GenomeNet

Database: RefSeq
Entry: NC_013077
LinkDB: NC_013077
Original site: NC_013077 
LOCUS       NC_013077             687718 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 chromosome A complete sequence.
ACCESSION   NC_013077
VERSION     NC_013077.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
            Assembly: GCF_000142805.1
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 687718)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 687718)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 687718)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928165.
            The Lachancea thermotolerans sequence is made of 8 chromosomes (A
            to H). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..687718
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="genomic DNA"
                     /strain="CBS 6340"
                     /type_material="culture from type material of
                     Zygosaccharomyces thermotolerans"
                     /db_xref="taxon:559295"
                     /chromosome="A"
     gene            complement(<2436..>2909)
                     /locus_tag="KLTH0A00110g"
                     /db_xref="GeneID:8290257"
     mRNA            complement(<2436..>2909)
                     /locus_tag="KLTH0A00110g"
                     /product="KLTH0A00110p"
                     /transcript_id="XM_002551428.1"
                     /db_xref="GeneID:8290257"
     CDS             complement(2436..2909)
                     /locus_tag="KLTH0A00110g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A00110p"
                     /protein_id="XP_002551474.1"
                     /db_xref="GeneID:8290257"
                     /db_xref="InterPro:IPR019587"
                     /db_xref="InterPro:IPR023393"
                     /db_xref="UniProtKB/TrEMBL:C5DB75"
                     /translation="MKVCTRVEINAPASVVRETLLDFSGHAKWNPFFTSIVLFEHDGH
                     DLSSQIKPGDRLEVTMKDIRSGKVNKFTPTVLANTVNKFKWEGSLIGQWFFSGIHTFE
                     FQEENGGQKCTLLQHETFSGVALPLLKPVLGGAQRNFEAMNNALKKACESQDEHK"
     repeat_region   3693..4109
                     /rpt_type=long_terminal_repeat
     gene            complement(<17344..>17547)
                     /locus_tag="KLTH0A00220g"
                     /db_xref="GeneID:8290262"
     mRNA            complement(<17344..>17547)
                     /locus_tag="KLTH0A00220g"
                     /product="KLTH0A00220p"
                     /transcript_id="XM_002551429.1"
                     /db_xref="GeneID:8290262"
     CDS             complement(17344..17547)
                     /locus_tag="KLTH0A00220g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A00220p"
                     /protein_id="XP_002551475.1"
                     /db_xref="GeneID:8290262"
                     /db_xref="UniProtKB/TrEMBL:C5DB76"
                     /translation="MPELGGSAPALIIFTGKVVIFELNSTAVHFKRFMEFHNSQLDGT
                     VETLKNHSQYCQIALTPSEYIYS"
     gene            <18502..>19083
                     /locus_tag="KLTH0A00242g"
                     /db_xref="GeneID:8290263"
     mRNA            <18502..>19083
                     /locus_tag="KLTH0A00242g"
                     /product="KLTH0A00242p"
                     /transcript_id="XM_002551430.1"
                     /db_xref="GeneID:8290263"
     CDS             18502..19083
                     /locus_tag="KLTH0A00242g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A00242p"
                     /protein_id="XP_002551476.1"
                     /db_xref="GeneID:8290263"
                     /db_xref="GOA:C5DB77"
                     /db_xref="InterPro:IPR002818"
                     /db_xref="InterPro:IPR006286"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DB77"
                     /translation="MAVKHILMIAGDFVEDYEIMVPFQILLMVGHKVDVVSPEKKAGE
                     KIATAIHDFEGHQTYTEKPGHNFMLNATYSNVQADDYDALVIPGGRAPEHLGTNESVL
                     NLVRAFANANKPIAAICHGPQLLAAANVISGRKVSAYPACRAEIIVAGAQYQAIAIDG
                     AVTDGKLVTAPAWPAHPAWMSQFLKVLGSKIEA"
     gene            complement(<21453..>21722)
                     /locus_tag="KLTH0A00264g"
                     /db_xref="GeneID:8290264"
     mRNA            complement(<21453..>21722)
                     /locus_tag="KLTH0A00264g"
                     /product="KLTH0A00264p"
                     /transcript_id="XM_002551431.1"
                     /db_xref="GeneID:8290264"
     CDS             complement(21453..21722)
                     /locus_tag="KLTH0A00264g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A00264p"
                     /protein_id="XP_002551477.1"
                     /db_xref="GeneID:8290264"
                     /db_xref="UniProtKB/TrEMBL:C5DB78"
                     /translation="MNELLYSSGKWPSPRCVFEGEQCHFIFQNIVEDPGQYDLHDKEL
                     IESAMRIYNTQFGAWWREFLETRISNITEGIKDILPRDNYRCTSL"
     repeat_region   complement(22324..22612)
                     /rpt_type=long_terminal_repeat
     gene            <23428..>25053
                     /locus_tag="KLTH0A00308g"
                     /db_xref="GeneID:8290266"
     mRNA            <23428..>25053
                     /locus_tag="KLTH0A00308g"
                     /product="KLTH0A00308p"
                     /transcript_id="XM_002551432.1"
                     /db_xref="GeneID:8290266"
     CDS             23428..25053
                     /locus_tag="KLTH0A00308g"
                     /note="weakly similar to uniprot|P53388 Saccharomyces
                     cerevisiae YPL265W Dicarboxylic amino acid permease,
                     mediates high-affinity and high-capacity transport of
                     L-glutamate and L-aspartate"
                     /codon_start=1
                     /product="KLTH0A00308p"
                     /protein_id="XP_002551478.1"
                     /db_xref="GeneID:8290266"
                     /db_xref="GOA:C5DB79"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DB79"
                     /translation="MTNEKEELPSGELKKTEAVQVCETYEADSVEPQNANEPEEGVLY
                     NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCN
                     QIAIAEVASFMPATGATIRHAEQFIDESVGFTFGWISTYSSLMPGELSATAVVMRYWT
                     DINPAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGAKQ
                     ERLGFHYWREPGPFAEYIVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH
                     AIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTGTAKSSPYVIAIQRANIKI
                     LPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFIS
                     AFLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLP
                     HSTCLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKL
                     FKKTKYLRPAEVDLESIFEDIRQNPEITLATTT"
     gene            complement(27377..27449)
                     /locus_tag="KLTH0A00330r"
                     /db_xref="GeneID:8290267"
     tRNA            complement(27377..27449)
                     /locus_tag="KLTH0A00330r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8290267"
     repeat_region   complement(27559..27975)
                     /rpt_type=long_terminal_repeat
     gene            <29810..>30532
                     /locus_tag="KLTH0A00374g"
                     /db_xref="GeneID:8290269"
     mRNA            <29810..>30532
                     /locus_tag="KLTH0A00374g"
                     /product="KLTH0A00374p"
                     /transcript_id="XM_002551433.1"
                     /db_xref="GeneID:8290269"
     CDS             29810..30532
                     /locus_tag="KLTH0A00374g"
                     /note="similar to uniprot|P36087 Saccharomyces cerevisiae
                     YKL070W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A00374p"
                     /protein_id="XP_002551479.1"
                     /db_xref="GeneID:8290269"
                     /db_xref="GOA:C5DB80"
                     /db_xref="InterPro:IPR007396"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:C5DB80"
                     /translation="MYIPKLTSVDDFDKQARTIKDHPLGILFSYSAPKIALTDFLLGD
                     KIDKPVDSEMCATHVPFFLQKSQDGSCRLVAHLAGKNQQIKLLKENPSCMVVFQGPNS
                     YVTPAWYPEKEETHKFVPTWDYSCVHVYGKAKIIEEKEWLLKMLDSLTDQEENKRPDR
                     DEFESKWKVEQTNQKYLDSLIKGIVGLEIEVSHIQSKLKVHQNQNPKNVNGVLRGYEM
                     EMGDDTAKQMCKLVRENYPREL"
     gene            complement(<34685..>35755)
                     /locus_tag="KLTH0A00418g"
                     /db_xref="GeneID:8290271"
     mRNA            complement(<34685..>35755)
                     /locus_tag="KLTH0A00418g"
                     /product="KLTH0A00418p"
                     /transcript_id="XM_002551434.1"
                     /db_xref="GeneID:8290271"
     CDS             complement(34685..35755)
                     /locus_tag="KLTH0A00418g"
                     /note="similar to uniprot|P00331 Saccharomyces cerevisiae
