498290.1"
                     /db_xref="GeneID:8206090"
                     /db_xref="UniProtKB/TrEMBL:C5DZS3"
                     /translation="MLSMFCRTPVVSRTLQQQGSRAFTNTAYRALPHRKDNLTADEQT
                     EQKNFDDNQARLEEMEHSRTKDVDYTHQRSEAELRKIGEDAQVEQNRPDDGVY"
     gene            <544095..>546728
                     /locus_tag="ZYRO0G06798g"
                     /db_xref="GeneID:8206091"
     mRNA            <544095..>546728
                     /locus_tag="ZYRO0G06798g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498246.1"
                     /db_xref="GeneID:8206091"
     CDS             544095..546728
                     /locus_tag="ZYRO0G06798g"
                     /note="some similarities with uniprot|P32571 Saccharomyces
                     cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
                     recycling ubiquitin from proteasome-bound ubiquitinated
                     intermediates acts at the late endosome/prevacuolar
                     compartment to recover ubiquitin from ubiquitinated
                     membrane proteins en route to the vacuole"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498291.1"
                     /db_xref="GeneID:8206091"
                     /db_xref="GOA:C5DZS4"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DZS4"
                     /translation="MSSSKLRCKSISKLSNVAEQFMIQDSRCGPGARVMTLLQVCLDT
                     LEAYKDEYKKLKRNDEVSQEQIYHIYESAYVYYKIVHSLVLNRIPNLNEFHQVKRRSN
                     TSDKKLMEIYNMLVKSLLYDEKISGVKTFIKEHSSDIDEISSDKELKTGGFISAKELE
                     FLLKSDDRNILLVDVRQRSEFEETHIKASNVICIEPISFKSSYTDLELEKKSMITSPN
                     VEIDIFKRRNEFTFVILYTDGNKENGHHNFYIQQEMVLLDLLINRSFAKPLHKDVKIL
                     VLEAGISSWKFHGGSCSSSENFQGNQDSGAIYINGNTSGLKLQQLPKLTPNISSSMDS
                     SMKDMMRSTSQDPSNAGFNLPIQQRPPGSANLINPSPSVSPSQLPLGSPPLSHHPDMK
                     FAKYPTTPQLADKDNANDSNGTANGTANGGSSAGNGLPTFTNVSPINSRAVAPARRTI
                     ASPNPPSILVGSSATNGTSANTSTNQPLSKPPTQPLPTLPQLPTRSSNSQSSLTQTKQ
                     YDLDFTVGLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHINLNSKLGSKGVLAK
                     HFARLIHQMHQSAAFKKSDKNKAVRPYEFKMACGSINSLFRESGQQDSQEFCQFLLDG
                     LHEDLNQCGGNPPLKELSEEAEKMRERLSMRIASSIEWERYLTRDFSVIVDLFQGQYA
                     SQLRCKVCNHTSTTYQPFSILAAPVPHAKSCYLLDCFKEFTKLEQLEKDEEWLCPYCK
                     KKQPSTKKLTITRLPRNLIIHLKRFDNLLNKNNVLVNYPFFLDLTPFWANDFDGRLPP
                     GVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLNKGWYYFDDTGYRPMR
                     TPTECITSNAYVLFYHRVYGV"
     gene            complement(<546927..>547832)
                     /locus_tag="ZYRO0G06820g"
                     /db_xref="GeneID:8206092"
     mRNA            complement(<546927..>547832)
                     /locus_tag="ZYRO0G06820g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498247.1"
                     /db_xref="GeneID:8206092"
     CDS             complement(546927..547832)
                     /locus_tag="ZYRO0G06820g"
                     /note="similar to uniprot|P54858 Saccharomyces cerevisiae
                     YDR068W DOS2 Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498292.1"
                     /db_xref="GeneID:8206092"
                     /db_xref="InterPro:IPR005607"
                     /db_xref="UniProtKB/TrEMBL:C5DZS5"
                     /translation="MEFFYEEQALANDPHKTEDHDEKTEKVFNKLEDEVSKRYDETAK
                     AFKGFVAEAEDGVKLNLPLDPAVSEKTQRYLGQLDSNLQNVEKFAQGYWTKVSNPGFW
                     SNVTNNLGNKFEQIVQLGEERGEDMDKGTDKESSKTVVGGNRTETELKTLSTDESLYL
                     NNKLSLPEDFDADSKTQEISQILEKDMDLANLMNGIVPQEISYKDFWNIYFTQKQRIL
                     EMETTRRKILESKETNKEEEIAWDEEEDDNDKQDEEPVIIKKEDTADNDNIKKEKQTS
                     NEESKTGKVGANANENDDDDDDDWE"
     gene            <548056..>548727
                     /locus_tag="ZYRO0G06842g"
                     /db_xref="GeneID:8206093"
     mRNA            <548056..>548727
                     /locus_tag="ZYRO0G06842g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498248.1"
                     /db_xref="GeneID:8206093"
     CDS             548056..548727
                     /locus_tag="ZYRO0G06842g"
                     /note="similar to uniprot|Q6Q559 Saccharomyces cerevisiae
                     YDR067C which is a model system for studying replication
                     of positive-strand RNA viruses in their natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498293.1"
                     /db_xref="GeneID:8206093"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DZS6"
                     /translation="MTSLVAPLQFNIVQFDFYRGSYPREINLPFLKNLRLKYILSLTP
                     EPLTNDPVMAKFCDENGIENIHIQCCKKKENKDKDKDKDKSTPKVKKKKKPVPIEYSV
                     VIECVKFLIDRRHYPCYMHCTNGELVTSLVVACLRKFSYWSTVSILNEFLAYNSSINI
                     HERNFIEQFHSEIEIDNLNLKDKVPWISLQHVGWNKEDKVQNAEITRINSVPGMLPKL
                     KFHSL"
     gene            complement(<548758..>550014)
                     /locus_tag="ZYRO0G06864g"
                     /db_xref="GeneID:8206094"
     mRNA            complement(<548758..>550014)
                     /locus_tag="ZYRO0G06864g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498249.1"
                     /db_xref="GeneID:8206094"
     CDS             complement(548758..550014)
                     /locus_tag="ZYRO0G06864g"
                     /note="similar to uniprot|P40087 Saccharomyces cerevisiae
                     YER143W DDI1 DNA damage-inducible v-SNARE binding protein
                     contains a ubiquitin-associated (UBA) domain may act as a
                     negative regulator of constitutive exocytosis may play a
                     role in S-phase checkpoint control"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498294.1"
                     /db_xref="GeneID:8206094"
                     /db_xref="GOA:C5DZS7"
                     /db_xref="InterPro:IPR000449"
                     /db_xref="InterPro:IPR001995"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015940"
                     /db_xref="InterPro:IPR019103"
                     /db_xref="InterPro:IPR021109"
                     /db_xref="UniProtKB/TrEMBL:C5DZS7"
                     /translation="MNLTISNETNEEVYGPLEVSDDMTLPDLVALIELECGFDRSKHD
                     LYHSVTLLDPNDTKSLTAIGMGDNELLLIRNKVTASAAGAGATNADSMSDDAFVEQFR
                     QELLRNQPLRQQLSWQIPEIDRMIEDEQLFRQRLGPLILQRRYGFGADSGPQNPFGIP
                     QEEYARLMNDPDDPSNQQKIAELINQQEIDEQMRNALEYTPEMFTTVHMLFIHLEING
                     HPVKAFVDTGAQATIMSTKLAERTGLARLIDRRFVGEARGVGTGKIIGRIHQAQVRIE
                     TQFIPCSFTVLDTEVDLLLGLDMLKRHQALIDLGKDSLKIAGVETRFLGESEIPKAFT
                     AQAPEAHQQKTEQGPGQTLGATPGGSAPTPAAPRPSAARANRPKSHDESNIKQLTDLG
                     FSRSEAINALDQTDGNAELAASLLFG"
     gene            <550132..>551004
                     /locus_tag="ZYRO0G06886g"
                     /db_xref="GeneID:8206095"
     mRNA            <550132..>551004
                     /locus_tag="ZYRO0G06886g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498250.1"
                     /db_xref="GeneID:8206095"
     CDS             550132..551004
                     /locus_tag="ZYRO0G06886g"
                     /note="similar to uniprot|P22134 Saccharomyces cerevisiae
                     YER142C MAG1 3-methyl-adenine DNA glycosylase involved in
                     protecting DNA against alkylating agents initiates base
                     excision repair by removing damaged bases to create abasic
                     sites that are subsequently repaired"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498295.1"
                     /db_xref="GeneID:8206095"
                     /db_xref="GOA:C5DZS8"
                     /db_xref="InterPro:IPR003265"
                     /db_xref="InterPro:IPR011257"
                     /db_xref="InterPro:IPR023170"
                     /db_xref="UniProtKB/TrEMBL:C5DZS8"
                     /translation="MKRPLETDGYDENDDEKEISGGIVASVIPDEFLEKHSSEFHKAC
                     RHIMRIDKSLVEIILKGDFPLFLKDKREVDFQFYYDKLASAIISQQISGIAAKSIKKR
                     LIDYFGGKFPAFGELHDELVDPIKRQKVQACGFSARKMEYLESLTNYFCEKENSIKDL
                     FANGTDDEIVEQLTKNIKGIGPWSSKMFLLTGLSRMDVFAPDDLGIARGFSKYLSDKP
                     LLVEELKRNRVAAKRSKIKHKKLNWVIYDDDLMEKFAAQFSPYRSVLMFILWRMAATN
                     VEAMANNEKEFVSN"
     gene            complement(<551125..>552594)
                     /locus_tag="ZYRO0G06908g"
                     /db_xref="GeneID:8206096"
     mRNA            complement(<551125..>552594)
                     /locus_tag="ZYRO0G06908g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498251.1"
                     /db_xref="GeneID:8206096"
     CDS             complement(551125..552594)
                     /locus_tag="ZYRO0G06908g"
                     /note="similar to uniprot|P40086 Saccharomyces cerevisiae
                     YER141W COX15 Protein required for the hydroxylation of
                     heme O to form heme A which is an essential prosthetic
                     group for cytochrome c oxidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498296.1"
                     /db_xref="GeneID:8206096"
                     /db_xref="GOA:C5DZS9"
                     /db_xref="InterPro:IPR003780"
                     /db_xref="InterPro:IPR023754"
                     /db_xref="UniProtKB/TrEMBL:C5DZS9"
                     /translation="MLLRSVLGRIGPKFPSCRPLLANSRFNFSRNWSSLRSYSNFNAI
                     KLDSNGFSRGFFSSTRPLNSSTASQEAIPSSIQPPKRLINSSKWVGYWLIGTSGLVFG
                     IVVLGGLTRLTESGLSITEWRPVTGTLPPMSQEEWEEEFAKYKESPEFKQINSSIDLD
                     EFKFIFFMEWIHRLWGRAIGAVFVLPAAYFALARKTSARVNRRLFGLAFLLGFQGFIG
                     WWMVKSGLDQDDLDERKSKPTVSPYRLATHLGCAFLLYLGMIWTGLEVLREKNFVKDP
                     AKALETFKTLDNPLLRPLRRMSLGILALTFCTTMSGALVAGLDAGWIYNTFPKMGENW
                     IPPKRELMDANFAHKEDKSDLWWRNLLENPTTVQLNHRLFGIATFGAVFALHMYGVKK
                     KHIVPKAADRTLKAMMGLVTLQVGLGITTLLWLVPIPLASAHQAGALAVFTSAILLAA
                     QLRKPRIPMKLLINGLHMQELRKGGSKILAEAAKQPKLK"
     gene            complement(<552837..>554471)
                     /locus_tag="ZYRO0G06930g"
                     /db_xref="GeneID:8206097"
     mRNA            complement(<552837..>554471)
                     /locus_tag="ZYRO0G06930g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498252.1"
                     /db_xref="GeneID:8206097"
     CDS             complement(552837..554471)
                     /locus_tag="ZYRO0G06930g"
                     /note="similar to uniprot|P40085 Saccharomyces cerevisiae
                     YER140W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498297.1"
                     /db_xref="GeneID:8206097"
                     /db_xref="InterPro:IPR008010"
                     /db_xref="UniProtKB/TrEMBL:C5DZT0"
                     /translation="MDSRHGRQDSGTNKRSEAANKPPPIITTRSRALDRYLSLQTHIY
                     REVVHAVEENGGDDDQRAGDLEDDYELEQLLNMVRIPPSLEKFMIWTLLACSDCFLHY
                     FTITPLRVATGFIAKYWRGKNRRSSEMYNDRCMVCLILIAAFVLNSLDTSKAYHRIKR
                     QSSVKLYMLFSVLEMANKMLASMGQSLFSVLFSRKNSQRVLSKRLLMQVLCLVYLISH
                     GYVMVYQIVALNVAVNSYSNALLTLLLSMQFAEIKASLFKRIDKEGLFQISIADVVER
                     YQLVLLLLVIAIRNMIAKSKSQSSIIPNSWTLHSTSSVITGILCGPMVNVIGSELVVD
                     WVKHAYITKFNRIRPKIYDKFLLIVCKDHSTSLLKFRDRLGLPIPALVVSFVVMIRPS
                     FTQALNFSSPLRCIMATSTLAIGFAILVVFKIGLHMLLIKWGQFILDGRQLNTAVTEN
                     EYVPGFLSDGLGRVDNKSRSIIHIRDFNVEPDSPSADENICNGKNVELSGASSQNDFS
                     NDIPPGPNDLRQHKNSKNPRSLENVARYKMVSKQIW"
     gene            <554642..>555331
                     /locus_tag="ZYRO0G06952g"
                     /db_xref="GeneID:8206098"
     mRNA            <554642..>555331
                     /locus_tag="ZYRO0G06952g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498253.1"
                     /db_xref="GeneID:8206098"
     CDS             554642..555331
                     /locus_tag="ZYRO0G06952g"
                     /note="similar to uniprot|P40084 Saccharomyces cerevisiae
                     YER139C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498298.1"
                     /db_xref="GeneID:8206098"
                     /db_xref="InterPro:IPR007308"
                     /db_xref="UniProtKB/TrEMBL:C5DZT1"
                     /translation="MTTVKSVQEEILKPLQRHKQLTVKEAEEISLGLIDTLCDSYCQD
                     EATLQYLSMFFTPQLYQDLLDERNLNKWCGYPMCSRSPERIRDPFEVDDNTKRFLWEN
                     NPYAYLSIYCSKFHFRCSQFYQVQLSDESLFARTGIHLINQSSSELERLNEKYGVTLF
                     EQLLREKASEDDMKSLVAGLRRLGIKNDNDNGTEKGDDQFETDLSKWLSDIKIVEHEE
                     PELLGDLEKDG"
     gene            complement(<555376..>556491)
                     /locus_tag="ZYRO0G06974g"
                     /db_xref="GeneID:8206099"
     mRNA            complement(<555376..>556491)
                     /locus_tag="ZYRO0G06974g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498254.1"
                     /db_xref="GeneID:8206099"
     CDS             complement(555376..556491)
                     /locus_tag="ZYRO0G06974g"
                     /note="similar to uniprot|Q6Q5U4 Saccharomyces cerevisiae
                     YDR065W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498299.1"
                     /db_xref="GeneID:8206099"
                     /db_xref="GOA:C5DZT2"
                     /translation="MVQNFIHLPEHRQCVLHLYRHTLRNSKQCCHSQHLINRIKKITR
                     QTIVKHRYDKSSWSVHFYLQKLYELNHLLIQRDVKTVWNLLTDVSKSKSKSKSKKSST
                     RSSRILKALQDIHQLKQDKGLQDPQIVREKLILNNYIKREQARNHLPRFIPEEYKTKL
                     LLPLALHTVAMARLNSIHGKLVEGPPKVFLTHTTPMGHRIWFVRSAFNKKKRQSKTLG
                     ILIRREKNEGHKRWDYLRQCKSNAYWAQQEANWEQLIENKIVPQFDLNRYLDSQSIGK
                     KKIECPPQLAHWLEPIGYSIQKLNQINADKAAYFRNYKNRVLLNGGQALYFENKSITM
                     YQRRVKRFQQMVQNDLPYVVPFFPGRDLLSTLTKYRF"
     gene            558826..558898
                     /locus_tag="ZYRO0G06996r"
                     /db_xref="GeneID:8206100"
     tRNA            558826..558898
                     /locus_tag="ZYRO0G06996r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (TGC) cove score=80.16"
                     /db_xref="GeneID:8206100"
     gene            complement(<559273..>560025)
                     /locus_tag="ZYRO0G07018g"
                     /db_xref="GeneID:8206101"
     mRNA            complement(<559273..>560025)
                     /locus_tag="ZYRO0G07018g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498255.1"
                     /db_xref="GeneID:8206101"
     CDS             complement(559273..560025)
                     /locus_tag="ZYRO0G07018g"
                     /note="similar to uniprot|P13856 Saccharomyces cerevisiae
                     YGR152C RSR1 GTP-binding protein of the ras superfamily
                     required for bud site selection, morphological changes in
                     response to mating pheromone, and efficient cell fusion;
                     localized to the plasma membrane; significantly similar to
                     mammalian Rap GTPases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498300.1"
                     /db_xref="GeneID:8206101"
                     /db_xref="GOA:C5DZT3"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR020849"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZT3"
                     /translation="MRDYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTI
                     EIDNKVFDLEILDTAGVAQFTAMRELYIKSGMGFLLVYSVTDRQSLEELLDLREQVLR
                     IKDVSRVPMVLVGNKADLGDERVVSVEEGIEVSSKWGKVPFYETSALLRSNVDEVFVD
                     LVRQIMRNELEAVNNNPKGTKGRAVTPAAATNVKRGGATPVHQVKAPTSKSRPNAQHR
                     AHQRQQSKAAANGSTGKDQSSKKKQKDKCVIS"
     gene            <560215..>560796
                     /locus_tag="ZYRO0G07040g"
                     /db_xref="GeneID:8206102"
     mRNA            <560215..>560796
                     /locus_tag="ZYRO0G07040g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498256.1"
                     /db_xref="GeneID:8206102"
     CDS             560215..560796
                     /locus_tag="ZYRO0G07040g"
                     /note="similar to gnl|GLV|KLLA0C12023g Kluyveromyces
                     lactis KLLA0C12023g and some similarites with YGL105W
                     uniprot|P46672 Saccharomyces cerevisiae YGL105W ARC1
                     Protein that binds tRNA and methionyl- and glutamyl-tRNA
                     synthetases (Mes1p and Gus1p) delivering tRNA to them
                     stimulating catalysis and ensuring their localization to
                     the cytoplasm also binds quadruplex nucleic acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498301.1"
                     /db_xref="GeneID:8206102"
                     /db_xref="GOA:C5DZT4"
                     /db_xref="InterPro:IPR002547"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5DZT4"
                     /translation="MARRFLNVRSNLLTGLTIARRYHFNLVNLKVGITREVALHPHSD
                     KLYVSQIQLACNETKQVCSGLRGIIPKESFENKLVVVVDNMKKCKLRREVSEAMVLCG
                     QGSEGDVQLCRPANDSETLLGRNILLEGPGESELPPTRKIKPKEWESISSRLYVGDQN
                     VVVYRQEDGVEKRLLVDGVPIVVDDLPRGSAVR"
     gene            complement(560961..561080)
                     /locus_tag="ZYRO0G07062r"
                     /db_xref="GeneID:8206103"
     tRNA            complement(join(560961..561004,561043..561080))
                     /locus_tag="ZYRO0G07062r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8206103"
     gene            complement(<561185..>561910)
                     /locus_tag="ZYRO0G07084g"
                     /db_xref="GeneID:8206104"
     mRNA            complement(<561185..>561910)
                     /locus_tag="ZYRO0G07084g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498257.1"
                     /db_xref="GeneID:8206104"
     CDS             complement(561185..561910)
                     /locus_tag="ZYRO0G07084g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498302.1"
                     /db_xref="GeneID:8206104"
                     /db_xref="InterPro:IPR008979"
                     /db_xref="InterPro:IPR010400"
                     /db_xref="UniProtKB/TrEMBL:C5DZT5"
                     /translation="MSHHCEDEHFDHGHGHGHDHTAPIPTNPNQSLFTKIDTSKVRCL
                     NAVARGVPAHTELFRVFLKDQDEKFNCSRYLESDADCQLVVHIPFVGNCKLFSVILRT
                     SDSDDGLSSPKTIKLFKNYNRSIDFDTLGSSKADLAIQHPNNVGVTDSGVNEDENTFV
                     EHYLPRRLFQNCSSLTLFLEDNWTGDEDDLCRLYYLEIRGEFTGKIAPHGGAPMTTVY
                     ESAPNPVDHQKLESEMDEVEMGL"
     gene            <562168..>563190
                     /locus_tag="ZYRO0G07106g"
                     /db_xref="GeneID:8206105"
     mRNA            <562168..>563190
                     /locus_tag="ZYRO0G07106g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498258.1"
                     /db_xref="GeneID:8206105"
     CDS             562168..563190
                     /locus_tag="ZYRO0G07106g"
                     /note="highly similar to uniprot|P05373 Saccharomyces
                     cerevisiae YGL040C HEM2 Delta-aminolevulinate dehydratase
                     a homo-octameric enzyme catalyzes the conversion of
                     delta-aminolevulinic acid to porphobilinogen the second
                     step in the heme biosynthetic pathway localizes to both
                     the cytoplasm and nucleus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498303.1"
                     /db_xref="GeneID:8206105"
                     /db_xref="GOA:C5DZT6"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DZT6"
                     /translation="MHQAEFLDVEPSSISSILQGGYNHPLLREWQSERQLTKNMFIFP
                     LFISDDPNDDSEIDSLPNIRRFGVKKLVPYLKPLVAKGLRSVIIFGVPLKKENKDPVG
                     TAADDPEGPVIQGIKTLKREFPDLYIMCDVCLCEYTSHGHCGVLYEDGTINRERSVAR
                     LAAVAVNYAKAGAHSVAPSDMIDGRIRDIKRGLINAGLAHKTFVMSYSAKFSGNLYGP
                     FRDAACSAPSSGDRKCYQLPPGGKGLARRALKRDQEEGADGIIVKPSTFYLDIMRDAS
                     EICNDLPICAYHVSGEYAMLHAAAEKGVVDLKTIAFESHQGFLRAGARLIISYLTPEF
                     LDWLNN"
     gene            <563726..>565228
                     /locus_tag="ZYRO0G07128g"
                     /db_xref="GeneID:8206106"
     mRNA            <563726..>565228
                     /locus_tag="ZYRO0G07128g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498259.1"
                     /db_xref="GeneID:8206106"
     CDS             563726..565228
                     /locus_tag="ZYRO0G07128g"
                     /note="highly similar to uniprot|P32582 Saccharomyces
                     cerevisiae YGR155W CYS4 Cystathionine beta-synthase
                     catalyzes the synthesis of cystathionine from serine and
                     homocysteine the first committed step in cysteine
                     biosynthesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498304.1"
                     /db_xref="GeneID:8206106"
                     /db_xref="GOA:C5DZT7"
                     /db_xref="InterPro:IPR000644"
                     /db_xref="InterPro:IPR001216"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005857"
                     /db_xref="UniProtKB/TrEMBL:C5DZT7"
                     /translation="MPVDTRTDVIDLVGNTPLIELKTLPKALGIKPKVYAKLELYNPG
                     GSIKDRIAKSMIEYAESTGEIHPDRTTLIEPTSGNTGIGLALIGAIKGYRTIITLPEK
                     MSNEKVSVLKALGAEIVRTPTEAAWDSPESHIGVAQRLEKEIPGAVILDQYSNPRNPE
                     AHYYGTAKEIQEQLQHLKEFKNLRAVIAGAGTGGTITGISRYLKEQDEKIDIVGADPF
                     GSILAQPESLNKTDVSGYKVEGIGYDFVPQVLNRKEVDTWYKTDDKASFIYARQLISN
                     EGVLVGGSSGSAFSALVKYNNDHPELTEDDVLVAVFPDSIRSYLTKFVDDEWLKRNDL
                     WSDDVIARVGGKGSSKYDRKDPFHGATVQDLKLKPVVSVKESAVVADVIQILRENAFD
                     QLPVLTEDGRLTGMVTLSQLLKKLSNGSATKEDKMKSLYIDFRRLKNFDDVSSYNENK
                     TGKKKFVQFTKASKLADLNGFFERNSSAVITEGSKPIHIVTKIDLLDYLI"
     gene            complement(<565293..>565727)
                     /locus_tag="ZYRO0G07150g"
                     /db_xref="GeneID:8206107"
     mRNA            complement(<565293..>565727)
                     /locus_tag="ZYRO0G07150g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498260.1"
                     /db_xref="GeneID:8206107"
     CDS             complement(565293..565727)
                     /locus_tag="ZYRO0G07150g"
                     /note="similar to uniprot|P0C5N3 Saccharomyces cerevisiae
                     YGL041W-A Identified by expression profiling and mass
                     spectrometry"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498305.1"
                     /db_xref="GeneID:8206107"
                     /db_xref="UniProtKB/TrEMBL:C5DZT8"
                     /translation="MFRGLVFARSIAPVSLRTFQRPLVGLRPTTVSQRWYAQSWDGKQ
                     PNDQIEAHLKVQKLMDDIHKHPRVAEKLENVSKIMLDKGLANGDESKPPGPWQMVKIL
                     MDKDLKNAMAEFKQELQDSGIELGPDQLGPLMTVLGIEKKTK"
     gene            complement(<565863..>567566)
                     /locus_tag="ZYRO0G07172g"
                     /db_xref="GeneID:8206108"
     mRNA            complement(<565863..>567566)
                     /locus_tag="ZYRO0G07172g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498261.1"
                     /db_xref="GeneID:8206108"
     CDS             complement(565863..567566)
                     /locus_tag="ZYRO0G07172g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498306.1"
                     /db_xref="GeneID:8206108"
                     /db_xref="GOA:C5DZT9"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DZT9"
                     /translation="MTFEIDSTEGSTKNRIGYTVNGPRNSKDDWKDGTDHKIVVVDTN
                     NSVSDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLI
                     NYVIMGGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVA
                     SDLTALQLVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVA
                     VIIFFIMAIIANCGHNQQHEYIGFKNWSHGDAPFVQGFKGFVTIFVTSSFSYGGTETV
                     TLTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKSVLTSPFT
                     IVFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNR
                     NKAPYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKG
                     LEAQGKVHELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDPWSTSSFFSFYLELIVF
                     PACWIFWWVIKRDRFKKAKDMDFITDKYVQSEEESLLNERLDNLKGLPRVRQAISDYF
                     L"
     gene            complement(<567844..>568740)
                     /locus_tag="ZYRO0G07194g"
                     /db_xref="GeneID:8206109"
     mRNA            complement(<567844..>568740)
                     /locus_tag="ZYRO0G07194g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498262.1"
                     /db_xref="GeneID:8206109"
     CDS             complement(567844..568740)
                     /locus_tag="ZYRO0G07194g"
                     /note="highly similar to gnl|GLV|CAGL0D06160g Candida
                     glabrata CAGL0D06160g and similar to uniprot|P07273
                     YGL043W Saccharomyces cerevisiae DST1 General
                     transcription elongation factor TFIIS"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498307.1"
                     /db_xref="GeneID:8206109"
                     /db_xref="GOA:C5DZU0"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR003618"
                     /db_xref="InterPro:IPR006289"
                     /db_xref="InterPro:IPR016492"
                     /db_xref="InterPro:IPR017923"
                     /db_xref="UniProtKB/TrEMBL:C5DZU0"
                     /translation="MDSREVSTHVKNLEKFKTNDETVLDILKALEKEVVPTEKLLRET
                     KVGVEVNKFKKSQNAEIVKLVKRMISSWKETINKSKKAKIQPQSQQQQPSTSQNPSTQ
                     QLSPTEPRKQDKFVSSKPRNSKNDGVDTNIYNHKLRDMVIRALYDALAKESEHPPSSV
                     LDSAKSIEEEMNKLNNCDENEKAYKDKYRIIYSNIISKNNPDLKHKITNGDVTSQYLV
                     SCDPKELAPEHLKKKLEEIAKQNLHNAQGATIQRSITDRFTCGKCKEKKVSYYQLQTR
                     SADEPLTTFCTCEACGNRWKFS"
     gene            <568877..>569692
                     /locus_tag="ZYRO0G07216g"
                     /db_xref="GeneID:8206110"
     mRNA            <568877..>569692
                     /locus_tag="ZYRO0G07216g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498263.1"
                     /db_xref="GeneID:8206110"
     CDS             568877..569692
                     /locus_tag="ZYRO0G07216g"
                     /note="similar to uniprot|P25299 Saccharomyces cerevisiae
                     YGL044C RNA15 Cleavage and polyadenylation factor I (CF I)
                     component involved in cleavage and polyadenylation of mRNA
                     3' ends interacts with the A-rich polyadenylation signal
                     in complex with Rna14p and Hrp1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498308.1"
                     /db_xref="GeneID:8206110"
                     /db_xref="GOA:C5DZU1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR026896"
                     /db_xref="UniProtKB/TrEMBL:C5DZU1"
                     /translation="MNRTSGGQHLPSRVVYLGSIPYDQTEEQILDLCSNVGPVNNLKM
                     MFDPQTGKSKGYAFVEYKDLESSASAVRNLNGYQFGSRLLKCGYATGTDMENNDNNNN
                     SNNNNNNSNNMEDGTSLKFARLPAGIDVNINMTTPAMMISSELAKRNAEEQLGLLRNF
                     QDWTRRNPEDAVELLRECPQLSFVIAEILLTNGISNVDDLTQLAVQRNDTPETGANGT
                     DAPQDPNIQSRQRELLRQVLQLSDSEIAVLPDDEKMSLWDLKQRATRGEFGLI"
     gene            <569912..>571189
                     /locus_tag="ZYRO0G07238g"
                     /db_xref="GeneID:8206111"
     mRNA            <569912..>571189
                     /locus_tag="ZYRO0G07238g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498264.1"
                     /db_xref="GeneID:8206111"
     CDS             569912..571189
                     /locus_tag="ZYRO0G07238g"
                     /note="some similarities with uniprot|P39927 Saccharomyces
                     cerevisiae YGR156W PTI1 Pta1p Interacting protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498309.1"
                     /db_xref="GeneID:8206111"
                     /db_xref="InterPro:IPR025742"
                     /db_xref="UniProtKB/TrEMBL:C5DZU2"
                     /translation="MSDPRRRTSRHVLTPDSLSSAIQLTNMPADWSQDTASSVVAGSG
                     PIVDITTKTDPRTGRLSAAIFDYKTSKDCRRAFEILSRIDSLPCNLERIIPQNYKNHA
                     SMASKDELQLNRDSFPWNCGLDLPFEMISEVPLPRKPSQTPAPPVANNNSNTNGNSSN
                     NKSPTNNNIAFPDILRKASQHLPQLQPNILSTPDPVSSNLSKIPPLQLIEIISNLKIL
                     ANQDSMKRSQLEAFLKTNLNISISVTQALLEMGFINYNAVTQVLKRQQGGNGFSSSVN
                     SSSNTPLNTNIPMPMPMPMPPFVPPQQPLPPPPQQQQQQPGQGPPPPFGFMPPPIPFM
                     PPTPVMGTTPPPMMPMQQMPPAPAPAPPAPVPIPPVPTPSQRRINMAKLQALPQNQRD
                     MIKQVLSFTDEQIRVLPQDQKSLVENLKKEYIL"
     gene            <571506..>574019
                     /locus_tag="ZYRO0G07260g"
                     /db_xref="GeneID:8206112"
     mRNA            <571506..>574019
                     /locus_tag="ZYRO0G07260g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498265.1"
                     /db_xref="GeneID:8206112"
     CDS             571506..574019
                     /locus_tag="ZYRO0G07260g"
                     /note="similar to uniprot|P05374 Saccharomyces cerevisiae
                     YGR157W CHO2 First step in the methylation pathway for
                     phosphatidylcholine biosynthesis Phosphatidyl-ethanolamine
                     N-methyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498310.1"
                     /db_xref="GeneID:8206112"
                     /db_xref="GOA:C5DZU3"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR016219"
                     /translation="MASDVVARTRSSGVTFTPPTTHDMVRSLFDPTVRKSFLEICITL
                     ALLSDFVFCYWGLQRFGLTSMKKAFLAQYLFWRLCYNLGIGVALHLQSRYETWTNYAK
                     RNHVFTKGNHTPLARFCQFELKTKMSEGYDMYSQPEELNVWLLFRQFVDLILMQDFCT
                     YMIYVYLSLPAQWSAMLNWRTGLGVSMILFNIWVKVDAHRVVKDYAWYWGDFFFLQES
                     ELVFDGVFNISPHPMYSIGYMGYYGLSLICGNYHVLLVSISGHLLQFLFLKYVESPHM
                     EITYGSESSDDNSQINSCIDDLIATKNYDYSRPLINSGFWVNNFDKLRFTDYFTVGTS
                     LALICWLFLERPSVKLLFNLTFFTKFVTSIVVCSILYLQSSQKWFTKLYLKNGYTQVY
                     SYQQWQFIYNFSSCLTYTLLFIQTLAKLFDDNTYIEYTQFIFGLLLCAVQTWCNAEIR
                     SAISDFGWFYGDFFLSNYIPTKSLTSHGIYRYLNNPETILGVAGVWGTVLMTDFSWEN
                     IALACLWSGCNFIIVKFIEQPHMAKLYGDNTRVGGIEKTLQGLGPWRRMSELMDRVEN
                     VITKSLTNQQEPFDKGLEKPRKDIKSVNNHLRVRTNSQEWEEAVEDAIGNVTSKLYPD
                     CKFEIEDLGEKSFILPRPITIRWQVPIELFDEDAWIGLYNIIQTRSNSKTTKVSSSGH
                     WSAVSPNAYKGYESNNLAVTEFEKNDTVACGKVTFDSSLLHFKPGIYEFRYHAGNSHN
                     VLCTSKPFELLLPNLDMETPEILNKQLLQLLTSVSAVKNGKFDSHGNRYFTTRIFQRL
                     VKDSLGVELSTDYINRVNGDIGAISQRICHIKKVLDDLE"
     gene            complement(<574134..>574862)
                     /locus_tag="ZYRO0G07282g"
                     /db_xref="GeneID:8206113"
     mRNA            complement(<574134..>574862)
                     /locus_tag="ZYRO0G07282g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498266.1"
                     /db_xref="GeneID:8206113"
     CDS             complement(574134..574862)
                     /locus_tag="ZYRO0G07282g"
                     /note="similar to uniprot|P48240 Saccharomyces cerevisiae
                     YGR158C MTR3 3'5' exoribonuclease exosome subunit
                     nucleolar protein involved in export of mRNA and ribosomal
                     subunits homologous to the E. coli exonuclease RNase PH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498311.1"
                     /db_xref="GeneID:8206113"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DZU4"
                     /translation="MNVQDRRRLLGPANAKPIAFSVPPKDVEESSKEIGNEHLISMHT
                     GLIENCNGSSLVEVKDTSVLLHQSSLITSVYGPRALRGSFTSNASLSIQLENGSLEKY
                     SNSQLKEVSNFLTGIFNSVVNRSRYPKSGIDIFLYLTYDKDLNSDESKMGHLSSIIPY
                     CITGITLALVDAGIEVLDMASAGVHDGNVFAFLKNGQEVAGFWKDDGKCENIMESLEP
                     CRKEYFSYRELMVRHLMEKQASKV"
     gene            complement(<575051..>576700)
                     /locus_tag="ZYRO0G07304g"
                     /db_xref="GeneID:8206114"
     mRNA            complement(<575051..>576700)
                     /locus_tag="ZYRO0G07304g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498267.1"
                     /db_xref="GeneID:8206114"
     CDS             complement(575051..576700)
                     /locus_tag="ZYRO0G07304g"
                     /note="similar to uniprot|P53180 Saccharomyces cerevisiae
                     YGL045W RIM8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498312.1"
                     /db_xref="GeneID:8206114"
                     /db_xref="InterPro:IPR011021"
                     /db_xref="InterPro:IPR011022"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DZU5"
                     /translation="MSFLGLFKKDVHHSSSYGKKSSHIVPGGILQKNLVREFYIRLDD
                     PHRIWKPDEYISGETVLNIKKDVTNVAVRLKLVSQVKVKSSVGGTTLRTKVTDKLLEK
                     TTFLYGNESDCQLGAQKDATNGLTQGEHIFPFKLKIPNGKKVFSSIKFERGSITYYLQ
                     CSLEAMGRGQVERPVSRCMHPFLVMVPLDVSNLPEPKTKTVVLQSTSPVRPSNNIGFD
                     NGSSNTKNTGNSNTSNNTNNSASSVSDKTVRISVDLSKAGYCIGEVIPVRVSLQHYKN
                     FCHPAGLIVTLARICRVGSGGNDEPMETFRKDICQTIRPIYVDPETHACSVTAYLKVP
                     VDTFSTFTSLQKFFTFQYYVEVMINLSQKNIILTESNRVVAGLHDGVKPGSSESLSGL
                     EESLVGGMPRRLMSMVSKSGSLNEENFDESNIIYKDMVNVERLKRMNNVTGMSIETVI
                     GMTRSEQSSPVLAEQSLQPVQIQPVQQPLPIAQSDLSPPFSDSQFLYSKPLIDEWLAP
                     LDAYPPVPEYTPNNDIKIIEDKRELEQEKLKQLESDPPDIY"
     gene            complement(<577044..>578450)
                     /locus_tag="ZYRO0G07326g"
                     /db_xref="GeneID:8206115"
     mRNA            complement(<577044..>578450)
                     /locus_tag="ZYRO0G07326g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498268.1"
                     /db_xref="GeneID:8206115"
     CDS             complement(577044..578450)
                     /locus_tag="ZYRO0G07326g"
                     /note="some similarities with uniprot|P27476 Saccharomyces
                     cerevisiae YGR159C NSR1 Nucleolar protein that binds
                     nuclear localization sequences required for pre-rRNA
                     processing and ribosome biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498313.1"
                     /db_xref="GeneID:8206115"
                     /db_xref="GOA:C5DZU6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DZU6"
                     /translation="MASTSKASKKELKQKELKQKEEAKAAKAAKASKPSKSAKAAKTS
                     KSTKSAKAAKVESESSDSSSGSDSDSESSSDDEDDKKSSSSSSSDESSSDDESEEEKS
                     KKKTSKKEESSSESDSDSDSESSSDESEEDKKESKKESSSDESSSDESEEDKKESKKE
                     SSSDESSSDEEEDKKDSKKDSSSDESSSESSSDEEDSKSSSSSSSEEASKPSKRKAEV
                     DEEQEESSKKAKLSGEPATIFVGRLSWNIDDQWLKNEFEHIGGVQSARVIYERGSTRS
                     RGYGYVDFTDKSYAEKAVKEMHGKELDGRPINCDMSTSKPTVNPREDRAKRFGDMPSE
                     PSDTLFLGNLSFNADRDQIYELFSPHGEVISVRIPTHPETEQPKGFGYVQYASVDSAQ
                     KALETLQGEYIDNRPVRLDFSTPKTGNGGGNRGAPRGGARGGGNRGGFRTGSGANSAP
                     LGKGKNSAPFKGSKKTFD"
     gene            complement(<578705..>579880)
                     /locus_tag="ZYRO0G07348g"
                     /db_xref="GeneID:8206116"
     mRNA            complement(<578705..>579880)
                     /locus_tag="ZYRO0G07348g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498269.1"
                     /db_xref="GeneID:8206116"
     CDS             complement(578705..579880)
                     /locus_tag="ZYRO0G07348g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498314.1"
                     /db_xref="GeneID:8206116"
                     /db_xref="UniProtKB/TrEMBL:C5DZU7"
                     /translation="MFKIAILLLLLNQVWATKTLSTTDISTSTVCPCSAARCTECEQN
                     TSGGTVTQSASTVTITTNDIESASTITKDITTTTNITASGSTITEVSTVTVTASDTVS
                     ALTVTANGTTQDASTVTITASGTAPAVPASTITKEASTVTVTANSTVPAFHQEASTVT
                     ITANETAHPSTVTVTTNCTASTISQDASTVTLTANSTAPASTLDASTVTVTTNVTGPP
                     STITVTASGSLTIHVSEAPSTVVVTANGTASAFTVTETSTVTGTHTVPSSNATSTIAA
                     AFQGPTPSTVFQTSTMTVDGTFARSTPTAATPAPYTVTKTITAPCTASAGSVISELAT
                     TTTTEVSKDSSLAATSHMTPSSGSTAPSAPPIASYSAAAQINRFPMLLGILPMIAVL"
     gene            complement(<580202..>580774)
                     /locus_tag="ZYRO0G07370g"
                     /db_xref="GeneID:8206117"
     mRNA            complement(<580202..>580774)
                     /locus_tag="ZYRO0G07370g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498270.1"
                     /db_xref="GeneID:8206117"
     CDS             complement(580202..580774)
                     /locus_tag="ZYRO0G07370g"
                     /note="some similarities with uniprot|P53289 Saccharomyces
                     cerevisiae YGR161C RTS3 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498315.1"
                     /db_xref="GeneID:8206117"
                     /db_xref="UniProtKB/TrEMBL:C5DZU8"
                     /translation="MSLSMEKKHLQPVLRSPHNNRKLSCEEIIDEMEKEQDAAVVRLL
                     REVDRLKAENLQLRKQIHSNSFASSNGSGSGSSRQSSQFSNESPLGVDSEYHYMLPSH
                     RSSLARGTSLQGASTFHPIDTSIPTQTVQRKRGASITSPRTSMLSVDSSPVCNGEVVD
                     PLHDVPRPWSGAGGGSPAEAARRWQEYRIR"
     gene            complement(<581554..>583671)
                     /locus_tag="ZYRO0G07392g"
                     /db_xref="GeneID:8206118"
     mRNA            complement(<581554..>583671)
                     /locus_tag="ZYRO0G07392g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498271.1"
                     /db_xref="GeneID:8206118"
     CDS             complement(581554..583671)
                     /locus_tag="ZYRO0G07392g"
                     /note="similar to uniprot|P53746 Saccharomyces cerevisiae
                     YNR060W FRE4 Ferric reductase reduces a specific subset of
                     siderophore-bound iron prior to uptake by transporters
                     expression induced by low iron levels"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498316.1"
                     /db_xref="GeneID:8206118"
                     /db_xref="GOA:C5DZU9"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="UniProtKB/TrEMBL:C5DZU9"
                     /translation="MMVLLSAMVFMWSISAALSLQHSAWERVSVLSCAINLTQIPWNF
                     ESEPGFYNKLCDYEPAFGSWSHCIHEQLLDVANESTFVKSLDYINQLCSLVDGDDRHG
                     VTLEKYYSSLHNASHYMRPVPSDPKFKAWYPVEIDSATRRQLNSAYYSFLINLDNSDK
                     YALWLIWYFIIIMGVAALLMIPGVKPWLFKFTTVNKIRGDFILPTLTQTHAAYLPYKW
                     ATGLVPTKFESLLVLGFFLLHGFLLFYNYKIDPYNMIFKSHQLQWLRQVADRSGILSF
                     AHFPLIVVFSTRNSILEHLTGFKYTTSIVLHKWVGRSMVIDAFIHGIAYILYAQETES
                     IESLSQQDFWKIGVLAAYVAIFLCIFSMGFLRRSYYETFLYLHIVLALFFFYCCWAHV
                     KRFGWEKWIHVSIAFWILERLLRLKSILRFGIASAKLELVGPDLFKVLVPRPANWSCQ
                     PAQYVFLYFLQPACICWQSHPFTFIDLGQEVLIVIRAKQGATQRVLTDLIHKGGRSQL
                     KVLIEGPYGASSPLPRFQDTLLLCGGSGVPGPLAYALNMAQPLASAPQRQNLHIVIVN
                     RGVDILEAYMDPILRLKHLNVDLQIHITGSQTKQLTSGTPQQYGSTAVANPGWGSASK
                     IQNLQEVISSARIHYGRPNVSEVIANIAGESRSLAICCCGPPAFVDLTRNYVAETIGT
                     SVRNNRRNNNSSMIEYFEEYQTW"
     gene            complement(<583978..>586101)
                     /locus_tag="ZYRO0G07414g"
                     /db_xref="GeneID:8206119"
     mRNA            complement(<583978..>586101)
                     /locus_tag="ZYRO0G07414g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498272.1"
                     /db_xref="GeneID:8206119"
     CDS             complement(583978..586101)
                     /locus_tag="ZYRO0G07414g"
                     /note="similar to uniprot|P38731 Saccharomyces cerevisiae
                     YHL040C ARN1 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to
                     ferrirubin ferrirhodin and related siderophores"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498317.1"
                     /db_xref="GeneID:8206119"
                     /db_xref="GOA:C5DZV0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DZV0"
                     /translation="MENRSNSKISEPRFERQEVHVTDKEYNDVPPEFENVKYGQNAHQ
                     EVMPVDSDGEKQKLRPSLNMHGLPDKLHVSKWLVIRQSELLAAEYDWWPFRILLLFCA
                     FICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAVISAASQIVYARLADVFGR
                     LTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVVLVLLLILSDFSSLKWR
                     LFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAFIFPLSCVPLICCMLHMWW
                     KARRTEEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSLGCILVPLTLAGG
                     TSSKWDDSQIIGPLVLGVVLLPMLIVYELKWAREPILPWKLIKDRAVWASMSISFLYD
                     FIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFALYITRVTRLKPYII
                     AGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVSVQSATSHENMA
                     TVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYEQPYNFIAEYT
                     WGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIAHNDLGEGEYI
                     ARDKDYIFDWIEDKCRKFVPGLHPKGRHPSFASQEAQEETRSIEEGQVPDDSSDVVME
                     SGESNFKKLQGEFHSRRVSSHEQNI"
     gene            <587527..>589464
                     /locus_tag="ZYRO0G07436g"
                     /db_xref="GeneID:8206120"
     mRNA            <587527..>589464
                     /locus_tag="ZYRO0G07436g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498273.1"
                     /db_xref="GeneID:8206120"
     CDS             587527..589464
                     /locus_tag="ZYRO0G07436g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498318.1"
                     /db_xref="GeneID:8206120"
                     /db_xref="GOA:C5DZV1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DZV1"
                     /translation="MILSRVITLGAIAATGAAFSQDYKADANEAFNELVPSNNQTAID
                     QLIHELREVSINDSRCQACLNRLEVGKKWAQENPGVIPVAWPQWCVRYKAGSPDSCTR
                     NFARTTVERNAEGSNFVDMLTLIDPHGYDGQLYCQYLEEDSCPKPPTPNSSLSHLWPP
                     KQPKHHVAPEPGNETFNVLHISDFHVELDYTVGAESNCSATMCCTPHSQGKGGGGYLY
                     KGHWNSFYKDAHYENEFTYVKGAYYNVFQNSSISAPAPTFGHYHCDAPEILVNSSINS
                     VVDYGKKHNLSFEFAMFTGDLIDHDEQAWMNFDKSLASEEAGFRDLKSRLGDMPVYST
                     LGNHDSYPYGEIAQEGHGFSNKYTWNNDLMAEMWKDYGWINETTSQFVRTHYTGFAVD
                     TKVGLRIVSLNSNCYYRKNHYAFWNATDPDGFGMWSFLISELVDAESKGQRVWIMTHI
                     PPIVDGLPLPSKIFYEIIERFSPYTIAGVFFGHTHLDQFNILYAGNNTKTIENVINHA
                     WISQAVTPWFNNNPSWRWYEIDKETFSVMNAYNYYAKLNETFDNEGKEPEWLFEYSCR
                     DGYGIDWPKTSPLNGTYWHLVSEKIRDSVEYRQIYENYATRFSPYVPDCSQNGKCLSD
                     YCTLSSFQVDDYDNCVSQLHT"
     gene            complement(<589686..>591635)
                     /locus_tag="ZYRO0G07458g"
                     /db_xref="GeneID:8206121"
     mRNA            complement(<589686..>591635)
                     /locus_tag="ZYRO0G07458g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498274.1"
                     /db_xref="GeneID:8206121"
     CDS             complement(589686..591635)
                     /locus_tag="ZYRO0G07458g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498319.1"
                     /db_xref="GeneID:8206121"
                     /db_xref="GOA:C5DZV2"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:C5DZV2"
                     /translation="MDESMGGTLEYRRDNKRHAKAWSLVIALMMVCSTLILYKFFSIQ
                     CDDYMSSIRMSFSDKSAQKHDGDEIDTGNAWRLDTASNYSIDLDYWLKQEEPMERHYY
                     FNVSTVQEVHPDGVSRTLTVINGQYPGPLVEASSGDTVVIHVENHMDGDPLTIHCHGL
                     LMKDQAFNDGSSWINQCPIPAAGSYEYRIKLDDDQYGTYWYHSHYSTQYADGVFGPLV
                     IHSKKEYEDLDFSYDKELVVMVNDYYHDTSYSYMSTYMGSGNENTEPVPDNGLIQGQN
                     HFEYVDSQYLVPHGAEKKRFAHEVPHTVLDLDPNSIYRVRVINAGFFLPFEFGLEGHM
                     LKVIEADGTLVEPIQVESLTLSVAQRYSFVLLPQDPDFNKKNYWMHAHFNQFCTKEEN
                     PNFNMDVKAIVNYNDNSNSVEKTSWTYNGGDVLCRDFDQSKLKTLNKKVPSAHSDSNL
                     PDVRVDIDILWMIGAYQMARGYLNDKTYLPLQNGSTMYQLGFAPGANTVKDWNDNQLL
                     TFSDNQYMINLNQRGQVVDLVINNYDDGAHPFHLHGHKFWVLAIGDSGYFQDEYYDTN
                     DDEQAMNFDNPIFRDTVNIPGFGWAVIRFVVDNPGVWPFHCHIGWHMEAGLLLQINAL
                     QEEYASWNHYPQNWYSQCQYWQDKL"
     gene            <592050..>593285
                     /locus_tag="ZYRO0G07480g"
                     /db_xref="GeneID:8206122"
     mRNA            <592050..>593285
                     /locus_tag="ZYRO0G07480g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498275.1"
                     /db_xref="GeneID:8206122"
     CDS             592050..593285
                     /locus_tag="ZYRO0G07480g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498320.1"
                     /db_xref="GeneID:8206122"
                     /db_xref="GOA:C5DZV3"
                     /db_xref="InterPro:IPR007312"
                     /db_xref="UniProtKB/TrEMBL:C5DZV3"
                     /translation="MQFQFSALAFVALFLFPLGHCATRSFSSYNPDPTDVAKNAATAN
                     TTQLTWNVRGRAIDRFVVIWLENTDYNKAAGHPDMKWLAKRGITLDNYWALTHPSQPN
                     YVASVGGDYFALDHDEYVTVPKNVSTIADLLDSKGISWGEYLEDMPYSGYQGFEYLNQ
                     KTQANDYVRKHNPLISYESVFLNETRLSLIKNFSQFERDLKDHKLPQYFHITPNMTND
                     GHDSSIKTAAHWARSWLTPLLKNKHFMKNTLVLLTFDENEIYSTQNQVFTILLGGAVP
                     DHLKGTKDHTFYDHYSLLSSVEANWDLDNLGRNDVNANVFSTIANKTNITNRFVNTTY
                     MVNNHTYNGYFLNSSISLPAPNITAINRNGKPVLQKIKDTWKDVYSSQLSHSYFTPTT
                     TTVSARLTNLATVSASVSS"
     gene            <593385..>595073
                     /locus_tag="ZYRO0G07502g"
                     /db_xref="GeneID:8206123"
     mRNA            <593385..>595073
                     /locus_tag="ZYRO0G07502g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498276.1"
                     /db_xref="GeneID:8206123"
     CDS             593385..595073
                     /locus_tag="ZYRO0G07502g"
                     /note="similar to uniprot|P38732 Saccharomyces cerevisiae
                     YHL039W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498321.1"
                     /db_xref="GeneID:8206123"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="UniProtKB/TrEMBL:C5DZV4"
                     /translation="MGKLEDCIQWAVKNGSIVDERIHFKQSSISGISAVVEGILATEE
                     PLIQIPSKLLITNEKAQESFQVDSDVIDKNAPNALVQLYVAKLKFAKGMPSIYQPYID
                     LLPLKLEQPYFWDWKELQVIKGTDLYLVMKQRLPKLLEEWTTLLKKLSLEPSDDLGQL
                     ETPGLDLVDYVARYRETNEQLPWNSFAAYVWSAGIFASRAFPKIALNDQCLSINEAFL
                     YPIVDFLNHKNDTKVKWCFQDGKMCFVSKESLKSGEELFNNYGDKSNEELLLNYGFVQ
                     DNNQYDDARLTLRLDSQLLDGAEQLGIPLSQERVTDNSVQFKLNKKELLPHNLVKLFA
                     LVHKLKSEDGINLRNSLEGIDSLQSILMQKVEFFRQKTRIDASASRKLQILRKYFDQQ
                     RRLFQLSIENGQKLQKELIKSNSEFLISFKTIFKNDKQFANSLLLTFGVAKFEDLITK
                     DCMNQILLLWIVRVANKNEYAKKLPFEIPQFIYDTFQEVSSTIVIEKEDVLQMMGFYQ
                     AMFPAMSEKIPEIYGQGNWRIRQFIVADTVMDRLVWTRKLTQEPFFVKKQRIAF"
     gene            complement(<595175..>595690)
                     /locus_tag="ZYRO0G07524g"
                     /db_xref="GeneID:8206124"
     mRNA            complement(join(<595175..595592,595677..>595690))
                     /locus_tag="ZYRO0G07524g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498277.1"
                     /db_xref="GeneID:8206124"
     CDS             complement(join(595175..595592,595677..595690))
                     /locus_tag="ZYRO0G07524g"
                     /note="uniprot|Q9HF97 Zygosaccharomyces rouxii cof1
                     Cofilin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498322.1"
                     /db_xref="GeneID:8206124"
                     /db_xref="GOA:C5DZV5"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR017904"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DZV5"
                     /translation="MSRSGVSVADESLQAFNDLKLGKKYKFVLYGISEDKTTIVVKET
                     STSQSYDEFLGKLSENDCLYAIYDFEYEIGGNEGKRSKIVFFTWSPDTAPVRSKMVYA
                     SSKDALRRALTGVSADIQGTDFSEVSYETVLERVSKGAGSH"
     gene            <595928..>596425
                     /locus_tag="ZYRO0G07546g"
                     /db_xref="GeneID:8206125"
     mRNA            <595928..>596425
                     /locus_tag="ZYRO0G07546g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498278.1"
                     /db_xref="GeneID:8206125"
     CDS             595928..596425
                     /locus_tag="ZYRO0G07546g"
                     /note="weakly similar to uniprot|Q07887 Saccharomyces
                     cerevisiae YLL049W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498323.1"
                     /db_xref="GeneID:8206125"
                     /db_xref="UniProtKB/TrEMBL:C5DZV6"
                     /translation="MSSVQDTIESFESRLQRLEDALGDAGGVDLYGLVSLLSFEVRSM
                     FYQGQDYSEQLMGLLDGFSGNETVDEFEKKSRVLMSCYDGLTKSLRWLDQLESFMSKL
                     GTKMETGSGAPVELNAVMELPALMNKCHVLLVRSILVAKRFMEMNLRFNEFWLKIDQK
                     LGGPS"
     gene            complement(<596422..>598317)
                     /locus_tag="ZYRO0G07568g"
                     /db_xref="GeneID:8206126"
     mRNA            complement(<596422..>598317)
                     /locus_tag="ZYRO0G07568g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498279.1"
                     /db_xref="GeneID:8206126"
     CDS             complement(596422..598317)
                     /locus_tag="ZYRO0G07568g"
                     /note="weakly similar to uniprot|P03874 Saccharomyces
                     cerevisiae YHL038C CBP2 Protein required for splicing of
                     COB aI5 intron Cytochrome B pre-mRNA processing protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498324.1"
                     /db_xref="GeneID:8206126"
                     /db_xref="UniProtKB/TrEMBL:C5DZV7"
                     /translation="MVDTNLKFWSTLVFAAFKRRPENPVFGYKRNVIKMRNAHGKRIE
                     SLLKKPDLHVVDLELDGTLETAHVSRIRELLLKDARAPTDSTLRIFRNGKVPKQGQKQ
                     EISDWKYSSLLFKNALNPKYGLPLSKLNAHEDFLMNKTILLESESGEEKLDRILWPSA
                     VFSHSCRGIGIPTETYRQYREKYGTDDKIPKLVNPLPGDPFLKLYPVDFVPSDFQAVG
                     LFPNYVETHKNVFKGFDLFGALVKSRLCTESEIKLINQRVITKEKPSSYTPSSDIDLK
                     GVDVQDHRDSNNLQVETNLNNLNKWTKVSKDYQSFWSARGIPNKIIPADILRCLFLTK
                     DITISQMKEEFCKHYILFSIFSQAWRIDRKFNNKDPNFSESSLDVPWRPWDLYILKRS
                     QEISAIPIPTTLEEFSDVKLQFDQFLSEFFSYYALIVSEMKAETDSFFQPTESHLPRM
                     VPVKQVLRNILLENQWVQTLYPNLHTHMKNRFQWIHSSNYLAVPTTTEMDEKTRQSNE
                     KLLTIVRIISELESESRQNQLGERGGIYVDLKTPASNWKIVIVNNSLTDPEVRRLLKF
                     NSDLGLQFTQNLEYSRNEDGWSCQKKKMLDPDTYIYLYHNEKHLESNKDLIDDIIDRF
                     DQQADKN"
     gene            <599222..>600853
                     /locus_tag="ZYRO0G07590g"
                     /db_xref="GeneID:8206127"
     mRNA            <599222..>600853
                     /locus_tag="ZYRO0G07590g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498280.1"
                     /db_xref="GeneID:8206127"
     CDS             599222..600853
                     /locus_tag="ZYRO0G07590g"
                     /note="similar to uniprot|P38734 Saccharomyces cerevisiae
                     YHL036W MUP3 Low affinity methionine permease, similar to
                     Mup1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498325.1"
                     /db_xref="GeneID:8206127"
                     /db_xref="GOA:C5DZV8"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C5DZV8"
                     /translation="MSREQETGLLLDDNSIDNVPRKDVDPQQSFLNDLETSLTDIAED
                     PFVEVPQGRHLGVFSTMVLFVARIVGSGIFATPSSIYVNCGGNTGIYFGVWTLAGLVS
                     FAGLFVFLEYGSWLPRSGGRKNFLEQTYTRPELMMSVTFVCFTIFTGFAMSNAIVFGK
                     YFLYVLGFSDPSTGVQSNASKYVSIIVISVAMLVHGCSVRTGVRIQNFLGGIKFGLIG
                     LMCLIGLYSFFYHVPEGKESPSLKSNSVFAFQNKSEVSLASLASAFLNAFFCFSGWDS
                     VHSVASEVKNPTYTLKVGGTASLLICFTCYSMMNLAYVNVLSYEEIKQAGPLVGSVLF
                     TKLFGKFLGSKLLSLSVAVSTLSNLLVVIYGLSRMNQESFREGYLPFSKQLASNWPWG
                     SPLPSILVCGGFTIIWLAALPPENSSFDYLVSMEGYGNQFFLLLIAVGLFIHRRRHKG
                     QQPSTRASTLGTILMIIVSGYTLITPFIGDQNRNMIGFLPPYQITSILIIGACFFFWL
                     VTFVILPRTFHYELEPNISYLADGLAVTEWKKKII"
     gene            complement(<601181..>606268)
                     /locus_tag="ZYRO0G07612g"
                     /db_xref="GeneID:8206128"
     mRNA            complement(<601181..>606268)
                     /locus_tag="ZYRO0G07612g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498281.1"
                     /db_xref="GeneID:8206128"
     CDS             complement(601181..606268)
                     /locus_tag="ZYRO0G07612g"
                     /note="similar to uniprot|P32386 Saccharomyces cerevisiae
                     YLL048C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498326.1"
                     /db_xref="GeneID:8206128"
                     /db_xref="GOA:C5DZV9"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZV9"
                     /translation="MLQQWLQWWLQQLEDRTTHFYLPAYIYTSMLSAYFKISGCFDTF
                     FKGSKIKVNTLMLLTKDNSCPFWVFDDVTQCGRARYINYYFPLFVLVSGLLYWTYNIL
                     THHYKYDKLKLKQRDVNDLMLIDGEDDENKPLLQESPSPSSYNGNEVDGEELKERHFS
                     LQRLKLVKPNGEPHGKPELVRRGFIEKSRTIFELLLVLSQFAVHFGIWLNHTEDDSEF
                     TSRSSIVQVIVWGFLVTLVTLRLWNINQSARWVNRYCGNIWSISFTSYMFMFFTTVLP
                     FRSIFIGHIEEKSVKNYYLSQFYLDLALFALLFLSPSGNKLAVVYKTDEQITPSPEPV
                     SSIASFITWSWLDKFVWQAHKSVIEKKDIWGLRMDDYAIFVIKRFKQYVERKGKEKSF
                     TYNLLTFFTKYLLLQGFWALLDSMMSFAPTILLKRILEYVDDRESAPGNLAWFYVCCM
                     FFCRVFCAIFSGQALFFGRRVCIKMKAIIISEIYTKALRRQVAVNSNKQSTDEVDPQE
                     LNEEEHRDGDEESGTSANLGAIINLMAVDAFKVSEICAYLHAFVEAVAMSCVAIVLLY
                     KLLGLSAIIGALLIVVLMPVNFRLVTWLGQLQKKSLSYTDKRIQNLNEAFQAIRIIKF
                     FSWEDNFEKGIQAIRDVELKLLLQRSLIWALCSFVWYATPTIVTTSAFAFYIYVQKQT
                     LTTPVAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRIQEFLEEPDTDKYNQLSVA
                     PGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEM
                     KLLNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFNSPYSEARY
                     NDVIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCL
                     SAVDSHTASWIYDNCITGPLMQGRTCILISHNIALTLRNAELVVLLENGQVKEQGDPL
                     TLLHKGHLGEDELVKSSIMSRNNSSVNVKTKSSTSVQNLAKTSKESTKPQQTDEERKK
                     AGKLVKDETKAEGVVGLEVYKWYLKIFGGWKTLSFLVSAFVFAQGMYIGQSWWVRDWA
                     SHNMNSTIFAFRENLVSAGFHTFGRVDAFVHYVAELPNRVAVATGAEPVGPHSMFYYL
                     AIYFLIGFAQSVLSAFKTILSFVAGLNASKKIFNLLLQKVLHAKLRFFDSTPIGRIMN
                     RFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFITPQFLIVAVIVAVLYYFIGYF
                     YLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDESRFIQENLHKIDENNRPFF
                     YLWVANRWLAMRIDLIGSLVVFGAGVFILLNIDHIDAGMAGISLTYAITFTEGALWLV
                     RLYSNVEMNMNSVERLKEYMVVEQEPYNQPIMTPPSDWPQHGRVEMSDVSLRYAPGLP
                     RVIKNVSFTVEPKSKVGVVGRTGAGKSTIITALFRFLDPETGHIKIDNVDISLIDLQM
                     LRRSITIIPQDPTLFTGTIKSNLDPYDEYSDEDIFAALKRVNLVSQEELDRSNIDAAS
                     VGSENVNKFLDLNSEINEGGGNLSQGQRQLVCLARSLLRSPKIILLDEATASIDYQSD
                     AKIQETIRKEFQGNTILTIAHRLRSVIDYDKILVMDQGEVKEYDHPYSLLLNKNSQFY
                     SMCESSGELEVLIELAKEAFVEKLNSK"
     gene            complement(<606630..>607460)
                     /locus_tag="ZYRO0G07634g"
                     /db_xref="GeneID:8206129"
     mRNA            complement(<606630..>607460)
                     /locus_tag="ZYRO0G07634g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498282.1"
                     /db_xref="GeneID:8206129"
     CDS             complement(606630..607460)
                     /locus_tag="ZYRO0G07634g"
                     /note="similar to uniprot|P10080 Saccharomyces cerevisiae
                     YHL034C SBP1 Single-strand nucleic acid binding protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498327.1"
                     /db_xref="GeneID:8206129"
                     /db_xref="GOA:C5DZW0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DZW0"
                     /translation="MSSEEVTNNNNVAAATTAPKAPVDPETTIFVGNVASGVTEDDLK
                     KVFQEEFGDKVEVEIPAPAKTTKGKVLPRRYAFVKFPQKIDVEAIKSKYDKTVVNEKG
                     IFIRKALTEEERDTQRKTKKQQRRNTKNGAKFPKFRTAVSAPPNKEKPPLEEMERSND
                     TLYVNNIPYSATKEQLAEFFGTTPELIVLPMRRMRNTKTNKVFYSKKMNRGIAFVTFE
                     NLQVDIKTKVEEFQSKTLQDRPIVVDVAALRQQTNDEQKPSDEQEKKDEDKEEKSESN
                     "
     gene            complement(<608384..>609154)
                     /locus_tag="ZYRO0G07656g"
                     /db_xref="GeneID:8206130"
     mRNA            complement(<608384..>609154)
                     /locus_tag="ZYRO0G07656g"
                     /product="60S ribosomal protein L8"
                     /transcript_id="XM_002498283.1"
                     /db_xref="GeneID:8206130"
     CDS             complement(608384..609154)
                     /locus_tag="ZYRO0G07656g"
                     /note="highly similar to uniprot|P29453 Saccharomyces
                     cerevisiae RPL8B and to YHL033C uniprot|P17076
                     Saccharomyces cerevisiae RPL8A Ribosomal protein L4 of the
                     large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L8"
                     /protein_id="XP_002498328.1"
                     /db_xref="GeneID:8206130"
                     /db_xref="GOA:C5DZW1"
                     /db_xref="InterPro:IPR001921"
                     /db_xref="InterPro:IPR004037"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR018492"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5DZW1"
                     /translation="MAPGKKVAPAPLASKSAKTSGPKNPLIRSTPRSFGIGQNVQPKR
                     NLSRYVKWPVYVRLQRQKKILSMRLKVPPSIAQFQHTLDRNSAAEAFKLFNKYRPETA
                     AEKKERLTKEAAAVAEGKTRQEASPKPYNVKFGLNHVVSLVENKKAKLVLIANDVDPI
                     ELVIFLPALCKKMGIPYAIVKGKARLGTLVNQKTSAVAALTEVKKEDEAALAKLVSTV
                     NVNFGDKYDEVKKHWGGGVLGEKSQKKLEKRIQAVNSN"
     gene            complement(609429..609499)
                     /locus_tag="ZYRO0G07678r"
                     /db_xref="GeneID:8206131"
     tRNA            complement(609429..609499)
                     /locus_tag="ZYRO0G07678r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=66.96"
                     /db_xref="GeneID:8206131"
     gene            complement(<609766..>611880)
                     /locus_tag="ZYRO0G07700g"
                     /db_xref="GeneID:8206132"
     mRNA            complement(<609766..>611880)
                     /locus_tag="ZYRO0G07700g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498284.1"
                     /db_xref="GeneID:8206132"
     CDS             complement(609766..611880)
                     /locus_tag="ZYRO0G07700g"
                     /note="similar to uniprot|P32190 Saccharomyces cerevisiae
                     YHL032C GUT1 Glycerol kinase converts glycerol to
                     glycerol-3-phosphate glucose repression of expression is
                     mediated by Adr1p and Ino2p-Ino4p derepression of
                     expression on non-fermentable carbon sources is mediated
                     by Opi1p and Rsf1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498329.1"
                     /db_xref="GeneID:8206132"
                     /db_xref="GOA:C5DZW2"
                     /db_xref="InterPro:IPR005999"
                     /db_xref="InterPro:IPR018483"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:C5DZW2"
                     /translation="MSQDINRLTVDGVVPLIATVDVGTTSSRAILFNRLGQEVSKHQI
                     EYSTTASKEKYGASGKRRPSFDRNPDDPIFTAEGIAIKETKYVEIEDLKQPDPTLRFP
                     RPGWVECKPINILENVEECLAKAFSFVWSVNEQRQQDGLPPYRVHAMGIANMRETTIV
                     WSKETGLPVVDYGIVWNDTRNAGIVAEMKKNTPKEKQERLQEKIGLPLYSTYFSCSKL
                     RWLLDNEPAVQKSYGEGDLMFGTVDTWLIYHLTHNHAFISDVTNASRTGFMNLDTLDY
                     DDELLSYWGIDKTKINLPRITSSAEYFGDFKVPEVTKSWMDPSDWDILEKLSNRGPPI
                     PVQGCLGDQSSSLVGQLAFKPGAAKCTYGTGCFLLFNTGSKKLISKHGALTTFGYWFP
                     HLEGDDKNSPHFALEGSVAVAGAVVQWLRDNLRLIPKAEDVGPLACRVPDSGGVVFVP
                     AFSGLFAPYWDADARATIMGMSQHTTASHIARAAVEGVCFQARAILSAMSADALGEGK
                     RDKEFLNEMEDDSEEKSALSTLAVDGGMSKSDEVMQIQADILGPCTKVRRSPTSECTA
                     LGAAIAAEMGFKDPKDRIMWKDLKDVKKWVFYNGIPKGEAVPAELMPNLKLFVSDSDD
                     AERRHKRRLWDIAVRRTRGWMAAVYPPNSNVNEGFQTDGLAVESPAVQPENSPFIPPK
                     HENLEREMHRKELRKQRNALKV"
     gene            <612724..>614802
                     /locus_tag="ZYRO0G07722g"
                     /db_xref="GeneID:8206133"
     mRNA            <612724..>614802
                     /locus_tag="ZYRO0G07722g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498285.1"
                     /db_xref="GeneID:8206133"
     CDS             612724..614802
                     /locus_tag="ZYRO0G07722g"
                     /note="uniprot|Q6RW11 Zygosaccharomyces rouxii FPS1
                     Glycerol facilitator"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498330.1"
                     /db_xref="GeneID:8206133"
                     /db_xref="GOA:C5DZW3"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:C5DZW3"
                     /translation="MPDTQDGKSNSQKLLNDYLSNPDPGPSPSAPQPTTAGTGDTSTT
                     AADVNLQGNKNFDNSGNSGIESRHKSSSNWNDDGYDYEMQNYYPQPYTQRTSRARSNT
                     NYIPHYMTGPDSQYPIQEVVPNTQMAVATGSDPAANRADGFGHSVRSRAPTIRSNVPD
                     FHSILGSTRSKPHSHNGSHIRSNSSGRSSAASAAADSENHGNETGDGVNSGSSNHALS
                     TPLMVRPKTLHQNPQTPTVLPSAYHPINNWTSLKHGYLKEFLAEFVGTMVMIIFGNAV
                     NCQVNVASKIQQENFDKALQKVSNSPEQLRETAEAFKNLVSSTSGGTFDEVALGWAAA
                     TTMGYFAAGGSAISGGHLNPSITVVNFIFRGFPFKNVFIYVTGQLLGAFVGALILFIF
                     YKRVIEEGFPGEWWKNETVAGIFCVFPKPYLSTSRQFVSEYICTALLQIGTFALTDPY
                     TSLSSDLFPLMLFILMYILNASLSYQTGSAMNMARDLGPRLALYAVGFNRHMLWVNHH
                     HFFWVPIVAPFLGSITGGLIYDVCIYQGHESPVNWPIATYKDILRRSWLRRRQWKGRS
                     NWPVIGKKLSNNPAPSEFSDFSYEDDDEDRGNPFQNPKTDPSKVSLVQEADPGADTRS
                     PDSVHFKSVQGDSRRLHGEIPTIMEENPSLETESLGSLTSLSINNNDNNGPTSNDGIP
                     SFPTVQKKQE"
     gene            complement(<614897..>615565)
                     /locus_tag="ZYRO0G07744g"
                     /db_xref="GeneID:8206134"
     mRNA            complement(<614897..>615565)
                     /locus_tag="ZYRO0G07744g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498286.1"
                     /db_xref="GeneID:8206134"
     CDS             complement(614897..615565)
                     /locus_tag="ZYRO0G07744g"
                     /note="highly similar to uniprot|P38736 Saccharomyces
                     cerevisiae YHL031C GOS1 v-SNARE protein involved in Golgi
                     transport homolog of the mammalian protein GOS-28/GS28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498331.1"
                     /db_xref="GeneID:8206134"
                     /db_xref="GOA:C5DZW4"
                     /db_xref="InterPro:IPR023601"
                     /db_xref="UniProtKB/TrEMBL:C5DZW4"
                     /translation="MSQSFVTVRSQAISLESQVESLLSKYSTFAQTTSSEQTSQEKRL
                     DTQLEELLNQRQDVVERLGTICDENPTISASKLSQLQRHREMLKEHWQNLRNIRSSIQ
                     QERNRLNLLFSVKSDIAQQRTEDSTVPFEDDEDYYRGESRRVDQSHNLVDRLISQAWE
                     TRDQFSAQSNLLQSGSNRVLQTLHRVPGINQLIARIGTRRRKNVLVMASVIVICILLL
                     FFTW"
     gene            complement(<615624..>616097)
                     /locus_tag="ZYRO0G07766g"
                     /db_xref="GeneID:8206135"
     mRNA            complement(<615624..>616097)
                     /locus_tag="ZYRO0G07766g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498287.1"
                     /db_xref="GeneID:8206135"
     CDS             complement(615624..616097)
                     /locus_tag="ZYRO0G07766g"
                     /note="similar to uniprot|Q07879 Saccharomyces cerevisiae
                     YLL042C ATG10 Enzyme that mediates formation of the
                     Atg12p-Atg5p conjugate which is a critical step in
                     autophagy"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498332.1"
                     /db_xref="GeneID:8206135"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="UniProtKB/TrEMBL:C5DZW5"
                     /translation="MRFEEYRAQLPSLKHSLQDCDKVKNLHYNPLKSTIHIHIQWDVT
                     EFNISHLECKITYSQTYHEPQLLLRIWKFSQIEGIDCIEPWFPKQIDRILPLPNWFQF
                     GLDTISTSSSDNPAAWYSIHACDTADIVGDRSIFQSTYLSRWASVFLFDWIQNVD"
     gene            complement(<616337..>617128)
                     /locus_tag="ZYRO0G07788g"
                     /db_xref="GeneID:8206136"
     mRNA            complement(<616337..>617128)
                     /locus_tag="ZYRO0G07788g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498288.1"
                     /db_xref="GeneID:8206136"
     CDS             complement(616337..617128)
                     /locus_tag="ZYRO0G07788g"
                     /note="highly similar to uniprot|P21801 Saccharomyces
                     cerevisiae YLL041C SDH2 Iron-sulfur protein subunit of
                     succinate dehydrogenase (Sdh1p Sdh2p Sdh3p Sdh4p) which
                     couples the oxidation of succinate to the transfer of
                     electrons to ubiquinone"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498333.1"
                     /db_xref="GeneID:8206136"
                     /db_xref="GOA:C5DZW6"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR004489"
                     /db_xref="InterPro:IPR006058"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="InterPro:IPR025192"
                     /db_xref="UniProtKB/TrEMBL:C5DZW6"
                     /translation="MMNSVLKRSVVNGLNLQRGLATATAVAPRLKNFKVYRWSPDEPS
                     KKPYLQTFQVDLNECGPMVLDALLKIKNEQDATLTLRRSCREGICGSCAMNIGGRNTL
                     ACLCKIDQNESKDLKVYPLPHMYIVKDLVPDLTNFYQQYKSIQPYLQRKSYPEDGKEI
                     LQSVEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLLQAYRWLIDSRDQAAQ
                     TRKAMLQNTMSLYRCHTIMNCTRTCPKGLNPGLAIAEIKKELATD"
     gene            complement(<619006..>628332)
                     /locus_tag="ZYRO0G07810g"
                     /db_xref="GeneID:8206137"
     mRNA            complement(<619006..>628332)
                     /locus_tag="ZYRO0G07810g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498289.1"
                     /db_xref="GeneID:8206137"
     CDS             complement(619006..628332)
                     /locus_tag="ZYRO0G07810g"
                     /note="similar to uniprot|Q07878 Saccharomyces cerevisiae
                     YLL040C VPS13 homologous to human COH1 component of
                     peripheral vacuolar membrane protein complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498334.1"
                     /db_xref="GeneID:8206137"
                     /db_xref="InterPro:IPR009543"
                     /db_xref="InterPro:IPR026847"
                     /db_xref="InterPro:IPR026854"
                     /db_xref="UniProtKB/TrEMBL:C5DZW7"
                     /translation="MLESLAATLLNRLLGSYIENFDPTQLNVGIWGGNVKLKNLKLRK
                     DCFDGLHLPIDVKFGILGDLVLNVPWSSLKNKPVKVNIEDCYLLCTPRDFDSLHSAEQ
                     VERELRVKLQSLARWEVASQARAAADDSNSHKDQNESFMQSLITKVVDNVQVSIKNIH
                     IRYEDMSSNLSKEPCSVGITLNELSAVSSDSDWNPSFISITQDITHKLLTLDSFCLYW
                     NTNTNSIQEHGEIYDPNAMISKFKNCVATNGVSKPDFQYMLRPVTGSGRLTVSKLGST
                     EDRPHIDLQMLYDEFGLEIDDSQYADILHTLSSIHLSQKTQKFRKMRPTYPVSQNPKG
                     WFRYLGDCVIEEIHEKNDMWTWDHISKRCQQRRLYVKLWSKKLSVSNWEQPLPDRDEE
                     KQLEQLHRELGFEDIVLFRSLGRKEFAKQKLKSRDASPAKTQQPSSQGGWFSSWWGGG
                     NSSQDSDLTITDEQRQELYDAIEFEENDGSLTDAQLPRDRITMKVTGLLRKGTFSMRK
                     KDHEFCLGEVIFENCEVDFLQRPDSFLTSFKLQQFKVEDGSPNTLYKHIISVKNTESD
                     SPSKSVTKSLPLFHLDFESNPVDESADSKLNVVLRGMTVFYHVHFITEILRFFSPPKQ
                     HKDTVGAIINAAEATVEGWTTQTRMGLESLLEEHKTANITLDLQAPLIILPLNPHSWE
                     TPCAVIDVGHIFLKSDLVPKERINKLKQLTPEEYAKIDESELNKLMFDRYQLYLQDTQ
                     MLIGSDVRSTITSLNGASEGCQYSILNKLRLEVTLDLSILPKAFNLPKVRAFGRLPQL
                     KLSLNDNQYKILMQLLEKSIPSLLDVDADNEFRETADTLDDTRRKVQIQLSRTLKDLE
                     KMLPMELAQKLFELHFDVDDIQISIYKCLESNSMQCKKLVDVLGGKVKFNFVRKAKEM
                     NIKLNVHSLEVEDHIEESNNEEFRHLISSGNVDQNGSKDLFNLEYKRMQRIVSHDNTL
                     IEVFDQDVSMNLAKLKLVLSPKSLLTLINYALTTFTDPNAPVAPADALRHNEENREDA
                     PQKINVNIKVAGVVVVFNDESLKLATLVVSAGDFSLLYMPEKMKVKLSLGGLELTDET
                     TETLPRDSMFRKLISMSDQELAEVSYETFDAADRPGDYDSFFKYNTGSMHVNFVEHSI
                     NKVLTFFCKFQRMKALFDKAREVAYNQAPSIEAVNKMKMDVKIKAPIIQFPRLVSAED
                     EIYDSINFYLGEFFVENKFDKNEAGAEINNINLGIREAQVSSILNLDQGLTQHLHMVD
                     NLCLTFNIDHNPFADVSTPKFLVRGYFDPLMSSLTELQLKYLLEVSEKVSAAFDITDT
                     SAVELSEEVIYANAFLDSPDTENSPSSVVTSETPRTENGEPLEGIKMDFSFKAPEISL
                     TLYHDTTSSKDLENNGLTKLTFQDIALSAQYNDDGTGEGESHIATFTVEDIRDIKDNK
                     HTELIPKVVNDNYQFMAAVTCTKLHHGKLVNASVTIDSPQVILAMDYLFALKSFFDAS
                     FEKKQANVTEDETTSREQNPSLPATENNSSNTKLQYSLNVVNAAVIMLADPSDLYSEA
                     VMFNIGQFLLSDQNITSLCANNVGMSLSKMNTEDKNQVRLLEEFSSSLVIDRRESTPE
                     KLLTNVQISVEPMVMGISLRDIRLAMLVFNRVVSQMNGTPEEHDSGDNASSMTPGGFS
                     KEFEKKLSKYAPSFVSSVEAMSRRGSVSHDVIMRGENLEADFGGIRLFLIGDVHEMPI
                     LDMNVSPFQASVKDWSTEIDALAALEVYMNVFNYSRSSWEPLVEPFPISFHLSKSAAN
                     KDAKVMFDVISKKTAEVSLSARTISMLSQIPGTLTTNYSLEPRGASKPYKIKNDTELD
                     LDVWIVTDTLQERKSLTTLAAGSAIPWEFEDWRSVRENLEAEHLGLNLGAAIAGGRYK
                     TTMKVDVTYEGEMLFVLQPAVEHVHNRIVCELELGEDNIKTITFRSPLLLENTTSTDM
                     EIMVEPEQASRRFSFELKALSSRSVPVEYAFNSSLRIKPITEAEYDWSQQPIIWRSLL
                     KKPISLQCNSYDGRNENFHIEVNGKYDEKEPLAQIFPHMKLVISSPIAIENLLPCDLK
                     FSLFDKREEEKNMCLLKKGERVPVHDVSLDNFLLLRVQPLIEDASMSKPSIVNTATKS
                     ALKPELSLVMKLSGGQKFNAMLHYQSVEGTRAKIIRITSPYIIFNETDRDLYVQGNSS
                     NIAQCKLQAEDDVRFSIPKMFSFDVNSYKKNRARIRFKESDWSMPISFEALGQSFDTV
                     VNIPNKEQECNFGITVSEGEGDYLLSKIISIAPRYIIHNFLDVPIELCEHGSTNVLDV
                     EPGKSIPLYKMRNVVHKQLMVKFLGSTSEWSSPFFIKDIGFTYLKVLKQNSHVLLKVE
                     IILERATVFIRIKDAQNHWPYSIRNFSDQEFIFYQRDPRVVDDYYDYDTYDELDETEY
                     KPYYYRVPPKSVMPYAWDYPAARQKKLILTARGRRREVQLAEIGNLKPMRLPSRSPSE
                     EPLSMDLNVIADGPTQALVITNYNPDFSLYKLRNKNNTSSSVSVSSSSGDGFEAEAED
                     KNVYAKIVLSFKGVGISLINASLQEILYLHANGLEMRYNESDLYQTFSWKVKWLQVDN
                     QLFGSPFQNILYPYAVPHTTHEIENHPVISGSVSKVKDDSHGLMYFKHATLLLQELTI
                     QLDEDLLIALLDFAKSPGAAWNLSSKDARYPTKITLPQCADLKFADDMYFEIFHIQPI
                     MLHVSFVRSDQHQLLKDEQEKLGVEYQGTMLVFLDMLTMTMANVNDAPITLNSLYMAN
                     LRVPINTLYKAVETHYGQQFFYQIHKILGSADFLGNPVGLFNTISSGVWDIFYEPYQG
                     YMMNDRPQELGLHLAKGGLSFAKKTVFGLSDSMAKFTGSMAKGLSITQDLEFQERRRL
                     QQRMNANKRNRFTSTAQSFANTVGSGFTGMAFDPVTGAQKEGASGFFKGLGRGLIGLP
                     TKTAIGILDLTSNLSQGVRSTTTALDVPAAARVRLPRYIDYHEKIIRPFDLKEAQGQY
                     WLKVVNGGLYMNDNYLAHVVLPGKELAVLVSMEHIIELNIGNLESMWTTDYFGIQGIV
                     LQRGGIHIKLKTQSEYFIPIANPQERKCLYKHIAIAVTEYNKYCEAAL"
     gene            <628580..>634129
                     /locus_tag="ZYRO0G07832g"
                     /db_xref="GeneID:8206138"
     mRNA            <628580..>634129
                     /locus_tag="ZYRO0G07832g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498290.1"
                     /db_xref="GeneID:8206138"
     CDS             628580..634129
                     /locus_tag="ZYRO0G07832g"
                     /note="similar to uniprot|P38737 Saccharomyces cerevisiae
                     YHL030W ECM29 Major component of the proteasome tethers
                     the proteasome core particle to the regulatory particle
                     and enhances the stability of the proteasome"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498335.1"
                     /db_xref="GeneID:8206138"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024372"
                     /db_xref="InterPro:IPR026827"
                     /db_xref="UniProtKB/TrEMBL:C5DZW8"
                     /translation="MSSVTSEVKEKELVEKVELRLALSDTPDKFEQNLDTFLPPLLLK
                     LGSPHASVRQAVFNSLRDVLARLNSLTNVRLPVEKLLLQSQKPPFTQESNNVRLYSLL
                     LASKGIDRLEVGEKRQLIPVAMREISKLPDAAAARVFHIVCKLITSWVPPQRSSKEED
                     EAFESLKLEDRGDLEFLAQKFTQFFFLIPAKADPQTKIIPRGYTCPGLCADEVSFFTY
                     TAGVTFTKEQMVHFKSSIFKFFNSGFTQDTKLLAKFLIVASTDSSDISDTAAFYLKKL
                     NISSEDPDFVDFLISLYTGDKSVGKPPVRPELQDKILSFLNKSVYATSNAKKVSQICH
                     IGLHSSLYRLRSSCLTFVRHVAQHNYKNLIEQPGENEGIGFNVNIASLIRNNLHSEGW
                     PRLQLSSSTPNFANTILQRRLQYETLGDILSRDFDLLKDLSFIEFLFDSLRGDFSEFL
                     PSIQEALTSLTGSLSQLPAASKEKLREIIRKHLSDDFELESSENKETKDSLMACRFIL
                     IKYANATFEFDDSEARLFNIWGTSRANRFDIIEESNKGLDPYWFRMNRASDTKEFKST
                     SELLSSRISETMLPSFPEFVATLLKENDLKSLTVTSVIRGTLGTAVRFAKQCLISQAV
                     RGKSTCVVQDEDWSLRIEKALDVDDKVSSLALNLISGFDGEWFTGFLRLLCGEIIQKN
                     ESGRHISTAKYPDAIYGELLLILLRNCSDKTLGALEDLIPAFYNFLGTIQTANDLDIV
                     SGANLLGIISASVPNSPHLKTIVDQRIETSPGGEIGASLIADSYIFPRLYLRGHFKLV
                     GNERLGALVSNLLSLISNPKLKLLSGKLLCEVSKFGLLRELDSQARHDTLNRLIDLLG
                     SKLLKDEAYVEIWGTFSLYSREFGLFEEFFNKLYDTHVSKQIELIFAVGESLSILAGG
                     WKSSFLLKQLDVSRTALVPLQNSFGDENVGIVLDKVLNACDSTKPSLRKSACIWLLSL
                     LQYLKSTTEISSRCNEIHLRFMKFLVDKDEFVQDSASRGLSLVYEIGNGDLQESMIKS
                     LLKSFTDSANAMNMSSGTVSADTQLFDEGMLNTGDGSVSTYKDILNLASEVGDPALVY
                     KFMSLAKSSSLWASRKGIAFGLGAIMSKSSLENLLLEDRGTAEKLIPKLYRYRFDPYQ
                     SVSRSMNDIWNTLISNSNSVISEYFDEILKELLAGMGNKEWRVREASTLALLQLVQGQ
                     GREQLDDKLLDIWFMAFRSMDDIKESVREAGIRLTTVLAKILARAVDVNKGVKPEKSR
                     HILESILPFLLGTRGLNSDAEDVRNFSLKTIVDLIKNSGSAMKPFAVELVHEFILLFS
                     SIEPQIVNFLSLNASNYKVDANTIDMHRKTTVTNSPLLEAIDKLITNSDDSLIDSHVN
                     SVTKAIKKSVGLPSKVAASTVVNILVRRYSFSLTPYSGRLLKVCVNQFDDRNESVRLT
                     FALSFGHVYHVASLEKCVKYAEQLSERYFTSNESISRKVVGSAVEAVSKYANKQFEDV
                     SGIYVPLLFIASNDADEVVGTFFSKVWTETSTSGTGAMKLYLKETVDLLQKYIGSKDF
                     AMRRTCAKSVSLLCEKVDLTVKEETVQQLFEITIESLKGRTWEGKEVIVEALVSLAVK
                     FHVYVNSHSELSESLQDVLTAELGRQNKRYTKQIIFSYCRFMEVFPQPSMVDKLIQVA
                     QTFFEDGAEDGDSSNKRSKPYSEISLKSSPKNVELEDYSIKLLKSCAKICRPVNDVYP
                     YSLFHFIVSKILFLLQEDFVIYTWRTQVGACEIGSEIMETYNEKFVAVEFEESLRKLW
                     NELFIRNSTRETVDNAKIQLVRFGSKISTKDAYLRNEIQRDLINLSETDVSAKVSNEL
                     KILGIND"
     gene            complement(<634289..>635671)
                     /locus_tag="ZYRO0G07854g"
                     /db_xref="GeneID:8206139"
     mRNA            complement(<634289..>635671)
                     /locus_tag="ZYRO0G07854g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498291.1"
                     /db_xref="GeneID:8206139"
     CDS             complement(634289..635671)
                     /locus_tag="ZYRO0G07854g"
                     /note="highly similar to uniprot|P04838 Saccharomyces
                     cerevisiae YLL039c UBI4 ubiquitin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498336.1"
                     /db_xref="GeneID:8206139"
                     /db_xref="GOA:C5DZW9"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR019954"
                     /db_xref="InterPro:IPR019956"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DZW9"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKI
                     QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
                     ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
                     LRLRGGAMLV"
     gene            complement(<636468..>637247)
                     /locus_tag="ZYRO0G07876g"
                     /db_xref="GeneID:8206140"
     mRNA            complement(<636468..>637247)
                     /locus_tag="ZYRO0G07876g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498292.1"
                     /db_xref="GeneID:8206140"
     CDS             complement(636468..637247)
                     /locus_tag="ZYRO0G07876g"
                     /note="similar to uniprot|Q07872 Saccharomyces cerevisiae
                     YLL038C ENT4 Protein of unknown function contains an
                     N-terminal epsin-like domain"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498337.1"
                     /db_xref="GeneID:8206140"
                     /db_xref="InterPro:IPR001026"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="UniProtKB/TrEMBL:C5DZX0"
                     /translation="MSLFDSMRVFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTY
                     SPKTVREITQVLKRRLSSYGRRTSHKNSIHIVKALTLILYLINNGSEEFVAWVRGNLI
                     YFECLKSCEVSQKRDEPLAKQIRSMSNQICDCVKDDELLENKKKEIIEFRSSISSPGR
                     KSTDNSHLKLIGVAKGSLERTPISLTNQKNENVTLLSEYQYAPNPDIYYRRGTTSLDL
                     RRRNKGSANEISVIRLDPLEEENEARSIQAKGWKAIGGYIK"
     gene            complement(<637442..>638938)
                     /locus_tag="ZYRO0G07898g"
                     /db_xref="GeneID:8206141"
     mRNA            complement(<637442..>638938)
                     /locus_tag="ZYRO0G07898g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498293.1"
                     /db_xref="GeneID:8206141"
     CDS             complement(637442..638938)
                     /locus_tag="ZYRO0G07898g"
                     /note="similar to uniprot|P32523 Saccharomyces cerevisiae
                     YLL036C PRP19 Splicing factor associated with the
                     spliceosome contains a U-box a motif found in a class of
                     ubiquitin ligases"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498338.1"
                     /db_xref="GeneID:8206141"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013915"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DZX1"
                     /translation="MFCAISGKPPRTPVVSLVSKCVFEKDLIEQYIQETGNDPISNAP
                     LSVDQLLIISQTPQQSAFTNAVNSSTLNSNYSIPNLLSSLQNEWDAIMLENFRLRKQL
                     DAFTKQLSTALYERDAAKIVASNALREREQLVQELNQLSLHLGVDEAEESEEQVTGLP
                     QDLIEQLLNASKEYVNITKKNKDLFVDEVSELVCRNNYNASDSPVLQSGSKLRSGLSK
                     SVVFTIDDGNTVYYTQGDKNSQFEINVEEKLEYLTMTPNEEYLIFSTTDGKIGTYNIK
                     ESQKHVLEIRTDEIILIQSHEYILNDQFLWVDKKGKVGYSSLDGSKTTLVSQGGAGDF
                     SRAALHKDGLLLALVQDDNIQIRNVTQFEEPPTVWNLGKEINQEGSITGVKFSSNGYW
                     MIVSTTHAIMSFDLRKSVGTLAVQPITIESQIWDTDLSGKHLVIWQSGRLQFYSFVKS
                     SKTWELNKDLPLKPLEEQDLKSLKLSYGESGAVTVLQSLNKIQVFSLE"
     gene            complement(<639096..>640781)
                     /locus_tag="ZYRO0G07920g"
                     /db_xref="GeneID:8206142"
     mRNA            complement(<639096..>640781)
                     /locus_tag="ZYRO0G07920g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498294.1"
                     /db_xref="GeneID:8206142"
     CDS             complement(639096..640781)
                     /locus_tag="ZYRO0G07920g"
                     /note="similar to uniprot|P38738 Saccharomyces cerevisiae
                     YHL029C Cytoplasmic protein required for replication of
                     Brome mosaic virus in S. cerevisiae which is a model
                     system for studying replication of positive-strand RNA
                     viruses in their natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498339.1"
                     /db_xref="GeneID:8206142"
                     /db_xref="GOA:C5DZX2"
                     /db_xref="InterPro:IPR000195"
                     /translation="MVENIPPVLSSHHYKHLKHLDRCKQLVETCVELLSKGDHDALAY
                     LARTLGIPPQLRHKVWPLLLKYHPMCISPNILSNTVVWDSEHNFYKLVSGTSSSNDIN
                     KEPREGLENLILHDLKKYFRNVSKSEEDHELQVLKEAVLKFLSKWSRIFQYESGLAWI
                     AVGLAEWIPIIENSEGPIVLNERKNHTSGTTTPNQPNPTCLSPLFKEYPLPSYLKSKL
                     PKDSIFDFNEIYERIVLVILHCPDTITAQKLVEAESLKNSAPRRGSYAIKEGKLNYSP
                     FLSGGDLGYQTQVFFKVFSTVLPELYQPFTEENAVQPSSKRTGWLYWWMKCSGARAFQ
                     KQDRGRLWDILLGWRPEPNRHTIDFFLNYNSKKFDHLYHSRFRNNLDFFNSTSKNDPF
                     WFPDLDTIPLGTSKFKYDFNVFEELLDRNSYGHDAPPDPVPGNNDDDKIPFSLIDSHI
                     QLVFIYIAILQHNEFKLLEFEETETSEFLNNVPMLSRADDICFKRLCDDDQSTYQNGF
                     TSQEDLPKRPGSSKLRIGSDAKTSRSFNDILTMAGDIWRKWLWQELEECFVSE"
     gene            <642460..>644787
                     /locus_tag="ZYRO0G07942g"
                     /db_xref="GeneID:8206143"
     mRNA            <642460..>644787
                     /locus_tag="ZYRO0G07942g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498295.1"
                     /db_xref="GeneID:8206143"
     CDS             642460..644787
                     /locus_tag="ZYRO0G07942g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498340.1"
                     /db_xref="GeneID:8206143"
                     /db_xref="UniProtKB/TrEMBL:C5DZX3"
                     /translation="MLYRLSGCWTITLTLALLLAQRVASASNNGYTLDGDSTPWDSNS
                     GANESSDSIKVAGSSTPSVTGTTGSIPSYSSQPQPSSRDNDPFSSAPSPSGYGSGGSS
                     SNTESYSSSVNAATSSSSDFSPSSSETPTASSSSQTGGTSGSYSSSSAPGPTDSSSSV
                     SNFESSSPSPSSSSPASLFSSSSASPTASDSSSTYPGLSSSSEVASSGSAVPSSTSSY
                     SSPSSSSANTASGSSYSSVSSDIYPSSTPSSSSSSSSYSPSSSFSSFSSSSSAVPSSS
                     SYSSLPSSSHSYSSSTPSSSSISSSSSFVSSSSSSSSAPSSSSSLPSSSSSIPSSSSS
                     APSSSSYQSSSSSSSSIFSSSSSIPSSSYSSSSTSRSYSPSSSGSSSSFSYSSSWSPT
                     STASSGSSGAFGYLSSSSSYSPSSSSSFSYSSKASSSSSDFILDATSSSSDSSSAYSS
                     IGSSSDSLPKSTTTSYSPSSSSSSSVWSPTSSPSSSYSSSSSSYSWPISPTTSSYPSS
                     TSSESSSDPSSTITSNTWSSISSASSYPSSGSSTPVATSSGSSSQSSSDTLKSAFVTS
                     FSVRSTTSSSPIKTLTRSAGGGEITSIRYSMVILTSQGSRYTQTRVVTNSPTAGSQKS
                     IQNGNGGYWASTGKVVGTFVPVGIVCLGIILFLIWAMFIHPRKKQKQFDTFYNNNIYS
                     PSLKSDTPSLHQSRPSSVSGFVYADEKGIITPKPAPNQSLTTDDESFELPKPVVVDQR
                     LDFHQMLNNIDNSSSKVSLADDVDYSRKFLHLGDK"
     gene            <645949..>647400
                     /locus_tag="ZYRO0G07964g"
                     /db_xref="GeneID:8206144"
     mRNA            <645949..>647400
                     /locus_tag="ZYRO0G07964g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498296.1"
                     /db_xref="GeneID:8206144"
     CDS             645949..647400
                     /locus_tag="ZYRO0G07964g"
                     /note="weakly similar to uniprot|P33400 Saccharomyces
                     cerevisiae YHL027W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498341.1"
                     /db_xref="GeneID:8206144"
                     /db_xref="GOA:C5DZX4"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DZX4"
                     /translation="MVLLRDILNQDTSENNISKTPPPAVGAGDFKKRSASLPSPNFSG
                     TSSSNGNSDSEDDGSKCRLSVPSSSSRVETPQSSTPSSTEEEQFFCKWDQCGKMFNQP
                     ELLYHHLCQDHVGRKSQRNLQLACKWEECNVKTEKRDHITSHLRVHVPLKPFDCYRCG
                     KKFKRPQDLKKHLKVHAESHLVVKKRRGPKLGSKRVQKKQKEEPEVARSKFSSASSSI
                     SSPSPTPDKSYSLPTLPRVSFQQLISNEIPSYEPVYTQQLGAKLRTVLPSLGEEESLP
                     RSPPVATQNAAGFFTTLSKNMSSSLPNQYSTVKQPVITTPIAPAVQPGYKPSSYPKVY
                     QLPPIGPPPIDAPSERVSPAASLPSLSSAPILNSRYNSFGRLPHFNALGQHFSSNQKN
                     NGSESTEEDDLLEQISSLRVGDDDYEDDGDDDESQDIFESLEIVNIIRDYLLCSLLEQ
                     EFEDGNVEQELDQKDFSKVSDTHNLSRYPQVVI"
     gene            <647633..>649507
                     /locus_tag="ZYRO0G07986g"
                     /db_xref="GeneID:8206145"
     mRNA            <647633..>649507
                     /locus_tag="ZYRO0G07986g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498297.1"
                     /db_xref="GeneID:8206145"
     CDS             647633..649507
                     /locus_tag="ZYRO0G07986g"
                     /note="similar to uniprot|Q9P4W6 Saccharomyces cerevisiae
                     YLL035W GRC3 Protein of unknown function required for cell
                     growth and possibly involved in rRNA processing mRNA is
                     cell cycle regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498342.1"
                     /db_xref="GeneID:8206145"
                     /db_xref="InterPro:IPR010655"
                     /db_xref="UniProtKB/TrEMBL:C5DZX5"
                     /translation="MAQLENANALQYQEVSDSDESNSSTESTVTPGPKDEDLAEYDEE
                     DEEEPNNDSKGQFQPLLDENVFIIDETKDTLLVGLTEKQRIFVSGVFCLQVVKGGILY
                     GHTHYSASKDTYTVWHPLCDSIPSIQSSFYAGWEEGVHISSEHEELVECDLKDFPCII
                     KLHNPKVDNLLEASELYSEVGNLWRKQGDFTQNFTSPQCGFAILHESLNQFSPLHITG
                     EWLNVIERLGLAHKNSSHDMRVIVLGGKNTGKSTLLRLLAQNFLYGGSSQEEILYFDL
                     DPGQPEFSPPDCISINQLSRFTKVLGKHMGQPFFSPIRQHYLGSNSPQDIPHLYLRCI
                     DELVDYLDEQTYMGTSLMNLPGWIKGFGLNILNHVIRRYKPTHIVMLESKSSRQYFEE
                     LDTGTLFTSSLRDDYRAQILKVHTNFNSFEDSKFSAATLRTQNMLAYFHTQTKTKSLI
                     KYNFTPLIMQPPLQISFGNRGVQGIRFFEEFEDIHKDDIKNALQGTVVGLYSCDDDED
                     NALRENITFQGAFPILKNLPSKIVFFSLALIHSIDVENRLMNVYIPGFRTNQLGSNSE
                     RKWIMIRGKSETPFCELYPSKTLFNGDKIPYISNERRKKYEYIWKVRRNVMRRGHHLK
                     "
     gene            complement(<649595..>652075)
                     /locus_tag="ZYRO0G08008g"
                     /db_xref="GeneID:8206146"
     mRNA            complement(<649595..>652075)
                     /locus_tag="ZYRO0G08008g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498298.1"
                     /db_xref="GeneID:8206146"
     CDS             complement(649595..652075)
                     /locus_tag="ZYRO0G08008g"
                     /note="highly similar to uniprot|Q07844 Saccharomyces
                     cerevisiae YLL034C RIX7 Putative ATPase of the AAA family
                     required for export of pre-ribosomal large subunits from
                     the nucleus distributed between the nucleolus nucleoplasm
                     and nuclear periphery depending on growth conditions"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498343.1"
                     /db_xref="GeneID:8206146"
                     /db_xref="GOA:C5DZX6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DZX6"
                     /translation="MAKGPAKKSSLRGSLDGKIENLIYRLLEEKALERKRSNTAENDD
                     DESMETVYFAKDLKGGEIFTYCQSKDVTMLRVKKVVLQKSIERVLKQIIEEEAQEFES
                     FPGYKDEEPTAQDVEAQLKEQNLMVMPEVNDMNKSITEQWNVKAETPAEDTPDDKVNG
                     SASKKRTKDSAPSKPKKQKTKEDRTPPQSRLESIGGMEDVVAQLMELIGLPILHPEIY
                     ISTGVEPPRGVLLHGPPGCGKTSIANALAGELQVPFLSISAPSVVSGMSGESEKKIRD
                     LFDEARSLAPCLMFFDEIDAITPKRDGGAQREMERRIVAQLLTSMDELNMEKTGGKPV
                     IVIGATNRPDSLDAALRRAGRFDREICLNVPNELSRVHILKKLAQNLKIDGEIDFIKL
                     AKLTPGFVGADLKALITAAGTCAIKRIFHAYAYSSIATDNKMDIDQDTENKDEDEKSL
                     KNTANMIDPLPLTIIQKFIQNFPEPLNDEQLSNLSIQYEDFLKALPTIQPTAKREGFA
                     TVPDVTWASVGALTKVRVELNMAIVQPIKKPELYEKVGISAPAGVLLWGPPGCGKTLL
                     AKAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPR
                     RDSTLSESSSRVVNTLLTELDGLNDRRGIFVVGATNRPDMIDPAMLRPGRLDKTLFIE
                     LPNAEEKLDILKTLVRTNGTPMSSDVDLETVIADDRCKNFSGADIASLVRESSVLALK
                     RSFFKNDQVQSVVENNLDKEFEDLSVAYPSEEILVTMSDFVNALRKVRPSVSDKDRLK
                     YEKLSNKLGWNDDVELTTEETKTPNTNA"