                     YMR303C ADH2 Glucose-repressible alcohol dehydrogenase II
                     involved in the production of certain carboxylate esters"
                     /codon_start=1
                     /product="KLTH0A00418p"
                     /protein_id="XP_002551480.1"
                     /db_xref="GeneID:8290271"
                     /db_xref="GOA:C5DB81"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DB81"
                     /translation="MTEKLPSSIPLTQRAVIFKKHSGKLELKSIEVQSPKANELLINV
                     KFSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGASVRGWKIGDYAGIKWLNS
                     CCMSCEQCELSNEPNCAYADISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLC
                     AGITVFKALKTANLTAGNWVAISGACGGLGSMAIQYAKAMGYSVVGIDSGAEKEHLFN
                     DLGGDVFLDFSKSENLVPEVVSATGGGGGAHGVLNLSASENAINTSVRFCRANGVIVL
                     VGIPSGATCVSEVFDHVVKSIKIVGSSVGNRADTREALDFYSRGLIRPAIKVAGLSQV
                     PQIFKKMDNGEIVGRCVVNTGE"
     gene            <37100..>38848
                     /locus_tag="KLTH0A00440g"
                     /db_xref="GeneID:8290272"
     mRNA            <37100..>38848
                     /locus_tag="KLTH0A00440g"
                     /product="KLTH0A00440p"
                     /transcript_id="XM_002551435.1"
                     /db_xref="GeneID:8290272"
     CDS             37100..38848
                     /locus_tag="KLTH0A00440g"
                     /note="weakly similar to uniprot|P53389 Saccharomyces
                     cerevisiae YNR055C HOL1 Putative ion transporter similar
                     to the major facilitator superfamily of transporters;
                     mutations in membrane-spanning domains permit nonselective
                     cation uptake"
                     /codon_start=1
                     /product="KLTH0A00440p"
                     /protein_id="XP_002551481.1"
                     /db_xref="GeneID:8290272"
                     /db_xref="GOA:C5DB82"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DB82"
                     /translation="MTTVIDYNVIPGDSHLVDFDETRKSGEREGKIVLNPTPSDDPDD
                     PLNWTPRRKWTAVACVLIYTLGACIPTAAIYSVLPNIEANTNITLSELNNGTGYMFLF
                     LGLGCLIFQPLALQFGKRPIYLFSMLATALICVWPPYTKSNGEWVASKILQGFVGSSM
                     ESLPEISMSDLFFEHERSFALSLYGLTLLSASFLAPFVAGFISEGQGWEWVMWWCAIF
                     GAVCFVLLFFLMEETNYDRKLKVDAATGEVITLASRKQQLGAVFTNIDEVIASNSEGN
                     NAGEKNETKTNDIGASLQTEEYPENINIVNQVSNVEVVDSNSYAPNYEGTKTYLQKLS
                     LFGGRRKKFLLQHYIFAPFLMARFPVVLWAGFLYGSSLVWFNVLNATAALILGGSPYD
                     FSSSTIGVAYLSPTIFSVILFFISGLCSDWLKVRVALWRGTGLSKPEDRLWILVIYCV
                     LGCAASILWGVGAYYEIHWFGLVFGMGLLGGCGIFGIASSATYVVDTYKELDTEAMVV
                     VIIIRNCMSFGVSYGITDWVTDLGYKKCFISVAFLCFAANFTFLAMVYFGPRLRNRQK
                     HMYWSMVDKYRKLGMH"
     gene            <40190..>41299
                     /locus_tag="KLTH0A00462g"
                     /db_xref="GeneID:8290273"
     mRNA            <40190..>41299
                     /locus_tag="KLTH0A00462g"
                     /product="KLTH0A00462p"
                     /transcript_id="XM_002551436.1"
                     /db_xref="GeneID:8290273"
     CDS             40190..41299
                     /locus_tag="KLTH0A00462g"
                     /note="some similarities with uniprot|Q04179 Saccharomyces
                     cerevisiae YDR400W URH1 uridine nucleosidase (uridine
                     ribohydrolase)"
                     /codon_start=1
                     /product="KLTH0A00462p"
                     /protein_id="XP_002551482.1"
                     /db_xref="GeneID:8290273"
                     /db_xref="InterPro:IPR001910"
                     /db_xref="InterPro:IPR023186"
                     /db_xref="UniProtKB/TrEMBL:C5DB83"
                     /translation="MKCLQTVLASAICLISKAAAEVFIVDNDTPTALQVLLPLAAGKQ
                     VLGITTNLGDYDTDAATYEAAMALSTGNLTSCVPVYKGAEQPLLLDYNTYHLWQDLYG
                     DIVWQGAWDKDYESPVPVNASYEYNKTVGAPQWIMDTVKNSKDNVTIVAAGTMTNLAL
                     ALAQWPAMAEKVKLVIMGGYVDGQIAQTTGGDFVNDMYTDFNLMVDPEAAQTALSAPW
                     KELVIVGNISSEIFPTQDLYNELIAVSGGLAEIKSNKSLGYVSETVGNGTLPSFNLPY
                     WDEVASAIAADPEIVTASYDAYVSVDTSFSSPFYGSLRIYPANLRAKKGVRTGKAKMI
                     TSIDEGKLNAMIVDALVRDWTNYCKTGSAPSVAIM"
     gene            <42443..>44149
                     /locus_tag="KLTH0A00484g"
                     /db_xref="GeneID:8290274"
     mRNA            <42443..>44149
                     /locus_tag="KLTH0A00484g"
                     /product="KLTH0A00484p"
                     /transcript_id="XM_002551437.1"
                     /db_xref="GeneID:8290274"
     CDS             42443..44149
                     /locus_tag="KLTH0A00484g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A00484p"
                     /protein_id="XP_002551483.1"
                     /db_xref="GeneID:8290274"
                     /db_xref="GOA:C5DB84"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DB84"
                     /translation="MPHRSKTACALCKAEKKCCDKKRPKCSHCTDENVACSYPLTLRW
                     GGRPYKDKTKQIKIPKNTVLVDGVLMVRDKSHLSPNRYERRSRLVLINEGPVFTKDIT
                     KGKVRKAVEGASEESSVQISNPCYFTPQGSMPSLKLLNCSLEHSTFFEFYVYKTSYHF
                     VALNKGCKSNPFHTIVPQMAMFNPSLMKLVMAFGGEHRERFRRLENPQLCYSLDEDFV
                     GKKPLTMTGQELLKQGVMELVDQLASPKTVIDDTVLASVLVLASFCIYFGTIENKWHA
                     HLYGAEGIILRELKEKSKIEKGLLRYTCEQGPYFFLRRWFAYMRIWGCISSASFRQKT
                     VERPLLEIDFEEAQDPRRHKNGDVDYALYTSGMESLVLSYLAQVANLILKSETRPPGS
                     DREYIFRDAVELEYKIMNYLGSRKQEGEASLKRFLPLTEGAPCDSTKQYSILIATNML
                     FGLTGVLQLRRRVLGLTHESLLVQNLVLKITDLIEKKLSTGTFVQPCLLFCFFSCGCE
                     LLDESLVPKRTLFLNLLDSLIRDGVESARQARSAMQECWRTSKPWWEVLKERGLDICF
                     AI"
     gene            complement(<44472..>45476)
                     /locus_tag="KLTH0A00506g"
                     /db_xref="GeneID:8290275"
     mRNA            complement(<44472..>45476)
                     /locus_tag="KLTH0A00506g"
                     /product="KLTH0A00506p"
                     /transcript_id="XM_002551438.1"
                     /db_xref="GeneID:8290275"
     CDS             complement(44472..45476)
                     /locus_tag="KLTH0A00506g"
                     /note="similar to uniprot|Q07589 Saccharomyces cerevisiae
                     YDL144C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A00506p"
                     /protein_id="XP_002551484.1"
                     /db_xref="GeneID:8290275"
                     /db_xref="GOA:C5DB85"
                     /db_xref="InterPro:IPR003710"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR013332"
                     /db_xref="InterPro:IPR013752"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DB85"
                     /translation="MPNKPNVLLVGAGGVGAMASFALEYSGESSVTSVLRSDYAHVVE
                     NGFKINSCDYGRGIRYRPSNVVNSIEASKQYGPFDYVVLATKCIPGVSSMIDIIAPAV
                     SKDTAIVLIQNGIGIEDEALFKCPGNVILSGVSMIASSNVKGHIEHSDRDFLSVGYFE
                     NVNLTNEHQEKVCKRFVSMYKNDKNQCVFDENVKYSRWRKLVYNACLNPVCALTEADV
                     GRLEIFGGTDSIIRKAMKEVIAIAKSDGVELSEALMDFMIRSKDPVYYRPSMLVDIDK
                     GNPLEVEVICGNPVRIAKKNGVEAPYLTLIYDLLKVVQGRIMEKRGMLIVPKERQVPK
                     "
     gene            complement(<46253..>47173)
                     /locus_tag="KLTH0A00528g"
                     /db_xref="GeneID:8290276"
     mRNA            complement(<46253..>47173)
                     /locus_tag="KLTH0A00528g"
                     /product="KLTH0A00528p"
                     /transcript_id="XM_002551439.1"
                     /db_xref="GeneID:8290276"
     CDS             complement(46253..47173)
                     /locus_tag="KLTH0A00528g"
                     /note="similar to uniprot|P14065 Saccharomyces cerevisiae
                     YOR120W GCY1 Putative NADP() coupled glycerol
                     dehydrogenase proposed to be involved in an alternative
                     pathway for glycerol catabolism"
                     /codon_start=1
                     /product="KLTH0A00528p"
                     /protein_id="XP_002551485.1"
                     /db_xref="GeneID:8290276"
                     /db_xref="GOA:C5DB86"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DB86"
                     /translation="MATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHI
                     DTAAIYRNEAAVGRAIRDSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDL
                     YLMHFPVALKTDLIKDGNVLSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAI
                     GVSNFSIKNIEEILKPELGLSVPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGS
                     SESSMLTDPDLIKLAEKHQVEPAQILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSS
                     NDVQQISKILEKLGSKRYVSPSWAPFPMYE"
     gene            complement(<49572..>53438)