     gene            complement(<652418..>653236)
                     /locus_tag="ZYRO0G08030g"
                     /db_xref="GeneID:8206147"
     mRNA            complement(<652418..>653236)
                     /locus_tag="ZYRO0G08030g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498299.1"
                     /db_xref="GeneID:8206147"
     CDS             complement(652418..653236)
                     /locus_tag="ZYRO0G08030g"
                     /note="similar to uniprot|P38740 Saccharomyces cerevisiae
                     YHL026C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498344.1"
                     /db_xref="GeneID:8206147"
                     /db_xref="InterPro:IPR018852"
                     /db_xref="UniProtKB/TrEMBL:C5DZX7"
                     /translation="MKETTRSSKWFIFYYLFENGLISAMVAGGSEFGIAYAMYWNHKS
                     PLTLWAFPHTLSGDCALSHFIQVGLTWYAEELTIGWDALNGKTPIIPFANKYLPKSKF
                     VRWYFEVDNGIIPDEDEPENNTFKKYMKRQLIRYPQKNWFFNLCEWLIRKSIRALIVG
                     AIIWAVEWPITMGIMAGTGTRVGSHDYKFHGYYPEVMKLIYGFVLGLISTPTAILIVV
                     LRDQWYRLYLQTEESSGGLLSPAGLEDKSSKLQESSKQNSTILKNPVTDDSFTS"
     gene            <653827..>656157
                     /locus_tag="ZYRO0G08052g"
                     /db_xref="GeneID:8206148"
     mRNA            <653827..>656157
                     /locus_tag="ZYRO0G08052g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498300.1"
                     /db_xref="GeneID:8206148"
     CDS             653827..656157
                     /locus_tag="ZYRO0G08052g"
                     /note="weakly similar to uniprot|P53148 Saccharomyces
                     cerevisiae YGL093W SPC105 Protein required for accurate
                     chromosome segregation localizes to the nuclear side of
                     the spindle pole body forms a complex with Ydr532cp"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498345.1"
                     /db_xref="GeneID:8206148"
                     /db_xref="InterPro:IPR013253"
                     /db_xref="UniProtKB/TrEMBL:C5DZX8"
                     /translation="MAKGILKSSQNEEPQFASGLQLPTSSLSRHEVLENGNNTTSRIN
                     TLQLENKINRRVSFAPDVTLHSFDFVPQVKDVKLPRRKEKREEDDEKNPEGEESTELS
                     QAEPGQDSEMTMTQVFKPSKEMEMTDIFRPPHDEPMELTQVRRAPENVDDGFEKMESS
                     QIEHATGNLDDGSQTMELSQIQHATENVDGASEQMELTQVQHATGNLDDASEHMELTQ
                     VPRATRNVDGASEQMELTQVPRATGNIADESEKMDLTQVHRIIENVDDESEKMELTQV
                     PSRVHTPPAKRRKTMSSEIEEDDDMELSLMRMSPIALRGTDTKPPLSYSLKKFLDAVG
                     VSFLIDTNFIKSQEAVEFPLTKLPVSLHSHQILSKLYVDMPVLEMNEFVCRELWRRVD
                     QSSVQFQDLENQISSSVPPLLFREYFQSSEDMRRLMNQQLQLVKSFAKLESRKAWYDW
                     RIQHFKGLQDVLLENLGLLQEEKTKLDKDLQRAQKNKEETFSLLQVLRKEVELVRDLP
                     SQVYKKESKLADKLQLEKFRQELKAHKIAFNDSQNLRLQRRSLVAEIESKCKELGELK
                     GKLHQLQQKNKTQVTDYDMTKLRRKLEFLSVLSGIQFKGINNSQLLVKCFDLIELSID
                     LSLSQSAPQKACSLLNNTEPFYNELLEYVISQLQTSTNFLTDLFLQLRKLIPLIKTYF
                     FLKHLFPLTISTANRTTTIQLMDYDIRTDVKYVYKLSMQELITAVLDENSTVSLSVEL
                     AQKNKEIPLDVISARFVSKTGRILSWANLKRIHMTT"
     gene            <656384..>660292
                     /locus_tag="ZYRO0G08074g"
                     /db_xref="GeneID:8206149"
     mRNA            <656384..>660292
                     /locus_tag="ZYRO0G08074g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498301.1"
                     /db_xref="GeneID:8206149"
     CDS             656384..660292
                     /locus_tag="ZYRO0G08074g"
                     /note="similar to uniprot|P49687 Saccharomyces cerevisiae
                     YGL092W NUP145 Essential nucleoporin catalyzes its own
                     cleavage in vivo to generate a C-terminal fragment that
                     assembles into the Nup84p subcomplex of the nuclear pore
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498346.1"
                     /db_xref="GeneID:8206149"
                     /db_xref="GOA:C5DZX9"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR021967"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:C5DZX9"
                     /translation="MFNRNTNGGFLFGNANTSTPTSTPTPAPNSLQVPQKSGNLFGNA
                     NANLGVSTPSPSGGLFGNSNTQAGAGGGGGLFGNQSTTNKPLFSNGASTTNNTGGSSL
                     FGNTNTNTNTNTNANTSNNTTAPSTFSFGNNASKTNNNSSGGLFSNSGNQPTGGLFGN
                     KPTASGGLFGGSSAPQPQQQQPPNGNITASNPYGLNINNIPIPSVSDMPAPITSSKGN
                     KQGSESSSSGTSGLISSGSVMDGKRNFSLSSSSPSNLPTTTSLPSFSHSSLVNKLSAR
                     LKTVNQASAVQGLFSPSRNKLWDNHETGGVLTSNSSEYKPTHSNNTVLPSKGLSPFPL
                     QKGEVSDLRKLKIDPNRSAAKKVKLLSGMAATTKSFELDDGTTRNWDIKKSESRNSSV
                     SNLNNTDTDEFSSAETKVDGEEKPGNTKEEPKTDYWCSPSLEKLSHLPMNQLSIVPDF
                     VIGRKGYGCITFNREVDLTAFAPNLEEELFGRIVVFHPTKTVEVYPEESKKAPIGHGL
                     NVPATITLENIYPVDRKTKKPLKDGSRSDEVQLLIKRLKNMRDMEFISYNPFGGIWTF
                     KVNHFSIWGVVNEEDVEVDTAEVEKLKNENMSNRTLAFPKNKRKLVQSNAQGFTHSPK
                     ENGDRTQNDLLALQDQSGAEATDELVEDENGDDLFLEEKPYEPDVSEQDFAGMEVEPS
                     LNVSTDWVTQLKLAGSSLQSIFAAPKDLLAPGNDEIDMLFNEFNQSVELKKKIKKERK
                     LTSPLNFAKFCCDSKFLVKDSHGPVGAKLHNLLLPYQRDVAIVNSLFRKQLKGSVIME
                     RQSNAYPVVTQNSLQFKDVMELHGPSDPDYQVWKLCSLLFDAVDLPDSLDNEEVKANL
                     LKKERHRLLCSWIVDQVQEEIDAKLKKTTNALDQIFLYLAKNDIVGASQLAIKSQNGH
                     IAILISLLGSNDPGVCQLASLQLDKWNSAGNKVDSSVARIYRLLTGDLVNGSFLTAEM
                     MSEFNWLALLGVVLYYGKIDEFSLEDLINHFFRYFKKPENDIFLIILSLFSTPSSSEA
                     LLKKLKLNTTALESLFPWYFAQILRFGTAYKFSNVILDQLTLTSIEELKFANLHEEAL
                     LATCFLSNDFVAQQQIDSLVFHNIKRLSKSSNGYILDRLKISTKLIYQAKALNDKYNS
                     NYLSEAKHLLKAKSFEDAEKVIVTLVGPRLVIQGASTRLEELEILRTLLSSFPQNEME
                     NWESGLGVFDNFLKLILDKDYREELFSSLISGLSLLHQANRFHKEVPVCCNIMAQELV
                     TTFINEHGGKLDDNTKGKLLRLPLGQPEKVYLECMLAKTV"
     gene            complement(<660451..>661428)
                     /locus_tag="ZYRO0G08096g"
                     /db_xref="GeneID:8206150"
     mRNA            complement(<660451..>661428)
                     /locus_tag="ZYRO0G08096g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498302.1"
                     /db_xref="GeneID:8206150"
     CDS             complement(660451..661428)
                     /locus_tag="ZYRO0G08096g"
                     /note="highly similar to uniprot|P52920 Saccharomyces
                     cerevisiae YGL091C NBP35 Essential nuclear protein
                     evolutionarily conserved putative ATPase exhibits genetic
                     interaction with CDC2 encoding the catalytic subunit of
                     DNA polymerase delta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498347.1"
                     /db_xref="GeneID:8206150"
                     /db_xref="GOA:C5DZY0"
                     /db_xref="InterPro:IPR000808"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028601"
                     /db_xref="UniProtKB/TrEMBL:C5DZY0"
                     /translation="MTGTDIEQVLPPAYELKEPEPEHCPGPESENAGKGNACTGCANQ
                     SVCESLPKGPDPDIPAIVENLSNIKHKILVLSGKGGVGKSTFTTLLSWALSTDEDLQV
                     GAMDLDICGPSLPHMLGCSDETVHESSTGWTPVYVADNLATISIQFMLPEDDSAIIWR
                     GSKKNSLIKKFLKDVDWDQLDYLIVDTPPGTSDEHISISKYMKESGIDGALVVTTPQE
                     VALLDVRKEIDFCRKAGIRVLGLVENMSGFVCPNCKGESQIFKPTTGGGKALCEELGI
                     RFLGSVPLDPRIGRSSDQGESFLDTHPDSPASTAVLEVVEALRDEVGDF"
     gene            <662157..>663224
                     /locus_tag="ZYRO0G08118g"
                     /db_xref="GeneID:8206151"
     mRNA            <662157..>663224
                     /locus_tag="ZYRO0G08118g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498303.1"
                     /db_xref="GeneID:8206151"
     CDS             662157..663224
                     /locus_tag="ZYRO0G08118g"
                     /note="some similarities with uniprot|P53150 Saccharomyces
                     cerevisiae YGL090W LIF1 Protein involved in DNA
                     double-strand break repair physically interacts with DNA
                     ligase 4 (Lig4p) homologous to mammalian XRCC4 protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498348.1"
                     /db_xref="GeneID:8206151"
                     /db_xref="GOA:C5DZY1"
                     /db_xref="InterPro:IPR014751"
                     /db_xref="InterPro:IPR015381"
                     /db_xref="UniProtKB/TrEMBL:C5DZY1"
                     /translation="MKFVSCLPVSDAAVEHEEVDEVVLCESHFSQDNFPSSADAIENL
                     TIEWLVLSEGSEIHQRHNCRLYDLQVFTDASETKYIWYELLRQLTSHKVYNPDMEQKV
                     RYTRWICNAPEGGEWSLCMELKSGGIVRKIAQLQLTPASHCELNLFQMANTLFQECCA
                     CNDKMAQIKSQTDTIERHLNDLQEERKLLDQLLEKRDTKTRSVVVGLLNEKKRKIAEL
                     QRQLKDQGPQDAELINRYVTDPVRGHISPGRRRKRLDNHNSDTRRNPRLAPPPKKLRV
                     KKEESGSEPEPEPEGKQEFKFLGIKKQDNPVKQEDEELPDPSTSSTNESTSHTENSTD
                     EGENGDEDEDQDEDEEETDVE"
     gene            <663951..>665849
                     /locus_tag="ZYRO0G08140g"
                     /db_xref="GeneID:8206152"
     mRNA            <663951..>665849
                     /locus_tag="ZYRO0G08140g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498304.1"
                     /db_xref="GeneID:8206152"
     CDS             663951..665849
                     /locus_tag="ZYRO0G08140g"
                     /note="similar to uniprot|Q08925 Saccharomyces cerevisiae
                     YPL184C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498349.1"
                     /db_xref="GeneID:8206152"
                     /db_xref="GOA:C5DZY2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DZY2"
                     /translation="MHLYNTSDMNQLFNTSDIQFPNSDLSRSVTPEQAAWTGAPSNQI
                     LPPRYGLTELEARSSGYPVYPYQQDNNKSQLGQLQPQRPQPVVPPMSFSTPSGPSGIG
                     GISNGPGGPGASLIAGASAGGPVGASTGSGICDAFQEPDEYAMSQVSAFSSPYSSQST
                     QRLTQQQPPGPQNDYALATAAAAAVANANSYMPSIPQLGSNRNFNNAPSKTVYLGNTP
                     ITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRLHIDGRDI
                     KIGWGKPTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPVDVTEPVITEDKLR
                     LDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANLANINPYYRNKKIFYGKDRCA
                     FITKTQQHNAAQFLGVQPGMERLVQFSDSELISNALLQQSAAAAAIATSAGGPNNLGN
                     RTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSLH
                     GITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFDEDSKREDPIFTESS
                     LRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKGHPVFKDLKINFGKDRC
                     GNVPHQVR"
     gene            <666343..>666936
                     /locus_tag="ZYRO0G08162g"
                     /db_xref="GeneID:8206153"
     mRNA            <666343..>666936
                     /locus_tag="ZYRO0G08162g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498305.1"
                     /db_xref="GeneID:8206153"
     CDS             666343..666936
                     /locus_tag="ZYRO0G08162g"
                     /note="some similarities with uniprot|Q08926 Saccharomyces
                     cerevisiae YPL186C UIP4 Protein of unknown function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498350.1"
                     /db_xref="GeneID:8206153"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DZY3"
                     /translation="MVKVIYGHSADHFKELKVAGDFSQWEIKPMLKNSEFWEYNFYKG
                     SLPPEAKALHFKFIDDNGIWFTDNDYAKETDANNNENNVRILTAEEIGELGGDDDEME
                     EAGESSYDINDEGPVRPAPTPTARELKEPNESGELDESTVIVNHADVQEVNRDGERPE
                     TSGTVYSQGREVTDQYKTILARIIAFFTNLFRSWFSH"
     gene            complement(<667300..>667863)
                     /locus_tag="ZYRO0G08184g"
                     /db_xref="GeneID:8206154"
     mRNA            complement(<667300..>667863)
                     /locus_tag="ZYRO0G08184g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498306.1"
                     /db_xref="GeneID:8206154"
     CDS             complement(667300..667863)
                     /locus_tag="ZYRO0G08184g"
                     /note="similar to uniprot|P01149 Saccharomyces cerevisiae
                     YPL187W MF(ALPHA)1 Mating pheromone alpha-factor made by
                     alpha cells interacts with mating type a cells to induce
                     cell cycle arrest and other responses leading to mating
                     also encoded by MF(ALPHA)2 although MF(ALPHA)1 produces
                     most alpha-factor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498351.1"
                     /db_xref="GeneID:8206154"
                     /db_xref="UniProtKB/TrEMBL:C5DZY4"
                     /translation="MRLSIALGVTFGAVAGLTAPVEEVKRDADAHFIELDPGQPMFKR
                     EAEAHFIELDPGQPMFKREAEAEAHFIELDPGQPMFKREAEAEAHFIELDPGQPMFKR
                     EAEADAHFIELDPGQPMFKRDADAHFIELDPGQPMFKREAEAEAHFVELDPGQPMFKR
                     EAEADAHFIELDPGQPMFKRGEIESAA"
     gene            complement(<669189..>670454)
                     /locus_tag="ZYRO0G08206g"
                     /db_xref="GeneID:8206155"
     mRNA            complement(<669189..>670454)
                     /locus_tag="ZYRO0G08206g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498307.1"
                     /db_xref="GeneID:8206155"
     CDS             complement(669189..670454)
                     /locus_tag="ZYRO0G08206g"
                     /note="highly similar to uniprot|Q06892 Saccharomyces
                     cerevisiae YPL188W POS5 Mitochondrial NADH kinase
                     phosphorylates NADH also phosphorylates NAD() with lower
                     specificity required for the response to oxidative stress"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498352.1"
                     /db_xref="GeneID:8206155"
                     /db_xref="GOA:C5DZY5"
                     /db_xref="InterPro:IPR002504"
                     /db_xref="InterPro:IPR016064"
                     /db_xref="InterPro:IPR017437"
                     /db_xref="InterPro:IPR017438"
                     /db_xref="UniProtKB/TrEMBL:C5DZY5"
                     /translation="MLLRVPLRLGRFYTSLEYPAIRIRDYSKYVSLKSVQDLRLATSP
                     DFVTSANSKLQSLIWQKPMQNVFITKKPWTETTRSSMVHFISYLHDSFPEINVIVQPD
                     VADEIAQDFRSTPRQDPHQPHILYTGTDEEIVSRTDLLVTLGGDGTILRAVSIFGNRQ
                     VPPVLAFSLGTLGFLLPFDYQEHRRVFEKVISSRAKCLHRTRLECHIIRNGQSEDCSL
                     ATSLHAMNDLFLHRGNSPHLANLDIFIDGDFLTRTSADGVAFSTPTGSTAYSLSAGGS
                     IVSPLVPSILLTPICPRSLSFRPLILPHSSHIRVRVGSKATQGPANAMVKLSVDGIPQ
                     EDLRIGDEIHVVNEVGTIYLNGSQLPSTSNKRQVSERRKSIKNSGIYCIAKTENDWTR
                     GLNELLGFNSSFRLTKPQKEEELERDLTD"
     gene            complement(<670807..>671281)
                     /locus_tag="ZYRO0G08228g"
                     /db_xref="GeneID:8206156"
     mRNA            complement(join(<670807..671212,671271..>671281))
                     /locus_tag="ZYRO0G08228g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498308.1"
                     /db_xref="GeneID:8206156"
     CDS             complement(join(670807..671212,671271..671281))
                     /locus_tag="ZYRO0G08228g"
                     /note="similar to uniprot|P28263 Saccharomyces cerevisiae
                     YEL012W UBC8 Ubiquitin-conjugating enzyme that negatively
                     regulates gluconeogenesis by mediating the glucose-induced
                     ubiquitination of fructose-1 6-bisphosphatase (FBPase)
                     cytoplasmic enzyme that catalyzes the ubiquitination of
                     histones in vitro"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498353.1"
                     /db_xref="GeneID:8206156"
                     /db_xref="GOA:C5DZY6"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="UniProtKB/TrEMBL:C5DZY6"
                     /translation="MSKVPRSFRLLEELEKGEKGLGPESCSYGLADSDDISMTTWNGT
                     ILGPPHSNHENRIYSLSIECGPNYPDHPPTIKFISKINLPCVDSKTGQVTPSTFHTLR
                     DWKRAYNMETILLELRKEMATPANKKLPQPKEGSTF"
     gene            <671493..>673457
                     /locus_tag="ZYRO0G08250g"
                     /db_xref="GeneID:8206157"
     mRNA            <671493..>673457
                     /locus_tag="ZYRO0G08250g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498309.1"
                     /db_xref="GeneID:8206157"
     CDS             671493..673457
                     /locus_tag="ZYRO0G08250g"
                     /note="similar to uniprot|P40957 Saccharomyces cerevisiae
                     YGL086W MAD1 Coiled-coil protein involved in the
                     spindle-assembly checkpoint phosphorylated by Mps1p upon
                     checkpoint activation which leads to inhibition of the
                     activity of the anaphase promoting complex forms a complex
                     with Mad2p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498354.1"
                     /db_xref="GeneID:8206157"
                     /db_xref="GOA:C5DZY7"
                     /db_xref="InterPro:IPR008672"
                     /db_xref="UniProtKB/TrEMBL:C5DZY7"
                     /translation="MVSSNGGSSPFLESPVHASPKMSPQTDRQVMSLQYKLNTVQNEF
                     EIEKLRLQQQSNLLDKKYRNVVEELEKALDDTKYLYETNGRLEQELSDLKNSSNQNDD
                     TRDEELRRLRSELRAKDYRIDELESNYQSKLSKLERKLENNQVESQSSQTLLKRYEEE
                     ISKQSGQIKMLQRANSEKDDELATLKASNVVTQHHNYSTEDLQELTVTNKMLQDQLQY
                     SKELEEANMQQAGELKRLRMTSESQNFWKSENEKLQNKVEQLNLLEKQFQDSQLENVQ
                     LKSQIASWGLYTDGKQSPEDIVRDWTLTKKECIVLNDENKKIRFDLMNLKNLNDELAH
                     ERNQLLELNKNYEANIINLKKLNHEVEQQKQLSFEECRLLRIEMEELSKFSKDSNRDA
                     DAGYGSLVDSYKNQTEDLTGELKKLNDQLLAREPATKKRKASDQLGLNYSQRLNELQL
                     ENVSLSRELKKCQDTITILEDKIKNLTELKEKKIRILQLRDNPLLKDQFVKRKQLELL
                     KKENADLLQFAQANNNGDKELESVPISVYESINFEIKQREEGLFRANKKFVRLKEVFN
                     KKSLEFIDVVNSLLGFRLEFQQDGKVKIISCFKPERSLVVDLNQNTLKSNLDRDIEDW
                     ESLLQLWVDQRGQIPCFLATITLKLWEESA"
     gene            <673661..>674491
                     /locus_tag="ZYRO0G08272g"
                     /db_xref="GeneID:8206158"
     mRNA            <673661..>674491
                     /locus_tag="ZYRO0G08272g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498310.1"
                     /db_xref="GeneID:8206158"
     CDS             673661..674491
                     /locus_tag="ZYRO0G08272g"
                     /note="similar to uniprot|P53153 Saccharomyces cerevisiae
                     YGL085W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498355.1"
                     /db_xref="GeneID:8206158"
                     /db_xref="GOA:C5DZY8"
                     /db_xref="InterPro:IPR016071"
                     /translation="MGDNRNLPVTQPNSINFNVVILSIFFSGSFIGAWAFFNRFLKQY
                     TKATEIPQNVFRKRWLFGKVTAVGDGDNFHFFHAPGGLIAGWGWLRPLPELNKSDPPI
                     SSSKVGSSVPIHRRIFDSIFGRNKTRTAYSNYFLGLPVPYKNKRNLPTISIRICGVDA
                     PERAHFGNPAQPFSEEALIWLRHTLIGKCVWIKPLAVDQYNRCVAKVEYWTWTGWKNV
                     SLEMVKQGLAVVYESKTSAEFDGEEDKYRFHEMAAKARRRGIWSQKQFETPGEYKRRI
                     "
     gene            complement(<674545..>676419)
                     /locus_tag="ZYRO0G08294g"
                     /db_xref="GeneID:8206159"
     mRNA            complement(<674545..>676419)
                     /locus_tag="ZYRO0G08294g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498311.1"
                     /db_xref="GeneID:8206159"
     CDS             complement(674545..676419)
                     /locus_tag="ZYRO0G08294g"
                     /note="similar to uniprot|P53154 Saccharomyces cerevisiae
                     YGL084C GUP1 Multimembrane-spanning protein and similar to
                     uniprot|Q08929 Saccharomyces cerevisiae YPL189W GUP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498356.1"
                     /db_xref="GeneID:8206159"
                     /db_xref="GOA:C5DZY9"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="UniProtKB/TrEMBL:C5DZY9"
                     /translation="MVLEALTDGLQRFFSFGVLDHRLEPSSRDRRRQMLLSKIYATPR
                     GRVSSKVSKQGPFGDLAIQSPLWKTWEFKFYYLAFVIVVPLTIKSVMDASSEENPNYS
                     LYEPLLSRGWIFGRKVDNSDLQYSFFRDNLPLLLGVMVLHTSIKRITLKLTKISKVYF
                     DFIFGIAFVVAAFGVNCFKYFAEILITFSIGSAFKFNPRLAILLSWTFGISLLFFNQK
                     YSRYSYGSISSILSCLDGQFQGLIPRWDVFFNFTLLKILSYNMDFLEKWQEKQSADIN
                     NSSIALKSLGKVSPPGSRSESPMSNASGSATGSSLELHKTRSNQHPLEEKERLVAPHP
                     LHDYNLLHYIAYVTYTPLFIAGPTITFNDYLYQTRVTLPSISLRNTTVYAIRFAFCFL
                     TMEVIVHFAYVVAITQRKAWYGDSPFQIFMIGLFGLTVVWLKLLIPWRLFRLWALMDC
                     TDTPENMIRCVYNNYSCLAFWRAWHRSFNKWVVRYIYIPLGGSQNRILTSLAVFSFVA
                     IWHDIKLRLLLWGWLIVLLLLPEMFATKYMNRYSDRSWYRHLCAAGGVVNIWVMVIAN
                     LFGFCMGTEGTKDFLKEIFGTVAGLRFFLLASGFLFIMVQIMFEQREHEKRKGINIRC
                     "
     gene            <677123..>679465
                     /locus_tag="ZYRO0G08316g"
                     /db_xref="GeneID:8206160"
     mRNA            <677123..>679465
                     /locus_tag="ZYRO0G08316g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498312.1"
                     /db_xref="GeneID:8206160"
     CDS             677123..679465
                     /locus_tag="ZYRO0G08316g"
                     /note="similar to uniprot|P53009 Saccharomyces cerevisiae
                     YGL083W SCY1 Suppressor of GTPase mutant"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498357.1"
                     /db_xref="GeneID:8206160"
                     /db_xref="GOA:C5DZZ0"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ0"
                     /translation="MFWFSKTGISSKYTFSASPTFITEPWSVYTGRPKDTSTSSSGPS
                     KVSIFIFDKKRFETHLLTYGIIKSKNSSHDKALIAEAYEVLRNQVGNLAKLKHPNILH
                     VVEPLEEHSKNFMFVTEYVTGSLESVFTNVDEELNFFKGHVREDIVIQRGILEITQAL
                     EFIHNRASCVHLDIQPRSVFINDNSDWKVSGFGHLWNLPQSTNSAEYFMQQFDPRVPP
                     FMHLALDYTAPEIVLDSTVSFKSDYFSLGSLILKLYTGKSLLNSENSSSQYRDEYAKF
                     ERKLVNRSWEGVISNIPHNLKICMPKLMNRDIYERYENISDFLKCDFFQDPLMKTLNF
                     LDDLPTKDRDDRLLYLEGLVELLPKYPSSLLQRKFLTVLLHLLSQLCGDVKLDAASLS
                     MDVHLIIRIGSTLSQLTFQERVFPVLADKSNFPHILKHATLPLAENISTLKDKIRQDD
                     FMQVILKPLITYVFRDMKDELAVPTQEKLLEKMAVLTDIFDFLTVKSFLLPLLSELFG
                     RTTSLTVKTACVSCFQLLIERKNVDTDLTCQEILPLFQSMKTRDPRILMQSLNLFETV
                     PHVVKSENLLVEQLLPLLWRYSLAPTLQTSQYAQYLQTTNKITSDIQQNHMESLSKTN
                     RSQDANGTRDFNRLIEPTKINDPPREDTDTKNANSIATPAIQPVRKTSANKASTPLNP
                     LTAKFTEELPSRSKLTRPPRRPEVKTTKLDEDDFDEFVSAASPTLSQRNINVSQPNGT
                     DSPSYNSLQTPQTSGGSNTQTVNSISLPPGFSVPLQPSKK"
     gene            <679961..>680164
                     /locus_tag="ZYRO0G08338g"
                     /db_xref="GeneID:8206161"
     mRNA            <679961..>680164
                     /locus_tag="ZYRO0G08338g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498313.1"
                     /db_xref="GeneID:8206161"
     CDS             679961..680164
                     /locus_tag="ZYRO0G08338g"
                     /note="similar to uniprot|Q3E823 Saccharomyces cerevisiae
                     YPL189C-A"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498358.1"
                     /db_xref="GeneID:8206161"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ1"
                     /translation="MRAATRINVTNKLYVSTFLVAFSSVALTSIFPCPAHSLDSDSPA
                     DELPQDETKQSQLLKKRELQGKF"
     gene            <680710..>682986
                     /locus_tag="ZYRO0G08360g"
                     /db_xref="GeneID:8206162"
     mRNA            <680710..>682986
                     /locus_tag="ZYRO0G08360g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498314.1"
                     /db_xref="GeneID:8206162"
     CDS             680710..682986
                     /locus_tag="ZYRO0G08360g"
                     /note="similar to uniprot|P38996 Saccharomyces cerevisiae
                     YPL190C NAB3 Single stranded DNA binding protein acidic
                     ribonucleoprotein required for termination of non-poly(A)
                     transcripts and efficient splicing interacts with Nrd1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498359.1"
                     /db_xref="GeneID:8206162"
                     /db_xref="GOA:C5DZZ2"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ2"
                     /translation="MSDNNGAYEPVTDTDNVGSQTEASGSSEAQDAMKSILASVEEAK
                     QNASDSDGNDDEEEGSDDLYEDKSGSENDNKETGSANEEQEDEENTSQGSSNKEELRD
                     EHSSEGSDEESSKEKDVKVEEAGEKQTEEKEESYDEDNNDNDNSESSEESNRAQEEQD
                     EEEMDEEEKSIENGVDEDTKPASVQSSLRDATIHNELLQKQANYIMASDMLNLAEFQE
                     LSSRDKVAAIVNMLNSNPDTALPTSGSSVTNNSESDGFPEQTNWPRPSVDEKQRPDLN
                     GPMTAVERERYNKYLRGENKITEMHDIPPKSRLFIGNLPLKNVSKEELFRIFSPYGHI
                     LQINIKNAFGFIQYDNPQSVRNAIAHESQEMNFGKKLILEISSSNARPQFDHGDHGTN
                     SSSTFISSSKRPFQHEDNDAADMYNDNQGYKKSKRCVPACVIYVKRTADRSYANEVFS
                     HFRRGTGLETDMIFLKPRMELRRMINDVAYDGVWGVILVNKTRNVDIQIFYKGPQGET
                     KFDEYISISSDDAIAIFNNLKTSKGSGGMSASRAPPPTTLVGAPNPYAAAAPPPPHQS
                     YYGGYGLTPPMAQQPPMAPQQPPYVQAAPSAYAPYGAPAPAPPTATPYGRYQPQLAQP
                     MPAAPPPPPAAAAAAGDPGQHQLLAAIQNLPPNVVSNLLAAAQQQQQQQQQPQTNQQL
                     LGLLQSMQPQPQPQQQQQQQFASQPVPQPQFQRLQQQHFPQPPAPLNSPPHQTQQPQQ
                     SAGNNVQSLLDSLAKLQK"
     gene            <683440..>684585
                     /locus_tag="ZYRO0G08382g"
                     /db_xref="GeneID:8206163"
     mRNA            <683440..>684585
                     /locus_tag="ZYRO0G08382g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498315.1"
                     /db_xref="GeneID:8206163"
     CDS             683440..684585
                     /locus_tag="ZYRO0G08382g"
                     /note="similar to uniprot|P53155 Saccharomyces cerevisiae
                     YGL082W and similar to uniprot|Q08930 Saccharomyces
                     cerevisiae YPL191C Hypothetical ORFs"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498360.1"
                     /db_xref="GeneID:8206163"
                     /db_xref="InterPro:IPR007518"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ3"
                     /translation="MSLSFATKPVQVNGIPHRILLQNDNGPCALLALANTLLLAPRYA
                     AEARELATLAQHSSVKLEDLVQVLANIAIMSPNGANTDVNQLFQILPQLHTGLNVNPI
                     FNGSFEDGIEMAIFRLYNVGIVHGWIIDGDSDPIAREHVSKYSYESAQKILLQSYDIQ
                     NGSYSPHNSQEIIEDANYIRSFLARSATQLTDYGLVHLKEILVEKSYAVLFRNDHFST
                     IYKYEGELFTLVTDLGYKNRPDIVWQSLKSVNGSADVFYTGNFIPATQAAQEGPEQPI
                     DSDAAVATGATSNPAVNGGGVNNPFLGEGESETSAPYQLQQIEDDEALAKRLQEEEDD
                     RAATNMQRSYQRREKKKTVAENGNGNGDGNDTKSRKRDKIKKSCIIM"
     gene            <684847..>685782
                     /locus_tag="ZYRO0G08404g"
                     /db_xref="GeneID:8206164"
     mRNA            <684847..>685782
                     /locus_tag="ZYRO0G08404g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498316.1"
                     /db_xref="GeneID:8206164"
     CDS             684847..685782
                     /locus_tag="ZYRO0G08404g"
                     /note="some similarities with uniprot|P53156 Saccharomyces
                     cerevisiae YGL081W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498361.1"
                     /db_xref="GeneID:8206164"
                     /db_xref="InterPro:IPR000253"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ4"
                     /translation="MEEVRKFRFSLREAQSDRGVIKVFGRASRKDPNRIAQRDNLFYD
                     ERSLSRNHALLGIKLMEPLADGITMDQFRIYVKDLESTYGIVDLNSQESDPFVIDLKN
                     GERFGLIKLNNPISVNQRRGAKLKFQIDVDDVGEDEFECRVSDVSFDDSPLVTRPSTC
                     DNEIEFLSMLQGFSPSDSESESESEGTPCAPNDDMDSVSENSFYSETSESYALVNLYT
                     LPKVDIWDEDDEESDVRKEDFKVNEERIGNKRPLPDADDEDAQDEGQDIQFRPNKRAK
                     TGIVSKRDIITGTIGFLLGSVGTIGFLIGIAGRLE"
     gene            <685941..>686255
                     /locus_tag="ZYRO0G08426g"
                     /db_xref="GeneID:8206165"
     mRNA            <685941..>686255
                     /locus_tag="ZYRO0G08426g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498317.1"
                     /db_xref="GeneID:8206165"
     CDS             685941..686255
                     /locus_tag="ZYRO0G08426g"
                     /note="some similarities with uniprot|Q08931 Saccharomyces
                     cerevisiae YPL192C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498362.1"
                     /db_xref="GeneID:8206165"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ5"
                     /translation="MSDNEKVDKTEPKDSSVEVSPVKRVKRLEKKPLTPTKGRVSKPA
                     RQRTVSPRMKAKQVALATTRNPQQQQRQNKDSFYRGALLGSFLGATLSTVITNAIAKL
                     LG"
     gene            complement(<686252..>687217)
                     /locus_tag="ZYRO0G08448g"
                     /db_xref="GeneID:8206166"
     mRNA            complement(<686252..>687217)
                     /locus_tag="ZYRO0G08448g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498318.1"
                     /db_xref="GeneID:8206166"
     CDS             complement(686252..687217)
                     /locus_tag="ZYRO0G08448g"
                     /note="similar to uniprot|Q08932 Saccharomyces cerevisiae
                     YPL193W RSA1 RiboSome Assembly"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498363.1"
                     /db_xref="GeneID:8206166"
                     /db_xref="InterPro:IPR019496"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ6"
                     /translation="MYNPSSYGSPYPDPPPYGRALPRPTSSGTLENDVKRQKLDRPSP
                     YYIPQYQYGQPPPMTVPVPAPAPAPAPAPAPAPAPAPYYSPPQPTTYGSYWNQPVYPP
                     PNVPYMATPQALAPVKDSPVPTIKESRKEPLKNEPSIEESDAEENDDDGDVDGGNEAN
                     GDEATSSTSTIQGTSITLATEEDIAKWKEERKKMWLLKISNKRKEHMERMGVKEEELK
                     GHSILHETKKQKQFIQNIQNQVNRTNPKSNLNVKIVQREMAQENVQLLQFIKELGDSH
                     LLDYELTAEEKSKLFGSPDDKQRNARKPYTRGNHNNTNNARRGKS"
     gene            <687952..>688335
                     /locus_tag="ZYRO0G08470g"
                     /db_xref="GeneID:8206167"
     mRNA            <687952..>688335
                     /locus_tag="ZYRO0G08470g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498319.1"
                     /db_xref="GeneID:8206167"
     CDS             687952..688335
                     /locus_tag="ZYRO0G08470g"
                     /note="similar to uniprot|P53157 Saccharomyces cerevisiae
                     YGL080W FMP37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498364.1"
                     /db_xref="GeneID:8206167"
                     /db_xref="GOA:C5DZZ7"
                     /db_xref="InterPro:IPR005336"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ7"
                     /translation="MSQPVQRAAQRSLISRYVNKETLKYIFTTHFWGPVSNFGIPIAA
                     IYDLQKDPTLISGTMTSALLVYSAVFMRYAFAVTPKNFLLFGCHVINETAQLGQAYRF
                     LDYNYFSSPEKQAAIKAKYATVVPN"
     gene            complement(<688463..>690133)
                     /locus_tag="ZYRO0G08492g"
                     /db_xref="GeneID:8206168"
     mRNA            complement(<688463..>690133)
                     /locus_tag="ZYRO0G08492g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498320.1"
                     /db_xref="GeneID:8206168"
     CDS             complement(688463..690133)
                     /locus_tag="ZYRO0G08492g"
                     /note="similar to uniprot|Q08949 Saccharomyces cerevisiae
                     YPL194W DDC1 DNA damage checkpoint protein part of a
                     PCNA-like complex required for DNA damage response
                     required for pachytene checkpoint to inhibit cell cycle in
                     response to unrepaired recombination intermediates
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498365.1"
                     /db_xref="GeneID:8206168"
                     /db_xref="GOA:C5DZZ8"
                     /db_xref="InterPro:IPR007268"
                     /db_xref="InterPro:IPR026217"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ8"
                     /translation="MSFKATFQDSEKHNIWFRTVSALTTVRKDINFTITSAELIAWAI
                     NTTDTTLCQVRFARSFFEDYEFKPYEIVFGEDGVQIVPDSHGTDQKLYSFEVNGRHLT
                     TISKKPDGDSVNEFTIAINNTASCPDVLANRLLIHIEMSSLISKDYTPQFTPIKYDPI
                     VIDLKYKRKFLDVYGSKSRSVQETLNHRLSEIFVEAERELSTALFNENNEPNPKDMNQ
                     LTMADEINLVCCNQALIKNFLDNCNPNITEEMKLEISHQKLCVTAFTKAIYGKNNDVL
                     RNNISLSNTISTSDLECHCLFLKEINNGDKGDDGTKSIVFKLKDFKNFMSIGSSGKSS
                     LSGNLNIWFCHRGEPLLVELNRPDVKSELVQITDSSGMANAENENAITKATATVSPNT
                     RASREPFKAEPFLPRVSPLKSSSVPSKETRRSPLKNMGGSIPNKSSITRQLFVKEDDE
                     HPLSVWNHEEEELKREQPEPNEEILLAAPAERSRTTVGWGQRPLEPDHSLKPMDKQSM
                     LKQEKRKYLQELKDEQKRQKREINDRSTQESQEGLGPTQPNRPKGLFD"
     gene            complement(<690407..>693211)
                     /locus_tag="ZYRO0G08514g"
                     /db_xref="GeneID:8206169"
     mRNA            complement(<690407..>693211)
                     /locus_tag="ZYRO0G08514g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498321.1"
                     /db_xref="GeneID:8206169"
     CDS             complement(690407..693211)
                     /locus_tag="ZYRO0G08514g"
                     /note="similar to uniprot|Q7LIB1 Saccharomyces cerevisiae
                     YPL195W APL5 Delta-like subunit of the yeast AP-3 complex
                     which functions in transport of alkaline phosphatase to
                     the vacuole via the alternate pathway suppressor of loss
                     of casein kinase 1 function delta-like subunit of the
                     yeast AP-3 adaptin component of the membrane-associated
                     clathrin assembly complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498366.1"
                     /db_xref="GeneID:8206169"
                     /db_xref="GOA:C5DZZ9"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017105"
                     /db_xref="UniProtKB/TrEMBL:C5DZZ9"
                     /translation="MSSLYAPTNEDVKQRLRPFGIFFEKSLKDLIKGIRANNETPEKL
                     NHFLAQALSECREEANSPDFNLKTNAVLKLTYLEMYGFDMSWANFHILEVMSSSKLQQ
                     KRVGYLAASQSFYKDPDILMLATNLMKKDLKYTGTDDVVKVGIALSGLSTIITPPLAA
                     DICDDLFTMLNSSRPYIRKKAITALFKVFLQFPEALRDNFDKFAAKLEDDDTSVVSAA
                     VSVICELSKKNPQPFIQLSPLLYEILVTISNNWIIIRLLKLFTNLSKVEPKLRPRLLP
                     KILELMDSTTATSVLYESINCIVKGHMLEEDDYDVAMQCLDRLHTFCDSSDPNLRYIS
                     CVLFYKIGKINTAFISQFDKLVMRLLNDVDVSIRSKAIELIEGIVDEDNLQNIVLVLL
                     KQFVDQDVVLLQVGGFETTREIPIFIPEQYKIKMVNAVIHICSMDNFANLNDFEWYNA
                     VLWDLAILSQDLSDKSLGYRVGEQLRNIMIKVPSMREITMTTIIKVLYNEEINNHLPS
                     ILKDCFWSLGEFSSFIENGDDLINLVFQRRKYYPADVEIILIPSLLKIFSNWCNRSTD
                     IDPERVKSVLSDLLSHFEPLCYSKAFEVQERAVQCMEFLKLASEAMEQDTEGLPLLLT
                     DILPSFFNSYELKPISQGTQQKLQSCISVDCETPFLTEEELQAVLNQEENENDEGLFS
                     EDLLLIDDSSSASYQNQDYDVPDESKANSEEPNVLDNEELESRKRAERESNPFYLSQN
                     NDRTSKASTQLLDFSHREADEPEAHLIRLNKNTNGTEDETERKRKSKKKHKKRVHVLS
                     DEVVVENKPQSPTLSIQSLPTNASSSRGKISLRMPTKLEKFDFSKPLVSPSHDGTSDA
                     RRQSTSGEQDELERLRRKFETQQLEANETLENGENDEETIIIKKKKSSKKKKKHSSSK
                     KSKKKDSVDETPKVSNDTVI"
     gene            <693417..>694004
                     /locus_tag="ZYRO0G08536g"
                     /db_xref="GeneID:8206170"
     mRNA            <693417..>694004
                     /locus_tag="ZYRO0G08536g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498322.1"
                     /db_xref="GeneID:8206170"
     CDS             693417..694004
                     /locus_tag="ZYRO0G08536g"
                     /note="similar to uniprot|P53158 Saccharomyces cerevisiae
                     YGL079W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498367.1"
                     /db_xref="GeneID:8206170"
                     /db_xref="GOA:C5E000"
                     /db_xref="InterPro:IPR019371"
                     /translation="MDDSSSEARAGIENDTTVRSRSPSVDSQSYAIPMPEEIEEQLSE
                     ESSSFDDSNSVESNEDQILGRALPESGQHAFSQDSQEFEPMLDVSKHIFDSLMQAIDS
                     ADFSEAISLQTKTSAVINSKSTELKQLIDETKVRFSQFKERFEKGSLTAKNIRGNLRY
                     SKDKIEKINALVRTSYPIEFNEAREKILERPLDDH"
     gene            complement(<694035..>694820)
                     /locus_tag="ZYRO0G08558g"
                     /db_xref="GeneID:8206171"
     mRNA            complement(<694035..>694820)
                     /locus_tag="ZYRO0G08558g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498323.1"
                     /db_xref="GeneID:8206171"
     CDS             complement(694035..694820)
                     /locus_tag="ZYRO0G08558g"
                     /note="similar to uniprot|Q08952 Saccharomyces cerevisiae
                     YPL196W OXR1 Protein of unknown function required for
                     normal levels of resistance to oxidative damage null
                     mutants are sensitive to hydrogen peroxide"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498368.1"
                     /db_xref="GeneID:8206171"
                     /db_xref="InterPro:IPR006571"
                     /db_xref="UniProtKB/TrEMBL:C5E001"
                     /translation="MGAFSRLKKSWSQSNYDTLKSRNNGGGPSKNINTHATEPNLKNN
                     LDNDEDVLPPITLNGYSPGTKRRLLTPEMCDEIRTLMPTRIQLYTDWNLLYSLEQHGS
                     SLQSLYHNVTPKSKSPMRVGYVLVIKDSKQGIFGAYSNEPFHPTSDRRYYGNGECFLW
                     KMEKVPNLTIGCDGKTKTNIENGNEHKWQFRGYPFTGLNEFAIYCQSDFLSMGAGDGH
                     YGLWCDDNLFHGVSNPSLTYGNDVLSREGNKFHITALEVWKVG"
     gene            complement(<695127..>696746)
                     /locus_tag="ZYRO0G08580g"
                     /db_xref="GeneID:8206172"
     mRNA            complement(<695127..>696746)
                     /locus_tag="ZYRO0G08580g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498324.1"
                     /db_xref="GeneID:8206172"
     CDS             complement(695127..696746)
                     /locus_tag="ZYRO0G08580g"
                     /note="similar to uniprot|P20447 Saccharomyces cerevisiae
                     YGL078C DBP3 Putative ATP-dependent RNA helicase of the
                     DEAD-box family involved in ribosomal biogenesis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498369.1"
                     /db_xref="GeneID:8206172"
                     /db_xref="GOA:C5E002"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E002"
                     /translation="MSKKELKDKKRVSEDDSNVDTKKHKSDKKEHKVKKDKKEKKDKK
                     EKKEKKEKKEKKEKKKEKESNKDSKIEKEEVKEEKENEEENVVIGGYQQSKDLANVPQ
                     SDIDSFYKENEVSVEDSQKYNLRPLLSFSHLSLKPEIQSEISKFPKPTPIQSVSWPYL
                     LSGRDVIGVAETGSGKTFAFGVPAIDQLVSNGDAKRKSVKVLVISPTRELASQTYDNL
                     IILTNKVGLECCCVYGGVPKQEQRNQLRNSQVVVATPGRLLDLINEQSVDLSQVQYLV
                     LDEADRMLEKGFEEDIKNIINQTNSRDRQTLMFTATWPKEVRELASTFMRDPVKVSIG
                     NRDELSANKRITQIVEVIEPRQKDRKLLELLRKYQSGAKKDDKVLIFALYKKEASRVE
                     NNLKYNGYDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAARGLDIPNVKTVINL
                     TFPLTVEDYVHRIGRTGRAGQTGTAHTLFTDNEKHLAGALVNVLNGANQPVPEELKKF
                     GTHTKRKEHGAYGAFFKDVDMSKKPKKVTFD"
     gene            complement(<697178..>698887)
                     /locus_tag="ZYRO0G08602g"
                     /db_xref="GeneID:8206173"
     mRNA            complement(<697178..>698887)
                     /locus_tag="ZYRO0G08602g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498325.1"
                     /db_xref="GeneID:8206173"
     CDS             complement(697178..698887)
                     /locus_tag="ZYRO0G08602g"
                     /note="similar to uniprot|P19807 Saccharomyces cerevisiae
                     YGL077C HNM1 Choline transporter (permease) that also
                     controls the uptake of nitrogen mustard expression is
                     co-regulated with phospholipid biosynthetic genes and
                     negatively regulated by choline and myo-inositol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498370.1"
                     /db_xref="GeneID:8206173"
                     /db_xref="GOA:C5E003"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004756"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="UniProtKB/TrEMBL:C5E003"
                     /translation="MSTSGEFQQRSSQSEIHKREFYEAPNEELSMDKNDMDKYDDESG
                     SGGSEEVVLRKSFSLWSILGVGFGLTNSWFGISASLVTGLSSGGPLLVIYGIILISLI
                     SITIGVSLGELTSAYPHAGGQFWWSLKLAPPKHKRFAAYMCGSFAYAGAIFTSASTTL
                     SVASELVAMYQLTHEDFTPKRWQVFVTYLILHFFLMQFNCYGKSLPLIASSSLYISLL
                     SFIVITITVLACSSGHFNSAKFVFSHFYNETGWSSGGIAFIVGLINPAWSFSCLDCAT
                     HMAFEVEKPETIIPTAILGTIAIGFITSFCYVISLFFSIRDLPSVLNNTGGFPVLVIY
                     EQALNSKAGAIVLGCLILFTSFGCVIASHTWQSRLCWSFSRDGGLPFAGLWSKVNSRM
                     GVPLNAHLMSCVWVAIIGFLYLASSTAFNSLITACIAFLLLSYSIPVICLLMKKRQIA
                     HGPFWFGKFGLFCNIALLLWTVFCLVFFSFPPDYPVNKDNMNYVSVVIVGYFLYSLIY
                     WKFWASKDFHTHDDDDDEQTVAQEISNEGFDEYDGTDDSRTHSSVIATTPQHMDFIEK
                     STK"
     gene            complement(<699877..>701213)
                     /locus_tag="ZYRO0G08624g"
                     /db_xref="GeneID:8206174"
     mRNA            complement(join(<699877..700506,700772..700865,
                     701203..>701213))
                     /locus_tag="ZYRO0G08624g"
                     /product="60S ribosomal protein L7"
                     /transcript_id="XM_002498326.1"
                     /db_xref="GeneID:8206174"
     CDS             complement(join(699877..700506,700772..700865,
                     701203..701213))
                     /locus_tag="ZYRO0G08624g"
                     /note="highly similar to uniprot|P05737 Saccharomyces
                     cerevisiae YGL076C RPL7A and to uniprot|Q12213
                     Saccharomyces cerevisiae YPL198W RPL7B Proteins component
                     of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L7"
                     /protein_id="XP_002498371.1"
                     /db_xref="GeneID:8206174"
                     /db_xref="InterPro:IPR005998"
                     /db_xref="InterPro:IPR012988"
                     /db_xref="InterPro:IPR016082"
                     /db_xref="UniProtKB/TrEMBL:C5E004"
                     /translation="MVAEKVLAPETHLKKTAAQQKSAEQIAAERKAHKAANQEKRQVI
                     LQRNTQYQKEYEAAERAVIDAKREAKVNGTFYVEGQPKLVFVVRIKGINHMAPKQRKV
                     LQLMRLNQINNGVFVKVTKATTELLKLIEPYIAYGYPSYSTIRQLVYKRGFGKINKQR
                     IALSDNQIVEEHLGKYGILSIDDLIHEIYTVGPHFKQANNFLWPFKLSNPNGGWGVPR
                     KFKHFIQGGALGNREQFINKLVKSMN"
     gene            complement(700595..700684)
                     /gene="SNR39"
                     /locus_tag="ZYRO0G08646r"
                     /db_xref="GeneID:8206175"
     ncRNA           complement(700595..700684)
                     /ncRNA_class="snoRNA"
                     /gene="SNR39"
                     /locus_tag="ZYRO0G08646r"
                     /product="snR39"
                     /note="C/D snoRNA intronic SNR39/SNR59"
                     /transcript_id="XR_002648431.1"
                     /db_xref="GeneID:8206175"
     gene            complement(701588..701682)
                     /gene="SNR39b"
                     /locus_tag="ZYRO0G08668r"
                     /db_xref="GeneID:8206802"
     ncRNA           complement(701588..701682)
                     /ncRNA_class="snoRNA"
                     /gene="SNR39b"
                     /locus_tag="ZYRO0G08668r"
                     /product="snR39b"
                     /note="C/D snoRNA monocistronic SNR39b"
                     /transcript_id="XR_002648432.1"
                     /db_xref="GeneID:8206802"
     gene            <701987..>702745
                     /locus_tag="ZYRO0G08690g"
                     /db_xref="GeneID:8206803"
     mRNA            <701987..>702745
                     /locus_tag="ZYRO0G08690g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498327.1"
                     /db_xref="GeneID:8206803"
     CDS             701987..702745
                     /locus_tag="ZYRO0G08690g"
                     /note="similar to uniprot|Q08954 Saccharomyces cerevisiae
                     YPL199C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498372.1"
                     /db_xref="GeneID:8206803"
                     /db_xref="InterPro:IPR002625"
                     /db_xref="InterPro:IPR013899"
                     /db_xref="UniProtKB/TrEMBL:C5E005"
                     /translation="MNHSVAVGRGPMLTHSPQDYNHATDSEYQRLRDLAEQAYERKHK
                     LSHESQVAYKSGQKAKAHELSEKSKQEVAKAEDYNLQAAEYVFRQNNADSASDEIDLH
                     GLYVKEAQWILKKRIYATIQQGDPQIRVIVGKGLHSPHGIAKLKPAVEELCDEARLKN
                     YIDPHNAGVLIIELKGSQVPQSWNAPDPGLSVSKPQQAHTMGYQPPQGPQYQQQQQPH
                     MAPPQQQQQQQQGGDGNLLVQMLSLLCVCISKSL"
     gene            complement(<702763..>703794)
                     /locus_tag="ZYRO0G08712g"
                     /db_xref="GeneID:8206176"
     mRNA            complement(<702763..>703794)
                     /locus_tag="ZYRO0G08712g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498328.1"
                     /db_xref="GeneID:8206176"
     CDS             complement(702763..703794)
                     /locus_tag="ZYRO0G08712g"
                     /note="weakly similar to uniprot|P53159 Saccharomyces
                     cerevisiae YGL075C MPS2 Essential membrane protein
                     localized at the nuclear envelope and spindle pole body
                     (SPB) required for insertion of the newly duplicated SPB
                     into the nuclear envelope potentially phosphorylated by
                     Cdc28p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498373.1"
                     /db_xref="GeneID:8206176"
                     /db_xref="GOA:C5E006"
                     /translation="MDFDKSSSSLVLDLAWNQVDKKNQDFIYAKDFPALIMSIEEILS
                     RGQQTPLAFLSNTGKSVIDTFAREKEFFKIYRDEFKEIFHGLVGKTFKDTIEGTNVSR
                     SVLDEQGQEPDVSTTPTRQQRSSPRKVNRLLKNLETRVASMKDELKFKDEILAEKDRE
                     LIQLTRKLSDYKDKYEFVQRQFSFYKDHGESPRRNSSESEQLNLEQNASTKHEFIISE
                     LKRKLQEQTLAISNLKEQLQRGEGAGVLYTNYSKRYNPLHNDGPMVLVLATLVFLTII
                     LLIGSMIWVTGGKDDSNSFSQYSWWENNSLLSRIGWFFRDWSDTGVDYVNFEPSSDAY
                     ERIMGIRRI"
     gene            <704684..>706402
                     /locus_tag="ZYRO0G08734g"
                     /db_xref="GeneID:8206177"
     mRNA            <704684..>706402
                     /locus_tag="ZYRO0G08734g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498329.1"
                     /db_xref="GeneID:8206177"
     CDS             704684..706402
                     /locus_tag="ZYRO0G08734g"
                     /note="similar to uniprot|P10961 Saccharomyces cerevisiae
                     YGL073W HSF1 Trimeric heat shock transcription factor
                     activates multiple genes in response to hyperthermia
                     recognizes variable heat shock elements"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498374.1"
                     /db_xref="GeneID:8206177"
                     /db_xref="GOA:C5E007"
                     /db_xref="InterPro:IPR000232"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027725"
                     /db_xref="UniProtKB/TrEMBL:C5E007"
                     /translation="MDRGSNKDSDVSPFNDDEIEQILHPNNLFTDDLRQLDKDSNSGA
                     IEDIINPSLDQNAANNSHNNNEAIENAIQRVSPVRMNNQLLPTRMFRPPVTAAQASTP
                     KPTTHKKRHLFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSN
                     FASFVRQLNMYGWHKVQDVKSGSIQNSSDDKWQFENEFFIRGREDLLQHIVRQRPANQ
                     ARLSGPTDPGSGTANGNGEMHLSEYHLGDNVNFAALLNELEQIKYSQLAISKDLLRIN
                     KDNELLWKENMLARERHRTQQQALEKILRFLASLVPHMDQKMIAENIFQDVHNGNGNQ
                     TDMPGSSASAAAAAGVPSSANLGVPSPGINGPFAPYDNEFQDFPNFNDGILPLDNRYL
                     LRNGSPNDSNSNYNSNLNHYDSNDVSTGRISEIPFDEEEEPSRSVGSNRSSFLSHLQS
                     NMEEQDARIQQLEDMVTSQANPNSSPNQNQNSSLPPQASTTSGLTPLLQPEDNLMSLQ
                     ENSPGVVVQDLSSHTNTNNNSTSSSTTRPQDADPAYSSAGKRVAHDDDHEDSLIEEID
                     TKKPRH"
     gene            <706808..>707824
                     /locus_tag="ZYRO0G08756g"
                     /db_xref="GeneID:8206178"
     mRNA            <706808..>707824
                     /locus_tag="ZYRO0G08756g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498330.1"
                     /db_xref="GeneID:8206178"
     CDS             706808..707824
                     /locus_tag="ZYRO0G08756g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498375.1"
                     /db_xref="GeneID:8206178"
                     /db_xref="UniProtKB/TrEMBL:C5E008"
                     /translation="MGIPMDLYRQSCKRRYLDCPQIVKDRLWNDMRRSTNTAHSLSSY
                     PLGWKMCFRRRIHVNAPQFFYSCNELCWIGVNGTRLTIYHGESRGDLELPDAQVRCVG
                     CHQLDDSTIYVYVGTSRGVFRGILNGDSFTCPIWKVIPMGGCLALDASDAPSHLVALM
                     ENDGVVISCSEGVFRLKEPVINNGNESYPAVDVSRNQLAISTWQERFDTNKNFDATPL
                     LFPDESVLHVKCMNDSGILLHTNQRLVVIQPNQLQPITTNGCTCFHYDGHHIYTVEQH
                     LYGTCFTIYEMDGIEDKWCQVGYYDIRATFGISKVLGMNVSGSTVELLSERNQLYRFE
                     IQYT"
     gene            <708666..>710342
                     /locus_tag="ZYRO0G08778g"
                     /db_xref="GeneID:8206179"
     mRNA            <708666..>710342
                     /locus_tag="ZYRO0G08778g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498331.1"
                     /db_xref="GeneID:8206179"
     CDS             708666..710342
                     /locus_tag="ZYRO0G08778g"
                     /note="similar to uniprot|P22149 Saccharomyces cerevisiae
                     YGL071W RCS1 Transcription factor involved in iron
                     utilization and homeostasis binds the consensus site
                     PyPuCACCCPu and activates the expression of target genes
                     in response to changes in iron availability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498376.1"
                     /db_xref="GeneID:8206179"
                     /db_xref="InterPro:IPR014842"
                     /db_xref="UniProtKB/TrEMBL:C5E009"
                     /translation="MDSISTSSGLVPDSMTESAESHSRQTNDGSLAIQANELPKALAE
                     DQNKFIHLDPVPDFRDKAEIKPWLQKIFYPQGIEIVIERSDNIKVIFKCKAAKRGKNT
                     KPRRNEVTTTSSMSASSSSVTSPNTGLSSAAGKKKRSVSRFNTCPFRIRATFSLKRRK
                     WNIVVVNNSHSHELKFDPDSDEYRKFKEKLREDNDWDAVKQFDELEYKSRSNLPIESS
                     LIPCECGLTSEIESFSIVLPSTKPAQNNNSTDSPSTNITNRNSVSSIGSGIGSNSSGM
                     APVISKPRSKKWQQQQQQRHREKLMRNPSTEHLFTQSQLQLQLQQLQQGCPVEFLDPS
                     IFTDSFASSPASSTMATQPPQQQQQQQQQQQQQHSLQLTDPLTEFNEIDFTDIFKPHS
                     IHLQDVHSNTQQDHGSDLLQPSQSSPPQFLDTNHETASRRDEFPPLLFSPLDAAANEL
                     MTPTDDMSVSPSHTSNSQNNSSQRWPTGISIHDQHQHQHQHQPILRQYFNDDEILAPA
                     RLASLWPQQQETSSSSPLRRVVNAVDSQSPCNENDYAVDDLLWKMNFENA"
     gene            complement(<710447..>710815)
                     /locus_tag="ZYRO0G08800g"
                     /db_xref="GeneID:8206180"
     mRNA            complement(<710447..>710815)
                     /locus_tag="ZYRO0G08800g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498332.1"
                     /db_xref="GeneID:8206180"
     CDS             complement(710447..710815)
                     /locus_tag="ZYRO0G08800g"
                     /note="highly similar to uniprot|P27999 Saccharomyces
                     cerevisiae YGL070C RPB9 RNA polymerase II subunit B12.6
                     contacts DNA mutations affect transcription start site"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498377.1"
                     /db_xref="GeneID:8206180"
                     /db_xref="GOA:C5E010"
                     /db_xref="InterPro:IPR001222"
                     /db_xref="InterPro:IPR001529"
                     /db_xref="InterPro:IPR012164"
                     /db_xref="InterPro:IPR019761"
                     /db_xref="UniProtKB/TrEMBL:C5E010"
                     /translation="MTTFRFCRDCNNMLYPREDNENQRLLFECRTCSYVEEAGNPLVY
                     RHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHSRENVFFQSQQRRKDTSMVLFFV
                     CLVCSHIFTSDQKNKRREFL"
     gene            <710992..>711543
                     /locus_tag="ZYRO0G08822g"
                     /db_xref="GeneID:8206181"
     mRNA            <710992..>711543
                     /locus_tag="ZYRO0G08822g"
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /transcript_id="XM_002498333.1"
                     /db_xref="GeneID:8206181"
     CDS             710992..711543
                     /locus_tag="ZYRO0G08822g"
                     /note="similar to uniprot|P53163 Saccharomyces cerevisiae
                     YGL068W MNP1 Protein associated with the mitochondrial
                     nucleoid"
                     /codon_start=1
                     /product="putative mitochondrial 54S ribosomal protein
                     MNP1"
                     /protein_id="XP_002498378.1"
                     /db_xref="GeneID:8206181"
                     /db_xref="GOA:C5E011"
                     /db_xref="InterPro:IPR000206"
                     /db_xref="InterPro:IPR008932"
                     /db_xref="InterPro:IPR013823"
                     /db_xref="InterPro:IPR014719"
                     /db_xref="UniProtKB/TrEMBL:C5E011"
                     /translation="MLRIITKRSPIVASRCGRLTTTPFLQQLNCRYQSTEASESKPSE
                     PVDPKISNIVNEISKLTLLETSVLINELKTQLNIPDIALPAAGAVAAPAGGAASGAAE
                     EEAQEEKPEEKTIFALKLESFDAKAKPKIIKEIKTMLGLSLVEAKKFAEAAPKVLKDN
                     VAKDDAEKIKSSLEALGAKVSLE"
     gene            complement(<711678..>712766)
                     /locus_tag="ZYRO0G08844g"
                     /db_xref="GeneID:8206182"
     mRNA            complement(<711678..>712766)
                     /locus_tag="ZYRO0G08844g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498334.1"
                     /db_xref="GeneID:8206182"
     CDS             complement(711678..712766)
                     /locus_tag="ZYRO0G08844g"
                     /note="highly similar to uniprot|P06245 Saccharomyces
                     cerevisiae YPL203W TPK2 Involved in nutrient control of
                     cell growth and division cAMP-dependent protein kinase
                     catalytic subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498379.1"
                     /db_xref="GeneID:8206182"
                     /db_xref="GOA:C5E012"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E012"
                     /translation="MEYYEQYPHHHHHHHHFRQPEQAVPASASSHHKSLLPQRSGISK
                     GKYSLKDFQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKKQQVVKMKQIEHTNDERH
                     MLKLVEHPFIIRMWGTFQDAKNLFMVIDYIEGGELFSLLRKSHRFPNPVAKFYAAEVT
                     LALDYLHSHNIIYRDLKPENLLLDRNGHIKITDFGFAKEVVTVTWTLCGTPDYIAPEV
                     ITTKPYNKSVDWWSLGVLIFEMLAGYTPFYDATAMKTYEKILQGKVNYPPFFHPDVVD
                     LLSKLIMADLTRRLGNLQSGSQDIKSHPWFGEVIWEKLLAKDIETPYEPPVVPGVGDT
                     SLFEMYPEEHLDYGATGDDPYGQYFVGF"
     gene            complement(<713156..>714661)
                     /locus_tag="ZYRO0G08866g"
                     /db_xref="GeneID:8206183"
     mRNA            complement(<713156..>714661)
                     /locus_tag="ZYRO0G08866g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498335.1"
                     /db_xref="GeneID:8206183"
     CDS             complement(713156..714661)
                     /locus_tag="ZYRO0G08866g"
                     /note="similar to uniprot|P29295 Saccharomyces cerevisiae
                     YPL204W HRR25 Protein kinase involved in regulating
                     diverse events including vesicular trafficking gene
                     expression DNA repair and chromosome segregation binds the
                     CTD of RNA pol II homolog of mammalian casein kinase
                     1delta (CK1delta)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498380.1"
                     /db_xref="GeneID:8206183"
                     /db_xref="GOA:C5E013"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5E013"
                     /translation="MDLRVGRKFRIGRKIGSGSFGDIYHGTNLISGEEVAIKLESIRS
                     RHPQLDYESRVYKYLSGGVGIPFIRWFGREGEYNAMVIDLLGPSLEDLFNYCHRKFTL
                     KTVIMLALQIICRIQYIHGRSFIHRDIKPDNFLMGVGRRGSTVHVIDFGLSKKYRDFN
                     THRHIPYRENKSLTGTARYASVNTHLGIEQSRRDDLESLGYVLIYFCKGSLPWQGLKA
                     TTKKQKYDRILEKKLCTSVETLCAGLPQEFAEYMLYCRNLKFDERPDYLYLARLFKDL
                     SIKLEYHNDHLFDWTMLRYTKAMVEKQRDLLMDTPQDNSANAATDNNNMNAASNTPNN
                     NNNNNGSSQAAVNPNSKSDSFNKVKLLAMKKFATHFHYCKNEDKHHPTPEEIKQQSIQ
                     NSNAAALLPEELLSAIDKGMESLKHQHNQAPAPAPAQAVAAAAVTSQTAAAAGANATV
                     TAPEPLLQQQQKESQYQPQQPLPQRTTHYPPQPSQPLQAKQEKPQGEDIWL"
     gene            <715926..>716438
                     /locus_tag="ZYRO0G08888g"
                     /db_xref="GeneID:8206184"
     mRNA            <715926..>716438
                     /locus_tag="ZYRO0G08888g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498336.1"
                     /db_xref="GeneID:8206184"
     CDS             715926..716438
                     /locus_tag="ZYRO0G08888g"
                     /note="highly similar to gnl|GLV|CAGL0J04400g Candida
                     glabrata CAGL0J04400g and similar to YBL021C
                     uniprot|P13434 Saccharomyces cerevisiae YBL021C HAP3
                     Subunit of the heme-activated glucose-repressed
                     Hap2p/3p/4p/5p CCAAT-binding complex a transcriptional
                     activator and global regulator of respiratory gene
                     expression contains sequences contributing to both complex
                     assembly and DNA binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498381.1"
                     /db_xref="GeneID:8206184"
                     /db_xref="GOA:C5E014"
                     /db_xref="InterPro:IPR003956"
                     /db_xref="InterPro:IPR003958"
                     /db_xref="InterPro:IPR009072"
                     /db_xref="UniProtKB/TrEMBL:C5E014"
                     /translation="MSLDEKNEDSRLSSPPNDDSNNGGGGSSSAEIDSATRRMQYMAE
                     LREQDRWLPINNVSRLMKNTLPTSAKVSKDAKECMQECVSEFISFVTSEASDRCAGDK
                     RKTINGEDILISLHALGFENYAEVLKIYLAKYRQQQALKNQLMYEQEDGEEDGERQRE
                     MSQEDENSPE"
     gene            <716835..>720200
                     /locus_tag="ZYRO0G08910g"
                     /db_xref="GeneID:8206185"
     mRNA            <716835..>720200
                     /locus_tag="ZYRO0G08910g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498337.1"
                     /db_xref="GeneID:8206185"
     CDS             716835..720200
                     /locus_tag="ZYRO0G08910g"
                     /note="similar to uniprot|P36775 Saccharomyces cerevisiae
                     YBL022C PIM1 Mitochondrial ATP-dependent protease involved
                     in intramitochondrial proteolysis involved in degradation
                     of misfolded proteins in mitochondria required for
                     bigenesis and maintenance of mitochondria"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498382.1"
                     /db_xref="GeneID:8206185"
                     /db_xref="GOA:C5E015"
                     /db_xref="InterPro:IPR003111"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004815"
                     /db_xref="InterPro:IPR008268"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027065"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027503"
                     /db_xref="UniProtKB/TrEMBL:C5E015"
                     /translation="MISSKTSRAVSQFLTRRLVRNSRTYLRPVVSNTRNASSLHGRGP
                     SLDQIALSSDIHWQRFQSQQKNESLQLNLKDLERQWMNQLMGISAKAEKDHDDGGKQQ
                     PMKKQEDEEGQVEEKDKQEEGNDKVEEHEKDRKNLEEKSESQGSPTSSSATAGLPAGG
                     NNGSDGNDSSGNDGNNRNKSKKHTPPEVYPQMLALPISRRPLFPGFYKAVVISDDRVM
                     KAIREMLDRQQPYIGAFMLKNSESDSDVIHSTDEVYDVGVFAQITSAFPSKDEKTGTE
                     TMTALLYPHRRIKIDSLLAPKGDAKGTPAEAPQESKDETAEVTTETQDVNESKTVAET
                     DSNAQAVTTLEEEDLNPTEFLKNYDVSLVNVSNLEDDPFERKSPVVNALTSEILKVFK
                     EISQLNSMFREQIATFSASIQSATTNIFEEPARLADFAAAVSAGEEDELQEILESLNI
                     EQRLEKSLLVLKKELMNAELQNKISKDVETKIQKRQREYYLMEQLKGIKRELGIDDGR
                     AKMIETFKKRVENLQLPESVKNVFDEEVQKLSTLETSMSEFGVIRNYLDWITSLPWGI
                     TSKEQYSINSAKKTLDEDHYGMNDVKDRILEFIAVGKLLGKVDGKILCFVGPPGVGKT
                     SIGKSIARSLNRKFFSFSVGGLTDVAEIKGHRRTYIGALPGRVIQALKKCQTQNPLIL
                     IDEIDKIGHAGIHGDPSAALLEVLDPEQNSNFLDNYLDISIDLSRVLFVCTANTLDTI
                     PRPLLDRMEVIELTGYVAEDKVKIAEQYLSPSAKRAAGLENANVDLAEDAIRSLMRKY
                     CRESGVRNLKKHIEKIYRKAALNVVKQLSMDDSPRIDKENVKENDKNPETPASASDGE
                     NAKESNGIEIEKTKDSSESMKVSDDIKITVDSDNLKDYVGPPIFTSDRLYENTPPGVV
                     MGLAWTSLGGTSLYVESVLEQPLQDCNHPSFERTGQLGDVMKESSRLAYSFTKMFLSS
                     KFPQNRFFEKAAIHLHCPEGATPKDGPSAGVTMATSLLSLALNKSIDPTVAMTGELTL
                     TGKVLRIGGLREKAVAAKRSGATTIIFPRDNLSDWEELPDNVKEGLEPVAADWYDDVF
                     QRIFSGLTAEEANSTWESQFKLIDAKKDKEKEH"
     gene            <720464..>721996
                     /locus_tag="ZYRO0G08932g"
                     /db_xref="GeneID:8206186"
     mRNA            <720464..>721996
                     /locus_tag="ZYRO0G08932g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498338.1"
                     /db_xref="GeneID:8206186"
     CDS             720464..721996
                     /locus_tag="ZYRO0G08932g"
                     /note="similar to uniprot|P38067 Saccharomyces cerevisiae
                     YBR006W UGA2 Succinate semialdehyde dehydrogenase involved
                     in the utilization of gamma-aminobutyrate (GABA) as a
                     nitrogen source part of the 4-aminobutyrate and glutamate
                     degradation pathways localized to the cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498383.1"
                     /db_xref="GeneID:8206186"
                     /db_xref="GOA:C5E016"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5E016"
                     /translation="MIRYSSLLTRRTTNAIRVSQRYYSQSFDDPDLFRTRALINGKWI
                     KKPDSFPVRNPSTQEIVAKVSDCQLSDYEDAIVGAKAAFDEFRHTSPQERSDMLENLG
                     NLLIENKQDLARLITLENGKPFADALGEVLYSASYFRWFSQEAVRMYGTVIPGPSGNK
                     QMFSIRQPLGVVGIMTPWNFPSAMLARKVAPALATGNTCVVKPASETPLSALVIGWLC
                     QQAGFPPSTCSILPTSKTPEVGKLLCGHDLVKKVTFTGSTRVGRLLMAQCAQDSKIIK
                     KVSMELGGNAPFIIFNDADLDKALNGIIGCKFRQSGQTCVCANRIFVHKDVYDEFATR
                     LVKRMISTFNLGDGFNEKVTHGPLISAAAVEKVSQLVEDAKQKGAEVLAGGKKAEALG
                     PYFYRPTVLSGVNESMDIFHTEVFGPVASLVKFEDTEEVIRMANNTDVGLAGYFYTQD
                     INRAQEIALRMETGMVGINTGAISDAALPFGGIKNSGLGREGSLHGLEDYTELKSIVL
                     QA"
     gene            complement(<722062..>723105)
                     /locus_tag="ZYRO0G08954g"
                     /db_xref="GeneID:8206187"
     mRNA            complement(<722062..>723105)
                     /locus_tag="ZYRO0G08954g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498339.1"
                     /db_xref="GeneID:8206187"
     CDS             complement(722062..723105)
                     /locus_tag="ZYRO0G08954g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498384.1"
                     /db_xref="GeneID:8206187"
                     /db_xref="GOA:C5E017"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5E017"
                     /translation="MSDISASEYISRQDELEQEARELMPWEPKTCTYEMGPLKQSVFA
                     CRSHKNIGLCYSCSIQCHTKCDIVELFTKRHFTCDCGTERDNQEPGEEGFRCQLRKNR
                     ESDVPSLTNRYGQNFRGLFCECEKEYDPDSNDTMIQCVLGTECNEDWYHDSCMGKKIP
                     PLESFDAYICWKCAKKYDYYLKRIISHPLGEKIVAHTLAHGVEEDKEDSKPTSGMKRS
                     ANEVDSQHNNDEYSIFLKEGFSEKLGELKDSIEDHNDKLYLFLNDLVPFLIKDEPVYE
                     PADDGEDAPDDLVSNVLRNAMHREQAIAGISAFNALKMKLNEFLKPFAETGNVVKEED
                     IKSFFQRPEETSK"
     gene            <723356..>725971
                     /locus_tag="ZYRO0G08976g"
                     /db_xref="GeneID:8206188"
     mRNA            <723356..>725971
                     /locus_tag="ZYRO0G08976g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498340.1"
                     /db_xref="GeneID:8206188"
     CDS             723356..725971
                     /locus_tag="ZYRO0G08976g"
                     /note="highly similar to uniprot|P29469 Saccharomyces
                     cerevisiae YBL023C MCM2 Protein involved in DNA
                     replication component of the Mcm2-7 hexameric complex that
                     binds chromatin as a part of the pre-replicative complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498385.1"
                     /db_xref="GeneID:8206188"
                     /db_xref="GOA:C5E018"
                     /db_xref="InterPro:IPR001208"
                     /db_xref="InterPro:IPR008045"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR018525"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027925"
                     /db_xref="UniProtKB/TrEMBL:C5E018"
                     /translation="MADNRRRRRENDEDSDSDNEIPPSSPQPLGRAAYDTVSSPIGAP
                     DSDLLENPEGEDDEIQDDPDLDELEEQMNEVDLMGDDMYGDYEADPERDRYDETHVDD
                     AEQQELSLADRRRIDAQLNQRDRLLKDGAYMDDDDAADATQLDEMGLPIQRRRRRRQY
                     EDVDADDDLLDDMEIDPLTEELTLESLSNVKANSYAEWITQPNVSRTIARELKSFLLE
                     YTDETGRSVYGARIRTLGETNSESLEVNYRHLAESKAILALFLAKCPSEMLKIFDLVA
                     MEATELHYPDYARIHSEIHVRISDFPTIHSLRELREANLNTLVRVTGVVTRRTGVFPQ
                     LKYVKFNCLKCGSILGPFFQDSNEEIRISFCTNCRSKGPFTVNGEKTVYRNYQRITLQ
                     EAPGTVPAGRLPRHREVILLADLVDISKPGEEVEVTGIYKNNYDGNLNAKNGFPVFAT
                     ILEANSIKRREGNALNDDEEGLDVFSWTEEEEREFRKMSRDRGIIDKIISSMAPSIFG
                     HRDIKTAIACSLFGGVPKNVNGKHAIRGDINILLLGDPGTAKSQILKYAEKTAHRAVF
                     TTGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGICLIDEFDKMNDQDRTSIHEA
                     MEQQSISISKAGIVTSLQARCSILAAANPNGGRYNSTLPLAQNVNLTEPILSRFDVLC
                     VVRDFVDEESDERLAAFVVDSHIRSHPENDPDELDRQRGEDGDAMKDDGNEDEGYEHL
                     TARQRRLQRQRKKEEEVSPIPQELLIKYIHYARTKILPKLHQMDMNKVSRVYADLRRE
                     SISTGSFPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVDAQKISVR
                     RQLQRSFAIYTLGHH"
     gene            complement(<726070..>728121)
                     /locus_tag="ZYRO0G08998g"
                     /db_xref="GeneID:8206189"
     mRNA            complement(<726070..>728121)
                     /locus_tag="ZYRO0G08998g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498341.1"
                     /db_xref="GeneID:8206189"
     CDS             complement(726070..728121)
                     /locus_tag="ZYRO0G08998g"
                     /note="similar to uniprot|P38205 Saccharomyces cerevisiae
                     YBL024W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498386.1"
                     /db_xref="GeneID:8206189"
                     /db_xref="GOA:C5E019"
                     /db_xref="InterPro:IPR001678"
                     /db_xref="InterPro:IPR018314"
                     /db_xref="InterPro:IPR023267"
                     /db_xref="InterPro:IPR023270"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5E019"
                     /translation="MGRRNFKKGKTFGARNDDDNGRGWSELVKENEKWEQYYKKLGLI
                     SEEDWPVFKSTCQAALPLTFRITGSRAHAQEVLDLFQQRHLANLTGIEFEGEPVKPPV
                     ELPWYPNHLAWQIDVPKSVIRKNPQFAKMQRFLVVENAVGNISRQEAVSMIPPTLLDV
                     QPHHTVLDMCAAPGSKTAQMIEYLHRDNDEPSGFVVANDADAKRSHMLVHQLKRLNSA
                     NLIVVNHDAQFFPRVKAHPDHTNKKDILRFDRVLCDVPCSGDGTMRKNVNVWRDWTTQ
                     NGLALHNVQLNILNRGLHLLKSGGRLVYSTCSMNPIENEAVVAEALRKWGGKVRLVDC
                     SDKLPGLVRSNGINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYP
                     HQQNTGGFFITVLEKVEEPESTPQADTKASEEPANKKAKTESTSTSAPASEKKERLPR
                     DANEEPFAFVDPNHEALKTCWGFYGIDDIFDRNTCLVRNATGEPTRVVYTVCPALRDL
                     IQANDERLKIIYSGVRLFVAQKSALECSWRIQSEALPIMKHHMTSNRIIKTNEELLKL
                     LLEESFPSFEIIGEKIGDEFVQQTKDISNGCAFIEVERDGSGKENLFLPVWKGNKCIN
                     LMVCKEDTQELLYRLFGVENLPKSNSARNKKVESKEETEEEKKETNGEQKETPKEEAT
                     A"
     gene            complement(<728273..>728689)
                     /locus_tag="ZYRO0G09020g"
                     /db_xref="GeneID:8206190"
     mRNA            complement(<728273..>728689)
                     /locus_tag="ZYRO0G09020g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498342.1"
                     /db_xref="GeneID:8206190"
     CDS             complement(728273..728689)
                     /locus_tag="ZYRO0G09020g"
                     /note="highly similar to gnl|GLV|CAGL0K01969g Candida
                     glabrata CAGL0K01969g and similar to YBL025W
                     uniprot|P38204 Saccharomyces cerevisiae YBL025W RRN10
                     subunit of UAF (upstream activation factor) involved in
                     promoting high level transcription of rDNA Upstream
                     activation factor subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498387.1"
                     /db_xref="GeneID:8206190"
                     /db_xref="InterPro:IPR022793"
                     /db_xref="UniProtKB/TrEMBL:C5E020"
                     /translation="MDRTVYEACSDLIVDYGTHKVSADEVLTQKVGGLVPIPFKTREE
                     LEIASDKDRKDGLFTGELVPSIDLRVLHYFATQLCLQKYPHLTEAFDETSLLTLGLLV
                     EQWVKDYLRDSNGELASGSSQSVSKAINYRDSPANI"
     gene            complement(729114..729648)
                     /gene="SCR1"
                     /locus_tag="ZYRO0G09042r"
                     /db_xref="GeneID:8206191"
     ncRNA           complement(729114..729648)
                     /ncRNA_class="SRP_RNA"
                     /gene="SCR1"
                     /locus_tag="ZYRO0G09042r"
                     /product="SRP RNA"
                     /note="SCR1 (SRP RNA)"
                     /transcript_id="XR_002648433.1"
                     /db_xref="GeneID:8206191"
     gene            <729797..>730165
                     /locus_tag="ZYRO0G09064g"
                     /db_xref="GeneID:8206798"
     mRNA            <729797..>730165
                     /locus_tag="ZYRO0G09064g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498343.1"
                     /db_xref="GeneID:8206798"
     CDS             729797..730165
                     /locus_tag="ZYRO0G09064g"
                     /note="similar to uniprot|P40083 Saccharomyces cerevisiae
                     YER137C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498388.1"
                     /db_xref="GeneID:8206798"
                     /db_xref="GOA:C5E021"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:C5E021"
                     /translation="MSDNQSLRVSQALDNLAKTILEQRDSSSYNEKLRRLEALINMIL
                     QTDSNGSKMDTTKLDSILREDDIEIIEKNHQRYALIPVIPLRSTTVSKNKKKNKIRCS
                     YCNEMGHTRANCEKKLQPQQ"
     gene            complement(<730224..>730571)
                     /locus_tag="ZYRO0G09086g"
                     /db_xref="GeneID:8206192"
     mRNA            complement(join(<730224..730457,730518..>730571))
                     /locus_tag="ZYRO0G09086g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498344.1"
                     /db_xref="GeneID:8206192"
     CDS             complement(join(730224..730457,730518..730571))
                     /locus_tag="ZYRO0G09086g"
                     /note="highly similar to uniprot|P38203 Saccharomyces
                     cerevisiae YBL026W LSM2 Component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing
                     splicing and decay"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498389.1"
                     /db_xref="GeneID:8206192"
                     /db_xref="GOA:C5E022"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016654"
                     /db_xref="UniProtKB/TrEMBL:C5E022"
                     /translation="MLFFSFFKTLVDQEVVVELKNDIELKGTLKSVDQFLNLKLDNIS
                     CTDQTKYPHLGSVRNIFIRGSTVRYVYLNKNMVDINLLQDAARREAMTEKK"
     gene            complement(<730843..>732192)
                     /locus_tag="ZYRO0G09108g"
                     /db_xref="GeneID:8206193"
     mRNA            complement(<730843..>732192)
                     /locus_tag="ZYRO0G09108g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498345.1"
                     /db_xref="GeneID:8206193"
     CDS             complement(730843..732192)
                     /locus_tag="ZYRO0G09108g"
                     /note="highly similar to uniprot|P39958 Saccharomyces
                     cerevisiae YER136W GDI1 GDP dissociation inhibitor
                     regulates vesicle traffic in secretory pathways by
                     regulating the dissociation of GDP from the Sec4/Ypt/rab
                     family of GTP binding proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498390.1"
                     /db_xref="GeneID:8206193"
                     /db_xref="GOA:C5E023"
                     /db_xref="InterPro:IPR000806"
                     /db_xref="InterPro:IPR018203"
                     /db_xref="UniProtKB/TrEMBL:C5E023"
                     /translation="MDPESMDTEYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHY
                     GGESASVTLSQLYDKFKQNPISKEEREAKFGRDRDWNVDLIPKFLMANGELTNILVHT
                     DVTRYVEFKQVSGSYVFKQGKIYKVPATEMEAISSSLMGVFEKRRMKKFLEWIGSYEE
                     DDISTHQGLDLDRNTMDEVYTKFGLGNSTKEFIGHAMALWTNDDYLHQPARPSVERVL
                     LYCQSFSRYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLDTPIEKVDYNEQGKFQG
                     VQTKLGHFRAPLVIADPTYFPEKCKSTGQRVIRAICILDHPVASTNNADSLQIIIPQS
                     QVDRKNDIYIAIVSDSHHVCAKGHYLAIISTIIETDKPHKELEPAFQLLNPIEERFMG
                     IAELFEPKEDGSKDNVYLSRSYDSSSHFESMTDDVKDVYFRVTGHPLVLKTRQDGDN"
     gene            <732487..>734034
                     /locus_tag="ZYRO0G09130g"
                     /db_xref="GeneID:8206194"
     mRNA            <732487..>734034
                     /locus_tag="ZYRO0G09130g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498346.1"
                     /db_xref="GeneID:8206194"
     CDS             732487..734034
                     /locus_tag="ZYRO0G09130g"
                     /note="similar to uniprot|Q12298 Saccharomyces cerevisiae
                     YDR061W Mitochondrial protein member of the ATP-binding
                     cassette (ABC) transporter family transcriptionally
                     activated by Yrm1p along with genes involved in multidrug
                     resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498391.1"
                     /db_xref="GeneID:8206194"
                     /db_xref="GOA:C5E024"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E024"
                     /translation="MSQKAGFVVRIRDALFKSSLARNAPAVFPHRIRDFEVKPGEKWV
                     IWGPGKGQFMNILSNKYLSDPPLSLQFGVGGKYPRVEQVLFKGVMPTAHLSARYEYFK
                     DEFDVTCKKFILDNAVGSNNVSYDVAKTDREVDMALYDKLIDSLQLTDLQDRWAMGLS
                     NGQMRRARLAYSLLKKPDLMLVDDPFLGLDPTATKIISEFLANYDLPIIIGLRFQDKI
                     PNWCTHVCCVENDGQVLFQGPVNQHDVQIKELRDSRVSSRYSENMGSSDLEGLISGHP
                     LFATKPNVPHLELRGLDVKYRGQPVLSNLHWKVELGSRWHVQGNNGSGKSTLLSLITA
                     EHPQSWNSRVVEHGTPRRTGSSSYFDINKNIGMSAPELHAIFLKNCGDRLNVRESIAT
                     GFHEASNNNFTPIWSKLNKDQQTMVEKFIKYFDLPSDKLFGELSVSDQKLALFVRSIV
                     KMPKLLVLDEAFSGMELEPMLRCHELLNHWPGTTMVVSHVPEETPKCHHYLRLVSPGV
                     YDIGQVR"
     gene            <734390..>736096
                     /locus_tag="ZYRO0G09152g"
                     /db_xref="GeneID:8206195"
     mRNA            <734390..>736096
                     /locus_tag="ZYRO0G09152g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498347.1"
                     /db_xref="GeneID:8206195"
     CDS             734390..736096
                     /locus_tag="ZYRO0G09152g"
                     /note="highly similar to uniprot|P40970 Saccharomyces
                     cerevisiae YDR062W LCB2 Component of serine
                     palmitoyltransferase responsible along with Lcb1p for the
                     first committed step in sphingolipid synthesis which is
                     the condensation of serine with palmitoyl-CoA to form
                     3-ketosphinganine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498392.1"
                     /db_xref="GeneID:8206195"
                     /db_xref="GOA:C5E025"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5E025"
                     /translation="MSDAKVEGPTGSTRVPLFVPENLPADVKKENEYGTLTSKEHLHQ
                     TKSLNGKPMEPPIMDTPPYYISLITYLNYLIVIIFGHMHDFLGMTFQKDSHQDVMEKD
                     GWAPWYSKFESFFSRRMKKKIDDCFSRPTTGVPGRFIRCIDRISHEENKYFTYPGTTS
                     MCLNLSSYNYLGFAQSEGQCTTTALQSVDKYGIHSGGPRTQIGTTDLHLDAERLIASF
                     LGKQDAVIFSMGYGTNANFFNAFLDSKCLVISDELNHASIRTGVRLSGAAVRTFAHND
                     MVGLEKLIREQIVLGQPKTNRPWKKILICVEGLYSMEGTLCSLPEVVELKKKYKCYLF
                     VDEAHSVGAMGPTGRGVCDLFGVDPNDVDFLMGTLTKSFGAAGGYIASNKWVIDRLRL
                     DLTTSNYAEPTPAPVLAQIIASLKTIKGELAPGEGKERLQRIAFNSRYLRLGLQRLGF
                     IVYGAPDSPVIPLLLYCPTKMPAFSRMMLQRKIAVVVVAYPATPLIESRVRFCVSSSL
                     TKDDLDYLLRHVSEIGDMLFLKASSGAASVPQDGRPPRWDVEDVIARTAEDCKNDNFF
                     LT"
     gene            <736360..>736806
                     /locus_tag="ZYRO0G09174g"
                     /db_xref="GeneID:8206196"
     mRNA            <736360..>736806
                     /locus_tag="ZYRO0G09174g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498348.1"
                     /db_xref="GeneID:8206196"
     CDS             736360..736806
                     /locus_tag="ZYRO0G09174g"
                     /note="similar to uniprot|Q12156 Saccharomyces cerevisiae
                     YDR063W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498393.1"
                     /db_xref="GeneID:8206196"
                     /db_xref="GOA:C5E026"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR011171"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5E026"
                     /translation="MASELYYFNTVTKEKIRKFRISTSRSETLQVLPIKIQPKDYEIT
                     IDEEELEELEDVKELSELAEILPDNSPRYLLTAYPLTTRENIKQVPLVLIYWKPATVV
                     SQEWKMLYAGALEQVRSECGTYKLVEVSSGLEDDADVEELKEQLEK"
     gene            <737073..>737895
                     /locus_tag="ZYRO0G09196g"
                     /db_xref="GeneID:8206197"
     mRNA            join(<737073..737093,737461..>737895)
                     /locus_tag="ZYRO0G09196g"
                     /product="40S ribosomal protein S13"
                     /transcript_id="XM_002498349.1"
                     /db_xref="GeneID:8206197"
     CDS             join(737073..737093,737461..737895)
                     /locus_tag="ZYRO0G09196g"
                     /note="highly similar to uniprot|P05756 Saccharomyces
                     cerevisiae YDR064W RPS13 Protein component of the small
                     (40S) ribosomal subunit; has similarity to E. coli S15 and
                     rat S13 ribosomal proteins"
                     /codon_start=1
                     /product="40S ribosomal protein S13"
                     /protein_id="XP_002498394.1"
                     /db_xref="GeneID:8206197"
                     /db_xref="GOA:C5E027"
                     /db_xref="InterPro:IPR000589"
                     /db_xref="InterPro:IPR009068"
                     /db_xref="InterPro:IPR012606"
                     /db_xref="InterPro:IPR023029"
                     /db_xref="UniProtKB/TrEMBL:C5E027"
                     /translation="MGRMHSNGKGISSSAIPYSRNAPSWFKLSSESVVEQIIKYARKG
                     LTPSQIGVLLRDAHGVTQARVITGNKIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHL
                     ERNRKDKDAKFRLILIESRIHRLARYYRTVAVLPPTWKYESATASALVN"
     gene            complement(738073..738146)
                     /locus_tag="ZYRO0G09218r"
                     /db_xref="GeneID:8206198"
     tRNA            complement(738073..738146)
                     /locus_tag="ZYRO0G09218r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=67.58"
                     /db_xref="GeneID:8206198"
     gene            complement(738476..738549)
                     /locus_tag="ZYRO0G09240r"
                     /db_xref="GeneID:8206199"
     tRNA            complement(738476..738549)
                     /locus_tag="ZYRO0G09240r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=67.58"
                     /db_xref="GeneID:8206199"
     gene            complement(739471..739543)
                     /locus_tag="ZYRO0G09262r"
                     /db_xref="GeneID:8206200"
     tRNA            complement(739471..739543)
                     /locus_tag="ZYRO0G09262r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (TGC) cove score=80.16"
                     /db_xref="GeneID:8206200"
     gene            complement(<740111..>741514)
                     /locus_tag="ZYRO0G09284g"
                     /db_xref="GeneID:8206201"
     mRNA            complement(<740111..>741514)
                     /locus_tag="ZYRO0G09284g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498350.1"
                     /db_xref="GeneID:8206201"
     CDS             complement(740111..741514)
                     /locus_tag="ZYRO0G09284g"
                     /note="similar to uniprot|P31755 Saccharomyces cerevisiae
                     YGL038C OCH1 Mannosyltransferase of the cis-Golgi
                     apparatus initiates the polymannose outer chain elongation
                     of N-linked oligosaccharides of glycoproteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498395.1"
                     /db_xref="GeneID:8206201"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5E028"
                     /translation="MIKPLNKSEFRLDKRTKQIFFGILLLYSLVAFHLSNKKYAKFIT
                     APEISNVALPTTSHVEQLNLKELRVKDRKLKDLREQLVMAFPYEPEKPIPRRIWQTWK
                     VKEDSLDFPASFRSYQRDWTEAATLQGFEYMLVPDDNIEAFLQNLYGELPLVLKAFKE
                     MPKNILKADFLRYLLLYARGGIYSDMDTFPLKPLNKWPSVDREKLKTFKETRKPVPYK
                     GFKSEEVVAQNEREPGLVIGIEADPDRTDWSDWFARRIQFCQWTIQSKPGHPVLRELI
                     LNITATTLYSVSSVKKTAEELIDKTHKNDYNVNYRDKRARDSHYDHDETKTDKNVDGS
                     DIMNWTGPGIFSDMVMQYLNNLIQNNNDVLLLNGNIYTPTTVDPAEAAAQDENGVSTK
                     KFYRKIIESLLVNRHIPWEFFTLITEPITVDDLMILPITSFSPDVGQMNAKGMDDEMA
                     LVKHQFEGSWKGDAGHD"
     gene            complement(<742041..>742679)
                     /locus_tag="ZYRO0G09306g"
                     /db_xref="GeneID:8206202"
     mRNA            complement(<742041..>742679)
                     /locus_tag="ZYRO0G09306g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498351.1"
                     /db_xref="GeneID:8206202"
     CDS             complement(742041..742679)
                     /locus_tag="ZYRO0G09306g"
                     /note="similar to uniprot|P53184 Saccharomyces cerevisiae
                     YGL037C PNC1 NAD() salvage pathway gene pyrazinamidase and
                     nicotinamidase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498396.1"
                     /db_xref="GeneID:8206202"
                     /db_xref="GOA:C5E029"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="UniProtKB/TrEMBL:C5E029"
                     /translation="MRALIVVDVQNDFLPGGSLAVPHGDEIVKPVIDLIEDPTEKWDQ
                     VVMTRDWHPHNHISFAKSHNLADFSPITYVSPVEGDDRKIEGTLFPVHCVEGTRGSQL
                     APEMLEEQKKIGCLIVSKGYLQDREYFSAFNDIWDHHKTELNNYLHCHGIDEVYVVGL
                     AFEYCVKSTAISASKLGYKTTILQKYSKGFLSDEKSMQELKQELAENNVQLA"
     gene            <743013..>743966
                     /locus_tag="ZYRO0G09328g"
                     /db_xref="GeneID:8206203"
     mRNA            <743013..>743966
                     /locus_tag="ZYRO0G09328g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498352.1"
                     /db_xref="GeneID:8206203"
     CDS             743013..743966
                     /locus_tag="ZYRO0G09328g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498397.1"
                     /db_xref="GeneID:8206203"
                     /db_xref="UniProtKB/TrEMBL:C5E030"
                     /translation="MARRQIFDIEGEKKGIKKKKSKKRMRLWNILFIALLILCIHCHR
                     IIPASNPSVVEPAAPINYGDISLLMINDFVLIIQVFMTCIPSGVLAPMLVDFVRISCL
                     FNMLSTFSLLSLSLLNGWDRLDESRTFKMEMRKTFNSWAENNEKRNWLNESVNWRELK
                     NWVNVFDIHFDMYVSNYTDVERNGKINRVICASFNMGQKSLFDMPFEQEICVTKEGIK
                     KLGKNRFSSLSVDTTKNLVKFLAKGGYVKAASNPPFYLFKLMETYGDMTIDFLETLQE
                     MTSSLQVETKSSLEKACSFHEGEKLLMLMRLKRPQAVASLM"
     gene            <744354..>746777
                     /locus_tag="ZYRO0G09350g"
                     /db_xref="GeneID:8206204"
     mRNA            <744354..>746777
                     /locus_tag="ZYRO0G09350g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498353.1"
                     /db_xref="GeneID:8206204"
     CDS             744354..746777
                     /locus_tag="ZYRO0G09350g"
                     /note="similar to uniprot|P53185 Saccharomyces cerevisiae
                     YGL036W Mtf1 Two Hybrid Clone 2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498398.1"
                     /db_xref="GeneID:8206204"
                     /db_xref="UniProtKB/TrEMBL:C5E031"
                     /translation="MSRLNESYPHVSDGTAKALVSSTVKVMRYLSNTGDYKVVFKLIN
                     ALGFFNQKVVEGRLNGSDLEGIDVFTPILQSEEVMKHKLDLVAIFLAYLSIHREFHPL
                     ILNSIKDWCKLLPEKKLITCTDTKYMPGFYTVVSLLDQYEEVTPQILQYLELDLAHVL
                     VHVWVPQWLQIAQTPLENDSLADLLLNEAKLDFVVATSNDLGQFIANKHLQKEPPTSY
                     FIYKICKRISLFADWMPSSLYKPAAQLAISHGSSASGLHFDLQVLMEVVDHPELNFFQ
                     EPRLVSLLHQATNNLRKVPFHKLHAALGTLGSIQSLPAIINMVQLLLCKFLINAGNVS
                     ELIQKADYRLQLHPNEKKWFNNRTNNKYQIPSWFETSLLPPLPPIAKSMFVFDNNEHE
                     SEQEAKSFTIITNLLFESLNMVILMNTEMLKQYQWLNIDPLMIDVSDETFNIRHLVAG
                     QFLLLYLIPIIMAAMLSQQLLESQVGILSEKRKSIMRKIIFSNTTRLCETLIHAHGNI
                     ALYHLLKLCTKASAEDMVLQGICLELLHHIFFGPNGTYNKQLCLENKLTTQALENYIT
                     VWNDGSHRYQPFFEKILNVEQPSVEVRTIPVSELYELLPDHEEILRTLQERSSSTPKS
                     SAPSSVTKENSQQKVGLTSRSGNVGTTTPLTYKYNPYSTPSFEPSKPVTLTPPVSFSS
                     GTYTADTMGSTPDTYTFNPRNNEMMMGRTTTPSDTNNYSTVFNGSFSGEPLSNLSRTI
                     ESLNGTPQTPSKGFFSSPWDGSPGISVTPNNSKIVSTGKNYILGGHNRIKNNSRAQSI
                     HIDNFKTGP"
     gene            <747001..>749052
                     /locus_tag="ZYRO0G09372g"
                     /db_xref="GeneID:8206205"
     mRNA            <747001..>749052
                     /locus_tag="ZYRO0G09372g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498354.1"
                     /db_xref="GeneID:8206205"
     CDS             747001..749052
                     /locus_tag="ZYRO0G09372g"
                     /note="similar to uniprot|P48234 Saccharomyces cerevisiae
                     YGR145W ENP2 Essential nucleolar protein of unknown
                     function contains WD repeats interacts with Mpp10p and
                     Bfr2p and has homology to Spb1p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498399.1"