                     /locus_tag="KLTH0A00550g"
                     /db_xref="GeneID:8290277"
     mRNA            complement(<49572..>53438)
                     /locus_tag="KLTH0A00550g"
                     /product="KLTH0A00550p"
                     /transcript_id="XM_002551440.1"
                     /db_xref="GeneID:8290277"
     CDS             complement(49572..53438)
                     /locus_tag="KLTH0A00550g"
                     /note="some similarities with uniprot|P08640 Saccharomyces
                     cerevisiae YIR019C MUC1 GPI-anchored cell surface
                     glycoprotein required for diploid pseudohyphal formation
                     and haploid invasive growth transcriptionally regulated by
                     the MAPK pathway (via Ste12p and Tec1p) and the cAMP
                     pathway (via Flo8p)"
                     /codon_start=1
                     /product="KLTH0A00550p"
                     /protein_id="XP_002551486.1"
                     /db_xref="GeneID:8290277"
                     /db_xref="InterPro:IPR018789"
                     /db_xref="UniProtKB/TrEMBL:C5DB87"
                     /translation="MRCIWALSALTALTSTAVGSPLQKRCSNPRQNTGPKESQATCTE
                     ITNGCPNLDFTWKPKNTGQMLYDISMKKVQWVKDNIYEITVHVQGEKNIAISCIDGLK
                     VIGINGPDGGTFWLYDRNNNIAKVDSPTDYDATFRVYGQEDTSNCRVWMPNFQIQYDY
                     NNQCDVYGNSKSFGLITGCNNYDNQGHSKTDAPGFYWSYQCSGKSSCGASSASSVFST
                     TQLTSATSKTCTKNKPTTTSCTKNKPTTTSCTKSKTQTTSESSSTETTETYTKPSCTK
                     SKTQTTPETPSTETTETHTKPSCTKSKFSKTSCTKSKTQTTPETPSTETTETHTKPSC
                     TKSKFSKTSCTKSKTQTTPETPSTETTETHTKPSCTKSKFSKTSCTKKSKSTTPLTPS
                     TAPGTTVPSTTYYPSSSAPVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVSETTTPET
                     PVGPSTAPGTTIPGTRSCSTSPGTTVPGTTYYPSSSSSGFGNSSVPVTSAPSSSAPVS
                     EFSSTPVSSAPSSSAPVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVSETSSTPETTA
                     PSSSAPVSEFSSTPVSSAPSSSAPVSEFSSTPVSSAPSSSAPVSEFSSTPVSSAPSSS
                     APVSESSSTCQTVVTSTVSGSTTVYTTTCSTPVSETSSTPVSSAPSSSAPVSSVPHST
                     PYYHNTTTAAGTGSTSYPVSLSSTPVTSGSGTPATSGSVPATSGSVPATSGTPATSGS
                     VPATSETTPATSGTPATSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPAT
                     SGSVPATSGTPATSGSVPATSETTPATSGSIPATSGTPATSGSVPATSETTPATSGTP
                     ATSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPATSGTPATSGSVPATSE
                     TTPATSGSVPATSGTPATSGSVPATSETTPATSGSVPATSGTPATSGSVPATSETTPA
                     TSGTPATSGSVPATSGSIPTTSTCQTIVKSAVSGTTTIFTTTCPESTLPTTTGPAQTE
                     SVVTVTESGTVTSYTTTCPITEVEPTTTGPDNAKTVLVSSVSGTVTSYTTTLPASESQ
                     PATTAPASSESVVVSSASGTVTSYTTTLPASESQPATTAPASSESVVVSSASGTPVTE
                     SIVTDTVSGTTTIYTTTCPVSSAVETTSPGPANSEIVTTSTISGTETVYTTTAPLSSA
                     QKTEAASPSGSQTKSVESSPAYSGSYTTPGASGSYVTQTPSSSLEVQSSSSVAAVSTT
                     AGVSTFEGAANKLRAGLLLAIPLALL"
     gene            complement(<56698..>58713)
                     /locus_tag="KLTH0A00572g"
                     /db_xref="GeneID:8290278"
     mRNA            complement(<56698..>58713)
                     /locus_tag="KLTH0A00572g"
                     /product="KLTH0A00572p"
                     /transcript_id="XM_002551441.1"
                     /db_xref="GeneID:8290278"
     CDS             complement(56698..58713)
                     /locus_tag="KLTH0A00572g"
                     /note="weakly similar to uniprot|Q08905 Saccharomyces
                     cerevisiae YOR381W FRE3 Ferric reductase reduces
                     siderophore-bound iron prior to uptake by transporters
                     expression induced by low iron levels"
                     /codon_start=1
                     /product="KLTH0A00572p"
                     /protein_id="XP_002551487.1"
                     /db_xref="GeneID:8290278"
                     /db_xref="GOA:C5DB88"
                     /db_xref="InterPro:IPR013112"
                     /db_xref="InterPro:IPR013121"
                     /db_xref="InterPro:IPR013130"
                     /db_xref="UniProtKB/TrEMBL:C5DB88"
                     /translation="MSNALRAVALSFHSRPLPESLQLMITCVSEVNRYAWLWNGDEGG
                     PFYGKACGQYAPSMQTALQCFVTYGAEGSVEEKLAPFTKYCSLFAGSQLTLEDYAAAL
                     ENGTRFLRDGASVGYGQPLATPIVLPERTMLANLKYFHYIYYNFSAAFSFSLLINLAV
                     AAAVVIAAVAKHSRANDKVTRFVRAKLLVPSIFGTAHHGETRTLPFYRVLLPTRGEAV
                     LLAAFLALNVALACYNYPLVSTGFDTKAMFLLKCVANRTGGLGFGLIPLTVLLAGRNN
                     ALQWLTGMPFSSMMFFHKWASRTMALHSLAHALLWFVYGIYGQPEPVASMFYDFAYWR
                     WGIYATLACAALLVHSAHSIKARWYEVFVVLHVTLALLFLVACLKHCAEFGWLGWIYL
                     ALGIWGSDRALRLWRLFFRFGGYTHGYAHVISAEDHIYKIVVPHVDFSRFRFFPGCYA
                     FLHVQGRRWFWQSHPFTLMRAGEGLEILLKAKEGLTRDLLRALPRDGAKVPLRLALEG
                     PYGHEAPLQTYRNVLVVSSGAGIPGPMSYLQKLTLAPGHVRRFAFVWAVPTEGLLESM
                     HGSLLAAAEHVRAAAATTCFELRIHVTRPRPGAQRPAWVPAEFVVSYGRPRVHEIVRR
                     FCDAADGPIAVTSCANPALDDLVRRYVSEQIARSAHRVDYYDELQVW"
     gene            complement(<59312..>60421)
                     /locus_tag="KLTH0A00594g"
                     /db_xref="GeneID:8290279"
     mRNA            complement(<59312..>60421)
                     /locus_tag="KLTH0A00594g"
                     /product="KLTH0A00594p"
                     /transcript_id="XM_002551442.1"
                     /db_xref="GeneID:8290279"
     CDS             complement(59312..60421)
                     /locus_tag="KLTH0A00594g"
                     /note="similar to uniprot|P07257 Saccharomyces cerevisiae
                     YPR191W QCR2 40 kDa ubiquinol cytochrome-c reductase core
                     protein 2"
                     /codon_start=1
                     /product="KLTH0A00594p"
                     /protein_id="XP_002551488.1"
                     /db_xref="GeneID:8290279"
                     /db_xref="GOA:C5DB89"
                     /db_xref="InterPro:IPR007863"
                     /db_xref="InterPro:IPR011237"
                     /db_xref="InterPro:IPR011249"
                     /db_xref="InterPro:IPR011765"
                     /db_xref="UniProtKB/TrEMBL:C5DB89"
                     /translation="MIGSRTRMAGARQLARHYHISAKDSASKVSTLAVRVHAGARYAP
                     KEGLAHLLSRFNFHNTGNKSALRLVRESELLGGRFESTVDREYITLKATFLKEDLPYY
                     VSALGDVVYKTSYRPHELPESVLPAAHHDLAVAQACPVKSAENLLYSTVFRSDLGNAV
                     LYDAVQKVSLDDIKAYADKVYTRDNIEIAGQGVNESDLKRFVNDSLFASLPQGTSLAK
                     EATPKTFVGETRLRSAEGDSVAAIAVPVAKADFATYQVLATYLTSALSDLSPLVTKAK
                     LDQYSNAGLFSLYVKGSDAAVVSENIKKVVATLKTGKDISAAKGAAALQLALHNETAA
                     FPVQLSLDNVKDFKLGKFSYAAVGDVAKLPFADEL"
     gene            <61421..>63292
                     /locus_tag="KLTH0A00616g"
                     /db_xref="GeneID:8290280"
     mRNA            <61421..>63292
                     /locus_tag="KLTH0A00616g"
                     /product="KLTH0A00616p"
                     /transcript_id="XM_002551443.1"
                     /db_xref="GeneID:8290280"
     CDS             61421..63292
                     /locus_tag="KLTH0A00616g"
                     /note="similar to uniprot|P32349 Saccharomyces cerevisiae
                     YPR190C RPC82 RNA polymerase III subunit C82"
                     /codon_start=1
                     /product="KLTH0A00616p"
                     /protein_id="XP_002551489.1"
                     /db_xref="GeneID:8290280"
                     /db_xref="GOA:C5DB90"
                     /db_xref="InterPro:IPR008806"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR013197"
                     /db_xref="UniProtKB/TrEMBL:C5DB90"
                     /translation="MATNSASPESLDDKEVINGSVASLEARGLNPESFLYRELCKTHL
                     GERAAAVMNMLVSKGRLSARELCDRLDMDLKSVKRILVSLVQLRCVQYCAETSVSGRT
                     TVYYSYCEDGLLLMLYAGEIVEAMQVHFQSDLAAQIVQNVLALGSLTLKAYLSSGLSE
                     VSPSEVSAYFLRLFEAGFLVPLTANDYCPVSELWTRLYKKEYDLIPKNSTLSDLKKRT
                     EAKQKAKKQFYQLVGPPDASSFIVTDPRTSLRQVADSVPLTFSLGRYLKLKRSKQLVQ
                     FSAAKVGKVPAALYKIALRMTERSSPEITDPLTKTGLLQDADELAATQDEAARAEEKN
                     PGVTFNAMDISKHLSDDIDLRGTIASQMKRQRPSSAEVQSHKRVKTEDGFVVPPPPAN
                     NGAEADEMADDNIDLDLDDSDTDPHSVTLINGHLKLLASSTVSFLQEPQPGLYYVPYT
                     RLMPLLKSSVYEALLSYTLGGSACRILRCIRDNNLATEKLINSTALMREKDIRSVIAT
                     LIRYNAVEIQEVPRTADRAASRSVFLFRNNPRHAYDFMTKNLTWNIANLYHKIEDLKS
                     ENSTLLQKANREDVKGKETELLLPSELNQLKMVNERELNALTRTQRLLLLWEVFRFF"
     gene            complement(<63363..>67598)
                     /locus_tag="KLTH0A00638g"
                     /db_xref="GeneID:8290281"
     mRNA            complement(<63363..>67598)
                     /locus_tag="KLTH0A00638g"
                     /product="KLTH0A00638p"