                     /db_xref="GeneID:8206205"
                     /db_xref="GOA:C5E032"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012580"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E032"
                     /translation="MVLKSTSASDISVYQVSGTNVSRSLPDWIAKRRKRTLKNDLEYQ
                     NRVELVQDFEFSEASNRIKVTKDGQSAMATGTYKPQIHLYDFANLSLKFERHTDAENV
                     DFLFLSDDWTKSVHLQNDRSIQFQNKGGLHYTTRIPKFGRSLAYNPLNCDLYVGSSSD
                     ELYRLNLEQGRFLNPFKLETEGVNHVSTCETNGLLAVGMENNVVEFWDPRSRSRICNL
                     VLGNQLDNSPFEVTTTSFRQDGLNFACGTSNGYTYLYDLRSSEPYAVKDQGYGFPLKK
                     IIWLDNVDTENKIMTSDKRIAKIWDRVTGKPYASMEPNVDINDVEHVPGTGMFFTANE
                     GIPMHTYYIPHLGPSPRWCSFLDSITEELEEKPSETVYSNYRFITRDDMKKLNLSHLI
                     GSNVLRAYMHGYFINNELYDKVALLANPNAYRDEREREIRRRIEKERESRIRTTGAVK
                     KPKVKVNKELVDKLSQKRGDTATEKVLADDRFKEMFADDDFQLDEDDYDYKQLNPVKS
                     ARETEEGSAKRIRALTAAEESDEERIANRSAEDDEESESSESESEPEPELNEQETKRL
                     QKQLKNQERKRREKADEDKFMSEFNVGAAQNDSRQVTFDEKVKEQREQEQDKKDGGAL
                     LHRNHRGEAEITFIPQKNKPSQSKKTSNNKKTERNPSESGRSRPRYEGRRASKNVFRG
                     M"
     gene            <750044..>751789
                     /locus_tag="ZYRO0G09394g"
                     /db_xref="GeneID:8206206"
     mRNA            <750044..>751789
                     /locus_tag="ZYRO0G09394g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498355.1"
                     /db_xref="GeneID:8206206"
     CDS             750044..751789
                     /locus_tag="ZYRO0G09394g"
                     /note="similar to uniprot|Q752V4 Ashbya gossypii AFR469W
                     SEC9 Protein transport protein SEC9 and weakly similar to
                     YGR009C uniprot|P40357 Saccharomyces cerevisiae YGR009C
                     SEC9 t- SNARE protein important for fusion of secretory
                     vesicles with the plasma membrane"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498400.1"
                     /db_xref="GeneID:8206206"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="UniProtKB/TrEMBL:C5E033"
                     /translation="MGIKKLLKIKPPEEQTHDKNREELMELGITTKNPNKKKRDKFAA
                     YGQYARDKSKNKVYAPPGYEPYATGESEDLNKSELDSSVQNSGSDGSSSNPYQVAGNE
                     ADPYAVKAGDGLSSDPFANVGAGALGIGSRNFASAYDGLTSHSPRPSAGTSRAGAGTG
                     TSNNPYNDVPATTNVGNRRAGGSPGVEAARSNPYGRRAAAGAYPSAAMGGEGPPASTG
                     GNPYSSMGIDEYSDGMKQPNLDFDLDLNEGPREGEYDPNQVAVDEDLNETIQDQSDNL
                     NNAPTSQEQELLPKPAPQRQQQQPAPQMYNPQPQWQFEEEEVEQRVQGQEMGASNRGY
                     KTFEELQKEEEARQQQEEDEAVDEVKQEIRFTKQGSVQSTRNTLRMAQEAEMSGMNTI
                     GMLGHQNNQFGDIENNLDLMYAHNRVADDKIGELKKLNRSMFAVHVGNPFTSRRRARE
                     KAETMKNRKIEEKMLQQEKLQGVQSSTKRVEGALSPGNEPLSTSDRYKREEILNRAKR
                     YQFEADEEDDMMEVEIDKNLDQIGQISGRLKKLALATGDEIDAQRKRLGKMEDNADDM
                     DIRLHMNTQRMAGIR"
     gene            complement(<751903..>752322)
                     /locus_tag="ZYRO0G09416g"
                     /db_xref="GeneID:8206207"
     mRNA            complement(<751903..>752322)
                     /locus_tag="ZYRO0G09416g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498356.1"
                     /db_xref="GeneID:8206207"
     CDS             complement(751903..752322)
                     /locus_tag="ZYRO0G09416g"
                     /note="weakly similar to uniprot|P48235 Saccharomyces
                     cerevisiae YGR146C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498401.1"
                     /db_xref="GeneID:8206207"
                     /db_xref="InterPro:IPR024368"
                     /db_xref="UniProtKB/TrEMBL:C5E034"
                     /translation="MSAFNDFCIVCDQLIPQDSLPPRVDELLYCSEECMVKDTSRVPP
                     AAAPAELSESASSLGDVDSLIASPLLLPMDGMVPPPASGIEDSDYMLMELESASQAVP
                     RTQAVKEPCSPGAGNAVQVLDRVAEDNYKLWLSQCHW"
     gene            complement(<752797..>753786)
                     /locus_tag="ZYRO0G09438g"
                     /db_xref="GeneID:8206208"
     mRNA            complement(<752797..>753786)
                     /locus_tag="ZYRO0G09438g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498357.1"
                     /db_xref="GeneID:8206208"
     CDS             complement(752797..753786)
                     /locus_tag="ZYRO0G09438g"
                     /note="some similarities with uniprot|P27705 Saccharomyces
                     cerevisiae YGL035C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498402.1"
                     /db_xref="GeneID:8206208"
                     /db_xref="GOA:C5E035"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5E035"
                     /translation="MTETPRKNNGEHAPRPHVCPICHRAFHRLEHQTRHMRTHTGEKP
                     HVCDFKNCGKRFSRSDELTRHRRIHTNPQPRAKRGRKKKSEILQETKPQDSPAPPSDE
                     PPSHSSSSTSLSLLRGTSESQEPELAISPSSTPFATPGTTPTVSRSSSRQRLTALSSL
                     QRMTPLTTTAPTYVDSTAPLRRRPGSALSLNDMLRESDSDSDDSDRGRKRSRTATPAS
                     SRSESVARANVNTTSATNTVAPILPTPTLGPAELSNRLLEIQRQQQQQHDPSTALPST
                     AGASTAFSGSASAAGISNSTHHTDANSHPAQNPDQDPAPLPPLRSLPLQFPTG"
     gene            <755241..>755858
                     /locus_tag="ZYRO0G09460g"
                     /db_xref="GeneID:8206209"
     mRNA            <755241..>755858
                     /locus_tag="ZYRO0G09460g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498358.1"
                     /db_xref="GeneID:8206209"
     CDS             755241..755858
                     /locus_tag="ZYRO0G09460g"
                     /note="similar to uniprot|P53187 Saccharomyces cerevisiae
                     YGL033W HOP2 Meiosis-specific protein that localizes to
                     chromosomes preventing synapsis between nonhomologous
                     chromosomes and ensuring synapsis between homologs
                     complexes with Mnd1p to promote homolog pairing and
                     meiotic double-strand break repair"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498403.1"
                     /db_xref="GeneID:8206209"
                     /db_xref="InterPro:IPR010776"
                     /db_xref="UniProtKB/TrEMBL:C5E036"
                     /translation="MVKLTSEDAQTLIESYLISQYRPFAINDIVLNLHGQITKAAATK
                     ALDSLVQEHRVTAKTFGKVIIYSCNEKELELPAGVESDNFTFAHLAELRKELKELDSD
                     KSAVTEALNKVLKEPSNAQLLHLQVAREQEIAHLQQVLTRLQEDWDPKMEPLINDLVK
                     TDKTLDKELKTRFKIMKNLLAIVKDTVRPTDMGEFLEEIGFEQMG"
     gene            <756123..>757040
                     /locus_tag="ZYRO0G09482g"
                     /db_xref="GeneID:8206210"
     mRNA            <756123..>757040
                     /locus_tag="ZYRO0G09482g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498359.1"
                     /db_xref="GeneID:8206210"
     CDS             756123..757040
                     /locus_tag="ZYRO0G09482g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498404.1"
                     /db_xref="GeneID:8206210"
                     /db_xref="GOA:C5E037"
                     /db_xref="InterPro:IPR002042"
                     /db_xref="InterPro:IPR019842"
                     /db_xref="UniProtKB/TrEMBL:C5E037"
                     /translation="MSFLADSIYGKDNVKFLKVKKDASNPKLQQIMEATVKVLLKGNF
                     DVSYTEADNSPIVPTDTVKNTILILAKTNDTWPSEKFASTLALHFTTKYAHVSGVSIQ
                     IYQERWVKFNVDGAPSQHSFVHQGPEKKIVELDYDKVPGPAQYKLSTSIKDLTVLKST
                     NSMFYGYNVCDYTTLKPTEDRVLSTDIYSKWDWSPSRLGSLHTLSSGSCDGIFDQVYD
                     EARAITLDIFAKENSASVQATMYNMATEILKKAPQVEYVSYELPNKHYFLFDFKWFKG
                     LENDNELFYPSPHPNGLIKCKVGRKASKL"
     gene            complement(<757119..>757769)
                     /locus_tag="ZYRO0G09504g"
                     /db_xref="GeneID:8206211"
     mRNA            complement(<757119..>757769)
                     /locus_tag="ZYRO0G09504g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498360.1"
                     /db_xref="GeneID:8206211"
     CDS             complement(757119..757769)
                     /locus_tag="ZYRO0G09504g"
                     /note="similar to gnl|GLV|KLLA0E10879g Kluyveromyces
                     lactis KLLA0E10879g and some similarites with YGR147C
                     uniprot|P37293 Saccharomyces cerevisiae YGR147C NAT2 N
                     alpha- acetyl-transferase transfers acetyl group from
                     acetyl coenzyme A to the N-terminal methionine residues of
                     proteins"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498405.1"
                     /db_xref="GeneID:8206211"
                     /db_xref="InterPro:IPR009688"
                     /db_xref="UniProtKB/TrEMBL:C5E038"
                     /translation="MFRSLPGLRQSILRASKARPMGFIRCQSQQVKKPKSIKELMSTY
                     GYSALGVYLGLSLIDLPLCFLMVHSLGEETISVYLNKFKQAFGFGKSEDEVIREVRDK
                     MARKQDEDNSQVQRSWWQEFKQSTLLAEFLIAYGIHKSLVIIRLPITAAITPPTVSLL
                     QKWGFNIGPQMFKTMSKDASIRYKGGNPKDFIKPTSNTQPPRNPHTKGQKWFNGMM"
     gene            complement(<758586..>759056)
                     /locus_tag="ZYRO0G09526g"
                     /db_xref="GeneID:8206212"
     mRNA            complement(<758586..>759056)
                     /locus_tag="ZYRO0G09526g"
                     /product="60S ribosomal protein L24"
                     /transcript_id="XM_002498361.1"
                     /db_xref="GeneID:8206212"
     CDS             complement(758586..759056)
                     /locus_tag="ZYRO0G09526g"
                     /note="similar to uniprot|P04449 Saccharomyces cerevisiae
                     YGL031C RPL24A and to uniprot|P24000 Saccharomyces
                     cerevisiae YGR148C RPL24B"
                     /codon_start=1
                     /product="60S ribosomal protein L24"
                     /protein_id="XP_002498406.1"
                     /db_xref="GeneID:8206212"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR023442"
                     /db_xref="UniProtKB/TrEMBL:C5E039"
                     /translation="MKLEIDSFSGGKIYPGRGTLFVRGDSKIFRFQNAKSAALFKQRK
                     NPRRIAWTVLYRRHHKKGITEEVAKKRSRRAVKAQRPVVGASMELIKERRAVKPDVRK
                     AQREEKKKADKEKRKSERSARRANKAKTAAAGGGEKVSKQQAKGAFQKVAATSH"
     gene            <759657..>760106
                     /locus_tag="ZYRO0G09548g"
                     /db_xref="GeneID:8206213"
     mRNA            join(<759657..759659,759792..>760106)
                     /locus_tag="ZYRO0G09548g"
                     /product="60S ribosomal protein L30"
                     /transcript_id="XM_002498362.1"
                     /db_xref="GeneID:8206213"
     CDS             join(759657..759659,759792..760106)
                     /locus_tag="ZYRO0G09548g"
                     /note="highly similar to uniprot|P14120 Saccharomyces
                     cerevisiae YGL030W RPL30 Protein component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L30"
                     /protein_id="XP_002498407.1"
                     /db_xref="GeneID:8206213"
                     /db_xref="GOA:C5E040"
                     /db_xref="InterPro:IPR000231"
                     /db_xref="InterPro:IPR004038"
                     /db_xref="InterPro:IPR022991"
                     /db_xref="InterPro:IPR029064"
                     /db_xref="UniProtKB/TrEMBL:C5E040"
                     /translation="MAPVKSQESINQKLALVIKSGKYTLGYKSTVKALRQGKSKLVIV
                     AANTPVLRKSELEYYAMLSKTKVYYFQGGNNELGTAVGKLFRVGVVTILDAGDSDILT
                     ALA"
     gene            <760320..>761591
                     /locus_tag="ZYRO0G09570g"
                     /db_xref="GeneID:8206214"
     mRNA            <760320..>761591
                     /locus_tag="ZYRO0G09570g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498363.1"
                     /db_xref="GeneID:8206214"
     CDS             760320..761591
                     /locus_tag="ZYRO0G09570g"
                     /note="similar to uniprot|P48236 Saccharomyces cerevisiae
                     YGR149W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498408.1"
                     /db_xref="GeneID:8206214"
                     /db_xref="InterPro:IPR021261"
                     /db_xref="UniProtKB/TrEMBL:C5E041"
                     /translation="MVETVNQHHRSPSEGEPVRGFSKASLSSLLELLDPLASNVSLTY
                     SPNNYLVKAKKHLKNLDPSKLTDSSQERRQQLGEWKNKVQHRVRALDPPLQNIFFNNG
                     STLDKMFYPFTLVNIFLIGLLMGKFPEWFHVYYTVMFNILMPIRFYTYYKTNNHYFLA
                     DLCYFTNMLCLLFIWAFPESVNLYQTCFALTFGTLSFAVITWRNSLVIHSLDKCTSCF
                     IHIIPVCTMYVIHHGVVPEFQENRFPAASKKLAPFWNLKKNIVWTSFYYLIWQSLYHY
                     FITIRQSYKIKSGQRMTSFEYLTTHTYKDFWMVKLPAPWPMLIYIVTQYLYQLCTMCL
                     CGIWYNYRPAAAGFLILIFLCASHNGATYYVDFYGKRYEKEVGRLRDETESLQQQLKY
                     TGTNSDSSMDSVSVISAESLSKENEDPKKEQ"
     gene            complement(<761703..>764222)
                     /locus_tag="ZYRO0G09592g"
                     /db_xref="GeneID:8206215"
     mRNA            complement(<761703..>764222)
                     /locus_tag="ZYRO0G09592g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498364.1"
                     /db_xref="GeneID:8206215"
     CDS             complement(761703..764222)
                     /locus_tag="ZYRO0G09592g"
                     /note="similar to uniprot|P48237 Saccharomyces cerevisiae
                     YGR150C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498409.1"
                     /db_xref="GeneID:8206215"
                     /db_xref="GOA:C5E042"
                     /db_xref="InterPro:IPR002885"
                     /translation="MLSLKSRGSWNVLRWIQVPRRTAVIPAKPSPMRRKRRRIKNVSS
                     KDLDLRGIDPQDSRALEFKVKQLQEFTRNLKEQFKLADSNTKKLEAEEELAKSIPEDD
                     DKRADELFGKLEAPAFEKPLPQPNLSTLILSAENQQLKKLIPVEIKERINDDGFLLAR
                     LIDKDNQNWNDIISKLYTTEKRLSDISMPIISSGILRKVKNLSYENIEKLDIMLLETK
                     NGDITCFNRLMYETLLLNLSNLRPPTSGEEDKVTMKMRQLLERYDKSKEISPDVPSKM
                     TQFSLNCCLKYSTKSVSFENMEYFLSKFKNDYGITPNRENYTTVIQFYVKFGVSKQAW
                     DVFDTMKFLSSSHAPDVTTYNSVLHLCNRERDYAKAIDLYEEMLDRQLQPSIQTLNIM
                     AKTMARASADNVISEGKADSLRLLGWKYIHTLESTFDHTKHETHFYHTLEAMMALAAY
                     DGDVGFARALYYKYTTRKYKEVVKYWKGKFDSQKIWQTALDPQLFNLLLLAYANFRPN
                     KLPILLGYEKGIKLRRNILNSVDYAGRYDLDDEIKVQLPMLPISDMNQAWQILAESRA
                     LWQFNLEFGGYYDLRDTPEGFDTTRLQEMVSKSATQDELQFNILHQVSQWKFQLVNHS
                     ILNPKSLTTFLTIPIKNGDRIEFMLRLKEFTFQQNDLESRIEKLYKGLKLVESRVEPN
                     SHERDLAINQIEMDENVKWFASMKHKIVAKNYIYELMMKAASAFKDSAISKDAWQSRG
                     EYRKTKLFQQMDSKRRIESDTQFAALMVQFFARQNMLTDALAIVMSTRKFIDWKYHMV
                     KGLHEGLVKLEDEKSISILLDIVNKKSSIELLDEKIRDFQL"
     gene            <764438..>764812
                     /locus_tag="ZYRO0G09614g"
                     /db_xref="GeneID:8206216"
     mRNA            <764438..>764812
                     /locus_tag="ZYRO0G09614g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498365.1"
                     /db_xref="GeneID:8206216"
     CDS             764438..764812
                     /locus_tag="ZYRO0G09614g"
                     /note="similar to uniprot|P53188 Saccharomyces cerevisiae
                     YGL029W CGR1 Coiled-coil protein that may contribute to
                     compartmentalization of nucleolar constituents expression
                     is growth-regulated"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498410.1"
                     /db_xref="GeneID:8206216"
                     /db_xref="InterPro:IPR005579"
                     /db_xref="UniProtKB/TrEMBL:C5E043"
                     /translation="MSSSEVGNKELDNSKVKGVPVSGRTWKVDKEQLRVGSRQVRNKK
                     LRSWELKQQKRLEDKQFKERMRQLKEDKEQEHQKWIQSLRERREKRAEKERYEMLATK
                     MHAKKVDRMRRREKRNKALKER"
     gene            complement(765217..765307)
                     /locus_tag="ZYRO0G09636r"
                     /db_xref="GeneID:8206217"
     tRNA            complement(join(765217..765252,765271..765307))
                     /locus_tag="ZYRO0G09636r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8206217"
     gene            <765491..>766492
                     /locus_tag="ZYRO0G09658g"
                     /db_xref="GeneID:8206218"
     mRNA            <765491..>766492
                     /locus_tag="ZYRO0G09658g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498366.1"
                     /db_xref="GeneID:8206218"
     CDS             765491..766492
                     /locus_tag="ZYRO0G09658g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498411.1"
                     /db_xref="GeneID:8206218"
                     /db_xref="GOA:C5E044"
                     /db_xref="InterPro:IPR007828"
                     /db_xref="UniProtKB/TrEMBL:C5E044"
                     /translation="MGPKKQGHLLEIIDEDVQSVNAFQGRLRKISSNSNGHQNDEDSN
                     HDSKRRKVHKDGSSKSSGKDNDHHDIMEGISQEDFRQYHKAKDRVRNFYKEQHEMQTM
                     AYNLQARVNYKTKTRAKMTIWDALCKLSELIDDSDPDTELSQIDHAIQTAESIRKDGK
                     PRWMQLVGLIHDLGKILYFFDSEAQWDVVGDTFPIGCRFAEENIFYEFFEGNPDNSHP
                     IYSTKYGVYEPNCGLNSILISWGHDEYMYYIAKSQSILNEKALAMIRYHSFYPWHREG
                     AYRYLMNEKDCELLEVVQDFNKYDLYSKCSQKYDLKELEKYYRDLIDEYFPQKYVEF"
     gene            complement(<766783..>768306)
                     /locus_tag="ZYRO0G09680g"
                     /db_xref="GeneID:8206219"
     mRNA            complement(<766783..>768306)
                     /locus_tag="ZYRO0G09680g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498367.1"
                     /db_xref="GeneID:8206219"
     CDS             complement(766783..768306)
                     /locus_tag="ZYRO0G09680g"
                     /note="similar to uniprot|Q5AKC7 Candida albicans SCW11
                     Potential cell wall glucanase and some similarites with
                     YGL028C uniprot|P53189 Saccharomyces cerevisiae"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498412.1"
                     /db_xref="GeneID:8206219"
                     /db_xref="GOA:C5E045"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5E045"
                     /translation="MINAIQLLASLAFLHSLAAALPVKREIVTRMHTAPTHTNTDMYS
                     TTTRIHVAPTVAYVVNGDVTYTTTLVPPNVDPTAEPVTSVIYGTSSAASQQPSQTPES
                     SSDSWSSPAPSSSPQAASSTTQLSSVSSQSPSPAPVSSSESSFPAPATSSESSSAAPA
                     TSSESSSPAPATSSQSSSPAPVTSSQSSSPAPAGSTQWTTLYPSSSSSSSSSPATPSS
                     SWTPASSSSAPSSSSSSASSSGGLVSVPTAISYTPYNDDSTCKSSDQVNADLQEIQSK
                     GIHRIRVYGADCGAFENILPAATRLGMKVNQGLWIDQSGVNSIDDAVQSLIQYGTQNG
                     WDIFDFITVGNEAINSGFCSVSDLISKIQSVKSQLRNAGYQGAVITSEPPVTFETNPQ
                     LCTDSGIDFVGVNPHSFFDFGIDANDAGSFVKGQVQLAQNACGNMDIFVTETGYPSNG
                     YIIGQEEPTQENQRIAINSILEEMNNNVTILSFFNDKWKNPGPYGIEQWFGIESQFN"
     gene            complement(<769394..>771838)
                     /locus_tag="ZYRO0G09702g"
                     /db_xref="GeneID:8206220"
     mRNA            complement(<769394..>771838)
                     /locus_tag="ZYRO0G09702g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498368.1"
                     /db_xref="GeneID:8206220"
     CDS             complement(769394..771838)
                     /locus_tag="ZYRO0G09702g"
                     /note="similar to uniprot|P53008 Saccharomyces cerevisiae
                     YGL027C CWH41 Processing alpha glucosidase I involved in
                     assembly of cell wall beta 1 6 glucan and
                     asparagine-linked protein glycosylation ER type II
                     integral membrane N-glycoprotein disruption leads to a K1
                     killer toxin-resistant phenotype"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498413.1"
                     /db_xref="GeneID:8206220"
                     /db_xref="GOA:C5E046"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:C5E046"
                     /translation="MLIMLVTELLLNIFCLSIGALASQKAFSNDLSFEEYTEQSLLWA
                     PYRPNCYFGLRPRNVDETPFQLGIMWFDNSRTDGVTRLRHFVDQGDHLNKYGWDVYDP
                     RLGGRETIIDDDNNLNLTIYFTKSHNGQNWAVRLHGEPIDANRDTTASIILYMNQNGE
                     NSNSRLVNMGSKSSKSMKFHGVSTELGEYEISVKRNSGKLFKDRALSSMEIVPGCDAS
                     KTSHLSMNVPDDSVWKAKDVFQTLLADSVKSILETQPEDVHTSLIPSVFTVRNIYGLP
                     PGNFHFLQNTFDNSDPKGFELDVVYNKVKASERISSSEDVSNLISYTLAEVTARFNRN
                     FQFSFQDEEHRKFAMETLSNLLGGIGYFHGKQLVDRTTELDEDTFREVPFTHPQEEGP
                     LSLFTSVPSRAAFPRGFYWDEGFHLLQIMDYDFDLAVEICLSWFELIEDGGWVAREVI
                     LGEEARSRVPGRFAVQNPHIANPPTLLLAFSEMLGRAIEQANQGSMNRFGEEDATAGN
                     NQLENNSELLITYAQKIYPKLLKHYNWFKTSQQSSLDDYLDILEEDGILDKVYVNETY
                     RWRGRTVTHCLPSGMDDYPRAQPPDDSELDVDALAWVGIMTRSMRQIAHILGLEKDEQ
                     MYSDIESRIVENLDVIHWSEEDGYYCDVTVGGEWDDQRSFSCHAGYVSILPFALKLMP
                     KDSPKLDQIVSLLSDSNKLFSDYGILSLSRDDEYFGKDENYWRGPVWMNINYLVLDAL
                     KFYYPEVVSKDKKVPSDAKKLYQALKQNLIDTVFDNWEKTGYCYEQFNPKTGKGQGIE
                     HFTGWTALIVNVMGHA"
     gene            complement(<772244..>774973)
                     /locus_tag="ZYRO0G09724g"
                     /db_xref="GeneID:8206221"
     mRNA            complement(<772244..>774973)
                     /locus_tag="ZYRO0G09724g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498369.1"
                     /db_xref="GeneID:8206221"
     CDS             complement(772244..774973)
                     /locus_tag="ZYRO0G09724g"
                     /note="similar to uniprot|P32786 Saccharomyces cerevisiae
                     YBL014C RRN6 involved in the transcription of 35S rRNA
                     genes by RNA polymerase I member of yeast Pol I core
                     factor (CF) also composed of Rrn11p Rrn7p and TATA-binding
                     protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498414.1"
                     /db_xref="GeneID:8206221"
                     /db_xref="InterPro:IPR019350"
                     /db_xref="UniProtKB/TrEMBL:C5E047"
                     /translation="MDDGLLPQHFPTGAQLAVGVRGSSMYVPSQEETGKNGGWVRHFE
                     DDMPFNLNELQIGKDAIVLDDPSTFIVEDDDEDGMESLRNLQDDSPVDDEVLDDDNEF
                     NEQWKETIIKDLRWERLSPSIPSNFSVFQGIDFHKDPMFDTRYGSPISPQDYVPGTLI
                     NDITQSDYLAAVRRKSKRETEKLLMFDPVVNDLFVAGNIQTARDLRSNSDQQTVIAFC
                     SGETNSILKLAVLPENKLHLANGAQWLQELFAKNVDDELGTFASIDLKASIKSIKIAD
                     VSSLLGRCSDTVGVLTENALHFIKIDNIDPQTSHISYSMHEPLKSTSFGDFPFADFVF
                     NPWELQQFAVVDIKGNWGVARLPKAIKPGSRIRFLPNLKGSIFDPEELSNWKRIEWSS
                     SYSKLLIIDASKMVELDIENDWQLEVVQAKTWSYLRDYRRIDDEFGALLTSKEIIIVS
                     TKSGNEQVSRVISWKHCLDPTDQTLRLSIQKMPLGFKMLILTCIFSKGHDKVYVHGFC
                     HDQDRHLVQAVNGPILICMPHVFKGISSMHFLPYNEEERWIASDTQGQKLWLNFLFKD
                     NSTNRLMHCFLTNDELSDPQDQLFVTPERMDAVPSLLPPIARHIDQVRFFIGQTKVTM
                     FEEPETPIAPDSEIFQNFGYQLSEAINGIVESWENQQMDIEQVQPLLSDLTNVPTKYE
                     SMEELESLLHQLSEYYRDLGIVLTDFKTISKLLIKEETMNFDLFFSKLLQCWDIVTPN
                     SLSVTRKVFDSILWSILRFYKSANYDKIETELRESLTEPYSEMISHWDEDESQLMGDQ
                     TSDDRLIQESSRPQFLFGSQSQIPTIKSSQSKSTRRRRHPHSVQTESSFNVPFTPTEQ
                     DLSSSRISGSQWGLLPNTMTPAFSLMSSPTPMLSQSQNSQRPRRKKKRIGGFG"
     gene            complement(<775201..>777327)
                     /locus_tag="ZYRO0G09746g"
                     /db_xref="GeneID:8206222"
     mRNA            complement(<775201..>777327)
                     /locus_tag="ZYRO0G09746g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498370.1"
                     /db_xref="GeneID:8206222"
     CDS             complement(775201..777327)
                     /locus_tag="ZYRO0G09746g"
                     /note="highly similar to uniprot|P00931 Saccharomyces
                     cerevisiae YGL026C TRP5 tryptophan synthetase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498415.1"
                     /db_xref="GeneID:8206222"
                     /db_xref="GOA:C5E048"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR002028"
                     /db_xref="InterPro:IPR006653"
                     /db_xref="InterPro:IPR006654"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018204"
                     /db_xref="InterPro:IPR023026"
                     /db_xref="UniProtKB/TrEMBL:C5E048"
                     /translation="MSELLRQTFANAKKEGRNALITFMTAGYPRVEDTIPILKGFQEG
                     GVDVIELGMPFSDPIADGPTIQVSNTVALQNNVTLKQTLELVAKARAEGITVPILLMG
                     YYNPILTYGEERFIKDAAEVGVNGFIIVDLPPEEALKVRNYVRDNGLSLIPLVAPSTT
                     NERLELLSKVADSFVYVVSRMGTTGAQSSMANDLDELVNRVKQYTKEIPIAVGFGVSH
                     RQHFLDVGQHSDGVVIGSKIITLVGEAPEGKRGEVAKNYVSEILNGVTHSTLSKEEFK
                     EIQKKSIEIAKQQQELVNTFQEVHKFPIRFGDFGGQYVPEALHACLRELEQGFDEAVV
                     DPKFWEDFRSLYSYIGRPSSLHKAARLSEYIGGAQIWLKREDLNHTGSHKINNALAQV
                     LLAKRLKKTEVIAETGAGQHGVATATACAKFGLGCTVFMGAEDVRRQALNVFRMRILG
                     AKVVAVTNGTKTLRDATSEAFRFWVSNLKTTYYVVGSAIGPHPYPTLVRTFQSVIGQE
                     TKEQFAALNDGKLPDAVVACVGGGSNSSGMFSPFEKDLSVKLLGVEAGGDGIDTDYHS
                     ATLTAGRPGVFHGVRTFVLQDKEGQVHDTHSVSAGLDYPGVGPELAFWKASGRADFVA
                     ATDAQALQGFKLLSQLEGVIPALETSHAVYGACELAKTLKPDQHIIINVSGRGDKDVQ
                     SVAEVLPKLGPKIGWNLRFEEDPSSG"
     gene            complement(<777685..>779112)
                     /locus_tag="ZYRO0G09768g"
                     /db_xref="GeneID:8206223"
     mRNA            complement(<777685..>779112)
                     /locus_tag="ZYRO0G09768g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498371.1"
                     /db_xref="GeneID:8206223"
     CDS             complement(777685..779112)
                     /locus_tag="ZYRO0G09768g"
                     /note="some similarities with uniprot|P40356 Saccharomyces
                     cerevisiae YGL025C PGD1 Subunit of the Mediator global
                     transcriptional cofactor complex which is part of the RNA
                     polymerase II holoenzyme and plays an essential role in
                     basal and activated transcription direct target of the
                     Cyc8p-Tup1p transcriptional corepressor"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498416.1"
                     /db_xref="GeneID:8206223"
                     /db_xref="GOA:C5E049"
                     /db_xref="InterPro:IPR020998"
                     /db_xref="UniProtKB/TrEMBL:C5E049"
                     /translation="MSGGEELSEILSINMKLDELESKLSSGDSSKESVMGAINETKGS
                     ILPMRLKFNDFLQTMSSIDKMQEVSPDEKFLLIKSKLLELTNSMQQVSEEFTKLQPLF
                     DTVPEYAERYGNKRYLPLETLRSATNGNGNDFSAQQLNQPNQQIPQSQQSVMESQQAQ
                     PLQQQQLQQQLQQQQQLQLQQQQLQQFQLQQQQQQQQINGNSAPSVNSVQSRKKSKSN
                     AGTPGSNVNTPSGGVTINNVTPSSKKPRKPRQPKRTPSGLNMGMGIGSVPTPIMSSSN
                     FTPQNVQSPAIGGGNVMSASNGNINGNGGNSVQSVNGVPPTSTMNTPMNNVMSPLGNT
                     PSGFGLSQSHPPQPLPQQLTQQLSQQLTQQRQQQVQQQRHQQAQAQAQAQAQAQAQAQ
                     AQQQQQQQQQAQQNPSQPQYGMAPHSGQLPQAQINMNTITPANILSMNMAADNQQNWG
                     SRGGKDFDPLDINNLDFGNLNMDFI"
     gene            complement(<779383..>780183)
                     /locus_tag="ZYRO0G09790g"
                     /db_xref="GeneID:8206224"
     mRNA            complement(<779383..>780183)
                     /locus_tag="ZYRO0G09790g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498372.1"
                     /db_xref="GeneID:8206224"
     CDS             complement(779383..780183)
                     /locus_tag="ZYRO0G09790g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498417.1"
                     /db_xref="GeneID:8206224"
                     /db_xref="UniProtKB/TrEMBL:C5E050"
                     /translation="MDPSTRLEQRRLKFSKDASKKILDDPLSDKSLISRGSDLSILQK
                     DQTAREQLLSRIKKSQDKHTVDHGLRKLREAIVSVFNDSRDDPTLIAFVYEVYQLSYD
                     YFFREQDFTKLGNLVLNFMFQKFPADSHFQQLYALYSSHVESNLSKCISILANNRRPS
                     ITVQERQLIRLSSIYLINLESPSQWFFILSHLPRRQIQFLTSIAAFQHMKERCYKYIK
                     TCYNQVTLDYVLDSWFYNMVGNSDIPNDWPLESIGGVQTLVLKRGTKT"
     gene            <780268..>781356
                     /locus_tag="ZYRO0G09812g"
                     /db_xref="GeneID:8206225"
     mRNA            <780268..>781356
                     /locus_tag="ZYRO0G09812g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498373.1"
                     /db_xref="GeneID:8206225"
     CDS             780268..781356
                     /locus_tag="ZYRO0G09812g"
                     /note="similar to uniprot|P32785 Saccharomyces cerevisiae
                     YBL013W FMT1 Methionyl-tRNA formyltransferase catalyzes
                     the formylation of initiator Met-tRNA in mitochondria
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498418.1"
                     /db_xref="GeneID:8206225"
                     /db_xref="GOA:C5E051"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR005793"
                     /db_xref="InterPro:IPR005794"
                     /db_xref="InterPro:IPR011034"
                     /db_xref="InterPro:IPR015518"
                     /db_xref="UniProtKB/TrEMBL:C5E051"
                     /translation="MNLIWRSIGRRWYSLNVLYFGSDEFSIHSLRALNELKGRSVDKL
                     QLVTRPPKWCGRSKSIKKNVPIVNVADQLGLPPARHCDSREDMLQLIDLVKSHEFNMI
                     IAVSFGRLIPAQLLEQVPYSLNVHPSLLPRYKGASPIQYTLLNQDRYTGVTIQTLHPH
                     KFDHGSIVAQTIPLKVQNLVQNRTVSEFEPGFPKRTAALMDQLGLQGGSLLKHVINDK
                     LYASPPALNPPYNSCYASKITSEMRRLHWPQDTAETAITKLETLGPPYVFKQVDENKS
                     KTMVDETPVKRIIFHNFERADFLPFSKAGEFIYNDKDQHIYVQCHSDALKIKELQFEG
                     FKMEKPEQFMKSLRKRCGTGTYQAHTFL"
     gene            <781689..>783968
                     /locus_tag="ZYRO0G09834g"
                     /db_xref="GeneID:8206226"
     mRNA            <781689..>783968
                     /locus_tag="ZYRO0G09834g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498374.1"
                     /db_xref="GeneID:8206226"
     CDS             781689..783968
                     /locus_tag="ZYRO0G09834g"
                     /note="similar to uniprot|P32784 Saccharomyces cerevisiae
                     YBL011W SCT1 High copy suppressor of choline-transport
                     mutants"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498419.1"
                     /db_xref="GeneID:8206226"
                     /db_xref="GOA:C5E052"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="UniProtKB/TrEMBL:C5E052"
                     /translation="MMPVDEKTTGGSSTTGFSTTSGDTELIARDLEPATSPSSKSSTN
                     EEKEDKDKGNEAHPHKQPFYRILIYNIILGMLLNIFDCFFREIRTRGGYKVPRQGPVI
                     FVAAPHANQFVDPVILMGQVKKVVNRRISFLVAEKSLKRRAIGFFSRCVMSIGVVRAQ
                     DNLKPAKGKITIDPENPRKLIGHGTSFLTDFKPKGLIGLPKSLGNVEIDSIESETELT
                     LRKEFKMNKPEVKSILTKGTSFKYADKVNQSLVYHKVFEHLASNQCIGIFPEGGSHDR
                     TDLLPLKAGVAIMALGCMDKHPESNVKIVPCGMNYFHPHKFRSRAVVEFGNPISIPHE
                     LVEKYRSPETNREAVKEMLDTISEGLKAVTVTCSDYETLIVVQAMRRLYAGHLSSRLP
                     LSMVVEMNRRLVKGYQTYREDPRIISLKKEIMTYNAHLSHYNIPDHLVMRDRMSFAKN
                     LWLLCFRSLRLLVMLAFALPGIIMFLPIFIVAKRISKQKAREALAASTVKIKANDVIA
                     TWKILIGMGLAPLLYTLWSIMISYLLRHRFPGNKILTFVISYFACSAVTYSALLVGDI
                     GMDIFKSLRPLYLSITTPQGLRDLQKERHALAEKITELINTIGPELFPDFDADTLRHK
                     YELDDEEEDRRTAELKRRRLLKKQKIKHEVKRAERAKTAEREENENDGHSTDSDAVSL
                     VNSENSLSNIPIFSNPANLISEGSTSSADMSSGSEFAVEEKIGAKDGVSSKIVQAIWE
                     KRSVEDHEGNNHDDADDSE"
     gene            complement(<784236..>786206)
                     /locus_tag="ZYRO0G09856g"
                     /db_xref="GeneID:8206227"
     mRNA            complement(<784236..>786206)
                     /locus_tag="ZYRO0G09856g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498375.1"
                     /db_xref="GeneID:8206227"
     CDS             complement(784236..786206)
                     /locus_tag="ZYRO0G09856g"
                     /note="weakly similar to uniprot|P53191 Saccharomyces
                     cerevisiae YGL023C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498420.1"
                     /db_xref="GeneID:8206227"
                     /db_xref="GOA:C5E053"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="UniProtKB/TrEMBL:C5E053"
                     /translation="MSSIHSQASDTLPQETQAATPPAQQQQYNRGKTPAIREENEEEE
                     DGDASNDAINRDDKPSPKANSTRSSSSSNAVSSSNGGKSMSTITFEKQKVVPPRARTH
                     SAQSVLSTISLQPMFHQHAHQNQQQSQQPQQTNEDQRNLSCTNLARINQQIQSPAMSS
                     IRKKGVTNSVTSGRISDEDLEIGLRLPFTDDKRLYLDANSVKQRQQQKQKQLQKKDNA
                     SVKTNGSTVVENEEVEEDDVVMQKRLTAQALRKLSNLRGSSTMGVGINQALINNDNNN
                     NSNNGNNNSLSYGDGDGRTIDEGSQDLEAMTHLKFGNKKVFLDSFPQGSNNNNNYYSS
                     NNNNNNNNNVAASLVTQQPSLQSIRKASLEVIQQPGQQLNTQQKVGVPPTSGTTPTNA
                     SSRRCVKQINNPKKPLYLPAVLRDVSETNLTNEDFVRPPSPPQSLVSNNQTITSRNLH
                     QQAQHSSQNTSASSTASIHSSSSSVMESCRRQIALWFFPNGEYSSMENRWSQLLDPPA
                     PPTKRHWLHDNKRGSCHYCHKLFTFWERKHHCRHCGDIFCQQHLGHWLYLNSDASFII
                     GGGGLGTLSKICDGCLEEYENVVKNPKWKSQKLGNFNQHGGLVEPTRAAAAAATPPKN
                     VEGINVQNDDSKGDFIGSVAGSVPADWNWSSF"
     gene            <787219..>789423
                     /locus_tag="ZYRO0G09878g"
                     /db_xref="GeneID:8206228"
     mRNA            <787219..>789423
                     /locus_tag="ZYRO0G09878g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498376.1"
                     /db_xref="GeneID:8206228"
     CDS             787219..789423
                     /locus_tag="ZYRO0G09878g"
                     /note="highly similar to uniprot|P39007 Saccharomyces
                     cerevisiae YGL022W STT3 Subunit of the
                     oligosaccharyltransferase complex of the ER lumen which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins forms a subcomplex with Ost3p and
                     Ost4p and is directly involved in catalysis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498421.1"
                     /db_xref="GeneID:8206228"
                     /db_xref="GOA:C5E054"
                     /db_xref="InterPro:IPR003674"
                     /db_xref="UniProtKB/TrEMBL:C5E054"
                     /translation="MVTTGKSTIAESAKTPVLTGKSSLVRWVQTVLTFTIFLAIFGAA
                     VSSRLFSVIRFESIIHEFDPWFNFRATKYLVTHSFLEFLNWFDDRTWYPLGRVTGGTL
                     YPGLMTTSGAVWHLLKRIGLPVDIRNVCVMFAPAFSGITALATYHFTKEIKDSGAGLL
                     AAAFMAIVPGYISRSVAGSYDNEAIAITLLMVTFMFWIKAQKTGSILHATLTALFYFY
                     MVSAWGGYVFITNLIPLHIFILILMGRYNAKLYSAYTTWYAIGTLASMQIPFVGFLPI
                     RSNDHMAALGVFGLLQLVAFGHFVKTKVSSDKFRVVMIVSLALILVVGVAALFALTYF
                     GFIAPWTGRFYSLWDTNYAKIHIPIIASVSEHQPVAWPAFFFDTHFLIWLFPAGVFLL
                     FLDLKDEHVFVIVYSVLCSYFAGVMIRLMLTLTPVICVAAAVALSKIFDVYLDFSHTM
                     KNKKVNVSNLVSRLLVSSTFIFYLVLFVFHCTWVNKMAYSSPSVVLPSTTYDGRTVLI
                     DDFREAYYWLRLNTEEDAKIASWWDYGYQIGGMADRTTLVDNNTWNNTHIALVGKAMA
                     SPEEKSYEILKQLDADYVLVIFGGLLGFSGDDVNKFLWMVRISEGIWPDEINERNYFS
                     ATGEYRVDSSASQTMKECLMYKMSYQGYPELFGGQGIDKVRGQTILPSDVLPLDYFEE
                     VFTSENWLVRLYQLKKEDSEGRSLKDAGDYERSTTKSNKKKNFKKPDLDLRV"
     gene            complement(<789474..>790421)
                     /locus_tag="ZYRO0G09900g"
                     /db_xref="GeneID:8206229"
     mRNA            complement(<789474..>790421)
                     /locus_tag="ZYRO0G09900g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498377.1"
                     /db_xref="GeneID:8206229"
     CDS             complement(789474..790421)
                     /locus_tag="ZYRO0G09900g"
                     /note="similar to uniprot|P32788 Saccharomyces cerevisiae
                     YBL010C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498422.1"
                     /db_xref="GeneID:8206229"
                     /db_xref="UniProtKB/TrEMBL:C5E055"
                     /translation="MDMSHSNPSNEPHADPVTQDTRDKEIKVNDVESRQVANSDEIAD
                     EHKGDTQQEQESDSDDFGSFSDASIEQEEEHIAEEVSQELDDDSNNVEKYLDQILPLD
                     DSIPKEPLPNVELDTLIQDERPRIIYEQLVLLRTVLRPFIWDKSHIKSNLWHILRIPE
                     RTIPNKQELGREPLNDSLFIALLNMLDDNKSRSQTALRDQLGINYSPPLAPIFLQEEV
                     EKQEEKEIPGLLAISPDEVENLQGYHDKLCQSIDLLLIKLQESRAEQIDLVKDKTTFE
                     NVVTNLTGHTQRLYRDEVAFYNKHKNKNKRKNRFSWVGH"
     gene            <792083..>794320
                     /locus_tag="ZYRO0G09922g"
                     /db_xref="GeneID:8206230"
     mRNA            <792083..>794320
                     /locus_tag="ZYRO0G09922g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498378.1"
                     /db_xref="GeneID:8206230"
     CDS             792083..794320
                     /locus_tag="ZYRO0G09922g"
                     /note="some similarities with uniprot|P32789 Saccharomyces
                     cerevisiae YBL009W haspin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498423.1"
                     /db_xref="GeneID:8206230"
                     /db_xref="GOA:C5E056"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR024604"
                     /db_xref="UniProtKB/TrEMBL:C5E056"
                     /translation="MAMDLDSSFGEFADDRRFIALVVSDNEDDYDSSTDEAASDDESL
                     EATPKANITPLGVRNSSNLNILNQDTSHSNNNNNNYGANNNKTPVPNSPRVSGSVRSP
                     ATTKSNKDEKKRWSFISNHSSTSSNNAKKRWSTLSSFTDSKDKDAKRDEKEKDKFVRR
                     VPTQGSGSVSSHKRISIDQHFEHSPTSKRSSTGSSLKQLFGLIALNDENKENHYPQKK
                     QESAKVPSTASTRGQPLKERRNTNVETPSSQRNSAFLGKTEMPRRQSRLHTHSPSISS
                     LSSLTSSSKWKFWQRSGNSIRDRTISRPLSTHSLVGPPTDPTTKTKSSFSELHKAIYA
                     NNNSTFEDNSSSISNSLSKRLSSSNLSLGNLKHRSSQSSLKHKSSQSSLQRFKTRRKS
                     NNMAEEGSISSSGSHSHHPKISLPVVDQMSRDKIKTKLRNSSSLLSLHSSLPIMMKDY
                     DEVVLQQILEYCDVSKELPYDDDYIPVLKNATELSTHVWRAQSEGTNVIYKKLPLETL
                     EDVTYSKSMCLHELKMLRLSKGTTGLPYLLRSFVIRERPIFDEETASTTEGKLYLLII
                     LRDNGTPLSQIKLNTWPQALKIFWQVVTTLYVAETKFEFEHRSLSLDHILVDDHLNVT
                     LCDLKGARAYWASRKETLFTRLDHPLFFQGGGDYQFDVYNLMRAILSETSWDNYEPRT
                     NLLWLHFLLYKLFHAYGDKLVLQGRERLAALAQLLDPSSNARRSIFKRNEREVRSCGD
                     LLRFK"
     gene            complement(<794352..>795065)
                     /locus_tag="ZYRO0G09944g"
                     /db_xref="GeneID:8206231"
     mRNA            complement(<794352..>795065)
                     /locus_tag="ZYRO0G09944g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498379.1"
                     /db_xref="GeneID:8206231"
     CDS             complement(794352..795065)
                     /locus_tag="ZYRO0G09944g"
                     /note="similar to uniprot|P53192 Saccharomyces cerevisiae
                     YGL020C MDM39 Protein involved in determination of
                     mitochondrial structure"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498424.1"
                     /db_xref="GeneID:8206231"
                     /db_xref="GOA:C5E057"
                     /db_xref="InterPro:IPR027538"
                     /db_xref="InterPro:IPR028945"
                     /translation="MDSGGWIVYCCIFFILLGKVLEYTSSYQDKWFTKLTLTPEARKL
                     NSQYHELLSERLRLQEENHSISAQDNYARWTKNNRKLGELDKKLGTIRDKLQETNTSS
                     KKVFGRVKLIGLTIPFWILKIWQRSHVVYHFPKQDLFPKLVTGVWARGWLYLALGPLQ
                     YLRNGSLNIQDYAPHGVSLGIWIWALQATINTLEFLVKQVILEKPVSPPPQKSKSATK
                     AETKRPEKLEITDDKVELD"
     gene            <795332..>796150
                     /locus_tag="ZYRO0G09966g"
                     /db_xref="GeneID:8206232"
     mRNA            <795332..>796150
                     /locus_tag="ZYRO0G09966g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498380.1"
                     /db_xref="GeneID:8206232"
     CDS             795332..796150
                     /locus_tag="ZYRO0G09966g"
                     /note="highly similar to uniprot|P43639 Saccharomyces
                     cerevisiae YGL019W CKB1 beta (38kDa) subunit of protein
                     kinase CK2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498425.1"
                     /db_xref="GeneID:8206232"
                     /db_xref="GOA:C5E058"
                     /db_xref="InterPro:IPR000704"
                     /db_xref="InterPro:IPR016149"
                     /db_xref="InterPro:IPR016150"
                     /db_xref="UniProtKB/TrEMBL:C5E058"
                     /translation="MPQDFIEDLSHPGSSEDDSGTYDEWIPTFCSRFGHEYFCQVPTD
                     FIEDDFNMTSLSQEVPHYRKALDLILDLEAMSDEEDEDEDADMGTQNGNESGGGKPQL
                     VNRSLAEHAAEQLYGLIHARYILTKPGLQAMAEKFDHKEFGTCPRYYCGGMQLLPCGL
                     NDTIGKNTVRLYCPSCQDLYLPQSSRHLCMEGAYWGTSFPGVFLKHFEELEEYVERKN
                     KEIFELKVFGFRINDAAISGPRMKWLRQYPSTPDEWEEFSKCEFEIPELPETNA"
     gene            complement(<796338..>796919)
                     /locus_tag="ZYRO0G09988g"
                     /db_xref="GeneID:8206233"
     mRNA            complement(<796338..>796919)
                     /locus_tag="ZYRO0G09988g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498381.1"
                     /db_xref="GeneID:8206233"
     CDS             complement(796338..796919)
                     /locus_tag="ZYRO0G09988g"
                     /note="similar to uniprot|P53193 Saccharomyces cerevisiae
                     YGL018C JAC1 Molecular chaperone involved with partner
                     Ssq1p in assembly of Fe/S clusters and in mitochondrial
                     iron metabolism contains a J domain typical to J-type
                     chaperones localizes to the mitochondrial matrix"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498426.1"
                     /db_xref="GeneID:8206233"
                     /db_xref="GOA:C5E059"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR004640"
                     /db_xref="InterPro:IPR009073"
                     /db_xref="UniProtKB/TrEMBL:C5E059"
                     /translation="MLNLVRQRRFLSTFYELFPQTFPKKAPVWNFNERQLRKEYRNLQ
                     AQHHPDMLGGNLSQEVSSSGGNYSSLLNKAYHTLKEPLPRSQYMLKVLNNMDLTEERL
                     SQSIMQSDPSILMQVLDTHEQLEEVLSEEDVRNIDLENRDRIKGIESQLQECYETMDY
                     GRAARLTVELKYWVNLAKAIKEWQPGKPVTINH"
     gene            <797095..>798582
                     /locus_tag="ZYRO0G10010g"
                     /db_xref="GeneID:8206234"
     mRNA            <797095..>798582
                     /locus_tag="ZYRO0G10010g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498382.1"
                     /db_xref="GeneID:8206234"
     CDS             797095..798582
                     /locus_tag="ZYRO0G10010g"
                     /note="similar to uniprot|P16639 Saccharomyces cerevisiae
                     YGL017W ATE1 Arginyl-tRNA-protein transferase catalyzes
                     post-translational conjugation of arginine to the amino
                     termini of acceptor proteins which are then subject to
                     degradation via the N-end rule pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498427.1"
                     /db_xref="GeneID:8206234"
                     /db_xref="GOA:C5E060"
                     /db_xref="InterPro:IPR007471"
                     /db_xref="InterPro:IPR007472"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017137"
                     /db_xref="UniProtKB/TrEMBL:C5E060"
                     /translation="MTERLIISEPYYFSDSISHCGYCKGQKPDKNDNFAVKSWYDKHS
                     EAKDGLDAQNCTLGVQAELVSVEMYDRLCNMGFRRSGKFLYKPDLLRNCCRMYTIRTT
                     TDQVRVSKDMKTCVKRFKKAVSPEYNQENKKDHKGPFNFTQEIIDTESKSDNFYTKFE
                     PAVYSDEKYRLFAKYQESVHNDFDHNAKSFKRFLCDAPFSPEVIRGTKQEWDQLNDWK
                     NPERSHFERVGPAHECYYYNGNLIAIAVIDILPSGISSVYFIWDPEYGKLSLGKLSAL
                     RELAISSKINRKHYYMGYYIQDCPKMNYKGKYGGELMDLCNYRYTPLTRVEKEIDHSK
                     FFVLSDDPNLTNEPHLNERFSGTADVWQTPGSLHNVVENIYGVNGGAFKVADDAAEQL
                     SRREIPYSRELTHDICNDGNGKNDIYRIPNVVPGLLPLEEILQMVLQKKINLVNNSMV
                     LFDTSVGHIRLVVDFDSESPKIKKAVCDLVRLFGLQNTMDSLVIV"
     gene            <799068..>802061
                     /locus_tag="ZYRO0G10032g"
                     /db_xref="GeneID:8206235"
     mRNA            <799068..>802061
                     /locus_tag="ZYRO0G10032g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498383.1"
                     /db_xref="GeneID:8206235"
     CDS             799068..802061
                     /locus_tag="ZYRO0G10032g"
                     /note="similar to uniprot|P32767 Saccharomyces cerevisiae
                     YGL016W KAP122 Karyopherin beta responsible for import of
                     the Toa1p-Toa2p complex into the nucleus binds to
                     nucleoporins Nup1p and Nup2p may play a role in regulation
                     of pleiotropic drug resistance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498428.1"
                     /db_xref="GeneID:8206235"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E061"
                     /translation="MLWKLFKANLLHLVKFCNQYVKDPSTCAPLLITIKKLMSNLSLI
                     FTNINELGNAETTGNAVTHWNNPIDTLVLMLSHEEQFASENWQDTLQTDELIHRLINS
                     PVPYNGLMQFIKTSELCNKLVLMFTEIIVEDLTKLQSRKGSMSKTYEVVHEHLYISTM
                     ALINANLSEWQVSEDILYNCIGAWINYISMARNVSPHGRMDLSEMFDNMINRMCQSSE
                     ATDDFYQAEKILSILANVFANDPIIMGHPQREQLEVIFLGVSRTGNADSSKNEWMLQY
                     MNHLVTNEMTDDLKELAVCVVDFLQVNTLDMCNKLFTVISSSQVNGENLQQYVKVLLQ
                     LTNFPLVPVLQEFFSVRMVDFWLDLADCYSNTITETYTEQAPQLATEIFQQVVNIYLP
                     KISLLNKQKAMEAESDDTATHEFDDFRSAIADLMESLWSILGNDKLTNILITGVGENT
                     LSAGGAGNVDIFEIEAMSFLLNTLLTDMNLSESPWICDILDSCEFFIRNILMLFQVGC
                     ESPADSVVARTLKLDFVRTGSSLIGTMAGYFQQSPSQLSTCVDALFQGLEKCTVSASP
                     ADSQLNDKMEVMIIKTISILCDTCRHELSSYLMQFINVFNTIMRPESNVSTFTREKLT
                     RSMGFIIESQVENGPEKQANCMLEVLNTIENYIQQALSIPEPPSEQQRSYLHCMLSCI
                     SELGTAMIHSSDVENEAFVQRIAEFQNYWQSDPLQISYKVLNLLQLVLSNPAYAKDMA
                     FVEVSCLILGKALGLPNEDPHFLKYSMSDIMEFLLKHISTTEVALALPYYVYLLEKLI
                     KHYKDQLSSQDFDFLFENFFFKYYQSAILHDPDLLQTTINFVNSVLDSKPGLVVHGTY
                     WTSFLLPEFVKYLSAKERFTIVAVTKFWCKVINNKKYTREDIELTHHQFVSMGQDIVY
                     QAMFGLFHSQRSDLNSYTDLLRTIMAKLPLQTPKWLVTALPAISNNNAAHEKFVSKLS
                     VTRGSRAANNVILEWWLSCNALPSL"
     gene            <802784..>805312
                     /locus_tag="ZYRO0G10054g"
                     /db_xref="GeneID:8206236"
     mRNA            <802784..>805312
                     /locus_tag="ZYRO0G10054g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498384.1"
                     /db_xref="GeneID:8206236"
     CDS             802784..805312
                     /locus_tag="ZYRO0G10054g"
                     /note="similar to uniprot|P32479 Saccharomyces cerevisiae
                     YBL008W HIR1 Non-essential transcriptional corepressor
                     involved in the cell cycle-regulated transcription of
                     histone H2A H2B H3 and H4 genes contributes to nucleosome
                     formation heterochromatic gene silencing and formation of
                     functional kinetochores"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498429.1"
                     /db_xref="GeneID:8206236"
                     /db_xref="GOA:C5E062"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011494"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019015"
                     /db_xref="UniProtKB/TrEMBL:C5E062"
                     /translation="MKIVKFPWLSHREERRKYEVYTVDVSADGKRIATGGLDGKIRIW
                     SVASIQEAAKEESAKRTVDEELKRPLASMSRHTGSVTCVKFSPDGKYLASGSDDRILL
                     IWAKDEEPRTEPIFGNEFEKEHWMVRRRLVAHDNDIQDICWAPDSSILVTVGLDRSII
                     IWSGSTFEKIKRFDVHQSLVKGVVFDPANKYFATASDDRTLKVFRYHKAGDLAFTIEH
                     VVSDAFKGSPLTTYFRRPSWSPDGQHIAVPNATNGPVSSVCIVNRANWDTSISLIGHD
                     APTEVARFNPRLFEVQNGGQSNAEGTEDQKNKREEVESIVATAGQDKSLALWGTSKAR
                     PIFVAYDIANKSITDMAWTPQGDTLFVSSLDSSLTVLFFDKGELGKAIPLEKNIEQLH
                     RYGVDKDSLDFPESVKQLSLEEEARKWRPQPREPSIGFLESRVGVKESQRANNNNDNS
                     NDNDFNKEKEKEQTPAVSRNENINILIPKRKKDNKLNQTEVKDGRKRVAPTLLSSGYS
                     PVRATPSFDKPSGGVTKPTTAAPKKKPVSLSMQGAEGKMSIQSYPMPRLGIHTLIMGM
                     KERGKDVFYKEKDLTAQSQKDGNDISPGVEGGIPNADTDISEEEHTMTLNSKLTQDKV
                     WVDEPNVRYLKTPGIIPDTDAVLLECGTFEDFYVLEIRNGVERSIQFDTEALLDNPTR
                     ILGYHKGKRTIELFVPEVVICAVGSINCKLWCLATANGSIFIISHSGQYRSPKISLGH
                     KVIKLRAQDEYLIAFTERGLFFVWNLATLKLIYKNVPILPILNGEPVEGNRVRSGKRI
                     KSFCLDADAKSLLVHMTNPDMIYQWIGQLGCWCEYDEDKIVGAE"
     gene            <805645..>807993
                     /locus_tag="ZYRO0G10076g"
                     /db_xref="GeneID:8206237"
     mRNA            <805645..>807993
                     /locus_tag="ZYRO0G10076g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498385.1"
                     /db_xref="GeneID:8206237"
     CDS             805645..807993
                     /locus_tag="ZYRO0G10076g"
                     /note="highly similar to uniprot|P07264 Saccharomyces
                     cerevisiae YGL009C LEU1 Isopropylmalate isomerase
                     catalyzes the second step in the leucine biosynthesis
                     pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498430.1"
                     /db_xref="GeneID:8206237"
                     /db_xref="GOA:C5E063"
                     /db_xref="InterPro:IPR000573"
                     /db_xref="InterPro:IPR001030"
                     /db_xref="InterPro:IPR004430"
                     /db_xref="InterPro:IPR004431"
                     /db_xref="InterPro:IPR012235"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR015931"
                     /db_xref="InterPro:IPR015932"
                     /db_xref="InterPro:IPR015937"
                     /db_xref="InterPro:IPR018136"
                     /db_xref="UniProtKB/TrEMBL:C5E063"
                     /translation="MSYVSTKGPRTLYDKVFDAHVVKRDSSGSCLLYIDRHLVHEVTS
                     PQAFEGLRNAGRKVRRTDCTLATVDHNIPTASRKTYKSTATFIDQADSRLQVQTLEQN
                     VKDFDVAFFGMAENRQGIVHVIGPEQGFTLPGTTVVCGDSHTSTHGAFGALAFGIGTS
                     EVEHVLATQTIIQSKSKNMRIMVKGDLTPGVTSKDLMLHIIGVIGTAGGTGSVMEFAG
                     KAIEDLSMEARMSMCNMSIEAGARAGMIKPDETTFNYVKNKPLAPKGAEWDKAVAYWK
                     TLHTDEGAKFDHEVIINAADIVPTITWGTSPQDALPITASVPDPAEANDPIIKSGMER
                     ALAYMGLTPKTPLKDIKIDKVFIGSCTNSRIEDLRNAAAVVKGYKIADNIKRAMVVPG
                     SGLVKSQAEKEGLDQIFKEAGFEWREAGCSMCLGMNPDILSPEERCASTSNRNFEGRQ
                     GAKSRTHLMSPAMAAAAGIAGHFMDIREFKYKNGDVPKVSIGQEEEDRKLQDAVYAHE
                     EEVLQPNDLSESMAEEEVDDIPVNEPERKIVKPNGSSAPPAGLPPFLTLEGIAAPLEK
                     ANVDTDAIIPKQFLKTIKRTGLSAGLFYEWRFVKDAEGKEQATDFVLNVDPYKQAKIL
                     VVTGDNFGCGSSREHAPWALNDFGIKCIIAPSFGDIFYNNSFKNGMLPIRVDQQVIVN
                     KLCPLAKEGKQLVVDLPKQQILSSDGEVLVDHFDVEEFRKHCLVNGLDDIGLTLQNES
                     DISKYETLRRDKFSFLEGGSSKLIKPVRGTKKSPFGNKAQEW"
     gene            complement(<808399..>812577)
                     /locus_tag="ZYRO0G10098g"
                     /db_xref="GeneID:8206238"
     mRNA            complement(<808399..>812577)
                     /locus_tag="ZYRO0G10098g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498386.1"
                     /db_xref="GeneID:8206238"
     CDS             complement(808399..812577)
                     /locus_tag="ZYRO0G10098g"
                     /note="similar to uniprot|P32790 Saccharomyces cerevisiae
                     YBL007C SLA1 Cytoskeletal protein binding protein required
                     for assembly of the cortical actin cytoskeleton contains 3
                     SH3 domains interacts with proteins regulating actin
                     dynamics and with proteins required for endocytosis"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498431.1"
                     /db_xref="GeneID:8206238"
                     /db_xref="GOA:C5E064"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007131"
                     /db_xref="UniProtKB/TrEMBL:C5E064"
                     /translation="MTVFIGVVKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTV
                     KKRVIGLDAEEPTGLVPSNYVEPANVIGTVRALYDYEEAQNPDEEITFLENELFDLFD
                     DQDQDWLLVQSKSSGAYGFIPGNYVEPAQGAPTTPAAAPAPAPIAPPGPTPIAPPIMT
                     PAGADELPPPPQPQRPGREPEDVTPALPKRPRDQEPPLPEPPLPPMRDEEEPPLPSRP
                     RDRVDEDEDEELPPPPKPVRPTSTGGGPSLGGLAGAGTERDDYRLGRRVESEDDYEDD
                     NYGGGYNDMGLNSSDHHTWSIAEVDGRKKKKCKLTVGGSKIYFEPSDGPHEEWTIDNL
                     TTYDNEKKHIFLEFVKPYRSLELHAGSTDTCNEIMSILGEYKGAQRDPGIREIEEASK
                     PKKEANVVHDFRAEADDELTVRQGQVVYIINDKKSRDWWLCELVSNGQRGIVPADCLE
                     SVKEKSSSSGFFGSLRKITGNTDKYNAKQNAKQASHKERDRERERLKNGSHARNHGRS
                     ESGSWKDDEAQSLNSVSNERRNTDRRRSNSMSAKKSSSGSTSKSQFPDPKKTRIWADR
                     SNTFKVEAQFIGCTEGKIHLHKANGVKIAVAAGKLSDEDLVYVERTTGFSLDKFKSRS
                     SEGSDEKRKRSTRDQDDEERDRYLREKELEELRKARELLDEERTRMQELTEKKPAKPP
                     RPQTTGGTNTMTLNYQPQYDWFEFFLNCGVDVNNCQRYTINFEREKITEDMMKDINEP
                     MLRTLGLREGDIVRVMKYLDKKFDREPKLPQGQATGGMFSQPDGSLKVSNADVSPAPP
                     LTQNLLPQATGAAVAQPTQASQTPLETAIPNATRNADDDAWTSKPAAKSESSVLDKNN
                     NSNFTGSMQDLIDLRPLEPKKKEPTAAPEPNLKDLEPVKTGGETKAAPLSSAPTGGTT
                     LQPLDPFKTGGNNLLPLTTGFVMMPVATGGLMPMQRTGGLAMPQTTFGNQNMDGLMQP
                     QKTNSALMPMGLQTTGGLKPQVTNPSLAPMNFQTTGSMLQPQRTNPGLIPIGTGGAMQ
                     PQGNSNMISMGTTGGGMMPQTTFGSQPMSQPMGASMPLQTTGGTMPRLGSVLPVQKTG
                     SGILPLQPTGSAMPMQATGSAMHFQGTGGFIPFQRTGGMPQQPTGNLIPLQRTGGNMM
                     PQTSFGANVTGGANMMPQTSFGANVTGGANMMPQTSFGTNVTGGANMMPQTSFGGPQL
                     TGTGNMMPQTSFGGPQLTGAGNMMPQTSFGANVTGGPNMMPQSSFGAQQMTGGANMMP
                     QTNFGGSQISGGFPQTSFGSGAQGTGGYPGMVQSVPQMTGGFQQNGHFGSQNQFTGGP
                     MPQQSFPGSSFNSGVDNATQGMQNMSLSQAPLQAQPTGFGFGNGPQQPQQPQQHGAKQ
                     ANLFNATPDNPFGF"
     gene            complement(<812965..>813471)
                     /locus_tag="ZYRO0G10120g"
                     /db_xref="GeneID:8206239"
     mRNA            complement(<812965..>813471)
                     /locus_tag="ZYRO0G10120g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498387.1"
                     /db_xref="GeneID:8206239"
     CDS             complement(812965..813471)
                     /locus_tag="ZYRO0G10120g"
                     /note="similar to uniprot|P25338 Saccharomyces cerevisiae
                     YGL010W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498432.1"
                     /db_xref="GeneID:8206239"
                     /db_xref="InterPro:IPR009305"
                     /db_xref="UniProtKB/TrEMBL:C5E065"
                     /translation="MFHNQLDLKAQLKQYKLYHREKTNVLIHMVFVPTILFSTCCMAH
                     RIPLGHGITLTNVLTTVFALHYVLLCFVPGLIASLLLAVLNWSLDNGKIRLHAYQEVS
                     LFVMGWIVQFIGHGYFEHCRPAIIDNLIQSLVTAPYFVLFEVLFKLGFYKQLQAELDR
                     DIKEETSR"
     gene            813980..814070
                     /locus_tag="ZYRO0G10142r"
                     /db_xref="GeneID:8206240"
     tRNA            join(813980..814016,814035..814070)
                     /locus_tag="ZYRO0G10142r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8206240"
     gene            <814364..>815125
                     /locus_tag="ZYRO0G10164g"
                     /db_xref="GeneID:8206241"
     mRNA            <814364..>815125
                     /locus_tag="ZYRO0G10164g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498388.1"
                     /db_xref="GeneID:8206241"
     CDS             814364..815125
                     /locus_tag="ZYRO0G10164g"
                     /note="highly similar to uniprot|P21243 Saccharomyces
                     cerevisiae YGL011C SCL1 Proteasome subunit YC7alpha/Y8
                     (protease yscE subunit 7)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498433.1"
                     /db_xref="GeneID:8206241"
                     /db_xref="GOA:C5E066"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5E066"
                     /translation="MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTSINSLA
                     IRGKNCSVIISQKKVPDKLLDPSTVSYIFKISKTIGMVINGPIPDARNAALRAKAETA
                     EFRYKFGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVIQTYVSVDEEQGPSIYKSDPA
                     GYFVGYKATATGPKQQEITTRLENYIKKTPSQDYMQEESWEKVVEFGITTLTDSLGTE
                     FSKKDLEVGIAVPDNFFTLTPDEIEERLVAIAEQD"
     gene            complement(<815183..>815779)
                     /locus_tag="ZYRO0G10186g"
                     /db_xref="GeneID:8206242"
     mRNA            complement(<815183..>815779)
                     /locus_tag="ZYRO0G10186g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498389.1"
                     /db_xref="GeneID:8206242"
     CDS             complement(815183..815779)
                     /locus_tag="ZYRO0G10186g"
                     /note="similar to gnl|GLV|CAGL0E02761g Candida glabrata
                     CAGL0E02761g and some similarites with YBL006C
                     uniprot|P38210 Saccharomyces cerevisiae YBL006C LDB7
                     Protein of unknown function null mutant shows a reduced
                     affinity for the alcian blue dye suggesting a decreased
                     net negative charge of the cell surface"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498434.1"
                     /db_xref="GeneID:8206242"
                     /db_xref="InterPro:IPR013895"
                     /db_xref="UniProtKB/TrEMBL:C5E067"
                     /translation="MEVMNSQLPKRRTYYEVIAGLASFERSQDVSLSHPELQELVKAE
                     FHNKQAEKLPNTTNEETKRKKVTVHGYLGGKVDLDEASNASYDLSHTLLGGYVPRRQL
                     ESLSSIDFAHYFHKSLECEDALQIYDMFVANNFRRATALPSTVTHVNNNNSSNHNEPH
                     ASSGSAVKKSLVCKKCGTKFSGSHRMHRLRKHDCNSKR"
     gene            complement(<815992..>817398)
                     /locus_tag="ZYRO0G10208g"
                     /db_xref="GeneID:8206243"
     mRNA            complement(<815992..>817398)
                     /locus_tag="ZYRO0G10208g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498390.1"
                     /db_xref="GeneID:8206243"
     CDS             complement(815992..817398)
                     /locus_tag="ZYRO0G10208g"
                     /note="highly similar to gnl|GLV|CAGL0A00429g Candida
                     glabrata CAGL0A00429g and similar to YGL012W
                     uniprot|P25340 Saccharomyces cerevisiae YGL012W ERG4 C-
                     24(28) sterol reductase catalyzes the final step in
                     ergosterol biosynthesis mutants are viable but lack
                     ergosterol"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498435.1"
                     /db_xref="GeneID:8206243"
                     /db_xref="GOA:C5E068"
                     /db_xref="InterPro:IPR001171"
                     /db_xref="InterPro:IPR018083"
                     /db_xref="UniProtKB/TrEMBL:C5E068"
                     /translation="MATPEKIPQTEKSTKAANFLPQGKWLKPEEIEYEFGGTPGVLGM
                     MIGFPLLMYYMWISAEFYHGYPAWPAGGESWCQFVKHLYQLFLENGVPTKYAWTIFLT
                     FWAFQIFFYYTLPGVWTKGQPLTHLKNKQLPYYCNAMWTLYTSTVLILTLHASGLFKL
                     YTIIEIFGQIMTCAIISGFAFSIGLYLWTMLISKDYHRMTGNPIYDIFMGAPLNPRWG
                     ILDLKMFFEVRLPWFTLFYITLGACLKQYETYGYVTPQLGVVMLAHWLYANACAKGEE
                     LIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHHPSEYQWSTGYNISLYLTL
                     LTAYYFFDTTNGQKNSFRKQMAGDKRVRKTFPFLPYQVLNNPKYMVTSNGSYLLIDGW
                     YRYARKIHYTVDWVQSLVWALSCGFNSIFPWFFPIFFFVVLVHRATRDQAKCKKKYGK
                     DWDTYCQHCPYTFIPYIF"
     gene            complement(<817779..>818978)
                     /locus_tag="ZYRO0G10230g"
                     /db_xref="GeneID:8206244"
     mRNA            complement(<817779..>818978)
                     /locus_tag="ZYRO0G10230g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498391.1"
                     /db_xref="GeneID:8206244"
     CDS             complement(817779..818978)
                     /locus_tag="ZYRO0G10230g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498436.1"
                     /db_xref="GeneID:8206244"
                     /db_xref="UniProtKB/TrEMBL:C5E069"
                     /translation="MRTLTRNTSGKSADANSELYSRVSSDDQNILNFNSRSQRLKRTI
                     SNGFRRSSSADSKSSKHCHKFRFWLNRKNNCVRSKSQDTDSYSTTSSVSTKVGAEPKL
                     YSRNNLRDYKESVVYKSSPRHHLRTWLNDDDHEGEASSILEIRQSNITTRIVKAKHYI
                     SLAAKQTAQIASVRRTAQLMAFTGAVTAAAVARVRAAQRNPNASHGSIANDTMYSLQE
                     VSNAIDQSGAPESDYNELNDIFKLHFQYKGAPGYFKRLKPLRIEELNPNSAAYKMYYK
                     MKFIPNPPIGADPLEFYLNRATFRQEKRIEEEDNLEPQHSKLTEFSDIQSTKSVQTRV
                     STAKSIFWSFVGMEAESTKEMENSQKDIQTSQNFLQEIHAEPSEHENELNSSSKSLFW
                     SFISGKS"
     gene            <819658..>822768
                     /locus_tag="ZYRO0G10252g"
                     /db_xref="GeneID:8206245"
     mRNA            <819658..>822768
                     /locus_tag="ZYRO0G10252g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498392.1"
                     /db_xref="GeneID:8206245"
     CDS             819658..822768
                     /locus_tag="ZYRO0G10252g"
                     /note="similar to uniprot|P12383 Saccharomyces cerevisiae
                     YGL013C PDR1 Zinc cluster protein that is a master
                     regulator involved in recruiting other zinc cluster
                     proteins to pleiotropic drug response elements (PDREs) to
                     fine tune the regulation of multidrug resistance genes"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498437.1"
                     /db_xref="GeneID:8206245"
                     /db_xref="GOA:C5E070"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E070"
                     /translation="MESGRVRRPRNKVNRACYNCRRRKIKCTGKYPCSSCEAYQCECL
                     YFPGYVPTKSNTSTNGNTNVNAKADDNSWKLPIENPQPNKLQSNESSSSTGRSSSTAD
                     GSGKTPTSSFNSNQTDEDELIQDWEAGELASMPPIELNGGSVGFYKDDIEFQKKLSNL
                     QQCLKQLKSIPNPNEQIKEIINSINVQVDTLVSDWEPEYDVKEYNKVLKNDGESMKSI
                     ETHLMKNKYADQVALTSFAVWTDTSKSEKNGIPASSFLANQPLVDDMFGLYSPVQALS
                     LRGIGHLFQRCVKLATSTEKTVQMKSNLYLLLRFFDICIDHFNQSCVSIANPLESYLQ
                     RKSLLLSSPNTTSSVSSRNSANSKDLIGVLINRLPQPFTQNVTSIDNKKLLDSMHDDF
                     DMFSLLLKMFDDHKKGFESLMIKITANPGHLTMFAPKMSTADIQDFIWYCEQEELLVA
                     LSYSYYNSTLYHFDEFSRSLEYFDLLLSLIDKQVWLHEKYGFEKVLDVATSYATGLGL
                     SRWEFYVGLDELTAERRRESWWKYYCIEKQHNFFTGILSSINDSKMNCLLPRVFRDAG
                     FSDHRHFVSNVHLTVNNPVFHSMALNDLAFYGECAVCQVISEFYGGTLYEERYTSIKN
                     TAKPPFVKYCLLEEVLRDTDMLKTKLQAIKIQTKRLYDIAYSKNEYEGDSVCRQDKVL
                     AVKHVLLQGCLLFYVSSAVNNLISRLRVHSDQSNVRSRENEYREILREEYINMTKLML
                     SLEDDYSVSRAFGHYSHVFLMVVSGSFSGCRFEPTIDEVVMVLRLFRRLRDISIYREN
                     KDQDTIRNSKAYSDFLQLCTFVSILTNSLLQSYMFLNDLTKEQLFTVLADAAPELQGL
                     VPLILNPKSEIYRHLMEPVQESGVHTNVKKMLEKGQKFPNKKRVYPKTAVQSLSPSNK
                     NSPEVQSFPFAQADIPVCQKARDGLSPGRNMATPVDALLNSDVPGGTIINERPNGSPD
                     YGFQPMFGAGDGSNKFNLGTVDEFVHKGDLNDLYTTLWSDLYSDESGQSILALNNFAP
                     DLGDQN"
     gene            complement(<823030..>825732)
                     /locus_tag="ZYRO0G10274g"
                     /db_xref="GeneID:8206246"
     mRNA            complement(<823030..>825732)
                     /locus_tag="ZYRO0G10274g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498393.1"
                     /db_xref="GeneID:8206246"
     CDS             complement(823030..825732)
                     /locus_tag="ZYRO0G10274g"
                     /note="similar to uniprot|P25339 Saccharomyces cerevisiae
                     YGL014W PUF4 member of the PUF protein family YGL014W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498438.1"
                     /db_xref="GeneID:8206246"
                     /db_xref="GOA:C5E071"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5E071"
                     /translation="MSVDSGSKENKHFSDVNPIVSESLDTALGQLHLEELDQNLKANP
                     TANSNQSQSTPKNGPQVTNQNSTDATAGNGGGAVSGSGPNGENSGADPNMVPPSHMFP
                     PHPQMIGMGFIPFSQMMPIPHHTGFFPPSDFKDGPQAPPPHPPPMGVATPPAPAVAAA
                     AVAAASPGATPMAATPPTATPVHPATGPILFNNTNDASVFAAPAALTPGFTTGAHVNA
                     PAPIDPLWSGPPMGTGSAAADPVSSSTVEDSSALEDGLPQKAGSVAGLSFRRQTFHAL
                     SPNDMVGGTGNDTGLSAADSVMDSGAQKTANVAAPAAARRQSVHMDKMFGSKADDNVA
                     IVEDTSNESEGDQGSKTFAAAYPYGGPLLQPNPILSGHHPPGSAHAFGIPSPFPAGYG
                     FTSPFQSFSPVLGAANTPMQAHSSIAMAHSPLQGAPMPADPTVNPLMAASTADPGSKS
                     MEQFTVPRDSASMQPPQTLPMGLHQQGGTPPPWMYGGHPFGMVPHPHSVPQKPPHVVG
                     LNPGMATNNNANHQGRRHANNRGGRSAHMGNGKNRHNRNYYYGNSNYHENHQRKLEEN
                     SRYANATLDQFIGNIYSLCKDQHGCRFLQMQLDVLGPEAADAIYDETRDYTVELMTDS
                     FGNYLIQKLLEKVTVDQRIFLARIAAPHFVRIASNPHGTRALQKLVECVSTEEEAQIV
                     INSLKGSIVELSKDLNGNHIVQKCLQKLQPKDVQFIFDAACQHCTEIATHRHGCCVLQ
                     RCLDHGSKAQCQALCNILLKHVDHLTLDPFGNYVVQYIITKEVEQDSYDYTYKVVHLL
                     KPKVVELSLHKFGSNVIEKIIRTRVVSETMIMEILNNRGDTDVPALLNDGYGNYVLQT
                     ALDVSHENNEYLYKRLSDIVRPMMIGSIKNTPHGRRIMGILQME"
     gene            complement(<826937..>829696)
                     /locus_tag="ZYRO0G10296g"
                     /db_xref="GeneID:8206247"
     mRNA            complement(<826937..>829696)
                     /locus_tag="ZYRO0G10296g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498394.1"
                     /db_xref="GeneID:8206247"
     CDS             complement(826937..829696)
                     /locus_tag="ZYRO0G10296g"
                     /note="uniprot|P24545 Zygosaccharomyces rouxii Plasma
                     membrane ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498439.1"
                     /db_xref="GeneID:8206247"
                     /db_xref="GOA:C5E072"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006534"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5E072"
                     /translation="MSDERITEKPPHQQPDSEGEPVPEEEVEEETEEEVPDEESEDDD
                     IDGLIDELQSQEAHEEEEEEDGPAAAGEARKIPEELLQTDPSFGLTSDEVVNRRKKYG
                     LNQMREESENLVVKFLMFFIGPIQFVMEAAAVLAAGLEDWVDFGVICGLLFLNAGVGF
                     IQEFQAGSIVEELKKTLANTATVIRDGSVQEAPANEIVPGDILKLEDGTVIPADGRLV
                     TEECFLQVDQSSITGESLAVDKHYGDEVFSSSTVKRGEGFMIVTATGDNTFVGRAASL
                     VNAAAGGQGHFTEVLNGIGVILLVLVVITLLLIWTACFYRTVRIVPILRYTLGITIVG
                     VPVGLPAVVTTTMAVGAAYLAKKQAIVQKLSAIESLAGVEILCSDKTGTLTKNKLSLH
                     EPYTVEGVSSDDLMLTACLAASRKKKGLDAIDKAFLKSLAQYPKAKGALTKYKVLEFH
                     PFDPVSKKVTAVVESPEGERIICVKGAPLFVLKTVEEDHPIPEDVHENYENKVAELAS
                     RGFRALGVARKRGEGHWEILGVMPCMDPPRDDTAATVNEAKRLGLSVKMLTGDAVGIA
                     KETCRQLGLGTNIYDAERLGLGGGGSMPGSEMYDFVENADGFAEVFPQHKFAVVDILQ
                     QRGYLVAMTGDGVNDAPSLKKADTGIAVEGATDAARSAADIVFLAPGLSAIIDALKTS
                     RQIFHRMYAYVVYRIALSLHLEIFLGLWIAILNHSLDIDLIVFIAIFADVATLAIAYD
                     NAPFSPSPVKWNLPRLWGMSIMMGIILAAGTWITLTTMFLPKGGIIQNFGSIDGILFL
                     EISLTENWLIFITRAVGPFWSSIPSWQLAGAVFVVDVVATMFTLFGWWSQNWTDIVTV
                     VRIYIWSIGIFCCLGGAYYLMSESETFDRLMNGKPLKENKSTRSVEDFLASMRRVSTQ
                     HEKGN"
     gene            <831554..>832684
                     /locus_tag="ZYRO0G10318g"
                     /db_xref="GeneID:8206248"
     mRNA            <831554..>832684
                     /locus_tag="ZYRO0G10318g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498395.1"
                     /db_xref="GeneID:8206248"
     CDS             831554..832684
                     /locus_tag="ZYRO0G10318g"
                     /note="similar to uniprot|Q04894 Saccharomyces cerevisiae
                     YMR318C ADH6 NADPH-dependent cinnamyl alcohol
                     dehydrogenase family member with broad substrate
                     specificity may be involved in fusel alcohol synthesis or
                     in aldehyde tolerance"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498440.1"
                     /db_xref="GeneID:8206248"
                     /db_xref="GOA:C5E073"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="UniProtKB/TrEMBL:C5E073"
                     /translation="MTVDYPKEFQGFAINDPKDWDHPKLTKFEPKKFDAHDVDIEVEC
                     CGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVSLCKVGDRI
                     GLGAQASSCMSCPRCHGNNEQYCAKSVTTYCSKYEDGYVSQGGYASHVRAHEQFCFPV
                     PEEIESEYVAPLMCGGLTVYSPIKRSIQGSKEPRVGVIGIGGLGHMAIMISKALGAHV
                     VAFSRSNRKRADAEKMGADAFVATGEEKDWSERYMDQFDLILNCASSTSELDLDSFLR
                     VLRVNKNFVSVGLPEKDDRFNLSPLTFMGNGATVGVSKLGSRQEAVELLDLAAKHGFR
                     PWVETIKLSEAGVHEGLTRLDAGDVRYRFALVGFNEFFGTGK"
     gene            complement(<832829..>833596)
                     /locus_tag="ZYRO0G10340g"
                     /db_xref="GeneID:8206249"
     mRNA            complement(<832829..>833596)
                     /locus_tag="ZYRO0G10340g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498396.1"
                     /db_xref="GeneID:8206249"
     CDS             complement(832829..833596)
                     /locus_tag="ZYRO0G10340g"
                     /note="similar to uniprot|P39707 Saccharomyces cerevisiae
                     YAR008W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498441.1"
                     /db_xref="GeneID:8206249"
                     /db_xref="GOA:C5E074"
                     /db_xref="InterPro:IPR006676"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR011856"
                     /db_xref="UniProtKB/TrEMBL:C5E074"
                     /translation="MRIVLIGETPLVFNLDDIRQLRQHGIVGVLSGTLPSLSQQNVFL
                     SVPLRLMMEELLWLLWDSPLDVNVVGGGLPHFSKDVKSGQIHGQQSALRVQESFEQQR
                     LQRWENHVRKLRLIGVEPQPGDSNLLEGSLFMQTHDSRKDDVKSEHTSSELNPTADQI
                     RHYKLYRKLRQMGFTVHPGGRFGGKYVVYPGDPLRFHSHVVISEPLEDDEPLDFLQMV
                     AGARLATTVKKSYVASCVEAKGEEEARFYSFEWAGFG"
     gene            <834438..>837830
                     /locus_tag="ZYRO0G10362g"
                     /db_xref="GeneID:8206250"
     mRNA            <834438..>837830
                     /locus_tag="ZYRO0G10362g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498397.1"
                     /db_xref="GeneID:8206250"
     CDS             834438..837830
                     /locus_tag="ZYRO0G10362g"
                     /note="similar to uniprot|P38929 Saccharomyces cerevisiae
                     YGL006W PMC1 May be involved in depleting cytosol of Ca2
                     ions putative vacuolar Ca2 ATPase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498442.1"
                     /db_xref="GeneID:8206250"
                     /db_xref="GOA:C5E075"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006408"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023298"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5E075"
                     /translation="MGFSVTAGQLAGMYEPKSLAKFGQLFDEEPAKLYEKLQTDKEQG
                     ISDASTESERYKCFNDNRVPERPPKTFLALAWEAFNDKTMLLLTAAAIVSLILGLYEA
                     LTQPPEYDPDGNKIPRVDWIEGVAIMLAVVVVVLVGASNDYQKEKQFLELNRKKEDRQ
                     VVVYRNGEEQLVGVHDLLVGDLMHLQTGEVVPADCILVDGNCEVDESTVTGETDAIKV
                     APLEQVWKRYVKAIHGNGNGNGDSSSNNIDPEAADCMLISGSKLISGLGKAVVTAVGV
                     NSVHGKTMMSLKTETESTPLQERLSELSDSISVFGCASAIILFLVLFIQFLFDIREGG
                     RLADLPAAKRGSQFMSILITSITVIVVAVPEGLPLAVTLSLAFATTRMTKDGNLVRVL
                     SACETMGSATAVCSDKTGTLTENRMTVVKGYMGSAEFDENNENNESTIKSLLEGEISD
                     DIKKDVMTNIVLNSTAFENKRFQEQQQHRQQREDQRLRGHTSDNPFSSILTRGRSRLQ
                     KLLHGGDDDDLSASQANSVEEPYIGSKTETALLTMANKNFGLDNLKEWRKNHKGHFNI
                     AKIVQVIPFESSRKWGGIVVKYEGEKNYRFFVKGAAEILFSRSLYYRNSDGSVAKLDG
                     QSRQTIDEHIQGLASNALRAISIAHKDLNYEGSWPPENITSDEPGEALPEKLFGEVVN
                     EKSQDGLVLDALVGIQDPLRPGVKNSIEQCQKAGVTIRMVTGDNVTTARAIARNCNIL
                     NEEDWVDSDCAMEGPKFRELSNDERVKILPKLRVLARSSPEDKKILVATLKQMGDVVA
                     STGDGTNDAPALKMADVGFSMGIAGTEVAREASDIILMTDDFSAIVNAIKWGRCVSGS
                     IKKFIQFQLTVNVTAVVLTFISSVTTGKSVLTAVQLLWVNLIMDTLAALALATDRPDK
                     NIMDRKPIGRQAPLISVSSWKMIMCQSFWQLVITLTLTYRSGQIFFGREATGHEKQIL
                     NACTFNTFVWLQFFTLFVSRKLDEADGIKDWRKRISRENLDFFQDLGRNGYFLGVMAV
                     IGLFQVFIMKFGGVAFSIAEQTPSMWACAILTSLLAIPVGALVRICPDEVALAIYPKR
                     FIGLVWYICTLGFFKKNAQKGLHDDEESLLGEAQEESSISTR"
     gene            complement(<838456..>839289)
                     /locus_tag="ZYRO0G10384g"
                     /db_xref="GeneID:8206251"
     mRNA            complement(<838456..>839289)
                     /locus_tag="ZYRO0G10384g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498398.1"
                     /db_xref="GeneID:8206251"
     CDS             complement(838456..839289)
                     /locus_tag="ZYRO0G10384g"
                     /note="similar to uniprot|P53195 Saccharomyces cerevisiae
                     YGL005C COG7 Component of the conserved oligomeric Golgi
                     complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498443.1"
                     /db_xref="GeneID:8206251"
                     /db_xref="UniProtKB/TrEMBL:C5E076"
                     /translation="MSDASVSGEDEILEMFFDEGFVPHAFVDILLSNAANKDISQVQA
                     TSSSLLSRFDFYTKNLTKELEMTIQKLEKLSETLPGTWTVKMDAADNDSTSVSAVGSS
                     KLEYYLDTLSSAVRVLEGDMAKINGQLDELDNNYESSSDIVNQLRNLEKIKTRLHKVL
                     NLFNQIKTILTISTATNDKSKTNVKNENGSSITVGEFRDSLQTLEETISQSFTEATNK
                     ETVMEKDEDLLKRIDLFTELKPLFQGLHKFNPVYSQFVDGIRKRTNEYLSAKDIGGEL
                     N"
     gene            complement(<839502..>840677)
                     /locus_tag="ZYRO0G10406g"
                     /db_xref="GeneID:8206252"
     mRNA            complement(<839502..>840677)
                     /locus_tag="ZYRO0G10406g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498399.1"
                     /db_xref="GeneID:8206252"
     CDS             complement(839502..840677)
                     /locus_tag="ZYRO0G10406g"
                     /note="similar to uniprot|P53196 Saccharomyces cerevisiae
                     YGL004C RPN14 Putative non-ATPase subunit of the 19S
                     regulatory particle of the 26S proteasome localized to the
                     cytoplasm"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498444.1"
                     /db_xref="GeneID:8206252"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E077"
                     /translation="MVKTVPVCHIQPDFADLIDAEDDGDFYINVDESLEHVKEYRLNT
                     GEHNNFVQIGSKLYSVELDGRKYKFRVKEGNYANVVQDRWTCIDAVDQPTTQFALGDS
                     DGNIRVFDSSPSLQHHIREAHLDEITCLKFFPSGQVLLSGSTDMRLKIWSLADESNPR
                     TFEGHKSQITDACMVERGRNFVSSSQDGTVKLWETGSGLAVHTFFRRENPLDGINTLA
                     LNKSSDVVSPRGSNALEFGTEGKTVLAGHNSGVITVYDLFNKNQVTQLPSFFMSSCNT
                     LTRIPNEQNYLYAGYSNGALAQWDLRKPDKPVDHVLINEGISINHIYYHSNALYVSSG
                     VDTAIKLDVQLPEGNIIAEAPTFLVANDCQVAQFVATPNNKSIIAVGNWGLCVRFQC"
     gene            <840882..>842729
                     /locus_tag="ZYRO0G10428g"
                     /db_xref="GeneID:8206253"
     mRNA            <840882..>842729
                     /locus_tag="ZYRO0G10428g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498400.1"
                     /db_xref="GeneID:8206253"
     CDS             840882..842729
                     /locus_tag="ZYRO0G10428g"
                     /note="highly similar to uniprot|P22336 Saccharomyces
                     cerevisiae YAR007C RFA1 Subunit of heterotrimeric
                     Replication Factor A (RF-A) which is a highly conserved
                     single-stranded DNA binding protein involved in DNA
                     replication repair and recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498445.1"
                     /db_xref="GeneID:8206253"
                     /db_xref="GOA:C5E078"
                     /db_xref="InterPro:IPR004365"
                     /db_xref="InterPro:IPR004591"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013955"
                     /db_xref="UniProtKB/TrEMBL:C5E078"
                     /translation="MSDVQLSRGDFHLIFTSQKRYDNPVDGVYQVYNIRKSEAGNSNR
                     KNLIMISDGVYHMKALMRNKAAAKLDSLELQRGDVICVTVAEPAIVKEKGKYVLLVDD
                     FDLVQSGLALFNSSSEFLDHYFAANPNETLRDDTGNRSGATSTASGEPNNTPKPQQAK
                     PNTGSNFPMGSGSQKSRPIFAIEQLSPYQNIWTIKARVSYKGDIKTWHNQRGDGKLLN
                     LNFLDTSGEIRGTAFNDNATKFNEILQEGKVYFLSKARLQPAKPQFSNLPHPYELMLD
                     RDTVVEECLDASDVPKTHFSFIKLNTIQNQEANSTVDVLGIIQTVNPHFELISRAGKR
                     FDRRDITIVDDSEYSIAVGLWNQQAVDFNLPEGSVVAIKSVRVTDFGGKSLSMGFTST
                     MIPNPEIPEAYSLKGWFDNTGRNLQYHSLKEEVNETNSTTNLVKYISERTTIATAQAQ
                     NLGRNEKGDFFSIKAAVSFLKVDNFAYPACLNENCNKKVIEQPDQTWRCEKCDTNHPS
                     PDWRYLLTISVLDETGQLWLTLFNDQAKQLLKVEASELVLLKESDPTAFSKITQSLQM
                     NQYSFRIRAREDNYNNQSRIRYTVSNLHNINYKAEADFLAEQLTQSLLE"
     gene            <842921..>844840
                     /locus_tag="ZYRO0G10450g"
                     /db_xref="GeneID:8206254"
     mRNA            <842921..>844840
                     /locus_tag="ZYRO0G10450g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498401.1"
                     /db_xref="GeneID:8206254"
     CDS             842921..844840
                     /locus_tag="ZYRO0G10450g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498446.1"
                     /db_xref="GeneID:8206254"
                     /db_xref="GOA:C5E079"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5E079"
                     /translation="MQRQKIRRHRAIKSCRYCYVHKLKCNKALPCYTCSTMNTTSECI
                     YGFNKNDNNSEEIKADNKSNEKSSRPLTTRGIDKTPKGTLVYRSKYFYPFFANSINDR
                     VLSSHAYGLLSPSQKFKRNEITKFNRFTNPLDSIEDALALLPPSRETALSQVETYFDS
                     VHPIIPILSKSKIMNALQTIKNTDNDQENINVPNLLLIMALFFCSSYAAVASGVIPDL
                     LLCNKYYAGYRLLLEISEFPLRPQLESLKAFTIVNFVIDPNMVDATAYSSMLVRMGQQ
                     LGLHKMEDIQSKLLWGYLLYIEGSASVVSGFPYFTPGNLATETISPTPESKDQNGLSA
                     AYTIGRWKVNAVFRNVMDLSGRQTISESDFLSTKKQIEKLYDEILEINDILRIEFPTY
                     FTYLTSTLLVFLYRLHLRHTALSYWQSRKDKLLQKTDNQVNSAQPIDITSSLTTRHIY
                     GDDVVHLSLLLLFHTYERLVQENTAKFVWYTRGSTVMQYLFVVIKDLYQNELKPCELN
                     SFSEPLKKTVNTDIEEILKRDDVFFKFVLIDHVIGLLELKLAALWNDEDLYKFILVKA
                     IKEKVWQVFRTQLGHNKNRIEEVSKCKLFVSGEKHLQNLKSINFEDYIDNWESDIVLL
                     EMNKILVNWIDDLQG"
     gene            complement(<844939..>846621)
                     /locus_tag="ZYRO0G10472g"
                     /db_xref="GeneID:8206255"
     mRNA            complement(<844939..>846621)
                     /locus_tag="ZYRO0G10472g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498402.1"
                     /db_xref="GeneID:8206255"
     CDS             complement(844939..846621)
                     /locus_tag="ZYRO0G10472g"
                     /note="similar to uniprot|P53197 Saccharomyces cerevisiae
                     YGL003C CDH1 CDC20 homolog 1 protein required for Clb2 and
                     Ase1 degradation"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498447.1"
                     /db_xref="GeneID:8206255"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E080"
                     /translation="MAGYSGNPFINNTPSSSPLKNADNNRVTKRPLGSSSSSSLMSSP
                     TRRSRITGSAAYGDRFIPSRTEIDLNTMASIGSVASLPPAPPSISEDQVELQREMQAH
                     ETFDAVLKNELFGEKLSRDAVGNESSIDRIKNTRPSRVNLNEPIEEEAPTTPPDSVDV
                     DSQVQSAPVTPHRGLHSHSEELFRPSSNAIRGASLLTYRERTGTRPSTASMMQSQFFD
                     TSSSVRPDSKQLLLSPGKQFRQIAKIPYRVLDAPSLADDFYYDLIDWSSTDMLAVALG
                     KSIFLADNATGDVLHLCDTENEYTSLSWVGAGSHLAVGQGNGLVEIYDVVKKKCIRTL
                     SGHMDRVACLSWNNYVLTSGSRDRRILHRDVRIPDSYFERIEAHTQEVCGLKWNVDDN
                     KLASGGNDNMLFVYDSTARNPVLTFNEHTAAVKAMAWSPHKRGVLGSGGGTADRRLKV
                     WNVNTSQKISDVDTGSQVCNMVWSKNTDEILTSHGYSRYNLTLWDFPTMDPVAILKGH
                     SFRVLHLTLSADGTTVVSGAGDETLRYWKIFDKPKVKAKPDSVIFSAFNQIR"
     gene            complement(<846835..>848133)
                     /locus_tag="ZYRO0G10494g"
                     /db_xref="GeneID:8206256"
     mRNA            complement(<846835..>848133)
                     /locus_tag="ZYRO0G10494g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498403.1"
                     /db_xref="GeneID:8206256"
     CDS             complement(846835..848133)
                     /locus_tag="ZYRO0G10494g"
                     /note="similar to uniprot|P39706 Saccharomyces cerevisiae
                     YAR003W SWD1 Subunit of the COMPASS complex which
                     methylates histone H3 on lysine 4 and is required in
                     transcriptional silencing near telomeres"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498448.1"
                     /db_xref="GeneID:8206256"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5E081"
                     /translation="MTNLLLQDPFSVLKEYPDKLTHSLENPLHTECVRFSPRGDYLAL
                     GCSNGGVIIYDMDTFRPICVLGNKMGAHMRSVQSISWSSDGKYLLTGSRDWSVKLWDL
                     ASAGQPLKQVRFDSPIWNCQWVNADQFTCVVTVLEESSAFLIYFAHDQPLVRTLHGNE
                     NNDDHGYVLTSTVHTKFSDIIFTGTSKGWINVYQLCKGESESNVAQMLKGLKVANANI
                     KHVIVSQQGDKIAVNCSDRSIRQYAFTLTADRSSVELELEHKYQDVINKLQWNSIFFS
                     NKAAEYLVASTHGSSAHELYLWETSSGTLVRVLEGSEEELMDIDWNFYKMFIASNGLE
                     SGDVYIWSIVIAPKWSALAPDFEEVEENVDYREKEDEFDQIDELEQQEELNQAEEVDI
                     DLRTREQFDVRGNDLLVAQFTIPTDYERILTLKAAKLAQD"
     gene            <848326..>848982
                     /locus_tag="ZYRO0G10516g"
                     /db_xref="GeneID:8206257"
     mRNA            <848326..>848982
                     /locus_tag="ZYRO0G10516g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498404.1"
                     /db_xref="GeneID:8206257"
     CDS             848326..848982
                     /locus_tag="ZYRO0G10516g"
                     /note="similar to uniprot|Q05359 Saccharomyces cerevisiae
                     YAR002C-A ERP1 Protein that forms a heterotrimeric complex
                     with Erp2p Emp24p and Erv25p member along with Emp24p and
                     Erv25p of the p24 family involved in ER to Golgi transport
                     and localized to COPII-coated vesicles"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498449.1"
                     /db_xref="GeneID:8206257"
                     /db_xref="GOA:C5E082"
                     /db_xref="InterPro:IPR009038"
                     /db_xref="InterPro:IPR015720"
                     /db_xref="UniProtKB/TrEMBL:C5E082"
                     /translation="MLLVSALLQLAIVALLFPSQVAAFSLYSNGERRCFYKELSKGTL
                     LQGKYSVKAYDDGIQSYRDTNPQEFDVSMEVEEVFDDYHRVVHQKGVSGELNLLALDS
                     GEHRICIQAQPNSWMGKSKTKINLDFEIGSDVKLDSKQKTVVDSLHQKVNILNDKVLS
                     IRREQKLVRDREAQFRDISESVNSHAMWWSVIQLVVLVLTCIWQMRHLRTFFVKQKVL
                     "
     gene            complement(<849067..>850605)
                     /locus_tag="ZYRO0G10538g"
                     /db_xref="GeneID:8206258"
     mRNA            complement(<849067..>850605)
                     /locus_tag="ZYRO0G10538g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498405.1"
                     /db_xref="GeneID:8206258"
     CDS             complement(849067..850605)
                     /locus_tag="ZYRO0G10538g"
                     /note="weakly similar to uniprot|P39705 Saccharomyces
                     cerevisiae YAR002W NUP60 Subunit of the nuclear pore
                     complex (NPC) functions to anchor Nup2p to the NPC in a
                     dynamic process that is controlled by the nucleoplasmic
                     concentration of Gsp1p-GTP potential Cdc28p substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498450.1"
                     /db_xref="GeneID:8206258"
                     /db_xref="UniProtKB/TrEMBL:C5E083"
                     /translation="MVDQSKSYRSRGAIAPYRRPMSSNNRSKPSILNKLKSFFTNDGN
                     DGKEENSGLKRRHLASGGSPTVSIPGGFFNSDDASPSIVLPKCPGEAQISNSTPNVDA
                     INEGERDEEASADEEPYNADISNAKLADFFSRKGGEPLSEMEMEGVKSLMKKSSKSVR
                     SSRAGSIVNTTLSHDDPTDLVYSRILKHSRTPSLATSTMRAPAFTPRYDDSFGSHSFA
                     NTSRGSVSSRRRVFDYSSLPSPYKTTVYKYSAADNDSSDAHGTKTPDASKSMVVKPSN
                     GKKLSNTASALVSLLENDNSKEETSNRLANPYSSHVNQLRKYKKSLPTLPATKQEPSK
                     FAPIKSSALQELENAKTKVTNEVAPKSQQHNSVDKYKPMRSSSLRSNVVKADESPERK
                     ITTKETEPEVPKAPTFNFQFQTNDKIEPNTKSQPHAHPAAKPEFAFKFQPQKFGPPDN
                     NSDSDVVDKIPTKVANAYSTAPSIIATESDPEYDFGQISPSNIDPSAVDNKKVQDFKT
                     LFVF"
     gene            complement(850769..850840)
                     /locus_tag="ZYRO0G10560r"
                     /db_xref="GeneID:8206259"
     tRNA            complement(850769..850840)
                     /locus_tag="ZYRO0G10560r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove score=66.07"
                     /db_xref="GeneID:8206259"
     gene            complement(<850978..>852027)
                     /locus_tag="ZYRO0G10582g"
                     /db_xref="GeneID:8206260"
     mRNA            complement(<850978..>852027)
                     /locus_tag="ZYRO0G10582g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498406.1"
                     /db_xref="GeneID:8206260"
     CDS             complement(850978..852027)
                     /locus_tag="ZYRO0G10582g"
                     /note="uniprot|Q96WU2 Zygosaccharomyces rouxii gl001
                     Putative C- 3 sterol dehydrogenase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498451.1"
                     /db_xref="GeneID:8206260"
                     /db_xref="GOA:C5E084"
                     /db_xref="InterPro:IPR002225"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5E084"
                     /translation="MSDECPILLVGGAGFLGLHLIQQFYDLTVRPRIHVFDVRPIPEK
                     LSRQFTFDPTEIVFHQGDLTSAEDVTNALLKSKARVIVHSASPMHGNAQSIYEHVNVK
                     GTRNLLDVSKKLGVKAFIYTSSAGVIFNGQDVHNADETWPIPEVAMDGYNETKAIAED
                     MVLKANSFQENFLTVALRPAGIFGPGDRQLVPGLRNVAKLGQSKFQLGDNNNLFDWTY
                     AGNVADAHVLATQKLLNSETASKVAGETFFITNDEPAYFWALARTVWKADGHVDKSVI
                     VLNRPVAILAGYLSEFFSKLLGKEPGLTPFRAKIVCATRYHNVTKAKELLDYKPRVNI
                     EEGIEKTLAWMDEKL"
     misc_feature    complement(852385..852551)
                     /note="Centromere Zyro0G"
     gene            complement(<852624..>853487)
                     /locus_tag="ZYRO0G10626g"
                     /db_xref="GeneID:8206261"
     mRNA            complement(join(<852624..852838,852926..853404,
                     853465..>853487))
                     /locus_tag="ZYRO0G10626g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498407.1"
                     /db_xref="GeneID:8206261"
     CDS             complement(join(852624..852838,852926..853404,
                     853465..853487))
                     /locus_tag="ZYRO0G10626g"
                     /note="uniprot|Q96WU1 Zygosaccharomyces rouxii orf
                     Hypothetical protein, highly similar to YGR001C
                     uniprot|P53200 Saccharomyces cerevisiae YGR001C Protein
                     with similarity to methyltransferase family members;
                     required for replication of Brome mosaic virus in S.