                     /transcript_id="XM_002551444.1"
                     /db_xref="GeneID:8290281"
     CDS             complement(63363..67598)
                     /locus_tag="KLTH0A00638g"
                     /note="similar to uniprot|P17883 Saccharomyces cerevisiae
                     YPR189W SKI3 dsRNA virus protection family member contains
                     8 copies of the tetratricopeptide (TPR) domain"
                     /codon_start=1
                     /product="KLTH0A00638p"
                     /protein_id="XP_002551490.1"
                     /db_xref="GeneID:8290281"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DB91"
                     /translation="MAELKQLLKDAKNALASEDYEQSIEKSKEVLNLDKNNYFAHVFL
                     GKAFSCTGDLAQSKKHYKAAIDMDPGNMLAWKGIFMLFRTANIAPTIVSFDEFFDLCG
                     EYAEHLVQQQLPMVDLVNDIRNFKNFYRDCQESYLRHMRPGTPMAERLSRHLITPQDA
                     LQGLLNIVSAEEQQQVSKLVSRERLKISANQPDYNLKVNSIAWQVYQDSEIDELYQQL
                     INITDDDEKRRGLESKWLEYRIRVLKSMPADIKHHFFTKVRNMVEDMVVVDHDFLLAW
                     QLYFEWQDYSDLDCMDVNVISKFLKKFPKEPLAAVLYAWVCSEQSSYNSKEFYEKTFQ
                     GEDTDNSGTSSVDSINDVVEDGMDESEKRRLQQLVDPSMEEATFGLSEDEVLLSLTEN
                     IKKTQQSIVAHRIVSHYYVSTREYESALHYTKAGIVLCAQSVKNMGAHLSNSKRELTL
                     DLATTYTYFEAPKNHPTALALFEKLLTENSDNVHAKMGKGLIAIERRNWQEAYELLKE
                     VTERYPDNYEVLSEFAWSELHLDAPDAAIERFKYILNNVEGSDLKVLEFRSLNHWRMA
                     KGYVYKQHGEINAGESSEKEYIKLAFKQLVQAVKTSENFAPGYSTLGDIYSEYYQDPT
                     RAFKCYFKSFEMDPSDLTAARYMCEKYCGSCDWQSASLIAERVVKAEKSKSILQNVNW
                     PYRVLGIAHLEKQAESESIEWFQSALRVEPADLESWLGLGQAYYSCGRVEASVKVFEK
                     ALEVSPGNAYAHYFKALSLSKMGLYDESIEIFRELTAEHPDEESYQVSMVEVLVEHCN
                     VLCSQGFLTRSVAAAADAIRKIESIVLHIDYKIHGMWLSLSNALRVICLVQSQVHLLP
                     LESLVNIFEVAELRNTDEIDKIDHVTLSGLLSDLEQDNVAIAAQFLVLSGKHAIACSD
                     YASLPRTVRASLWYNLGIVELMAFVILKSNSHRDAAIESFKKSIEYQSNTAEAWIGFG
                     IASIDLNVRVAQHCFIKATALNPRETSVWYDMAILALRYNDVAFARAVLMKSQSIAPQ
                     DSTPWFGLALASEKEGLTQDSARLFAHSFVLSNGKSKGAQLLYAKSVLKTRIGSGDDE
                     RDIGPGQELSAVAYGLDDYLKKNPDDKFALQCAILTLERLRNYAAARKLSDRLLDILE
                     KRFEKAQDDSELFHFAIVKSQLARVYLGLKDYETAIESADLSLGILAEHNNEVAEKCI
                     TSNHAVMGLASFFLDDFDQTLEHFKVLLDRPGESKQLVILVAKILYNVESEETREVAL
                     KELVDYINSNGPDLTVTLTIAVISLLEGIPDDMRAILSELKSLPLSDMISDRHRDIPF
                     LIQQLNTKLSQDCESQQQWQRTAFFFPNDSGSWGSLDKKIRARIAAGGQNKVPARKMS
                     EFYSSLGNLSKIQRSIFLCPWNKEALSSLKGCF"
     gene            complement(<68319..>68867)
                     /locus_tag="KLTH0A00660g"
                     /db_xref="GeneID:8290282"
     mRNA            complement(join(<68319..68766,68848..>68867))
                     /locus_tag="KLTH0A00660g"
                     /product="KLTH0A00660p"
                     /transcript_id="XM_002551445.1"
                     /db_xref="GeneID:8290282"
     CDS             complement(join(68319..68766,68848..68867))
                     /locus_tag="KLTH0A00660g"
                     /note="highly similar to uniprot|P20435 Saccharomyces
                     cerevisiae YPR187W RPO26 RNA polymerase subunit ABC23,
                     common to RNA polymerases I, II, and III; part of central
                     core; similar to bacterial omega subunit"
                     /codon_start=1
                     /product="KLTH0A00660p"
                     /protein_id="XP_002551491.1"
                     /db_xref="GeneID:8290282"
                     /db_xref="GOA:C5DB92"
                     /db_xref="InterPro:IPR006110"
                     /db_xref="InterPro:IPR006111"
                     /db_xref="InterPro:IPR012293"
                     /db_xref="InterPro:IPR020708"
                     /db_xref="InterPro:IPR028363"
                     /db_xref="UniProtKB/TrEMBL:C5DB92"
                     /translation="MSDYEEAFNDGPENFEDFDNEHFSDAEVYDAPEEFKDGETKDES
                     GKTIITGGTGAEDFQQHESNRKRTLKEKAIPKDERTTTPYMTKYERARILGTRALQIS
                     MNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL"
     gene            <69084..>70385
                     /locus_tag="KLTH0A00682g"
                     /db_xref="GeneID:8290283"
     mRNA            <69084..>70385
                     /locus_tag="KLTH0A00682g"
                     /product="KLTH0A00682p"
                     /transcript_id="XM_002551446.1"
                     /db_xref="GeneID:8290283"
     CDS             69084..70385
                     /locus_tag="KLTH0A00682g"
                     /note="similar to uniprot|P39933 Saccharomyces cerevisiae
                     YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
                     putative Zn-fingers"
                     /codon_start=1
                     /product="KLTH0A00682p"
                     /protein_id="XP_002551492.1"
                     /db_xref="GeneID:8290283"
                     /db_xref="GOA:C5DB93"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR013087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="UniProtKB/TrEMBL:C5DB93"
                     /translation="MEESEDHSNFWDVGKLGSEDGLPLVRSDSVGSIQSISSAGSTSS
                     SRAKTWVCEYEGCSKAFTRPSQLTEHQETVHQGLKPFTCTECGRQFTRKTHLERHMFT
                     HTAEKPFHCSHCGKGVTTRQQLRRHEITHTRSFVCPHEGCGESFYKHPQLRSHVLAVH
                     LQKLNCEFCGKKFQRPYRLKNHIAKHHNPDTVYKYQCSHGSCVEAFKTWTALQQHVKE
                     AHPKLQCPTCGKACVGEQGLQMHMRVHSSMTVIKNWKCESCPDLYFAKKADLVSHCLE
                     HHKDLVSTLLNDNEREPAEPSATASPNNIPLESGARPSRLRSSSTKHDSESELESIQT
                     EVKLRKYFDSGKSSVSLLLNSAGRKLKCPYLGCYRSFKTEEKYEMHIQKHKIHQLKLK
                     ILQEKNQATSLASEENELESNMERKNGNSQDLESLSAAANR"
     gene            complement(<70544..>72592)
                     /locus_tag="KLTH0A00704g"
                     /db_xref="GeneID:8290284"
     mRNA            complement(<70544..>72592)
                     /locus_tag="KLTH0A00704g"
                     /product="KLTH0A00704p"
                     /transcript_id="XM_002551447.1"
                     /db_xref="GeneID:8290284"
     CDS             complement(70544..72592)
                     /locus_tag="KLTH0A00704g"
                     /note="some similarities with uniprot|Q06628 Saccharomyces
                     cerevisiae YPR185W ATG13 Phosphorylated protein that
                     interacts with Vac8p required for the cytoplasm-to-vacuole
                     targeting (Cvt) pathway and autophagy"
                     /codon_start=1
                     /product="KLTH0A00704p"
                     /protein_id="XP_002551493.1"
                     /db_xref="GeneID:8290284"
                     /db_xref="GOA:C5DB94"
                     /db_xref="InterPro:IPR018731"
                     /db_xref="PDB:4J2G"
                     /db_xref="PDB:4P1W"
                     /db_xref="UniProtKB/TrEMBL:C5DB94"
                     /translation="MTTSLDKQLWELIDNFFLKAALLICHSKGWKGAPAADEGPPTTN
                     SWFNIETFGDTKLERELKPWTTFDGSESLPPLVIETYLDLARLSPSQQVTLKDQDGNP
                     WNVCKGTKKSEIMLERWLIQLDNGEDSPSLQSSGSEDTDDNVSELYRQLVLLFRYLET
                     LVGLLPASELQARLIRPGVSPEAPPPVKLGTRILDGSKPIVSKGRIGLSKSLIATYSN
                     VINETNLPAHLEQRKITPIRTKFGSLRISVSYRKDCDFHVNGSEEYNTQFNQETRSRS
                     AAPVATPSLRRVSMNSNRSMSISPNTTISPSPLAEPSPQKRGTVLARQLQPFKAGSVG
                     SGSLPQVQQGSLSRNPSATSVAAALRAQRPSNGSITAPTSQLHESHLEPSSIGSGSLS
                     KYSSSFGRLRRQSSVRRSDSVERSQKPSKLNESPSGDLLDFMKLLDDRKELKLKNKGT
                     KVDISNSLLKFQGMRTTNNNLSTDLSMSMSLERPSVSQPRNRSNSHSPNSSFSPSIQY
                     SSIPMRLSQSRSDSYRPEILGELSSARGSTERPKSIISNLNESFYDGRRLGGRTSSNE
                     GYAEDEEDEEDEEDLLVGRSAMNPASTNFRNRSTSPGSVRSVSSSFSKSQLPFKSLSN
                     FSGPTTMATPAHAKLHKAIVGNSPETNVSDALPKKDDSLNQEEDDDLLFFMSDMNLSK
                     "
     gene            complement(<72979..>77517)
                     /locus_tag="KLTH0A00726g"
                     /db_xref="GeneID:8290285"
     mRNA            complement(<72979..>77517)
                     /locus_tag="KLTH0A00726g"
                     /product="KLTH0A00726p"
                     /transcript_id="XM_002551448.1"
                     /db_xref="GeneID:8290285"
     CDS             complement(72979..77517)
                     /locus_tag="KLTH0A00726g"
                     /note="highly similar to uniprot|O93808 Saccharomyces
                     cerevisiae YPR184W GDB1 Glycogen debranching enzyme
                     containing glucanotranferase and alpha-1
                     6-amyloglucosidase activities required for glycogen
                     degradation"
                     /codon_start=1
                     /product="KLTH0A00726p"
                     /protein_id="XP_002551494.1"
                     /db_xref="GeneID:8290285"
                     /db_xref="GOA:C5DB95"