                     cerevisiae, which is a model system for studying
                     replication of positive-strand RNA viruses in their
                     natural hosts"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498452.1"
                     /db_xref="GeneID:8206261"
                     /db_xref="GOA:C5E085"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR019369"
                     /db_xref="UniProtKB/TrEMBL:C5E085"
                     /translation="MSESDDELTLSSNALAALQEFKQEEQQRQENFEKLLQQADEEFE
                     EKKRIQGMELFKEDWQLSQFWYADDTADVLAEALLEGADPDTVIAVVSAPSVYAAILK
                     RPKEQIPTKNIYLFEYDTRFELLAGRDHYVYYDYVQPLEFTDQLKGKVDRLLIDPPFL
                     HNNCQTNSLLAPKDGSKTMNGYLRHRFMSCTGERMADLISKLYPDSKITTFLPQHANG
                     LSNEFRCYADFEWKKWKFST"
     gene            <853727..>857292
                     /locus_tag="ZYRO0G10648g"
                     /db_xref="GeneID:8206262"
     mRNA            join(<853727..853799,853877..>857292)
                     /locus_tag="ZYRO0G10648g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498408.1"
                     /db_xref="GeneID:8206262"
     CDS             join(853727..853799,853877..857292)
                     /locus_tag="ZYRO0G10648g"
                     /note="similar to uniprot|P34111 Saccharomyces cerevisiae
                     YAL001C TFC3 Largest of six subunits of the RNA polymerase
                     III transcription initiation factor complex (TFIIIC); part
                     of the TauB domain of TFIIIC that binds DNA at the BoxB
                     promoter sites of tRNA and similar genes; cooperates with
                     Tfc6p in DNA binding"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498453.1"
                     /db_xref="GeneID:8206262"
                     /db_xref="InterPro:IPR007309"
                     /db_xref="UniProtKB/TrEMBL:C5E086"
                     /translation="MAQIPVFPDELVHLICEVVAYNKGEITLPELWRSSESFVGLSDD
                     KLKEFVFSSVSSHPDVKLYEGGKVCDKLYSEVAENEDAYTLRIGEDTLWTILTGYRKK
                     EANIGGFAFELLLEIAKAGDKGINTKDLAQATNQDPRSITGRVKKIGHLICSVQMIYK
                     GHVVKLLKLKRYSESDNAVKPYVNLRDYLGQIVDVVKKSKNGVRQIIDLKRELKFDVE
                     KRLSKAFIAAIAWLDEKEYLKKVLLVSPTNPSVKIRCVKYLRDYVQEDKSTNDFDYES
                     EPGDDPLDDDKLGLEEEDAYEGLDSSNATNILQEEGLLVQDEKSTGKDDILMNRFYPI
                     QNQTYDMTEKAGLQGISTMEVIKRLTGRDYKRAFTKSSEYYVESVGKPKNNVDEYRIV
                     RVYDFEGRKKFYRFFTEENFKKLTDAPQTYVSGRFEPIESQKEALAELNESNFIPLSS
                     SLRFVDNDGQESFFWNGEIKSPVSVSARGRKRKQEDVAAVQKAISVNNKRRSVKQKEK
                     PPSMSSTVPATASGDVVNSPSSPSENDGTNKPRVLEIGGFSAGSLRSLWRQRAILEVV
                     RKAGGVTYLREQFFEDVSHFMGSNTLLDKKTVRGDVNLMLQNEKLRMEDEPHTGKRII
                     YLPEVDPNAIASYIIKDKDNKKAYFKDVIHNTDIYFFDQTEKHRFHRGVKSAERVRNY
                     QDRSRTKKDAQKKAWKKAEDALSLQRQYKLSRDLTAVGEKDLSKKSGKPGKGKKKALF
                     QVGNKLGARALVMAVVITKSIKNEILWDEITKLFPSNSLSNLKKQWTARRIRMGHVGW
                     RAYVDKWRKILVSATREERVTLEDVERLDLPKLIDLWITSDVDEDQKPTLLYRDYLEN
                     KKRYTLIRVGTNVGMKSGLAMSSMIQRETSSLKKIFVYDNYDTSSKRLPPWGTEGDVR
                     AVIRSILYDHPDTSREKIEVLSTIPKELVDKVIMDMAKEKHLYLQGSRLEATDTIKEF
                     LETRGNYRMFEQCEIYRNKLEEMFQAGNGVIISEEIPDIASWIFIDLIAQSKVNLDVI
                     PTVDSSQKLSYVTRRLGIRGLTPPLIMSAKKSTKLTKEIHVPLPMGEPNSKLWIDGTG
                     CLRGEVWKCLLSMITNEILFNPGVTLDMLEQNCNFVLSRRELKDICGWLLKKGLVIET
                     PFEGLQAGHEWYTLLK"
     gene            complement(<857355..>861167)
                     /locus_tag="ZYRO0G10670g"
                     /db_xref="GeneID:8206263"
     mRNA            complement(<857355..>861167)
                     /locus_tag="ZYRO0G10670g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498409.1"
                     /db_xref="GeneID:8206263"
     CDS             complement(857355..861167)
                     /locus_tag="ZYRO0G10670g"
                     /note="similar to uniprot|P39702 Saccharomyces cerevisiae
                     YAL002W VPS8 involved in vacuolar protein sorting required
                     for localization and trafficking of the CPY sorting
                     receptor Vps8p is a membrane-associated hydrophilic
                     protein which contains a C-terminal cysteine-rich region
                     that conforms to the H2 variant of the RING finger Zn2
                     binding motif."
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498454.1"
                     /db_xref="GeneID:8206263"
                     /db_xref="GOA:C5E087"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR025941"
                     /db_xref="UniProtKB/TrEMBL:C5E087"
                     /translation="MQNDLFNESPTTSNASSNVSSGDISFLDYRAYTRLSERPVYSGN
                     NSIFNESNDTNQNGNFFDDFNNLSSTVKWKTLNKIYPILGAFGGPTCIYPTKSCHVLG
                     TSKGPILIFSTKQFILNRLVPQIVGEPTSKHLRSPVLDIVVSADGTHLAASYQSGDIF
                     LWNLNANTVELNAEEANDGNEKMAPSRAILQITNHRGRTINGIGFIGSRHTALIVSDN
                     TGGVFYHSGFRTHLWSLTYSSKQVLHISTGEKLLASQAAPEIQKREPLHMIAVLTTSR
                     FAIISTTPRPMTLMLEDLKSIGSREITSNSCLAWHENASKVAFSLNESAFVFEIKGVS
                     TFSTQKTFTKIGEPALSLQWITDDLLGILTVSHNFLMVDVNEDLRVVAKFDFLVHHLL
                     MPPNKHVAVCDKKLLLLTNYGLKVGQLPSWSDITLNHVQTGNYPGALKFIKSLLQEYM
                     PLWPLLRLTQDFSKREQELEKPFYNLALAALRFIITHQNADLNKIYELFSLVLSTVDL
                     FQDRQLKIEPMNAFLEKSMEFFSEDNVDIFFEVLLNMVLEGSMNALPAAIFKPMLINF
                     ADAEKLSILEDMIVMLDLRTLDIDLAVKLCQKYGLFCVLMYICNTIFDEYVLPLVDAV
                     SRINDKPEETFIFRTGEVGSVNTIFDYLSFVLTGRQFPKSDLIMPMKRQIDAKVSLYH
                     MLFSGTCVEWPPGSGKKLHTEADSAHEPAFPYFNLLINFNTARMLSTLNEIFEDSLLN
                     EGYAENGLGENPPVQITRQYMVDVVLDMMKKKESTRDKVLMGIFVACNVAKYPQFIRL
                     SSRALEDVIATICGVKDLQLTNDCQRALECLLSTYTPKNSERFIAELKELNFKRVLFI
                     LYVKTKKFFDILPLALSSEDTKTDYNQSFPTVISFVLFGARYDSLEHTRVVGLIRGHF
                     ESLVDKLGPKLAVEFFQKFDPGIHQSVVSLSCEDTQQKYLEELYSFGELEGTEMNDLK
                     DLYFELSCKYKSKQALLQWLGVLEFKNLDTERATNILLSAKNYEAAAVVHRRLQVNSM
                     VVNDMLNCINDWFKVGDKQYATLNRYLNIAIDAISDSSDDKLHNWTKLIACFMKLYGS
                     HKNDADVGQSCNRAFQELFVRLAMSEASANGDKKGQFWSILTSALEHQEVIMMKAKDL
                     RTLLFDVFTTYDIERHISRLILEIVQESSVGVGQLYESTLTKGWPIENDECEICGKTL
                     WGLGLDSINFVIWKNKRLLGESAPSTSTNEDKAIVSFGCHHVFHKRCLRNLGQVSGKY
                     SCLTCKKE"
     gene            complement(<862084..>863754)
                     /locus_tag="ZYRO0G10692g"
                     /db_xref="GeneID:8206264"
     mRNA            complement(<862084..>863754)
                     /locus_tag="ZYRO0G10692g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498410.1"
                     /db_xref="GeneID:8206264"
     CDS             complement(862084..863754)
                     /locus_tag="ZYRO0G10692g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498455.1"
                     /db_xref="GeneID:8206264"
                     /db_xref="UniProtKB/TrEMBL:C5E088"
                     /translation="MSSKENFQYPSAKGSKGGYSSFRRLKTFRKNESLFDASGTNFIR
                     YRGNSNHITSQQSDNYTNTFRVKATLAEHDLVESSDQNDIVRAVLKDAAHGKTSPDMG
                     SDSATIVAEDQVTFGIANNLLDSTSDLGTLDSNYPRVNEASSSYDVEKTNRAMVGSPK
                     ISQHGPGAGVSYVPKIYKGVSNNGPIGGKRHKVRFWRNNRRRNKHKKFCVNENHFSEE
                     STSRSNQLPIRKHHFRRWLNEKTDESATVNHIEEARHRAKYVASEAALAAIIRCHARA
                     AIRAGAAATAAYAKVTFEELNPGVSHATMIATINKACEDVAKTSLKSKTENADYLKLL
                     HLLNQHLNFKGNELQIPLKSCDDKGELEKKDEAFETSIRQADEHLYNSQTVTSLKIPP
                     KNSSENKKLLQKSDDHTRQTASSLISENSISEKLILQVDAGAELPLTQLVVPNDSARD
                     DNYSKEYLDELSDPLKSMTVEDEDEDFEGSRFVLFSSAESALDFDDDDSRRKDETELS
                     LIDSAYSYVDSEEGIWPQVASMRRQRLLLQMESLAPRSLLLESLTKDC"
     gene            complement(<864592..>865421)
                     /locus_tag="ZYRO0G10714g"
                     /db_xref="GeneID:8206265"
     mRNA            complement(join(<864592..865123,865342..>865421))
                     /locus_tag="ZYRO0G10714g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498411.1"
                     /db_xref="GeneID:8206265"
     CDS             complement(join(864592..865123,865342..865421))
                     /locus_tag="ZYRO0G10714g"
                     /note="highly similar to uniprot|P32471 Saccharomyces
                     cerevisiae YAL003W EFB1 Translation elongation factor 1
                     beta"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498456.1"
                     /db_xref="GeneID:8206265"
                     /db_xref="GOA:C5E089"
                     /db_xref="InterPro:IPR001326"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR014038"
                     /db_xref="InterPro:IPR014717"
                     /db_xref="InterPro:IPR018940"
                     /db_xref="UniProtKB/TrEMBL:C5E089"
                     /translation="MSFTDFSNIESLQKLNSHLADKSYVEGTSASQADVTAYKAFQKA
                     FPDFTRWFNHVASKADEFDSFPASKAAPAAEDDDVDLFGSDEEEDAEAEKIKAQRVAE
                     YEEKKSKKPSKGASKSIVTLDVKPWDDETNMEELIANVLAIKKDGLTWGAHKLVPQGY
                     GISKLQINMVVEDDKVSMDDLQETVEGDEDHVQSTDVAAMQKL"
     gene            complement(865184..865294)
                     /gene="SNR18"
                     /locus_tag="ZYRO0G10736r"
                     /db_xref="GeneID:8206266"
     ncRNA           complement(865184..865294)
                     /ncRNA_class="snoRNA"
                     /gene="SNR18"
                     /locus_tag="ZYRO0G10736r"
                     /product="U18 RNA"
                     /note="C/D snoRNA intronic SNR18 (U18 RNA)"
                     /transcript_id="XR_002648434.1"
                     /db_xref="GeneID:8206266"
     gene            <866250..>867635
                     /locus_tag="ZYRO0G10758g"
                     /db_xref="GeneID:8206800"
     mRNA            <866250..>867635
                     /locus_tag="ZYRO0G10758g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498412.1"
                     /db_xref="GeneID:8206800"
     CDS             866250..867635
                     /locus_tag="ZYRO0G10758g"
                     /note="no similarity"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498457.1"
                     /db_xref="GeneID:8206800"
                     /db_xref="UniProtKB/TrEMBL:C5E090"
                     /translation="MITNIHSQSDEQMDNIFVLNNFDQLNTVLLEEADILTVEKIWEI
                     ITTSGSLASDKSNGNSRVISQKNATHNSKNSTTGFTPGYVSDFELNAFGEFWQGASGE
                     KSDTLGFSSRCFLELAPVVGGPVMVDLREFMEQVKPDAIEEQKRPLQDINIAGNPIFE
                     NSSQIEFSNVPETSKNSRVSEDATELITNATQFLGDNKVSEFQSTNLRGSRHILNTKK
                     LACKQKSRSTVTNLNDGYRKLKGKLKREISTCNKLELEKQDQLLQLQGLKDEYSRLQD
                     KLTGVLAMNNELEKRNQMTDFYKLNFTNQYRKFDSKFDEFEKSTLLLQKERSARRALL
                     REMKACSINMKSLKKRKIKPAGNKELNNLKGWESKYMQFAERCSTVERIIQKGEVNLQ
                     KLFYELRNHSKEFHPVKIDETSFFPSTPTDSCMTESSWISKYLVLEKNSLSEDLNTIP
                     PLSSGLCRSVC"
     gene            <867947..>869140
                     /locus_tag="ZYRO0G10780g"
                     /db_xref="GeneID:8206267"
     mRNA            <867947..>869140
                     /locus_tag="ZYRO0G10780g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498413.1"
                     /db_xref="GeneID:8206267"
     CDS             867947..869140
                     /locus_tag="ZYRO0G10780g"
                     /note="similar to uniprot|Q06168 Saccharomyces cerevisiae
                     YLR321C SFH1 Involved in chromatin modeling cell cycle
                     progression homolog of Snf5p member of the chromatin
                     remodeling complex RSC"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498458.1"
                     /db_xref="GeneID:8206267"
                     /db_xref="GOA:C5E091"
                     /db_xref="InterPro:IPR006939"
                     /db_xref="InterPro:IPR017393"
                     /db_xref="UniProtKB/TrEMBL:C5E091"
                     /translation="MSQQQLLPQGYLSNFHNRIRNEQVPLFVTAQPARGHKRAKVVNY
                     AEFDPDIFDEFNNMGMEDDDMGEKKDSTNGGGTPGMGSPGQTGSMGANGDEKDSKING
                     EGNPDANGGNNHANPEEHALNIALPDIQEQDDRLSILRYPKIRETFLQSKIATPYRLD
                     IPPTLSTDQQEPIIIPITLNFEHGGHQINDFFTWNINDRSITPDEFSTIYCRDLDFPN
                     STVLHSQIVSSINEQLQEYETVAAVMVPDLQVIVNLTCSLDNRLYEDNFQWNLNDKSV
                     SPEKFAEIVVQDLGLPRDFMPAIAHAHHEYLLRVKKEWLEGHLNQEHVPNGAAFGYLS
                     GIRLDVDELGVSWCPKVEVLTQEEIQKREIEKERNLRRLKRESDRMHRRGRRRVDDLE
                     TTMRI"
     gene            <869531..>869980
                     /locus_tag="ZYRO0G10802g"
                     /db_xref="GeneID:8206268"
     mRNA            <869531..>869980
                     /locus_tag="ZYRO0G10802g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498414.1"
                     /db_xref="GeneID:8206268"
     CDS             869531..869980
                     /locus_tag="ZYRO0G10802g"
                     /note="weakly similar to uniprot|Q06162 Saccharomyces
                     cerevisiae YLR315W NKP2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498459.1"
                     /db_xref="GeneID:8206268"
                     /db_xref="UniProtKB/TrEMBL:C5E092"
                     /translation="MSSEQLLVRHVRDNLITHKHTLEEFAQLVAQHHRSKHESEPDEA
                     TIKDWYTKYEQQDDAALQLSEQRIENFLNDARQAQLLELEKSQLAESFSLEDVVNKLY
                     HVDQLLDKRLAYMNESMKDNVTELQKFNELLELANSTKTDDDEDISS"
     gene            complement(<870040..>871035)
                     /locus_tag="ZYRO0G10824g"
                     /db_xref="GeneID:8206269"
     mRNA            complement(<870040..>871035)
                     /locus_tag="ZYRO0G10824g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498415.1"
                     /db_xref="GeneID:8206269"
     CDS             complement(870040..871035)
                     /locus_tag="ZYRO0G10824g"
                     /note="similar to uniprot|Q9URQ3 Saccharomyces cerevisiae
                     YLR316C TAD3 tRNA-specific adenosine-34 deaminase subunit
                     Tad3p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498460.1"
                     /db_xref="GeneID:8206269"
                     /db_xref="GOA:C5E093"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C5E093"
                     /translation="MVKKNLNPLKIDYRRCIVEDRLLQIRNEKIIDVADPVRVWTIDI
                     DAKDSKQIVDFIRRTTQPNDPVPLMHVKRIKKKNAEKKILCVLICSVEMAREKSEVAS
                     LLEQAVPNLKFSNLENTQCVPRQAAPTKELVVEWSNEYWPLTWYGNPNDQILNDYVFD
                     MDFIKSLLALISSRSKEELQNGNKFPIVTAFVNPRDTKNPIISVDSRDHHDHTLLDHS
                     IMSGIKSVAEREAERRYQVEKGDREDTGSVYLCFDFDVYTTHEPCSMCSMALIHSRVK
                     RCIFLQPMIKTGCLKTESGNGYCMHNNRKLNSKYEVFQWIGNEYPIPTIDENICC"
     gene            <871341..>873908
                     /locus_tag="ZYRO0G10846g"
                     /db_xref="GeneID:8206270"
     mRNA            <871341..>873908
                     /locus_tag="ZYRO0G10846g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498416.1"
                     /db_xref="GeneID:8206270"
     CDS             871341..873908
                     /locus_tag="ZYRO0G10846g"
                     /note="similar to uniprot|Q06163 Saccharomyces cerevisiae
                     YLR318W EST2 Reverse transcriptase subunit of the
                     telomerase holoenzyme essential for telomerase core
                     catalytic activity involved in other aspects of telomerase
                     assembly and function"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498461.1"
                     /db_xref="GeneID:8206270"
                     /db_xref="GOA:C5E094"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="InterPro:IPR003545"
                     /db_xref="InterPro:IPR021891"
                     /db_xref="UniProtKB/TrEMBL:C5E094"
                     /translation="MKSLQEFIKNDLNIYPSDSEYERLVSFSQLNGLHELLNACFVVA
                     NSHNIDLPEIVPGSDHKRVIDYCIVHLLEKNLFDNILTFGYAVGRTEHVNNSLHCLYT
                     NSNVSRIKNSQWHQLHKLIGTHNFVNLLINYTVLQFTGGFFTQVIGNRANRPHTSPPW
                     YYQQNQNQKHLHNSTPITLRTSLQRKSSIFKGPNMIPTKDDIDELIDSIFEPFANEIK
                     CIRKSQIKPLIKRLSLNHTRVKYLGILDNICPISKDDNSYQLDTRTPVKQVNRFIIVL
                     VEKLVPIQMFGSKRNKSKVFHFISILLRLPLGGNIPLAEIMTSLRINDFTWLQMNRSD
                     TVKTEDLVAHFIFWFFQRFVVKIIATFFYTTEVSSNVEILFFRHDVWESISTPFLKAY
                     FEKYLVENKPCRNHKSYLLSRFNHSKLRLVPKKAKGEFRVLAAPQKGSDKEESSAYFL
                     HFKYVTYPVQCILDFVRKKRRTHFDKVYSQNEIVERIKTFKKALLKKHGFIPELSFMK
                     FDIESCYDSIRREKVMEVISRLLEHETGFFVRSQSIFNPSTGSLKVQNVVNGSRRPSD
                     DEVYIDNVRTVYLTKQDVLEVLELEFFRTALSFNGRCYLRKDGLFQGSRLSALVVDLA
                     YDDLVESESVFKPHPNYDGLVIRLADDFLIISSDKNQILSLERMSQVGFPAYGAKVKA
                     DKICIAHSGSACKTLQFCALEISLKNLDTWKTSCLFNIPNFRFHSTFKTYQKLRHLYE
                     LRLSYGTVDGNVNEPPTILYQIHQIGDNIATTFVHAFKGKPICLEEFEEFIHNIFASS
                     ELAWRHCPEDVVFKSQVRLALLRSFLEVLVKNTSKFENAIGFLISEVNKCMYISSLA"
     gene            complement(<874035..>876629)
                     /locus_tag="ZYRO0G10868g"
                     /db_xref="GeneID:8206271"
     mRNA            complement(<874035..>876629)
                     /locus_tag="ZYRO0G10868g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498417.1"
                     /db_xref="GeneID:8206271"
     CDS             complement(874035..876629)
                     /locus_tag="ZYRO0G10868g"
                     /note="similar to uniprot|P41697 Saccharomyces cerevisiae
                     YLR319C BUD6 Actin- and formin-interacting protein
                     involved in actin cable nucleation and polarized cell
                     growth isolated as bipolar budding mutant potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498462.1"
                     /db_xref="GeneID:8206271"
                     /db_xref="InterPro:IPR005613"
                     /db_xref="InterPro:IPR022782"
                     /db_xref="UniProtKB/TrEMBL:C5E095"
                     /translation="MLSSGREGLEYPNGRHSSNSSRKSSSSTLSNSSVETTVTKLLMS
                     TKQLLQTLTQWSKGIVNERMVSDAYVQLGNDFKLVSKFFSHSGLEVSDLGDVPMDLRR
                     VLEVALRDEPSDETLNKYLPSIREIIVTLLDKLKVKQALLKSMKSEKGTKRSLHQQRP
                     STVSSLSLSNKSTPPSSRTPSVSFTPKTHGQEISEPRTHRKNDIMSPEIAKNASLASP
                     VNSSSSNVPDAATHMAAPKQQNLSETEALSELKKGNNLQRRASKRFSAYQMAKLTNHS
                     NTEAAAAGALASVPPSLANTVTPSLPASSPASLAPPLPRDLMAQTLESPVDKEAPSSQ
                     RGTGNNYDNDYDKELNHQTTAKSTTNKSPVPPDVSPVPVFQPRLHADTSGASFTSAKT
                     DHINEKQDEDPSGPLYTIFLRMNGKTKKCHLPPPTSMHELQLLFVEKFAYSFDEDSFP
                     DLYLQDPKFSVFYELDQQGLSDLHDGCIVELKVKDKKEDEGKTGNKDVEMEKEPKINF
                     AEVISSLRGEISRAQEDMLDQMRDLSMKTQESLKTHELSLASRNMDKSVLSGNVPTST
                     STPAPAFTRPAVPVETVSALKQELSVLRQLHNESKRKSESTIGTVLSKLENFKNLSLE
                     ADKSSSNNRYIETSQNRLSELSDALLSKVDDLQDVIEVLRKDVAVHGVKPSKKKLDSV
                     QKELVLAENDLSMMQMFMQNEKPQWKKIWKAELEKVCEEQQFLTLQEDLTADLKEDLG
                     KALETFDLVNMCCVEQERHPKKSRSNPILPIPEPGTFHRVRDQVLNEVQALNPDHNER
                     IEALERAQKMWEREREYRDTDAFEDELGNFVEKGNLKTAGGVEEVERIRKQKDENNLR
                     AYFGGLDL"
     gene            <876838..>881109
                     /locus_tag="ZYRO0G10890g"
                     /db_xref="GeneID:8206272"
     mRNA            <876838..>881109
                     /locus_tag="ZYRO0G10890g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498418.1"
                     /db_xref="GeneID:8206272"
     CDS             876838..881109
                     /locus_tag="ZYRO0G10890g"
                     /note="weakly similar to uniprot|Q06164 Saccharomyces
                     cerevisiae YLR320W MMS22 Protein involved in resistance to
                     ionizing radiation acts with Mms1p in a repair pathway
                     that may be involved in resolving replication
                     intermediates or preventing the damage caused by blocked
                     replication forks"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498463.1"
                     /db_xref="GeneID:8206272"
                     /db_xref="InterPro:IPR019021"
                     /db_xref="UniProtKB/TrEMBL:C5E096"
                     /translation="MVVDDSGTVVVPDSEGDGEGEETLIFSPHDNDNIMAPIEAGVVP
                     LGQAVRLEPEDLPSEHSRRFLRRRKAIQRMPYSLERIKHKQLLQGYDMSGFESISEEL
                     KLPRPNPDLLGSFQDTKIPTDLSRRRNDKGHHDEEDVVTEPIIGPVSEDEASEAEEEE
                     RQEQEDEVEEEEGEEDNEEELVKFRGRLINIKTGFRGVLPRVAWEKAIKQHNSTTRNF
                     KRRRDSASGNHRGVAKKKNVATEKNVNQDDSLLNDLIVPDDEVPLDDQISLPLRKTNQ
                     QEVHDLKQLDQQYQKKYDHQYLSDYEDEVEEDQMDNFIIELGEVQNKNQVEIAPTFVL
                     TPQDTFNQDDDDPDLMEVGAVENDEGAIDGMLSKGPRIKGQGKFKSSTKRLGDTTRPG
                     STRKPSSYRMTPQRRSVRAPNRGNQQRIKQQTRLPSNYLPSQNSLKEAESSNLKPTST
                     QKKHNDKAKNKKQNSETIGPFAPLGSTNTRRANVFSTVMEAPSDKYALPKHGISKSES
                     SDLIILDNTNEDLREEAPLSALKSLFDEKQVIPPDTISLNLPDRQFVLSKFHRNDTPL
                     VLSNIFDHITERGVTDKELLQISESVTLFLLHFNHLGVLPVISEFHKRFRSKVSLLRE
                     KAKSIHFYQIAVCQLMLLEVSKYSDISNASRVELNSSILNHIISFFKLLSYCYDAVAK
                     SDPNYLFQSFDILSKIAKMLNQYDTLWDKLQEQGFRPEVCSFLIDSFHTNNPHWEILK
                     IEQDYTSIKEAFRFVNHCKRRYNWKITKNLIFLFDKIFKRRRFEDFTNECALTSGYIL
                     KPSQALRNNTMFNNYLNLLQEIELSDLVVERIIPMGELSPNDSVAALINRLNLLMVLA
                     RGSHVNLEKRMEDLLRPLLDSEYLSKQDHQSLKKIGQLVLDGILSLADINRIKNLPFR
                     GKILVMTFKNLLFECGETLEGAWTNFLDQLIPIIERSTKSKLLFCKEFYPCLILMSQR
                     DIFTENLVQVLQLYLRNLSLLGAKWAQRNILQVVKNKVDLSANWIDYYCTVGKFLIQS
                     NVMSWWSFYMYNDVRNSLTNKFYFDCKILQMCDNQSFELIKKSMFTTATNSILQISST
                     WFRRFLIQLMNRECSIIIDHRYNKSSNDTLNIAKRFVWMLNRLSYNDLLLQFISNLKN
                     CHQKKVVSIEFVTQMLEYLNLKFIDNIKDSHDFFSLKRELGISDIETEKSAFRDAFRS
                     QKDPISQASFVEWGLIHAHSNEEEMKRYMDKLESLFNFSAPEGSFRFFIRLITVHLRG
                     YFLHCKRRLLIYFLYLINGVLNARHLQISNSEFLELCMLHKILCSPNDVMNNAIVTED
                     PSSQKNLRAEYLQFQFNVLRIADGFLEFELLAQMSRKFLSGSPWSGELLYEELFDIEL
                     SNKIEDIFRYNSLTEQLDHVYILHDLNEEELESSISELIKDTPPQ"
     gene            complement(<881179..>882603)
                     /locus_tag="ZYRO0G10912g"
                     /db_xref="GeneID:8206273"
     mRNA            complement(<881179..>882603)
                     /locus_tag="ZYRO0G10912g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498419.1"
                     /db_xref="GeneID:8206273"
     CDS             complement(881179..882603)
                     /locus_tag="ZYRO0G10912g"
                     /note="similar to uniprot|P53201 Saccharomyces cerevisiae
                     YGR002C SWC4 Protein of unknown function component of the
                     Swr1p complex that incorporates Htz1p into chromatin
                     component of the NuA4 histone acetyltransferase complex"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498464.1"
                     /db_xref="GeneID:8206273"
                     /db_xref="GOA:C5E097"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR027109"
                     /db_xref="UniProtKB/TrEMBL:C5E097"
                     /translation="MSSSDILDVLNIQQKPKSHGNSASPPPTASASGASKAPRPQVTG
                     MQRELYNLLGENQPPIVVQPASRFKDKLTNTTKPSPWTNAEFKANDHLNLHHWVKGSK
                     ELVGEEAKESSYTKFNVHLRIPSFDKETYESFMANNIPNEELIKKEDSGTSSQEDTDD
                     WEYEEVDYLFQLCRKYDLRWFVIQDRYNYGRSRTLEELKEKFYKVCQRYFVAKSPNDP
                     LLPSLDFPKEKELERKKYLQRLLARSAAEIAEEEALIVESRKFEMAAKKTLNERESLL
                     RLLDSPNSDQSVSQYLTSQGMSQLYGSLLSDKSRKRKHESTVPENPWMKQQQLFALQR
                     QQLQQIQDKKQETQDTNQLKKTKRQKQEMQTAIKRKAETVYAEHLLEKFSADERKSLG
                     VMAHGDKLPPGVYLRSSKISTFKPALQSKVAAMLQELGLSVRPAMPSYDVVQRHEELL
                     KRIVALVDLKKHLDKLEAEKAITK"
     gene            <882760..>884988
                     /locus_tag="ZYRO0G10934g"
                     /db_xref="GeneID:8206274"
     mRNA            <882760..>884988
                     /locus_tag="ZYRO0G10934g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498420.1"
                     /db_xref="GeneID:8206274"
     CDS             882760..884988
                     /locus_tag="ZYRO0G10934g"
                     /note="similar to uniprot|P53202 Saccharomyces cerevisiae
                     YGR003W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498465.1"
                     /db_xref="GeneID:8206274"
                     /db_xref="GOA:C5E098"
                     /db_xref="InterPro:IPR001373"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR016158"
                     /db_xref="InterPro:IPR016159"
                     /db_xref="InterPro:IPR019559"
                     /db_xref="UniProtKB/TrEMBL:C5E098"
                     /translation="MISSKKAKIRVPNRLGLPGQNFESLWGILKDAIDHIYADQVSEL
                     SFELLYRTVYTLVLRRKALDLYSHLESYLGDKLDELKQNNLKDVEGFELLQKLFEIWK
                     SQCRCFKLISDVMIYLDKVYCKYERKMETYDMGLESFKKHVINPIKENISEAMLSDIN
                     KVRSQGSLQVPHADTWKGIVGMMETLEDEKDNYFSAHLEPVLLRETENYYKNAINYRE
                     LLPVEYLETMKKLKSYEFSLDQKFINGDSTVKVTTVLESVLIWTEQFMEAIPILIRDS
                     LTNNNVELLKELCSLSSEEKYCTKILDCIKNCIWEDVTSLSVDKNSRRRAQVATQWTT
                     KVIEIYNYYQSLLSTVDLHIFIFDGQDNSSLNLINEVIGKYLNQDAVQTCEFITLHLD
                     AFAKSTEDKRDINSVKESLEDCVKIFKLISEKDVFENFYKKQMSKRLLHQRSSIKLEK
                     WLVKQIKGEMGTFFTSKLDGMLRDINLSAGLSRSFKPDENLLPDCVFTSQILTMTSWP
                     FQTANVLDENVILPPQMRQYKEEFEVFYNRKYNDRTLRWAHHLGFMEIGFQFKNGYYE
                     ISMPIYGAIVFLLFEDHEELTTEQISELTNMPEQELQRQLISLSLAPKSRVLKKKPLS
                     KTISPQDTFCINYGFTSPTQKVKLQTIANITTKSEAQSQAGQDSLEKERVIEVNAAIV
                     RIMKSCKKSIHDELFQQVSETLKDRFTLTQSVFKKSVANLLNKEYLQRDMEDTNIYHY
                     IS"
     gene            complement(<884976..>885692)
                     /locus_tag="ZYRO0G10956g"
                     /db_xref="GeneID:8206275"
     mRNA            complement(<884976..>885692)
                     /locus_tag="ZYRO0G10956g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498421.1"
                     /db_xref="GeneID:8206275"
     CDS             complement(884976..885692)
                     /locus_tag="ZYRO0G10956g"
                     /note="similar to uniprot|P53769 Saccharomyces cerevisiae
                     YLR323C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498466.1"
                     /db_xref="GeneID:8206275"
                     /db_xref="GOA:C5E099"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5E099"
                     /translation="MFKKRSIKQGSGVKRKKVDLSGCGEDESGKVIKVPEVKGKSMMG
                     LESNGVEGRSISNAEIQDDNDDNDDKFKLLFGEQEVKTSEGEPVVNFKMKGKGAMTQP
                     KNVKVSILTDFHPDVCKDFKQTGYCGYGDSCKFLHSRDDFKTGWKMNQDWKIDESSSS
                     KSDKSKVEGIPFKCLICKEDYKSPIVTNCGHYFCSSCFTQRVRKDPNCAICGQDTHGV
                     ARIAKNLKCILKDQKQNQDI"
     gene            <885983..>887521
                     /locus_tag="ZYRO0G10978g"
                     /db_xref="GeneID:8206276"
     mRNA            <885983..>887521
                     /locus_tag="ZYRO0G10978g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498422.1"
                     /db_xref="GeneID:8206276"
     CDS             885983..887521
                     /locus_tag="ZYRO0G10978g"
                     /note="similar to uniprot|Q06169 Saccharomyces cerevisiae
                     YLR324W PEX30 Peroxisomal integral membrane protein
                     involved in negative regulation of peroxisome number
                     partially functionally redundant with Pex31p genetic
                     interactions suggest action at a step downstream of steps
                     mediated by Pex28p and Pex29p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498467.1"
                     /db_xref="GeneID:8206276"
                     /db_xref="GOA:C5E0A0"
                     /db_xref="InterPro:IPR006614"
                     /db_xref="InterPro:IPR010482"
                     /db_xref="UniProtKB/TrEMBL:C5E0A0"
                     /translation="MSDNSAKDRETRAQFVDEPTNRIGGNTTKVIRSALKKRSGSGQD
                     DSDDSGAIVSSPLLTSTPPTISKALVKLYPNLIVVDRTLSLLTWTSDDIWPSVLMVLS
                     YMAVILYFETIAKYFGHLVVVAIMWGYSQLDNHVEETLSTHPTLDDIVYVMNRVITKA
                     DILLSPITILSAQDIRKLLFTTAFLSPIYVIITLFILPPRKLLFIGGIYVLTYHSSWS
                     KVTRRLLWRFKLVRLLVFYVTGLDLGGISRSQGIFAAVHKQMNNLSGTNNDSDEGWPI
                     RFTYVLYENQRRWLGIGWTSSMLSYERSPWTDEFFNEAPPPDQFQLPDENTGMVWRWV
                     DKTWRLDNTNDGAIQLSSTKPKTTASPNADEGFIYYDNTWKKPSTEDSFSKYTRRRRW
                     VRTAELLKIKNVEGTESPNITVDSTSHNSTSQAANTDTGGSGHSTAIAPENSNHQNGS
                     KPHENLKRRGVSFSDVQNVHIVPLENEDEDESKNESSNDDGNYHDNQLDAENKNESTP
                     LLRD"
     gene            complement(<887798..>888034)
                     /locus_tag="ZYRO0G11000g"
                     /db_xref="GeneID:8206277"
     mRNA            complement(<887798..>888034)
                     /locus_tag="ZYRO0G11000g"
                     /product="60S ribosomal protein L38"
                     /transcript_id="XM_002498423.1"
                     /db_xref="GeneID:8206277"
     CDS             complement(887798..888034)
                     /locus_tag="ZYRO0G11000g"
                     /note="highly similar to uniprot|P49167 Saccharomyces
                     cerevisiae YLR325C RPL38 Protein component of the large
                     (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L38"
                     /protein_id="XP_002498468.1"
                     /db_xref="GeneID:8206277"
                     /db_xref="GOA:C5E0A1"
                     /db_xref="InterPro:IPR002675"
                     /db_xref="UniProtKB/TrEMBL:C5E0A1"
                     /translation="MAKEIADIKQFLELTRRNDVKVATVKVNKKLNKAGKSFRQTKFK
                     VRGSKSLYTLVVNDAGKAKKLIQSLPPTLNVNRL"
     gene            complement(<888384..>889550)
                     /locus_tag="ZYRO0G11022g"
                     /db_xref="GeneID:8206278"
     mRNA            complement(<888384..>889550)
                     /locus_tag="ZYRO0G11022g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498424.1"
                     /db_xref="GeneID:8206278"
     CDS             complement(888384..889550)
                     /locus_tag="ZYRO0G11022g"
                     /note="similar to uniprot|P41896 Saccharomyces cerevisiae
                     YGR005C TFG2 transcription initiation factor TFIIF middle
                     subunit"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498469.1"
                     /db_xref="GeneID:8206278"
                     /db_xref="GOA:C5E0A2"
                     /db_xref="InterPro:IPR003196"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5E0A2"
                     /translation="MSNDTGAVTNASTGNDSGDEYLSQEEEVFDGNDIENNENKVYEE
                     SLDLDLNQSNRQVWLVRLPMFLAEKWRDRNNIHGQQLGKIRINKDGSKIQLVLDENDN
                     DSIPHQYDLELTKKVVENEFVFTEQNLRKYQQRVRELATDPEKQKQAFQRKQEREEEL
                     KRRQQQLKRRNNRKKFNHRVMTDRDGRDRYIPYVKTIPKKTSITGTVCHECQVMPSMN
                     DPNYHKIVEQRRNLIKNNNKERITTLDETVGVTMSHTGMSMRGDNSNFLKVGREKAKS
                     NTKSIRMPKKEILDYLFKLFDEYDYWSLKGLKERTRQPEAHLKECLDKVATLVKKGPY
                     AFKYTLRPEYKRLKEEERKATLGELADEQGTGEDGQDGEGENEGDDEIEMEDVV"
     gene            <889694..>890428
                     /locus_tag="ZYRO0G11044g"
                     /db_xref="GeneID:8206279"
     mRNA            <889694..>890428
                     /locus_tag="ZYRO0G11044g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498425.1"
                     /db_xref="GeneID:8206279"
     CDS             889694..890428
                     /locus_tag="ZYRO0G11044g"
                     /note="similar to uniprot|P33411 Saccharomyces cerevisiae
                     YGR006W PRP18 Splicing factor involved in the positioning
                     of the 3' splice site during the second catalytic step of
                     splicing recruited to the spliceosome by Slu7p"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498470.1"
                     /db_xref="GeneID:8206279"
                     /db_xref="GOA:C5E0A3"
                     /db_xref="InterPro:IPR004098"
                     /db_xref="UniProtKB/TrEMBL:C5E0A3"
                     /translation="MDIGNLLKAEIDKKKNALDLKNRQVEEEPRVASSLPAHPEQGEK
                     SSDMLDLTQNNGHKAENASNPDESTLERLRTRPERIERAIEEDSQVSIDIDPVTIGDS
                     ERRQELSMQCNIYIHDLLKDWSNREYQPHLLPETAKCFFPLLVRLRKSNLDLDLLTSL
                     ATVLYHLQRDEFQQATESYMKLSIGNVAWPIGVTSVGIHARSAQSRIQGDHNVANIMV
                     DDRTRLWITSVKRLITFRESCSVGSN"
     gene            <890621..>891628
                     /locus_tag="ZYRO0G11066g"
                     /db_xref="GeneID:8206280"
     mRNA            <890621..>891628
                     /locus_tag="ZYRO0G11066g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498426.1"
                     /db_xref="GeneID:8206280"
     CDS             890621..891628
                     /locus_tag="ZYRO0G11066g"
                     /note="similar to uniprot|Q06170 Saccharomyces cerevisiae
                     YLR326W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498471.1"
                     /db_xref="GeneID:8206280"
                     /db_xref="InterPro:IPR025187"
                     /db_xref="UniProtKB/TrEMBL:C5E0A4"
                     /translation="MSGIITGLIGSYGQGWLQDKANEYAEEHFQPTKDPYYEELPSGK
                     KVRRRLPDYCSKQESKAYKKLQNQAWSHDKGMCGGCCWSECIGWAPLLTIIPIIGPAI
                     MYSIHGKMVDRAQIQFDLPQDMVLKMHGNIGVDLAIALVPVLGIVFSWMNACSTRNCA
                     MVYNFVSQRAIEAHNQKMRGKAGIAETKRNDKAEAAQAKQNAKAAKHSKSPTPVAAAT
                     PPASAPAATSNVKSSKYTQKEVRSASPPLRNVPNTVSPFERSSPQPYSRPAAPLPPPS
                     AAMPNSAVGGRVGGGNPYVVQSTNQSYPMQDWGQRPYQRPPAPTPGPAGTKSRAQRPY
                     I"
     gene            <891717..>892667
                     /locus_tag="ZYRO0G11088g"
                     /db_xref="GeneID:8206281"
     mRNA            <891717..>892667
                     /locus_tag="ZYRO0G11088g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498427.1"
                     /db_xref="GeneID:8206281"
     CDS             891717..892667
                     /locus_tag="ZYRO0G11088g"
                     /note="similar to uniprot|P33412 YGR007W Saccharomyces
                     cerevisiae MUQ1 Choline phosphate cytidylyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498472.1"
                     /db_xref="GeneID:8206281"
                     /db_xref="GOA:C5E0A5"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5E0A5"
                     /translation="MTVADSNRIWIDGCFDFSHHGHAGAILQARRTIGDPQRGWLVCG
                     VHNDEAITLNKGTKPVMNQWERYGHTRSNRWCSEVVEDAPYVTEPSWLDRYNCQYVVH
                     GDDITLDANGENCYRVVIEQGRFLMVKRTEGVSTSEIIHRILGKSKPVDRTSLPTFDE
                     LQMFSSGYNGYEPHCYVFENDLKNVVVKGGYDFHSYDGRTKLITGDFDLFHVGHIEQL
                     SQLQGPNHSYRLIVVVQLDEGSIMTLREIALSLLSCKYVDGILVKPSADFLKQYSDKF
                     IPMQSTFDGHFGYLNKQIIMDRVLENKQTYTERNKRKGFE"
     gene            complement(<892799..>893062)
                     /locus_tag="ZYRO0G11110g"
                     /db_xref="GeneID:8206282"
     mRNA            complement(<892799..>893062)
                     /locus_tag="ZYRO0G11110g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498428.1"
                     /db_xref="GeneID:8206282"
     CDS             complement(892799..893062)
                     /locus_tag="ZYRO0G11110g"
                     /note="similar to uniprot|Q06177 Saccharomyces cerevisiae
                     YLR327C RBF9 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498473.1"
                     /db_xref="GeneID:8206282"
                     /db_xref="InterPro:IPR006861"
                     /db_xref="UniProtKB/TrEMBL:C5E0A6"
                     /translation="MTRTTKWTEHEGRPDPKYFTHNGHFGENPYNVKKQGYGKGNWGR
                     PGDEIEDLIDDGEIPEVFNKSRRGSNVQSNEKKYGKLQHIGDA"
     gene            893563..893662
                     /locus_tag="ZYRO0G11132r"
                     /db_xref="GeneID:8206283"
     tRNA            join(893563..893599,893618..893662)
                     /locus_tag="ZYRO0G11132r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (GCT) cove"
                     /db_xref="GeneID:8206283"
     gene            <894075..>895475
                     /locus_tag="ZYRO0G11154g"
                     /db_xref="GeneID:8206284"
     mRNA            <894075..>895475
                     /locus_tag="ZYRO0G11154g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498429.1"
                     /db_xref="GeneID:8206284"
     CDS             894075..895475
                     /locus_tag="ZYRO0G11154g"
                     /note="highly similar to uniprot|Q06178 Saccharomyces
                     cerevisiae YLR328W NMA1 Nicotinic acid mononucleotide
                     adenylyltransferase involved in NAD() salvage pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498474.1"
                     /db_xref="GeneID:8206284"
                     /db_xref="GOA:C5E0A7"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR005248"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5E0A7"
                     /translation="MDPTKAPDFKPTDSKSRPEPPPDPISTIPKSSPIVPYVLADYNS
                     SIDAPFNLETAFKGRTKSKTRPPAPPPSEARTPASDTGGVGVGVGSSSGSSSRAPHSH
                     YQLHPYHRHRGGHRNPEEKEQHRRASHIPMNTTDFQPLSAEISSTEEEEDTEGNEEEL
                     AEGIDSRLNLDDDPEKEEKSGGISVGVRKNQIADLEEVPHGIVRQARNLDDYEFPTHR
                     LAKKLKNPNKMPLVIVACGSFSPITYLHLRMFEMALDAIREQTRFEVIGGYYSPVSDN
                     YQKPGLAAASHRVRMCELACERTSSWLMVDAWESLQPTYTRTAKVLDHFNYEVNVKRG
                     GVSTVTGEKMGVKIMLLAGGDLIESMGEPNVWADADLHHILGNYGCLILERTGSDVRS
                     FLLSHDIMYQHRRNVLVIKQLIYNDISSTKVRLFIRRNMSVQYLLPNSVIRYIQEHGL
                     YVNQTESVKQVMGTKD"
     gene            <895757..>896074
                     /locus_tag="ZYRO0G11176g"
                     /db_xref="GeneID:8206285"
     mRNA            <895757..>896074
                     /locus_tag="ZYRO0G11176g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498430.1"
                     /db_xref="GeneID:8206285"
     CDS             895757..896074
                     /locus_tag="ZYRO0G11176g"
                     /note="some similarities with uniprot|Q07927 Saccharomyces
                     cerevisiae YLR012C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498475.1"
                     /db_xref="GeneID:8206285"
                     /db_xref="UniProtKB/TrEMBL:C5E0A8"
                     /translation="MTIAMTTTQILRGFSQITYMQYKSLPPEIQDEYLDWAQEQWEKQ
                     WAQLQFERQGGVSGIAKKKAEQEVQWLERVTTWSYLHAYIPRNRCRKSSRVYYSMYNS
                     VSL"
     gene            <896227..>897378
                     /locus_tag="ZYRO0G11198g"
                     /db_xref="GeneID:8206286"
     mRNA            <896227..>897378
                     /locus_tag="ZYRO0G11198g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498431.1"
                     /db_xref="GeneID:8206286"
     CDS             896227..897378
                     /locus_tag="ZYRO0G11198g"
                     /note="highly similar to uniprot|P53206 Saccharomyces
                     cerevisiae YGR012W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498476.1"
                     /db_xref="GeneID:8206286"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="UniProtKB/TrEMBL:C5E0A9"
                     /translation="MSIDSGYWKNAVTFVSVSLAAYTSWKYYQAVLRRDTPPVKQSVD
                     ELIGNTPLVLIKSLSKATGTQIYAKMELCNPAGSAKDRVAFNAIREAEQDGRLIKGEP
                     GWVFEGTSGSTGISIALLCNSLGYRAHISLPDDTSNEKLSLLESLGATVNKVKPASIV
                     DPNQYVNAAKRACEELVKKGGRGIFADQFENEANWRIHYETTGPEIYKQMNGLIDGFV
                     AGCGTGGTITGVSKYLKERISPHVVLADPQGSGFYNRINYGVMYDKVEKEGTRRRHQV
                     DTMVEGIGLNRITRNFELGEHYIDESIRVTDDQALKMSKFLSVQDGLFIGSSTAINAV
                     AAVKLSRKLGKGSRIVIIACDSGSRHLSKFWKTAKDVDRDISLEQVMVD"
     gene            <897546..>899417
                     /locus_tag="ZYRO0G11220g"
                     /db_xref="GeneID:8206287"
     mRNA            <897546..>899417
                     /locus_tag="ZYRO0G11220g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498432.1"
                     /db_xref="GeneID:8206287"
     CDS             897546..899417
                     /locus_tag="ZYRO0G11220g"
                     /note="similar to uniprot|P53207 Saccharomyces cerevisiae
                     YGR013W SNU71 associated with U1 snRNP (no counterpart in
                     mammalian U1 snRNP contains few SR- RE- and RD-dipeptides