                     /db_xref="InterPro:IPR006421"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR010401"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="InterPro:IPR029436"
                     /db_xref="UniProtKB/TrEMBL:C5DB95"
                     /translation="MERQLLLRVSGKGEPVVSCSYGQGVLTLPSLPVYDGYDESSPLF
                     TVKLVIPGGSPVARDGLVWTNCPVDAKTPFVRDKFNKKEIKATFHQDHHVELPVFRPG
                     PFCFYFSFRNDRDELETTRRFYFVVPPSLYIDDRYIPLNSLTMQSVVSKWMGSDWDKI
                     FGKIASKGYNLIHFTPLQKRGDSNSPYSIYDQLEFDPAFFPNNIDDVSKMVLKLHKEH
                     GILAMTDVVLNHTANNSPWLREHPDSGYNHKTAPHLISAMELDKQLLEFSGKLRQLGY
                     PTELNSTHDLFKIMDGIKIHVLGSLKLWEYYVIDANQALDMVKNDWRQASHDQVEIPD
                     SAKNDLVELANFIRDSASCENFGHLGERFSNRLEGSKFVAILKTLYGFELNDAVLEEA
                     QKIVDEINLPLYREYDEDIGDILEQLFNRIKYLRVDDHGPKLGPVTDKSPLTEPYFTR
                     FNGSDGEEYALANNGWIWNGNPLVDFASSQSKAYLRREVIVWGDCVKLRYGAKPEDSP
                     FLWKKMSEYIETCAKLFDGFRIDNCHSTPLHVGEYYLDLARRHKPNLYVAAELFSGSE
                     AMDCLFVERLGTSSLIREAMQAWSEEELSRLVHRHGGRPIGSYKFMPLDDFAYPTNRQ
                     VEEFHIHNAKRVSEVNIPKNLTATPPHALFMDCTHDNETPFQKRTLEDTLPNAALVSF
                     CSSAIGSVYGYDECFPYLLDVVGEARTYDVTANDGISVARAQLHKIRDEIAQGSADIE
                     DSEMHVHHEGQYITFQRNNAKNGSGWFLVARTKFGEKGEQKLPKIKFTGSRCEFSFAY
                     SLLKAGGVPEDKNIIKGIPSKLEELSGFKVDYNEDLGESTIEITDSFPQGSIAVFKTQ
                     QNGIDETLLKFLTTGALKASEQLNLYSLNGLLYRCDAEERDISAGSSGVYDVPDFGRL
                     TYCGLQGWVSVLRKIIFSNDLAHPMSNHLRSGHWALDYVVQRLENYKEQPGISEMQAW
                     LASRFDRVKKLPSFLVPTYFALVIGIAYQCCRFRAIQNMPENVGSSTRFVQSLALTSV
                     QMLSEMRSTSLIPEKNVPCMAAGLPHFSTDYMRCWGRDVFISLRGLLLTTARFDDAKQ
                     HILAFARTLKHGLIPNLLDAGRNPRYNARDATWLFIQSIQDYVKMAPDGESILREKIP
                     RRFPLDDTYITVDDPRAFSYETSIEDIIFEILSRHAKGISYREANAGPQLDRVMSDRG
                     FDVKIHVDWSTGLIHGGSQYNCGTWMDKMGESEKAGSFGVPGTPRDGAAVEISGLLKS
                     ALRFVLELHEKKLFKYTKVEKEDGSQVTFKEWNNLVQENFEAKYFVPSDPSKDSEYDI
                     DETLVNRRGIYKDLYKAGKPYEDYQLRPNFAIAMTVAPELFTPELALQALDNADRIIR
                     GPVGMRTLDPSDYNYRPNYNNGEDSADFATSKGRNYHQGPEWVWCYGYFMRAFYRFHL
                     AADARCQSKGSSKPSSYLYQQLYNRFEGQRNFIYGSPWAGLTELTNKDGALCSDSSPT
                     QAWSSATTLDFFYDLWEH"
     gene            complement(<78506..>79303)
                     /locus_tag="KLTH0A00748g"
                     /db_xref="GeneID:8290286"
     mRNA            complement(<78506..>79303)
                     /locus_tag="KLTH0A00748g"
                     /product="KLTH0A00748p"
                     /transcript_id="XM_002551449.1"
                     /db_xref="GeneID:8290286"
     CDS             complement(78506..79303)
                     /locus_tag="KLTH0A00748g"
                     /note="highly similar to uniprot|P14020 Saccharomyces
                     cerevisiae YPR183W DPM1 Dolichol phosphate mannose
                     (Dol-P-Man) synthase of the ER membrane catalyzes the
                     formation of Dol-P-Man from Dol-P and GDP-Man required for
                     glycosyl phosphatidylinositol membrane anchoring O
                     mannosylation and protein glycosylation"
                     /codon_start=1
                     /product="KLTH0A00748p"
                     /protein_id="XP_002551495.1"
                     /db_xref="GeneID:8290286"
                     /db_xref="GOA:C5DB96"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DB96"
                     /translation="MAIENSVIVPAYHERLNIKPLTTRLFAALGNDGSKTTELIFVDD
                     NSKDGSVEEVDALQKQGYNVRIIVRTDERGLSSAVLKGFHGAQGQYLICMDADLQHPP
                     ESVPQLFDVLRNHAFVLGTRYAPGVGIDKDWPLYRRVISSGARMMARPLTTASDPMSG
                     FFGLQKKYLLNSDAKEINAQGFKIALDLLVKLPLPRQNAIGEVPFSFGVRTEGESKLS
                     GKVIVQYLQQLQELYVYKFGANNLVLFLFFWTILALYAFYKLMSLVF"
     gene            complement(<80170..>80515)
                     /locus_tag="KLTH0A00770g"
                     /db_xref="GeneID:8290287"
     mRNA            complement(join(<80170..80442,80507..>80515))
                     /locus_tag="KLTH0A00770g"
                     /product="KLTH0A00770p"
                     /transcript_id="XM_002551450.1"
                     /db_xref="GeneID:8290287"
     CDS             complement(join(80170..80442,80507..80515))
                     /locus_tag="KLTH0A00770g"
                     /note="similar to uniprot|P54999 Saccharomyces cerevisiae
                     YPR182W SMX3 Sm or Sm-like snRNP protein"
                     /codon_start=1
                     /product="KLTH0A00770p"
                     /protein_id="XP_002551496.1"
                     /db_xref="GeneID:8290287"
                     /db_xref="GOA:C5DB97"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR016487"
                     /db_xref="UniProtKB/TrEMBL:C5DB97"
                     /translation="MSELAPTNPKPFLRELINKPIVVTLKFNKTQYKGLLVSTDNYFN
                     LQLTEAEEFIEGQSKGKIGDIFIRCNNVLWIGEDLQKKEEEPQTLDQQS"
     gene            complement(<80668..>81840)
                     /locus_tag="KLTH0A00792g"
                     /db_xref="GeneID:8290288"
     mRNA            complement(<80668..>81840)
                     /locus_tag="KLTH0A00792g"
                     /product="KLTH0A00792p"
                     /transcript_id="XM_002551451.1"
                     /db_xref="GeneID:8290288"
     CDS             complement(80668..81840)
                     /locus_tag="KLTH0A00792g"
                     /note="similar to uniprot|P41733 Saccharomyces cerevisiae
                     YLR459W GAB1 GPI transamidase subunit involved in
                     attachment of glycosylphosphatidylinositol (GPI) anchors
                     to proteins may have a role in recognition of the
                     attachment signal or of the lipid portion of GPI"
                     /codon_start=1
                     /product="KLTH0A00792p"
                     /protein_id="XP_002551497.1"
                     /db_xref="GeneID:8290288"
                     /db_xref="GOA:C5DB98"
                     /db_xref="InterPro:IPR009600"
                     /db_xref="UniProtKB/TrEMBL:C5DB98"
                     /translation="MNLRELQVVFACLASRFGAAAVFPLLQQQLDRSVEFSTPVTSFR
                     SLQEGVFLLQNDFPLYSGGVMHHAPLLVALMSTFNSNTLISLLFTCADSAIAYQLIAM
                     AKCFQNLHLPAWVPGALYVINPLVLLSSVSRSTVVFSNLAISTALLSALQGKAVLSAA
                     SIAVAAYLSLYPLLLLVPILTLLPKDRFKTVAITFTTLAGLLLSSYKINDENWNYLFS
                     TYGVIITFSKIIPNLGLWWYFFVELFEMFIPFFKAVFNLFIVSCIIPFSLRFHKQPFY
                     AFILCLCWITLTKSYPTLGEGGFLLSFVPFFRPLFGYFRYSVISTLLFIHVSVLSPVF
                     YHLWVDLGSGNSNFFYAISLVYALGLATVLVDLVWAMLRIEYDKGKPNLNLKLTPI"
     gene            <84356..>86656
                     /locus_tag="KLTH0A00814g"
                     /db_xref="GeneID:8290289"
     mRNA            <84356..>86656
                     /locus_tag="KLTH0A00814g"
                     /product="KLTH0A00814p"
                     /transcript_id="XM_002551452.1"
                     /db_xref="GeneID:8290289"
     CDS             84356..86656
                     /locus_tag="KLTH0A00814g"
                     /note="highly similar to uniprot|P15303 Saccharomyces
                     cerevisiae YPR181C SEC23 cytoplasmic GTPase-activating
                     protein"
                     /codon_start=1
                     /product="KLTH0A00814p"
                     /protein_id="XP_002551498.1"
                     /db_xref="GeneID:8290289"
                     /db_xref="GOA:C5DB99"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR006895"
                     /db_xref="InterPro:IPR006896"
                     /db_xref="InterPro:IPR006900"
                     /db_xref="InterPro:IPR007123"
                     /db_xref="InterPro:IPR012990"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DB99"
                     /translation="MDFETNEDINGIRFSWNVFPSSRTDANKNVVPVGCLYTPLKSKE
                     DLMVMSYNPVVCGGPQCKAVLNPYCEIDLRSNAWACPICNSRNHLPAHYANMSQENMP
                     AELSNTTIEYITNRPVQVPPVFLFVVDITAEEENLQALKESIIASLSLLPPNALVGLI
                     TYGNVVHLHDLSCDTIDKCNVFRGDREYQLLQLIEMLTGEKSGVAGAAGGAVGANAAL
                     NKITPFSLNRFFLPLEQVEFKLTQLLENLSPDQWSIPAGHRPLRATGSALNIATLVLQ
                     GCYKNVASRIILFASGPGTLAPGLIVSSELKDPLRSHHDIDSDNAKHYKKASKFYSML
                     ADRIAQNGHTVDIFAGCYDQVGMSEMKYLTDTTGGVLLLTDAFSTSIFKQSFLRLFSS
                     DDEGYLTMAFNGNMSVKTSRDLKVQGLIGHASPVKKTDATNISDSEIGVGGTSTWKMS
                     SITPNHSYAVFFEIANNAAASAGVVGGDRPKLAYTQFVTSYQHASGTNRVRVTTVANQ
                     LLPFGSPAIAASFDQEAAAVLMARIAVHKAESDDGADVIRWIDRTLIKLCQKYADYNK
                     DDPRSFRLAPNFSLYPQFTYYLRRSQFLSVFNNSPDETAFYRHIFTREDTTNSLIMIQ
                     PTLTAFFMEEEPQPVLLDSVSVKPNTILLLDTFFYILIYHGEQIAQWRKAGYQDDPQY
                     ADFKSLLEEPKLEAAELLVDRFPLPRFIDTEAGGSQARFLLSKLNPSDSYQDQSAGGS
                     TIVLTDDVSLQNFMLHLQEVTVSGQT"
     gene            complement(<86917..>87879)
                     /locus_tag="KLTH0A00836g"
                     /db_xref="GeneID:8290290"
     mRNA            complement(<86917..>87879)
                     /locus_tag="KLTH0A00836g"
                     /product="KLTH0A00836p"
                     /transcript_id="XM_002551453.1"
                     /db_xref="GeneID:8290290"
     CDS             complement(86917..87879)
                     /locus_tag="KLTH0A00836g"
                     /note="similar to uniprot|Q06624 Saccharomyces cerevisiae
                     YPR180W AOS1 Nuclear protein that acts as a heterodimer
                     with Uba2p to activate Smt3p (SUMO) before its conjugation
                     to proteins (sumoylation) which may play a role in protein
                     targeting essential for viability"
                     /codon_start=1
                     /product="KLTH0A00836p"
                     /protein_id="XP_002551499.1"
                     /db_xref="GeneID:8290290"
                     /db_xref="GOA:C5DBA0"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DBA0"
                     /translation="MAAQARMRSAKVLLINLGGLGTEIAKNLVLSGVGFLSLVDNHDV
                     SEGDLSTQFFLSKDEIGTKRLDSAISRIQDMNPRVTLTVDTEDFRQKPDSFYGQFDLI
                     IATDVSTEEAIRVNQLTRKFNVPFFLCGLNGLSGFIFVDLIRFDATDEKLKSSVKTPL
                     GALSQNREVVEVTEYLNEEQSEVYERIVTRNAYKPFEQVLKEGTLKGKLTKRQVKRLT
                     NAVPLTFALFSYRDGYAAVTRHDLEQRATDACVQLGLPSENLKQEYVEQFSQQAGLEF
                     APVSAVIGGTVAQDVINILGKKQSPLNNFIVLDGISLDMHIFEL"
     gene            <88180..>90123
                     /locus_tag="KLTH0A00858g"
                     /db_xref="GeneID:8290291"
     mRNA            <88180..>90123
                     /locus_tag="KLTH0A00858g"
                     /product="KLTH0A00858p"
                     /transcript_id="XM_002551454.1"
                     /db_xref="GeneID:8290291"
     CDS             88180..90123
                     /locus_tag="KLTH0A00858g"
                     /note="similar to uniprot|Q06623 Saccharomyces cerevisiae
                     YPR179C"
                     /codon_start=1
                     /product="KLTH0A00858p"
                     /protein_id="XP_002551500.1"
                     /db_xref="GeneID:8290291"
                     /db_xref="GOA:C5DBA1"
                     /db_xref="InterPro:IPR021006"
                     /db_xref="InterPro:IPR026216"
                     /db_xref="UniProtKB/TrEMBL:C5DBA1"
                     /translation="MDLAKILDTAPEPAIVDAQTMGVSGDVSGDYWLPAPMCLYQKEL
                     SEQIVSLHYSDILKYYETEDYNTDVVLHSMQTMCLNSEYVATHPYLLIDHCVPKSLIT
                     KDIPNHLAETSGKFAVLKDLITLIQDYETETAIVCRSGRTMDLLEALLLGNRVNIKRY
                     RSPSIKTKQKARKHSCTCHLFPSDGFDETSGLPVDPKIYFDLLLCLDPTVDTSMPHIQ
                     QILTQARPSSGPGKQAPIVRLTTINAIDHCELYHSKLLDPKSREYLVRVSAAVVVLRD
                     VVGTLPPDLRPIYSQGLKYLVEWLEDPSIPWPLPDIYPIKTFTPMDVEKSLLTEVRFN
                     QANENLAHVFNNGKKRGRKPNSAYSKEGEPISYYQSKRLKNDYSTNPLKQNMAQLTGI
                     ATINDGGSVNYHLSGGLLTHKLIQSIGEAYYNLDRQSAELQNFETKEQNQVHRLELVM
                     KEHEDIKNQLEPAIKAQDYNREESTRLLAVVEEEHKKVASSMEELDTYTETLREKSPD
                     FSKLIDCLLEIAKVQEEIEKQQKLKVSRNNEHTYMTEELRRANEALAGFQAEKAPIAE
                     ETQQLEQKIEEKLAEDRIQSQKSQERIQKLMAQINDEKAILETLDKQVASMTEQLKKT
                     PPSKVRSSNNAQRGKHRKHSGNS"
     gene            complement(<90125..>91540)
                     /locus_tag="KLTH0A00880g"
                     /db_xref="GeneID:8290292"
     mRNA            complement(<90125..>91540)
                     /locus_tag="KLTH0A00880g"
                     /product="KLTH0A00880p"
                     /transcript_id="XM_002551455.1"
                     /db_xref="GeneID:8290292"
     CDS             complement(90125..91540)
                     /locus_tag="KLTH0A00880g"
                     /note="similar to uniprot|P20053 Saccharomyces cerevisiae
                     YPR178W PRP4 Splicing factor component of the U4/U6-U5
                     snRNP complex"
                     /codon_start=1
                     /product="KLTH0A00880p"
                     /protein_id="XP_002551501.1"
                     /db_xref="GeneID:8290292"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027106"
                     /db_xref="UniProtKB/TrEMBL:C5DBA2"
                     /translation="MNGQGTISFDEIRVDTSYIVEDGGKKADDTLKSLEFDREQKLTI
                     VPTDDTEVRESLVHLGQPEALENESNRDRRDRLSDLLYQNPDIRAQFLERQAKSPSLE
                     TGPSEASESEDEEFYTPASGSLVECRQFLIQDSLGRARERLRNERGHADSQDVSTTIV
                     QRRKLNAELSKYELWGSQVASSRPVSGVLLSPNQKSVACGSWHGDVKIIDSETLEILA
                     SFDAIHDDKIGGLDWSSDSTLLVTGGADRIVKVWKPSSPNDSTAVLKGHEGRVVKVKF
                     HPSDRYVASASFDMTWRLWDVERQVELQLQEGHAKEVYCLDFQCDGSLLCSAGLDSIG
                     RIWDMRSGQSLMILEGHAKPIYGVSWSPNGHHVATGSADGTVKVWDIRKVGNPFSILA
                     HNNIVSDVKFDKVSGRTLVSSSYDKTVSVFASDSWLRLASLKGHTDKVMSIDISHDFS
                     HLYSSGWDRSVKLWKLGVCNS"
     gene            <91636..>92610
                     /locus_tag="KLTH0A00902g"
                     /db_xref="GeneID:8290293"
     mRNA            <91636..>92610
                     /locus_tag="KLTH0A00902g"
                     /product="KLTH0A00902p"
                     /transcript_id="XM_002551456.1"
                     /db_xref="GeneID:8290293"
     CDS             91636..92610
                     /locus_tag="KLTH0A00902g"
                     /note="highly similar to uniprot|P20133 Saccharomyces
                     cerevisiae YPR176C BET2 Beta subunit of Type II
                     geranylgeranyltransferase required for vesicular transport
                     between the endoplasmic reticulum and the Golgi provides a
                     membrane attachment moiety to Rab-like proteins Ypt1p and
                     Sec4p"
                     /codon_start=1
                     /product="KLTH0A00902p"
                     /protein_id="XP_002551502.1"
                     /db_xref="GeneID:8290293"
                     /db_xref="GOA:C5DBA3"
                     /db_xref="InterPro:IPR001330"
                     /db_xref="InterPro:IPR008930"
                     /db_xref="InterPro:IPR026873"
                     /db_xref="UniProtKB/TrEMBL:C5DBA3"
                     /translation="MADLKLNKESHVSYIKSLDSKRQDYEYWLSEHLRLNGVYWGLTA
                     LCLLDAKNTFNKQEIIEFVRSCWDAKTGGFSAFPGHDAHIHTTLSGIQILATYNALDE
                     VLEGEALKQCISFIKDNQLPDGSFQGDRFGEVDARFVYSALNALSILGELTPEVVDPA
                     VAFIKRCYNFDGGFGLCPGAESHAAMAFTCIGALAIVGKLGELSADQFENIGWWLCER
                     QVPEGGLNGRPSKQPDVCYSWWVLSSLAIIGKLEWISFEKLREFILKSQDPKSGGISD
                     RPDNEVDVFHTIFGLAGLSLMGYDGLIEIDPVYCMPTSVTKTFKKYPY"
     gene            complement(<92634..>94724)
                     /locus_tag="KLTH0A00924g"
                     /db_xref="GeneID:8290294"
     mRNA            complement(<92634..>94724)
                     /locus_tag="KLTH0A00924g"
                     /product="KLTH0A00924p"
                     /transcript_id="XM_002551457.1"
                     /db_xref="GeneID:8290294"
     CDS             complement(92634..94724)
                     /locus_tag="KLTH0A00924g"
                     /note="similar to uniprot|P24482 Saccharomyces cerevisiae
                     YPR175W DPB2 Second largest subunit of DNA polymerase II
                     (DNA polymerase epsilon) required for normal yeast
                     chromosomal replication expression peaks at the G1/S phase
                     boundary potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0A00924p"
                     /protein_id="XP_002551503.1"
                     /db_xref="GeneID:8290294"
                     /db_xref="GOA:C5DBA4"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="UniProtKB/TrEMBL:C5DBA4"
                     /translation="MDPVVALPVKIQPGLLRPLAYRVLSKKYGLNIKSDGLAALADYI
                     GNRFGMNWRKDSGTFKFLEQFAAIWDQQERGLFIDRVGVEEVIKEVKERSKASQIPKK
                     VAGEESQSSVRPKTLDNFLANRQPSAAEQNILPSSLVAPDVDQDVTDVTEEAQRMEVD
                     EPALPTDSGDLDWQDHFKIIDAFAQQNFIYDHTTRQYRLKGQRARKVIPQAESNVAMF
                     ANRYHVVKDRVMRNDLFQGHGDTFNPLSSIAGPMSSGPGSFSSQNMTITQIKNLLGRD
                     GRSFLLLGLLRPNYKGGWSLEDPSGSVEVDLSQAIPTVGTFYVSGCILLAEGIYFSAG
                     HKFHVASLAHPPGERREATMDAIGNLDLLGVHQQSSPNYISRIDKDLKIRMHLLEREL
                     TDHRFAFLGGDLFLDQPQILEALRKVFAKLEGDPPTMMVLQGSFSSAPLFPVMSSKNI
                     SATSAYKNNFDALALLLLNFERLINETTFVFIPGNNDPWSSTVSLGTAGVWPQKPIPG
                     IFAQRINRVCKKIHWGSNPTRVAYLSQELILVRDDINGRFKRHNIAFPAIMDDEEYGG
                     EVADSALAQDALMPELNDNYEGIDQLVKSQDQLAASVQESRRLVKTILDQGHISPFVS
                     STRPVIWNLDHTLHLTPIPSLMVICDTTASQFEVTYNGCKSVNVGSFLYKRRARYVEY
                     RPSSRKVVREEVYF"
     gene            <94999..>95904