                     U1 snRNP protein"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498477.1"
                     /db_xref="GeneID:8206287"
                     /db_xref="GOA:C5E0B0"
                     /db_xref="InterPro:IPR002483"
                     /db_xref="UniProtKB/TrEMBL:C5E0B0"
                     /translation="MSEIIYVSPQLYLNSDTKWKSDGEKPGYIPILRADLYKFQESLK
                     GVLSSRSDQNQGKDGNLNSITYSIGSDAKTEYVANSGPDGVNQGPTGSTKFQTLQHFL
                     PISLEQQLHTVSIMGIPVKVANKDVETFLHQCIRLLLQHLDAAQQRYEDFWQCWTSVQ
                     SLETQEVFVRFSDIDSKLFASFVKIVQGWFQSDKRPGAAEIHMDVNTEQLIKDQQVEP
                     RKPSDTLIDSLNRLWQELDQSPTDKTQKQESNVEYQVDLTTLSDLPQDSLDQLCQDIV
                     KFRTRVLTIEREKRVRESYEESKRRRQQMMMIFDQIRRSRRDAGDDRAELEEEEEGEE
                     EEDEEEIEAGDEDDWTLEQRRQDLQRQEADHRYKSLLTQLQSEWEPELADLQRKLFRA
                     NHYEQVRLEEQPLHLKELSHLAVDPHYDHNRSYRQEEETRDEIDRKEHVIESTETNIQ
                     NKEQLLEGKQSAATIYNSADQDNGAENNAAEQQFKIKFAFKRAIDNSTRALSDEEDEG
                     RPIVAQVSDTPTTPTSTTTTTTTTTTTEAATNAPDVLPEDGLDTKLEELNRSGLVQEL
                     VKEYLGVYEQELVDYIFDTIRKERNKVALLTELRETFDEDAATIVENIWGSVHLTTS"
     gene            <900370..>904833
                     /locus_tag="ZYRO0G11242g"
                     /db_xref="GeneID:8206288"
     mRNA            <900370..>904833
                     /locus_tag="ZYRO0G11242g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498433.1"
                     /db_xref="GeneID:8206288"
     CDS             900370..904833
                     /locus_tag="ZYRO0G11242g"
                     /note="weakly similar to uniprot|P32334 Saccharomyces
                     cerevisiae YGR014W MSB2 Mucin family member at the head of
                     the Cdc42p- and MAP kinase-dependent filamentous growth
                     signaling pathway also functions as an osmosensor in
                     parallel to the Sho1p-mediated pathway potential Cdc28p
                     substrate"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498478.1"
                     /db_xref="GeneID:8206288"
                     /db_xref="UniProtKB/TrEMBL:C5E0B1"
                     /translation="MHHRSCLWRILVLLLSLQQVYADWPSGGGFDSSQSIGSQQDIPS
                     SNPNGGSSSSPNANGASSAGSASPSTTPFLESSDSNSGRPTAANSSPSQAVTSNSGNP
                     NDANTQGQELSSSQPTSGSSAQSQQSSVSSYPSAALTSNYQPSISSSAPGTSISQTPS
                     TSQGLASSIEALTSGSQAPDSSSQTQISNAYSQGTTTSGFQSSPQTPSSSQGPTLSSQ
                     GPASSSETSPSSSQEPASSSQGLPSSSQAPTFSSQGSTSSTQGSTPSSEASPSGSQEP
                     ASSSQAPTSSSQGLPSSSQVPTPSSEAPFSSSQVPTPSSVAPSSSSQAPTSSSQGPTS
                     SSEAPFSSSQVPTPSSETPSSSSQVPTPSSAAPSSSSEASPSSSQEPASNSQAPTSSS
                     QGLTSSFEGLSSSSQGVSSSSQEPSSSQSTSSSSQTPYSSSQAPTSDSQAPASSSVSQ
                     PALSVSQPSSSSAQLAAASTPSSSSTSLSISSSQAASSSSPVPSTSFEASNSNSEVPS
                     TSSEVPSSNSEAPSTSSEAPSSSYQAPSTSSEVPSSNSEVPSASSESSSSNSEVPSTS
                     SEAPSSSYQAPSTSSEPPSSSYQAPSTSSEPPSSSYQAPSTSSEPPSPSSDVPTSSYQ
                     VPSSSSSSEVASSNSEVPSSSYQVPGSSSKVPSSSYQVPSSSYQVPSSSSEIQSLSSQ
                     EPSSLTSQLSSSGSTFNGLTSQTGSSSSSSSYVVPSSSSSYEVPSSSSSYVIPSSSSS
                     YVIPSSSSSYVVPSSSSSYVVPSSSSSYVIPSSSSSYVVPSSSSSYVIPSSSSSYVVP
                     SSSSSYVVPSSSSSYVVPSSSSSYVIPSSSSSYVVPSSSSSYVIPSSSSSYVVPSSSS
                     SYVVPSSSSSYVVPSSSSSYVIPSSSSSYVIPSSSSSYVIPSSSSSYVVPSSSSSYVV
                     PSSSSSYVIPSSSSSYVIPSSSSSYVPTTSSSYLIPTSSSANVLTMPSSDVVSLSSSS
                     IGYYSGSSSSSSSIPPPTSSTSSYVDPTVSSSSLAQVPTGTSSYTYSSIPSTSSQSTI
                     QSQSSSSPVYTVPASTFSSPQTGSTSSSLTTGIASSNTSPETSSAQPTSLLTQTPLPA
                     SSQTSSVATGGFSSSAALSQAVSTPSVIPSTATTQSTSHRHGYSMTQSYWPVSGPTTT
                     LAPSSSTTNDNWWVPTKIITQPAPNTTASSTSSQATATLPQAIAAATQQVRPKGYSLL
                     TIGFKSALNYNFLISSPLSSAQIFAFLPSILNDPFQNQFNNVSIYQIVPLKSESLDYL
                     ATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKYLAELIDPTIPLTGLVPTGDKS
                     QGFGSDSNYDSASFDGDNGGSAYEGALGSSGKFTSSSHGHGSSGGKTAGLVVGVVVGG
                     CTYLAAMILLVRYFVKRQIKRSILKDPENCSIDSSDSNLDLSHLEKRNNSFNDQESVS
                     PSMKIHNWMNQSHNDNMAGSDVRLANDGRRFQVPKISRPIATQNSLGWNEV"
     gene            complement(<905177..>906127)
                     /locus_tag="ZYRO0G11264g"
                     /db_xref="GeneID:8206289"
     mRNA            complement(<905177..>906127)
                     /locus_tag="ZYRO0G11264g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498434.1"
                     /db_xref="GeneID:8206289"
     CDS             complement(905177..906127)
                     /locus_tag="ZYRO0G11264g"
                     /note="similar to uniprot|P53208 Saccharomyces cerevisiae
                     YGR015C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498479.1"
                     /db_xref="GeneID:8206289"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5E0B2"
                     /translation="MKRFLHHGKIPLKSIVDLAFHHQPPPNPVSHVVNSRPAIINIHG
                     IFGSRRLFRPFSKPLANALNTDVYSVDLRNHGDSPIAQPFNYVSFTKDVIHFIKKHIG
                     DKRPVQLIGFSLGAKVALLATLCSQINASKCIAIDAPPYETVAVDSVLVENYELITKI
                     INQEIKIEKGSKNWKKKLLKLFQGLPANATNNGDPSLYFANGFYSVKRNAEPPTAGQD
                     PYIEYSIPLEEFPNLIDEIIGWPDLQGKDNLEGLFKLSTDSPALFMKAMHSLAISDDY
                     SLLKKHFPRAVVKEIDSGHNMTVEKPEESLQCMIDFLKDS"
     gene            <906294..>906842
                     /locus_tag="ZYRO0G11286g"
                     /db_xref="GeneID:8206290"
     mRNA            <906294..>906842
                     /locus_tag="ZYRO0G11286g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498435.1"
                     /db_xref="GeneID:8206290"
     CDS             906294..906842
                     /locus_tag="ZYRO0G11286g"
                     /note="similar to uniprot|P53209 Saccharomyces cerevisiae
                     YGR016W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498480.1"
                     /db_xref="GeneID:8206290"
                     /db_xref="UniProtKB/TrEMBL:C5E0B3"
                     /translation="MPELKRIHRSVMDPDNNTDDGEDAIPMQPLDIDEQEDLIQQLEK
                     GNSKRNHLYVNVLTGIYAICGLSFLCQTRKSLGKEFWVYGLGCISMALSIVSVRYEIV
                     TDFQVFMTSQVQMNNIALQRFNVAVLVLVEWLALTELPLGMVSQIPLFLFFVSILTKR
                     WVRSMENEITSLRGLKYKYKSA"
     gene            complement(<906839..>907249)
                     /locus_tag="ZYRO0G11308g"
                     /db_xref="GeneID:8206291"
     mRNA            complement(<906839..>907249)
                     /locus_tag="ZYRO0G11308g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498436.1"
                     /db_xref="GeneID:8206291"
     CDS             complement(906839..907249)
                     /locus_tag="ZYRO0G11308g"
                     /note="similar to uniprot|Q02721 Saccharomyces cerevisiae
                     YLR329W REC102 Protein involved in early stages of meiotic
                     recombination required for chromosome synapsis forms a
                     complex with Rec104p and Spo11p necessary during the
                     initiation of recombination"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498481.1"
                     /db_xref="GeneID:8206291"
                     /db_xref="UniProtKB/TrEMBL:C5E0B4"
                     /translation="MTTLLAKPIEFRPHIKLPIVAHCTDLKIDADFHHCPHLWSPVDV
                     VSQLNEYLASLIVSQLEFQFPMVFSTIARNRFKSQETDIGPISYSLVYSSALIPITVQ
                     LIAGERTATTACQLLRPKRRTSRIDFQILKQPLD"
     gene            complement(<907780..>908892)
                     /locus_tag="ZYRO0G11330g"
                     /db_xref="GeneID:8206292"
     mRNA            complement(<907780..>908892)
                     /locus_tag="ZYRO0G11330g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498437.1"
                     /db_xref="GeneID:8206292"
     CDS             complement(907780..908892)
                     /locus_tag="ZYRO0G11330g"
                     /note="highly similar to uniprot|P53295 Saccharomyces
                     cerevisiae YGR173W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498482.1"
                     /db_xref="GeneID:8206292"
                     /db_xref="GOA:C5E0B5"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E0B5"
                     /translation="MAMGITERIKAIEDEMARTQKNKATEYHLGLLKGKLARLRQQLL
                     ADEANSGGGGGQGFEVAKSGDARVVLIGYPSVGKSSLLGKVTTTKSEIAHYAFTTLTS
                     VPGVLRYQGAEIQVVDLPGIIYGASQGKGRGRQVVATARTADLVVMILDATKSEHQRA
                     SLEKELEAVGIRLNKEKPNISFKKKDTGGVKVTFTSPSKTTLTEDSIKMILKDYRIHN
                     ADVLVRDDKCTIDDFIDIINDQHRNYIRCLYVFNKIDSVSLEEVDRLARQPNTVVMSC
                     EMDLGMEDVVEEIWYQLNLSRVFTKKRGVKPDFSDPLVVRNNSTVGDLCHSIHRDFKD
                     QFKYALIWGSSAKHSPQKCGLNHKIHDEDVVSLFTK"
     gene            909110..909191
                     /locus_tag="ZYRO0G11352r"
                     /db_xref="GeneID:8206293"
     tRNA            909110..909191
                     /locus_tag="ZYRO0G11352r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=83.48"
                     /db_xref="GeneID:8206293"
     gene            <909992..>910771
                     /locus_tag="ZYRO0G11374g"
                     /db_xref="GeneID:8206294"
     mRNA            <909992..>910771
                     /locus_tag="ZYRO0G11374g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498438.1"
                     /db_xref="GeneID:8206294"
     CDS             909992..910771
                     /locus_tag="ZYRO0G11374g"
                     /note="similar to uniprot|P42940 YGR207C Saccharomyces
                     cerevisiae YGR2 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498483.1"
                     /db_xref="GeneID:8206294"
                     /db_xref="GOA:C5E0B6"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR012255"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="UniProtKB/TrEMBL:C5E0B6"
                     /translation="MSSKGLRILVPVKRVIDYQIRPRVNKTKTAIETTGVKFSINPFD
                     DIALEEALRIKEKKKATVDAIHAISIGPSKSQDILRNCLAKGADTSTLVDAGSQELEP
                     LAVAKILKQVVEKQGSNLVILGKQAIDDDNNNTGQMLAGMLNWPQATNAANVEFENGG
                     DRIKITREVDGGEEIVSAPLPLVITTDLRLNQPRYVGLQNLMKAKKKPMDKLKLKDFA
                     DLDLESRLKLLQVVEPEPRSPGIKVGSVDELVQNLKDAKAI"
     gene            complement(<910799..>911092)
                     /locus_tag="ZYRO0G11396g"
                     /db_xref="GeneID:8206295"
     mRNA            complement(<910799..>911092)
                     /locus_tag="ZYRO0G11396g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498439.1"
                     /db_xref="GeneID:8206295"
     CDS             complement(910799..911092)
                     /locus_tag="ZYRO0G11396g"
                     /note="similar to uniprot|P42939 Saccharomyces cerevisiae
                     YGR206W Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498484.1"
                     /db_xref="GeneID:8206295"
                     /db_xref="InterPro:IPR019014"
                     /db_xref="UniProtKB/TrEMBL:C5E0B7"
                     /translation="MDLVEETLRNRPLVNSRGSKFPHEVPPRLHIPQIKLQPLQPASQ
                     MFGPWYNECDQLVQLAELHDKRSQQFESWYVSQCLSKKPPGMAMTMLSPSRRE"
     gene            <911178..>911708
                     /locus_tag="ZYRO0G11418g"
                     /db_xref="GeneID:8206296"
     mRNA            <911178..>911708
                     /locus_tag="ZYRO0G11418g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498440.1"
                     /db_xref="GeneID:8206296"
     CDS             911178..911708
                     /locus_tag="ZYRO0G11418g"
                     /note="highly similar to uniprot|P47096 Saccharomyces
                     cerevisiae YJR025C BNA1 3-hydroxyanthranilic acid
                     dioxygenase required for biosynthesis of nicotinic acid
                     from tryptophan via kynurenine pathway"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498485.1"
                     /db_xref="GeneID:8206296"
                     /db_xref="GOA:C5E0B8"
                     /db_xref="InterPro:IPR010329"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:C5E0B8"
                     /translation="MLNTTPINLDQWLKENSHLLQPPVNNFCLHRGGFTVMIVGGPNE
                     RTDYHINPTPEYFLQKKGHMTLRVVDESSEGDDRFKDIRIDEGSSYLLPGNTPHSPVR
                     YANTVGIVVEQDRPEGSHDKMRWYCSKCRSIVHEIELQMLDLGTQVKEGILSFESDVS
                     KRTCNKCGTLNYARPV"
     gene            <911837..>912568
                     /locus_tag="ZYRO0G11440g"
                     /db_xref="GeneID:8206297"
     mRNA            <911837..>912568
                     /locus_tag="ZYRO0G11440g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498441.1"
                     /db_xref="GeneID:8206297"
     CDS             911837..912568
                     /locus_tag="ZYRO0G11440g"
                     /note="similar to uniprot|P47095 Saccharomyces cerevisiae
                     YJR024C Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498486.1"
                     /db_xref="GeneID:8206297"
                     /db_xref="GOA:C5E0B9"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /translation="MPTDADYLIDSQDPRHPANLICTLCKQFFDFNWCTGTGGGISIK
                     HPQTGHLYVAPSGVQKEQMKPHDMFVVDGKSYEYLRIPPGLKPSACTPLFNACYKYKS
                     AGAIVHTHSLNAVTCSLIFGQEFRIRGVEQIKAIPSDRKDPSTGKVLNLNWDDTCVIP
                     IIENRPHEDQLEDPLMETFEKYPHACAVIVRRHGIFVWGPTIEKAKVINEALDYLMEL
                     AVKMHQLGIPPDCSVGQESKYISKH"
     gene            complement(<912593..>912904)
                     /locus_tag="ZYRO0G11462g"
                     /db_xref="GeneID:8206298"
     mRNA            complement(<912593..>912904)
                     /locus_tag="ZYRO0G11462g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498442.1"
                     /db_xref="GeneID:8206298"
     CDS             complement(912593..912904)
                     /locus_tag="ZYRO0G11462g"
                     /note="similar to uniprot|P47093 Saccharomyces cerevisiae
                     YJR022W LSM8 Component of small nuclear ribonucleoprotein
                     complexes involved in RNA processing and splicing"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498487.1"
                     /db_xref="GeneID:8206298"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5E0C0"
                     /translation="MSPLLKDYLHRRVLVITTAGDCIVATLEGFDKNTNVVISDVVDR
                     CTLRPMAMAQAVRGSEIVAMGPIDDAPTGTVDPLKDTKNKIPNEHLIWEKVGQRKLYR
                     H"
     gene            complement(<913680..>914534)
                     /locus_tag="ZYRO0G11506g"
                     /db_xref="GeneID:8206299"
     mRNA            complement(<913680..>914534)
                     /locus_tag="ZYRO0G11506g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498443.1"
                     /db_xref="GeneID:8206299"
     CDS             complement(913680..914534)
                     /locus_tag="ZYRO0G11506g"
                     /note="similar to uniprot|P42938 Saccharomyces cerevisiae
                     YGR205W Protein that binds ATP crystal structure resembles
                     that of E.coli pantothenate kinase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498488.1"
                     /db_xref="GeneID:8206299"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E0C1"
                     /translation="METVERVLQFVDKYVPLFMERRDHGGGSEPLFVFVCGPQGSGKT
                     FTTDAIVKHLGSKYRVAGASIDDFYLTHEDQLKFSRTFRRNKLLQGRGLPGTHDIALL
                     TQCIENVVRGKEGKLDIPTYDKSLCNGEGDRSEFRQVDLPLDVFVLEGWFLGFNPLLS
                     KQEINSHPLLQGGGDMVQVNANLLFYKDLLWGNSELKSLGVILEADDIKNVYQWRAEQ
                     EQELHKLKGQGMDDDQVKKFVDRYWPCYELYYEPLVQSESFGSVATLTLGLDLQRNVI
                     SIKDRCIE"
     gene            <914854..>915867
                     /locus_tag="ZYRO0G11528g"
                     /db_xref="GeneID:8206300"
     mRNA            <914854..>915867
                     /locus_tag="ZYRO0G11528g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498444.1"
                     /db_xref="GeneID:8206300"
     CDS             914854..915867
                     /locus_tag="ZYRO0G11528g"
                     /note="similar to uniprot|P41903 Saccharomyces cerevisiae
                     YJR019C TES1 Thioesterase peroxisomal acyl-CoA
                     thioesterase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498489.1"
                     /db_xref="GeneID:8206300"
                     /db_xref="GOA:C5E0C2"
                     /db_xref="InterPro:IPR003703"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5E0C2"
                     /translation="MESLFADIEKILELQSVSKSIYRSKRLGIPPVGSRGTFGGILLG
                     QSLLAAMYTVPTTFVPSSLHCYFVNGGDPTVLLQYEVEDIRRGKSFLHQQVKAYQADK
                     LVSIVAVLWSLEKQVSKDALHYFKTLEQDEFPPMDRFEDAGPLYRRTVIETNGLKRLD
                     DDLPSFRNFKLRDTFLDSFFNGCVDHRFPTDFFHSHGAKKKLDYYVRIRDLITNTGRN
                     EAPQVSVNPRNDFRYNYVAFCYLSDSYFIFTVPNFHGLPLFTYKFSVSLDHSIHFHGV
                     PEVNGWMYMRIHNPRSYKDKHLVQGEYFNAETGQIVASTSQEGLTVYHSEKKIREMIR
                     PKL"
     gene            complement(<915944..>918787)
                     /locus_tag="ZYRO0G11550g"
                     /db_xref="GeneID:8206301"
     mRNA            complement(<915944..>918787)
                     /locus_tag="ZYRO0G11550g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498445.1"
                     /db_xref="GeneID:8206301"
     CDS             complement(915944..918787)
                     /locus_tag="ZYRO0G11550g"
                     /note="highly similar to uniprot|P07245 Saccharomyces
                     cerevisiae YGR204W ADE3 Cytoplasmic trifunctional enzyme
                     C1-tetrahydrofolate synthase involved in single carbon
                     metabolism and required for biosynthesis of purines
                     thymidylate methionine and histidine"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498490.1"
                     /db_xref="GeneID:8206301"
                     /db_xref="GOA:C5E0C3"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5E0C3"
                     /translation="MSAQLIDGKSCAQAIRSEVAQEIVDIKSRDPSFKPCLAIVQVSD
                     RQDSSTYVRMKCKAAAEADIKTEFVHLNEDVSEAQVLEKVSELNEDPSIHGVLVQLPL
                     PAHINEDKVTSSVLARKDVDGFGPFNVGELNKRSGKPFFYPCTPLGIIELLKRYEITI
                     SGTKSVVIGRSDIVGSPVAELLKSLDSTVTVAHSKTQNLESYLEDADIVVVGIGCAQF
                     VKGEWFKNNKRGVVVIDVGTNYVEDPSKKSGYRSVGDVEFEEALKYVRLITPVPGGVG
                     PMTVAMLMKNTLTAAKREWENGGKLRKFEPLPLNLQKPVPSDFEISRARKPKDISEVA
                     LEAGILPSELEPYGSTKAKVNLKILDRLQNRKNGKYVLVTGITPTPLGEGKSTTTVGL
                     AQALGAHLNKTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISM
                     ANNLLAAAIDTRMFHESTQKDGPLYKRLVPAKKGVRKFSKTMLKRLEKMGIDKTNPND
                     LTPEEITKFARLDIDPETITWRRVVDCNDRMLRGITIGEAPTEKGHTRHTAFDISVAS
                     ECMAILALSNSLQDMRERLGRIVVAASKSGEPITCEDIGCAGAMTALLKDAIKPNIMQ
                     TLEGTPVFVHAGPFANISIGANSVLADKMALKLAGVDPETPVDLQKNRSGYVITEAGF
                     DFTMGGERFINIKCRSSGLIPDVVVIVATVRALKVHGGGPEVKAGAPLPIEYLQENVD
                     LLRKGCANLGKHIENAKQYGLPVVVAINKMASDTDLEHQVIKEESLKAGAFDAIVSNH
                     WEQGGLGAIELAEGIVKATNEIDSSKFDFLYGLQGTVEDRIREIAQKMYGAADVEFLP
                     EAQRKIELYTKQGFAHLPVCIAKTQYSLSHDANLKGVPKGFVFPVRDIKASVGAGYLY
                     ALAAEIQTIPGLPTHCGFMNVEVTEDGEIEGMF"
     gene            <919421..>919909
                     /locus_tag="ZYRO0G11572g"
                     /db_xref="GeneID:8206302"
     mRNA            <919421..>919909
                     /locus_tag="ZYRO0G11572g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498446.1"
                     /db_xref="GeneID:8206302"
     CDS             919421..919909
                     /locus_tag="ZYRO0G11572g"
                     /note="highly similar to gnl|GLV|KLLA0E16610g
                     Kluyveromyces lactis KLLA0E16610g and similar to YJR017C
                     uniprot|P22696 Saccharomyces cerevisiae ESS1
                     Peptidylprolyl-cis/trans-isomerase (PPIase) specific for
                     phosphorylated serine and threonine residues N-terminal to
                     proline"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498491.1"
                     /db_xref="GeneID:8206302"
                     /db_xref="GOA:C5E0C4"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR023058"
                     /db_xref="UniProtKB/TrEMBL:C5E0C4"
                     /translation="MSDTGLPSPWTVRYSRSKKREYFFNPDTKQSIWEEPEGTNHSQL
                     KQYLSEHPVRVRALHILAKHSESRRPASHRSDHITLPKEQAIQELEQLQNRIESGESF
                     ESLAKERSDCSSFKRGGDLGWFGKGEMQPTFEKTAFHLNVGQVSSIVESDSGVHLIKR
                     VG"
     gene            complement(<919989..>920423)
                     /locus_tag="ZYRO0G11594g"
                     /db_xref="GeneID:8206303"
     mRNA            complement(<919989..>920423)
                     /locus_tag="ZYRO0G11594g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498447.1"
                     /db_xref="GeneID:8206303"
     CDS             complement(919989..920423)
                     /locus_tag="ZYRO0G11594g"
                     /note="similar to uniprot|P42937 YGR203W Saccharomyces
                     cerevisiae Probable protein tyrosine phosphatase of the
                     CDC25-like phosphatase family"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498492.1"
                     /db_xref="GeneID:8206303"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5E0C5"
                     /translation="MQSRTVASIKYIDASQLFNMMKRGSSTPFQVIDVRGSDYIGGHI
                     RGGWNYPYKKFSDSIPELLDRLQEKRSSNSNDTTINVVFHCAQSQQRGPSAAMKFLRE
                     IPEPDLDKFEISVLRGGFINWQDLYGSDSTVTEDYHPDLWSW"
     gene            <920796..>922013
                     /locus_tag="ZYRO0G11616g"
                     /db_xref="GeneID:8206304"
     mRNA            <920796..>922013
                     /locus_tag="ZYRO0G11616g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498448.1"
                     /db_xref="GeneID:8206304"
     CDS             920796..922013
                     /locus_tag="ZYRO0G11616g"
                     /note="similar to uniprot|P33412 YGR007W Saccharomyces
                     cerevisiae MUQ1 Choline phosphate cytidylyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498493.1"
                     /db_xref="GeneID:8206304"
                     /db_xref="GOA:C5E0C6"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5E0C6"
                     /translation="MGPSSRNKSLKSRLSNTSLSNLFHLSKKRKHSDDEAESEAEGEE
                     ESEFDSQQSTDQNTTGETEDTQVAKRHHSQKHEEDKKFEEEELQRDAELPEDLRKYRP
                     RGFKLNIPPKDRPVRVYADGVFDLFHLGHMKQLEQCKKSLPNVVLICGVPSDSVTHKL
                     KGLTVLTDEQRCETLYHCKWVDEVIPNAPWCVTPEFLAQHKIDYVAHDDIPYGSADSD
                     DIYRPIKELGQFLTTQRTDGISTSDIITRIIKDYDKYLVRNFARGATRQELNVSWLKK
                     NELDFKKHVNEFRAYFKKNQENLNNVSKDLYFEVREILLRKTLGRKLYSKLAGDGGGE
                     LQDTLSKRGKLIREKSPVSDFASQFTGEEKSGSSNKLEQGNDAHYEKHERSPRRRGSS
                     STSKRSQQRKMKR"
     gene            <922274..>924025
                     /locus_tag="ZYRO0G11638g"
                     /db_xref="GeneID:8206305"
     mRNA            <922274..>924025
                     /locus_tag="ZYRO0G11638g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498449.1"
                     /db_xref="GeneID:8206305"
     CDS             922274..924025
                     /locus_tag="ZYRO0G11638g"
                     /note="highly similar to uniprot|P39522 Saccharomyces
                     cerevisiae YJR016C ILV3 Dihydroxyacid dehydratase
                     catalyzes third step in the common pathway leading to
                     biosynthesis of branched-chain amino acids"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498494.1"
                     /db_xref="GeneID:8206305"
                     /db_xref="GOA:C5E0C7"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="InterPro:IPR004404"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR020558"
                     /db_xref="UniProtKB/TrEMBL:C5E0C7"
                     /translation="MGLVDKASRKFCTTRIVGKKLNKYSYIVTEPKDQGGSQAMLYAT
                     GFKPDDLSKGQVGVGSCWWSGNPCNMHLLDLNHRCAESVNKAGFKAMQFNTIGVSDGI
                     PMGTSGMRYSLQSREIIADSFETQMMAQHYDANIAIPSCDKNMPGVLMAMGRHNKPSI
                     MVYGGTILPGTPTCGSSKLPKNIDLVAAYQSYGQYISKQITEEERSDVVSHACPGPGS
                     CGGMYTANSMAAAAEVMGITLPNTSTSPATSKEKLAECASIGDAIKKTMELNILPRDV
                     LTREAFENAITYVIATGGSTNAVLHLVAIAHSAGVKLTPDDFQRISDKTPLLGDFKPS
                     GKYFIADLYKVGGTQAVIKFLYENGFLHGNTLTITGETLAERAAKAAPLSEGQDLISS
                     VSQPVNPNGHLQILYGSLAPGGAVGKITGKEGTYFKGKAKVFEEEVSFIHALEKGEIK
                     KGEKTVVVIRYEGPKGGPGMPEMLKPSAALMGYGLGQDVAMLTDGRFSGGSHGFLIGH
                     VVPEAAEGGPIGLVKDGDEIVIDAQNNKIDLLVDENEMAKRRADWTPPSPRYTKGTLW
                     KYSKLVSNASQGCVLDA"
     gene            <924314..>926665
                     /locus_tag="ZYRO0G11660g"
                     /db_xref="GeneID:8206306"
     mRNA            <924314..>926665
                     /locus_tag="ZYRO0G11660g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498450.1"
                     /db_xref="GeneID:8206306"
     CDS             924314..926665
                     /locus_tag="ZYRO0G11660g"
                     /note="similar to uniprot|P42935 Saccharomyces cerevisiae
                     YGR200C ELP2 Elongator protein part of the six-subunit RNA
                     polymerase II Elongator histone acetyltransferase complex
                     target of Kluyveromyces lactis zymocin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498495.1"
                     /db_xref="GeneID:8206306"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5E0C8"
                     /translation="MVSVIPEATFIGANRQNQVSDVNKDAKVAFGAGKTIALWDPVNK
                     DAKGVYATLKGHQAEVTCVKFIPNMDLMVSTSEDHHVKIWKFSSLECLQTIEHYKHSI
                     VSLAVWKDLIVVGSADGLVSLWVFRDNEFVLDYEFTNRKGFFPLSLSVTNIEDGGFLL
                     AVGGTKPNIIVYSFVLRDSRVHECRLAAELEGHEDWVKSLAFRHKDTPGECLLASGSQ
                     DRYIRLWKVRLNELIDDSDENTERPKLLSNKQYKFEIKSGLRVSMSFEALIVGHDDWI
                     SSLQWHESRMQLLASTADTSLMVWEPDESSGVWICGSRLGEISSKGASTATGSSGGFW
                     SCLWFNHDGLEYILTNGKSGSWRVWSSSDNYYWEQHLGVTGATKQVTDIAWSPSGDYL
                     LSTSLDQTTRLYAPWLFNNDGTPRGQVTWHEFSRPQIHGYDMVCVEPLSNFRFVSGGD
                     EKILRSFDLPKGVFEILHKLAGYNSDFQNALPVSASLPALGLSNKATAVEDQEIEEEE
                     QDPNLRETNENKNISYDMASSLTIPPLEDQLQRHLLWPEIEKLYGHGYEISCVDVSSD
                     GKLIASACRSNNAQHAGVRIFDSNNWLEVKPTLLFHTLTITRLRFSKDNNYLLSVSRD
                     RQWAIWQRNFEDQTFSLKYKNEKAHTRIIWDCDWAPIEFGQVFLTASRDRTVKSWRYD
                     QESDNFTSENSVKFEQPVTALSICEKVIDGQLIVAIGLEGGSIHLYSYTPQGFKLLEQ
                     IDESLTPADKITRLRWSPSFREDRLYLGVSSSDTSTRIYSLKC"
     gene            complement(<926745..>928904)
                     /locus_tag="ZYRO0G11682g"
                     /db_xref="GeneID:8206307"
     mRNA            complement(<926745..>928904)
                     /locus_tag="ZYRO0G11682g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498451.1"
                     /db_xref="GeneID:8206307"
     CDS             complement(926745..928904)
                     /locus_tag="ZYRO0G11682g"
                     /note="similar to uniprot|P42934 Saccharomyces cerevisiae
                     YGR199W PMT6 Transfers mannose residues from dolichyl
                     phosphate-D-mannose to specific serine/threonine residues
                     of proteins in the secretory pathway dolichyl
                     phosphate-D-mannose:protein O-D-mannosyltransferase"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498496.1"
                     /db_xref="GeneID:8206307"
                     /db_xref="GOA:C5E0C9"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5E0C9"
                     /translation="MSESVEKGKVPQLQNFYRGLLRLESIISPIAYTLLALYVRFQNI
                     DKNPDVVWDEAHFGKFGSYYIKHEFYHDVHPPLGKMLIALTEWLAGFDGEFDFDSNQS
                     YPENVNYKLIRQINACFGVACCPLAYWTAKNMGFQLLTVHLIAIMVTLEHSYIVLSKF
                     ILLDSMLLFFTIATFACLVKMYTARREPFTRRWKLWMWLTGLSIGCVCSVKWVGLFVT
                     LVVGAYTILELFTLRFDPKVSRKQYFKHWAIRVINLIVTPFLIYLFLFKIHFTLLYKS
                     GPGDASTNTLFQVNLENNEIETGPRTVAFGSLITIRSHGLSPNLLHSHFQTYPEGSNQ
                     NQVTGYGFADDNNVWQVRFPRSSELNWEEDYLPDEGSGYITDGSVIRLFHNQQKVNLH
                     THRIPSHVSRGNYEVSGYGSEEIGDLKDDWIVEIVRQTDSSDPDYPKENYDELHPVST
                     FFRLRNKELGCYLTSTGFSYPKWGFQQAEIVCKHSWSKHDKSTWWNVEEHWNENLPID
                     TDWHPPKSRFWTDFVMINFAMASSNSALVEDHDKFDNLATDAWEWPTLHRGLRMCSWS
                     KDSYRYFLMGSPFNTWLSTLSLFVFLAITAKLLYQWKRQTKPMTESTFWEFIIQGVMP
                     FTAWVTHYLPFVVMGRVTYVHHYLPALYFAILIFGFVVDRLLRSSFNWIKYPVYIALF
                     GGCIKTYTYFSPICQGMTGMWTDYIYLEWLKSWDMAV"
     gene            complement(<929043..>929936)
                     /locus_tag="ZYRO0G11704g"
                     /db_xref="GeneID:8206308"
     mRNA            complement(<929043..>929936)
                     /locus_tag="ZYRO0G11704g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498452.1"
                     /db_xref="GeneID:8206308"
     CDS             complement(929043..929936)
                     /locus_tag="ZYRO0G11704g"
                     /note="some similarities with uniprot|P42835 Saccharomyces
                     cerevisiae YNL327W EGT2 Glycosylphosphatidylinositol
                     (GPI)-anchored cell wall endoglucanase required for proper
                     cell separation after cytokinesis expression is activated
                     by Swi5p and tightly regulated in a cell cycle-dependent
                     manner"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498497.1"
                     /db_xref="GeneID:8206308"
                     /db_xref="UniProtKB/TrEMBL:C5E0D0"
                     /translation="MRFFLQCLFYYCVTAAVTLVNAKDDSFFTNVGLRDSVSGYAYCR
                     DPNHWFQIDAELFLSEGQDRDVFLSIPREFTGLPTEPFELMHKSQVIGKVMISDDHLV
                     QISFPIPPKENITGNLRFMAKLDPDAVESIEAPRIINYNFYSSQGEHFKEPIRFEPRS
                     LGAVHVDGGMFLHNNTAWFVVDIPVEQLNEPVYVSSDPGAGSPVNQHQIIQGTARCEL
                     VTSVDSFHRPRITEPIEPLEDYTSESSVLMKFDHNLDGYYVRILYYTRPRILEFDRPI
                     RAQTAFYKRTVKGLTKYAIYS"
     gene            <930786..>931763
                     /locus_tag="ZYRO0G11726g"
                     /db_xref="GeneID:8206309"
     mRNA            <930786..>931763
                     /locus_tag="ZYRO0G11726g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498453.1"
                     /db_xref="GeneID:8206309"
     CDS             930786..931763
                     /locus_tag="ZYRO0G11726g"
                     /note="highly similar to uniprot|P32318 Saccharomyces
                     cerevisiae YGR144W THI4 Protein required for thiamine
                     biosynthesis and for mitochondrial genome stability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498498.1"
                     /db_xref="GeneID:8206309"
                     /db_xref="GOA:C5E0D1"
                     /db_xref="InterPro:IPR002922"
                     /db_xref="InterPro:IPR027495"
                     /db_xref="UniProtKB/TrEMBL:C5E0D1"
                     /translation="MSATATQTQEVTQLQLNAQQPIRHALSDVVKTEDWSDFQFTPIR
                     ESTVSRAMTRRYFQDLDKHAVSDVVIIGAGSSGLSAAYVICKNRPDLTVTCVEANVSP
                     GGGAWLGGQLFSAMIMRKPAHLFLDELEVPYDDEGDYVVVKHAALFTSTVLSKVLQFP
                     NFKLFNATAVEDLVTRPAGPNGEVTVAGVVTNWTLVTMAHDLQSCMDPNVIELAGYKN
                     DGTRDAEKKHGVILSTTGHDGPFGAFSAKRIVDIDSTNKLKGMKGLDMNHAEADVVKN
                     SGSYNNVGSVYFAGMEVSELSGCNRMGPTFGAMAVSGIKAAEEILRHFA"
     gene            complement(<931918..>934203)
                     /locus_tag="ZYRO0G11748g"
                     /db_xref="GeneID:8206310"
     mRNA            complement(<931918..>934203)
                     /locus_tag="ZYRO0G11748g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498454.1"
                     /db_xref="GeneID:8206310"
     CDS             complement(931918..934203)
                     /locus_tag="ZYRO0G11748g"
                     /note="similar to uniprot|P46951 Saccharomyces cerevisiae
                     YGR198W Essential protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498499.1"
                     /db_xref="GeneID:8206310"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5E0D2"
                     /translation="MSSVEDPVVESLRSRLVGSGNFHSGIHSLDTALTLQSRIHDHLF
                     GIGLDPTVAKVLSDDCKKLLGNFKVEPGNQDINIRNLLNKILYNCEGVLHYHMERPND
                     ANIYFSKSKVIELRDLPFAQFLNLENLYYRGLCKDDTLLYGEELFRIIDSVPNDSQGL
                     TLHYLSMIFNHISRDKEVAGRILATFPSSSPLTCLASLHLGEYEDTKFLNILAQLVNE
                     SHFPQAEANNNKALEDFHMFLHYYFKKATKLSPDWKKYIIESMEKTFQSVAVAKSAFI
                     YFGRNSITSPVDTKESILNFVNFVKYTQREYVLHGNKHDDLVSLIDSYAYILKIAQDS
                     SHDVENVFNFQDSVNKLLDLLRLMHKQNGFPLMSGQDSLNWLENRDELILPRTVSKRL
                     TNAWEMLFTIDKNSLTLLNDNSLTAYLTNALSVATDPLKLYQLNFQYCYLLAQKGLIE
                     PAIKILETVLLEENPECYSAWHLLALCKSINEDKEVSFKIVCSVLQAMQEGFEEGRLA
                     VTDRWQFVHLKMTQLKIVEDIFGIMDALEMLPELFELFSLLFPADDKRFDRIGNGYNQ
                     TKEYLLQIVWLFASGLYMRVPENYTDAADAINESIGVSKEFKNLNCNIAKGYLCLARG
                     QCKRASKEFNTVLLADPYNVSALVGLAQVVYPEGDTEICDYYKLRPLTPDSLDQKQDC
                     QPESVFVSEADRSANIARLKLLLESAIAHSIEADHSPEIWWYLSLIYEQYKDIGYKDA
                     LLNCVRYKETEPVRPFKYCNF"
     gene            complement(<934447..>935031)
                     /locus_tag="ZYRO0G11770g"
                     /db_xref="GeneID:8206311"
     mRNA            complement(<934447..>935031)
                     /locus_tag="ZYRO0G11770g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498455.1"
                     /db_xref="GeneID:8206311"
     CDS             complement(934447..935031)
                     /locus_tag="ZYRO0G11770g"
                     /note="similar to uniprot|P47089 Saccharomyces cerevisiae
                     YJR014W RBF22 Hypothetical ORF"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498500.1"
                     /db_xref="GeneID:8206311"
                     /db_xref="GOA:C5E0D3"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005873"
                     /db_xref="UniProtKB/TrEMBL:C5E0D3"
                     /translation="MLREVVYCGVCSFPPEYCEFSGKLKRCKIWLQENHAELFEKLYS
                     GEDAEVEGVTGKLAESSIGEKREEKLEKDLLKMQAKEENREQRELAKKLSSKIIIKRE
                     ARTKRKSVVAISGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIVIQGDVMGEV
                     ENYLHSILAEKGLKDVKVEVVDGAAKKKKKPEGA"
     gene            <935438..>937981
                     /locus_tag="ZYRO0G11792g"
                     /db_xref="GeneID:8206312"
     mRNA            <935438..>937981
                     /locus_tag="ZYRO0G11792g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498456.1"
                     /db_xref="GeneID:8206312"
     CDS             935438..937981
                     /locus_tag="ZYRO0G11792g"
                     /note="some similarities with uniprot|P46949 Saccharomyces
                     cerevisiae YGR196C FYV8 Protein of unknown function
                     required for survival upon exposure to K1 killer toxin"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498501.1"
                     /db_xref="GeneID:8206312"
                     /db_xref="InterPro:IPR026248"
                     /db_xref="UniProtKB/TrEMBL:C5E0D4"
                     /translation="MADQVGRKKSYRWVSASQASYDGSEWDSDDDDIIYGDKKGTSEN
                     HLKRDDTISNLPALPKLNYEDYEDNNTIKEEGSEKGDNEHDHSLEEEPAVVRESAGSR
                     RDSRVESFAGDDLLENYFGNTVASQAERNSNDKHHNGLIDRKKPEPLPLEEHGEDMKE
                     DGAVPKLEFNSSRESLRSPLPQKTPVNEDLDNLMAQISKEMEQQKKRYTREGDDLNAS
                     PKDSSGDDDDEEEELGVSKNGYFSNLVQSDKEDEHLMDKESPRSYQRDSALGEYSPDN
                     HLERSVLASSLSYSHSSRETGREPIENYEEDRVKDTPSSKSSVEPPERSALRSPLRSP
                     PHSPPHSPSHSPPHSPPRSPPRSPPRSPPRSPPRSPPKSSSRSPVRSPASMSSSLEDS
                     EDDALSFTESLNYHGSANGDDGEDNDSDNVNDNNYNEDEDEDEESDDEGIMRVHKSGY
                     FGKMVSEDDDAETIRRGNDSDNEKEERVSTERGDQNGLLHEDNNKGEMQNQQGFTEGA
                     EDDLSDAGESVEAGEGKRSISGQKSVNLGGWRPDIGGARSGFLQETARKAPPGYVYDE
                     NGELVNLTPSSMKSRAVSTYSEMESAWNPFPSGDDDDDDLQTVGDTKTIYDNQTIYNV
                     PGLITNNQNLPPLPNLDNETHLVNEPTGSNSSDPRSLTVDSSLATVSEIDSERDKGPL
                     KSHFHEVLNTSAPDLNGEPMKGKRTGESSGAETPTQKTPIISGSTTVPLLDLNKVISS
                     KSSHAHKIQELQHYYDQLVEHDTGIHAWIEASLTSSTKPEKGYLFEQYKVNKHVKDAY
                     ANADELSKKHTVTNTVASVNQNVSQLKKKVFLHPMKSRGLFSSIGKKKV"
     STS             937076..938220
                     /standard_name="D1S3690"
                     /db_xref="UniSTS:474268"
     gene            complement(<938076..>938813)
                     /locus_tag="ZYRO0G11814g"
                     /db_xref="GeneID:8206313"
     mRNA            complement(<938076..>938813)
                     /locus_tag="ZYRO0G11814g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498457.1"
                     /db_xref="GeneID:8206313"
     CDS             complement(938076..938813)
                     /locus_tag="ZYRO0G11814g"
                     /note="highly similar to uniprot|P46948 Saccharomyces
                     cerevisiae YGR195W SKI6 superkiller ExtraCellular Mutant
                     Ribosomal RNA Processing homolog of RNAse PH"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498502.1"
                     /db_xref="GeneID:8206313"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:C5E0D5"
                     /translation="MSRFEIYSPEGLRVDGRRWNELRRFDCSINTHSHAADGSSYLEQ
                     GNNKIITLVKGPKEPSLRSQMDPTKALLKVSVNITKFSKTERSKTSHKNERRVLEIQT
                     ALTRTFNKNVMLHIYPRTLIDIEIHVLQQDGGLVGTLINGITLALIDAGIAMFDYISG
                     VSVGLYDTTPLLEVNSLEENVMSSVTLGVVGKTEKLSLLLVEDKIPLDRLESVLAIGI
                     AGAHRVRELMDSELRKRAEKRVANSTN"
     gene            complement(<938959..>940149)
                     /locus_tag="ZYRO0G11836g"
                     /db_xref="GeneID:8206314"
     mRNA            complement(<938959..>940149)
                     /locus_tag="ZYRO0G11836g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498458.1"
                     /db_xref="GeneID:8206314"
     CDS             complement(938959..940149)
                     /locus_tag="ZYRO0G11836g"
                     /note="similar to uniprot|P47088 Saccharomyces cerevisiae
                     YJR013W GPI14 Glycosylphosphatidylinositol-alpha 1 4
                     mannosyltransferase I involved in GPI anchor biosynthesis
                     requires Pbn1p for function homolog of mammalian PIG-M"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498503.1"
                     /db_xref="GeneID:8206314"
                     /db_xref="GOA:C5E0D6"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="UniProtKB/TrEMBL:C5E0D6"
                     /translation="MVSGGVWLLVSSLLLRIGFFTFGIYQDAHMQVKYTDIDYYVFHD
                     AAGYVFKHGSPFMRDTYRYTPLLSWLLVPNHYLAWIHYGKLLFVIFDLITGVIIMRQL
                     AGSSKANWLASLWLLNPMVITISTRGNAESILGFMVMLTLYWLQNGQLVLAGLMYGIS
                     IHFKIYPVIYSLPISIYTYNRYKGHRWFYKLVLLGAAALIGLAGCSIWMYQIYGQEFL
                     ENAYLYHLYRTDHRHNFSIWNLLLYFDSARPEKSALSKIAFVPQLIVTASISILQWWN
                     PSFENLPCVLFVQTFAFVTFNKVCTSQYFIWYLIFLPLYISRSNISPLKGVIMLAVWG
                     ITQGLWLLQGYRLEFLGQDVFFPDLLAASAAFFLGNVWLLGQFIEDIKNSQQPKIDRV
                     KKEL"
     gene            <940285..>940620
                     /locus_tag="ZYRO0G11858g"
                     /db_xref="GeneID:8206315"
     mRNA            <940285..>940620
                     /locus_tag="ZYRO0G11858g"
                     /product="uncharacterized protein"
                     /transcript_id="XM_002498459.1"
                     /db_xref="GeneID:8206315"
     CDS             940285..940620
                     /locus_tag="ZYRO0G11858g"
                     /note="some similarities with uniprot|P47087 Saccharomyces
                     cerevisiae YJR012C Protein required for cell viability"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_002498504.1"
                     /db_xref="GeneID:8206315"
                     /db_xref="UniProtKB/TrEMBL:C5E0D7"
                     /translation="MAEGLCYEELIDHIIANKPIPNVVQVPEVTYDESERTHSELKPR
                     PKPWEMQEKVEEAPLVNEPLQDPSQLPSNIRLSEELRALTRSQSIESLSNYYAREAEL
                     DAALENDNR"
     gene            complement(<940728..>941624)
                     /locus_tag="ZYRO0G11880g"
                     /db_xref="GeneID:8206316"
     mRNA            complement(<940728..>941624)
                     /locus_tag="ZYRO0G11880g"
                     /product="unchara