                     /locus_tag="KLTH0A00946g"
                     /db_xref="GeneID:8290295"
     mRNA            <94999..>95904
                     /locus_tag="KLTH0A00946g"
                     /product="KLTH0A00946p"
                     /transcript_id="XM_002551458.1"
                     /db_xref="GeneID:8290295"
     CDS             94999..95904
                     /locus_tag="KLTH0A00946g"
                     /note="weakly similar to uniprot|P52919 Saccharomyces
                     cerevisiae YLR457C NBP1 Component of the mitotic apparatus
                     containing a coiled-coil domain essential for the G2/M
                     transition"
                     /codon_start=1
                     /product="KLTH0A00946p"
                     /protein_id="XP_002551504.1"
                     /db_xref="GeneID:8290295"
                     /db_xref="InterPro:IPR013743"
                     /db_xref="UniProtKB/TrEMBL:C5DBA5"
                     /translation="MEAAKNYFKSWFNADEPRKVERGSLDKWRKRSQMLDGLGGRGAR
                     RGRTSVTLRNKTTGKSLRPKRTAPGIWNLVKGVFSREDQDLREMKNAYTALKLRSNNR
                     GMQTRSQVQRRIASSAALKRKLLEKQYDEKRLDELRRGRKPGPRAVALEPRNISQPNF
                     DTDRVILLQHKVDALKEQLNEVERELHLTRKRLKFTQEKNALLEGLLNDANVDDDYLK
                     SRRRITNLQREDLKPEYDALPPSPHRAISPLVTSSPRKVELPQDDFYERYRSIPTAEL
                     LRRDPESSLSPIRVDLSKYSSSRAP"
     gene            <96149..>97432
                     /locus_tag="KLTH0A00968g"
                     /db_xref="GeneID:8290296"
     mRNA            <96149..>97432
                     /locus_tag="KLTH0A00968g"
                     /product="KLTH0A00968p"
                     /transcript_id="XM_002551459.1"
                     /db_xref="GeneID:8290296"
     CDS             96149..97432
                     /locus_tag="KLTH0A00968g"
                     /note="highly similar to uniprot|P52917 Saccharomyces
                     cerevisiae YPR173C VPS4 Defective in vacuolar protein
                     sorting homologous to mouse SKD1 and to human hVPS4
                     AAA-type ATPase"
                     /codon_start=1
                     /product="KLTH0A00968p"
                     /protein_id="XP_002551505.1"
                     /db_xref="GeneID:8290296"
                     /db_xref="GOA:C5DBA6"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR007330"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBA6"
                     /translation="MSTGDFLTKGIGLIQKAIDLDTATQYEEAYTAYYNGLDYLMLAL
                     KYEKNPKSKDLIRTKFTEYLNRAEQLKEHLEAKEDTQKSKKDSPAKKTSANSNDDDAD
                     DKKLRGALSGAILTEKPNVRWEDIAGLEGAKAALKEAVILPVKFPHLFTGNRKPTSGI
                     LLFGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKQLFAMARENKPS
                     IIFIDEVDALTGQRGEGESEASRRIKTELLVQMNGVGNDSQGVLVLGATNIPWQLDSA
                     IRRRFEKRIYISLPDLAARTRMFELNIGETPCSLTKEDYRTLAQLTEGYSGSDIAVVV
                     KDALMQPIRKIQNATHFKNVSEDPEHRKLTPCSPGDKDAIEMSWVDIEADELQEPELN
                     IKDFLKAIKTTRPTVNEEDLRKQIEFTRDFGQEGD"
     gene            complement(<97551..>98183)
                     /locus_tag="KLTH0A00990g"
                     /db_xref="GeneID:8290297"
     mRNA            complement(<97551..>98183)
                     /locus_tag="KLTH0A00990g"
                     /product="KLTH0A00990p"
                     /transcript_id="XM_002551460.1"
                     /db_xref="GeneID:8290297"
     CDS             complement(97551..98183)
                     /locus_tag="KLTH0A00990g"
                     /note="similar to uniprot|Q06608 Saccharomyces cerevisiae
                     YPR172W Protein of unknown function transcriptionally
                     activated by Yrm1p along with genes involved in multidrug
                     resistance"
                     /codon_start=1
                     /product="KLTH0A00990p"
                     /protein_id="XP_002551506.1"
                     /db_xref="GeneID:8290297"
                     /db_xref="GOA:C5DBA7"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="UniProtKB/TrEMBL:C5DBA7"
                     /translation="MSCPDSLPEHVLSLLKTSKYLHLATCSKPECIPSVSLMNYTYIS
                     PEKVFVADKEKGATGERRHYIIMATQRDTEKYENIAQNPEVSVLIHDWVTAKKLSLRK
                     SSMSNTPTPEPQSAAAAAAAQNPDHPSRLLNLLQELNQSELSQMSATLRGRAEAVDPS
                     SEEFRYYEEALLKANPDAGVYTKGQNVAVVKVRLESAKVSDRENNTSFYD"
     gene            complement(<98450..>99379)
                     /locus_tag="KLTH0A01012g"
                     /db_xref="GeneID:8290298"
     mRNA            complement(<98450..>99379)
                     /locus_tag="KLTH0A01012g"
                     /product="KLTH0A01012p"
                     /transcript_id="XM_002551461.1"
                     /db_xref="GeneID:8290298"
     CDS             complement(98450..99379)
                     /locus_tag="KLTH0A01012g"
                     /note="similar to uniprot|Q06188 Saccharomyces cerevisiae
                     YLR455W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A01012p"
                     /protein_id="XP_002551507.1"
                     /db_xref="GeneID:8290298"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:C5DBA8"
                     /translation="MEQKLTTGDLVLCKVGSFAPWPAVVFPQRLLRKDVYRRRRAECV
                     AVCFFNDETYYWDKPARLKRLTKSTIERFLEDAPATEDPGLVGAYEEARDYTSLHEFV
                     MQRLEEENRIEEWEKSAEADTKVEAGQDPFEGRPAGLKAGGAKLRKSSASASPPRGYP
                     KARRAASGSADGSIGTKSSSASLKSRSMPESPSAVKKLSRLDHAKRVEISLLFRCKLQ
                     RNLVQRELPPGPDEIKESHKLLGKITENTLANPQFFDFEALKHSKLHKLLKVITNDDN
                     LAEFHRECNDILASWSPVIAELKKDKLNQRRDT"
     gene            <100382..>101902
                     /locus_tag="KLTH0A01034g"
                     /db_xref="GeneID:8290299"
     mRNA            <100382..>101902
                     /locus_tag="KLTH0A01034g"
                     /product="KLTH0A01034p"
                     /transcript_id="XM_002551462.1"
                     /db_xref="GeneID:8290299"
     CDS             100382..101902
                     /locus_tag="KLTH0A01034g"
                     /note="similar to uniprot|P53322 Saccharomyces cerevisiae
                     YGR260W TNA1 High affinity nicotinic acid plasma membrane
                     permease"
                     /codon_start=1
                     /product="KLTH0A01034p"
                     /protein_id="XP_002551508.1"
                     /db_xref="GeneID:8290299"
                     /db_xref="GOA:C5DBA9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DBA9"
                     /translation="MSEAKLEALATVGTSEKASTVSVTSRRSYNGDELSEIQQDLAQK
                     HGVKQRKLEWKIDICVVPALVLLYFAAFLDRINISNARLYGMEEDLGLHGNQFNVALT
                     VFFVPYIVFELVANYLAKLFKPHWCFSVSMFMFGCSTIGCGFVKSFGGLITVRVFLGV
                     AESATFGLIFYILSSYYTPRQAQRRFSCFFSSVTLAGAAGGSIARQIYTGIGNKHLAN
                     WRWIFIIEGAATVFIAFLLFFITPDFPETAKFLKPNEKAFLKEKLQLYSRVESGFEVK
                     FNWRDYLPLFKEPIFYANALAYLGLLVPSYGYAYFATSIIKLLGYTAVSAQQHSVYPW
                     LAAFGYINIVAYLSDRLQNRWCFSVSSSIIGIAGLAMVLGSSAPHVRYGGCFVASLGL
                     YGATPVVVCWTSINLGGHLRKSFGTAFQVGLGNIGGIIATFLFLQKDEPKYTSGLSVS
                     IGFVGLSIISQLFIVFYCSFMNKKKMTLTYIERFEELPIEDRVLKGDLNPNFKYLL"
     gene            complement(<101960..>104230)
                     /locus_tag="KLTH0A01056g"
                     /db_xref="GeneID:8290300"
     mRNA            complement(<101960..>104230)
                     /locus_tag="KLTH0A01056g"
                     /product="KLTH0A01056p"
                     /transcript_id="XM_002551463.1"
                     /db_xref="GeneID:8290300"
     CDS             complement(101960..104230)
                     /locus_tag="KLTH0A01056g"
                     /note="similar to uniprot|Q06604 Saccharomyces cerevisiae
                     YPR171W BSP1 Adapter that links synaptojanins Inp2p and
                     Inp53p to the cortical actin cytoskeleton"
                     /codon_start=1
                     /product="KLTH0A01056p"
                     /protein_id="XP_002551509.1"
                     /db_xref="GeneID:8290300"
                     /db_xref="UniProtKB/TrEMBL:C5DBB0"
                     /translation="MEREASSLRDPELEDYLARVERLDSARNGSRRSPDAHDQRPKYR
                     PEDLERAQRLLDGDYTGYDSGTSPTKYSGSVPQIAYRSAYNYERTFSPKRGAGSPRRS
                     DAGSAPALGLDSSPDGTRRYTVSEQDYLLLQKLKREAVGDPLVSALPSRGRPRENRVV
                     RTVTLADDGDDNDEIPPPLPTRRAASPVLPPPDREEDSTPTKPARPLGLSVPSKSVAP
                     AKPARVPDLSMRLKSAAPASPVVETGTKPSTPLQKNTAVSIDNRDSLVPKKPPPRKPA
                     SLTEASKADGFIKILSDRAKKPVPPKPETLKKSASYLESLENNKLTTASLDKPSKPSI
                     QSKPSIQSKPTSYLDSLQKNKVTVSTPVREPKSPSPIAKPQHTPQMFMNSVLKTESSR
                     PLQDSSAQSPKPFVIPPKRKSPQKEPVPESDEKAEVSFLSLRSSLKPAQSFKKSDARE
                     PGFRSDEQKLVIPKLRRPKVQDDSAQFDGQESLKSVPRSIEGNGSASETASQRQRLNV
                     APPKPERKVSTPEALSKRESLAKAPPKPARKISTPEALSKRESLNKAPPKPPRKVSAL
                     EALSKRESLSKAPPKPARKVSTPEAVNKRESLSKPPPKPSRKVSMPEAMKRLEAIKAK
                     KLSQFEGTEVSEKPPQKLEPTVESKGSPLKAKTEANNQKAPESELAALIAAKQLANKG
                     KSRTAPELSNRAHLPQAIPFMAQLDNDKIAKMLRPASETDISRPRASDGDNQLNHPTK
                     SRARGPKRKLPKGVKT"
     gene            complement(<104423..>104870)
                     /locus_tag="KLTH0A01078g"
                     /db_xref="GeneID:8290301"
     mRNA            complement(join(<104423..104531,104620..104750,
                     104853..>104870))
                     /locus_tag="KLTH0A01078g"
                     /product="KLTH0A01078p"
                     /transcript_id="XM_002551464.1"
                     /db_xref="GeneID:8290301"
     CDS             complement(join(104423..104531,104620..104750,
                     104853..104870))
                     /locus_tag="KLTH0A01078g"
                     /note="highly similar to uniprot|P0C5R9 Saccharomyces
                     cerevisiae YPR170W-B"
                     /codon_start=1
                     /product="KLTH0A01078p"
                     /protein_id="XP_002551510.1"
                     /db_xref="GeneID:8290301"
                     /db_xref="UniProtKB/TrEMBL:C5DBB1"
                     /translation="MKPVVSSGKAWFCTVISAFGVVILSVIAHLFNTNHESFVGSIND
                     PEDGPAVARTVFMAVLVYAVFFVFCGSQIWLGKKKPAIELR"
     gene            105023..105096
                     /locus_tag="KLTH0A01100r"
                     /db_xref="GeneID:8290302"
     tRNA            105023..105096
                     /locus_tag="KLTH0A01100r"
                     /product="tRNA-Ile"
                     /note="tRNA-Ile (AAT) cove score=71.40"
                     /db_xref="GeneID:8290302"
     gene            complement(<105295..>106073)
                     /locus_tag="KLTH0A01122g"
                     /db_xref="GeneID:8290303"
     mRNA            complement(join(<105295..105709,106054..>106073))
                     /locus_tag="KLTH0A01122g"
                     /product="40S ribosomal protein S19"
                     /transcript_id="XM_002551465.1"
                     /db_xref="GeneID:8290303"
     CDS             complement(join(105295..105709,106054..106073))
                     /locus_tag="KLTH0A01122g"
                     /note="highly similar to uniprot|P07280 Saccharomyces
                     cerevisiae YOL121C RPS19A Protein component of the small
                     (40S) ribosomal subunit; nearly identical to Rps19Bp and
                     has similarity to rat S19 ribosomal protein"
                     /codon_start=1
                     /product="40S ribosomal protein S19"
                     /protein_id="XP_002551511.1"
                     /db_xref="GeneID:8290303"
                     /db_xref="GOA:C5DBB2"
                     /db_xref="InterPro:IPR001266"
                     /db_xref="InterPro:IPR018277"
                     /db_xref="UniProtKB/TrEMBL:C5DBB2"
                     /translation="MPGVSVRDVPAQDFITAYASFLQRQGKLEVPGYVDIVKTSAGNE
                     MPPQDSEGWFYMRAASVARHIYMRKQVGVGKLNKLYGNAKNRGSRPSKHVDASGSVNR
                     KVLQALEKIGIVEISPKGGRRISENGQRDLDRIAAQTLEDDE"
     gene            complement(<106916..>107791)
                     /locus_tag="KLTH0A01144g"
                     /db_xref="GeneID:8290304"
     mRNA            complement(join(<106916..107364,107680..>107791))
                     /locus_tag="KLTH0A01144g"
                     /product="60S ribosomal protein L18"
                     /transcript_id="XM_002551466.1"
                     /db_xref="GeneID:8290304"
     CDS             complement(join(106916..107364,107680..107791))
                     /locus_tag="KLTH0A01144g"
                     /note="highly similar to uniprot|P07279 Saccharomyces
                     cerevisiae YOL120C RPL18A and highly similar to
                     uniprot|P07279 Saccharomyces cerevisiae YNL301C RPL18B
                     Protein component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L18"
                     /protein_id="XP_002551512.1"
                     /db_xref="GeneID:8290304"
                     /db_xref="GOA:C5DBB3"
                     /db_xref="InterPro:IPR000039"
                     /db_xref="InterPro:IPR021131"
                     /db_xref="InterPro:IPR021132"
                     /db_xref="UniProtKB/TrEMBL:C5DBB3"
                     /translation="MGIDHTTKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPF
                     NKVVLRSLFLSKINRPPVSVSRIGKALNQQGAANKTVVVVGTVTDDNRIFEFPKATVA
                     ALRFTAGARATILKAGGECITLDQLAVRAPKGQNTLIVRGPRNSREAVRHFGAGPHKH
                     KAPRIMSKGRKFEKARGRRRSRGFKV"
     gene            complement(<108732..>110162)
                     /locus_tag="KLTH0A01166g"
                     /db_xref="GeneID:8290305"
     mRNA            complement(<108732..>110162)
                     /locus_tag="KLTH0A01166g"
                     /product="KLTH0A01166p"
                     /transcript_id="XM_002551467.1"
                     /db_xref="GeneID:8290305"
     CDS             complement(108732..110162)
                     /locus_tag="KLTH0A01166g"
                     /note="similar to uniprot|Q08268 Saccharomyces cerevisiae
                     YOL119C MCH4 Protein with similarity to mammalian
                     monocarboxylate permeases which are involved in transport
                     of monocarboxylic acids across the plasma membrane mutant
                     is not deficient in monocarboxylate transport"
                     /codon_start=1
                     /product="KLTH0A01166p"
                     /protein_id="XP_002551513.1"
                     /db_xref="GeneID:8290305"
                     /db_xref="GOA:C5DBB4"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DBB4"
                     /translation="MVSILPKRPQQLILSPHTRFEAHASGFKPQSGGTGRDSDDHVRE
                     STLDQLSHTGSTDDEDESEFPDGGVAAYLALLGSFMGLLPAWGVINSLGALEGYISKH
                     QLASDSSSSVSWIFALYLAIVSASCVLTGAYFDRNGGFGAIVVGTVLFVTSLVATANC
                     HTIWQFILAFSVLGGLANGILTTPLVSCVATWFSRKRAMATSCATIGGSLGGIIFPLM
                     LKKLYVEVGFPWALRILAFVCLACLSFACLFARERVKQKPQAFSSKHEMAKFYVLGSF
                     NWKYFCDAKYVFTTLGFSLAENSILATSTYIASYAMARGNSEGSSFTLITAGNAMQIL
                     GRYVPGYISDRYAGRFNVVIVMTLMAVVVNFAIWLPFGGNPKALWAYYLLYGFFSGSI
                     FSLTAVCIGQISKTRDFGKRYSTAYLLNAMMTLPTIPIAGTIIGRGSVSDYNKFIIFS
                     TCLMLAGGLSYAVARFLCAGVRICKV"
     gene            complement(<110365..>110928)
                     /locus_tag="KLTH0A01188g"
                     /db_xref="GeneID:8290306"
     mRNA            complement(<110365..>110928)
                     /locus_tag="KLTH0A01188g"
                     /product="KLTH0A01188p"
                     /transcript_id="XM_002551468.1"
                     /db_xref="GeneID:8290306"
     CDS             complement(110365..110928)
                     /locus_tag="KLTH0A01188g"
                     /note="weakly similar to uniprot|P38013 Saccharomyces
                     cerevisiae YLR109W AHP1 Thiol-specific peroxiredoxin,
                     reduces hydroperoxides to protect against oxidative
                     damage; function in vivo requires covalent conjugation to
                     Urm1p"
                     /codon_start=1
                     /product="KLTH0A01188p"
                     /protein_id="XP_002551514.1"
                     /db_xref="GeneID:8290306"
                     /db_xref="GOA:C5DBB5"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013740"
                     /db_xref="UniProtKB/TrEMBL:C5DBB5"
                     /translation="MLHGIRSAIRPASASGLRFFHNTTRTQMFQVGDVIKTGLAGVQE
                     NAPSNSIDLGKLVSKGKHIIVGVPAAFSPACSASHVPGYIAHLSDLQAKGVQDVFVTC
                     VNDAFVTKAWAESLKTPEQVHIVADTKGEFAKSGDTLFDSEEVFGNKRNYRYAVVVED
                     GKVVSTFEEPDKTGVNVSSAENVLKSL"
     gene            <111361..>113199
                     /locus_tag="KLTH0A01210g"
                     /db_xref="GeneID:8290307"
     mRNA            <111361..>113199
                     /locus_tag="KLTH0A01210g"
                     /product="KLTH0A01210p"
                     /transcript_id="XM_002551469.1"
                     /db_xref="GeneID:8290307"
     CDS             111361..113199
                     /locus_tag="KLTH0A01210g"
                     /note="some similarities with uniprot|Q12348 Saccharomyces
                     cerevisiae YOL117W RRI2 subunit of COP9 Signalosome (CSN)
                     like protein complex that cleaves the ubiquitin-like
                     protein Rub1 from Cdc53 COP9 signalosome (CSN) subunit"
                     /codon_start=1
                     /product="KLTH0A01210p"
                     /protein_id="XP_002551515.1"
                     /db_xref="GeneID:8290307"
                     /db_xref="UniProtKB/TrEMBL:C5DBB6"
                     /translation="MTGDDAGYGDFAASEDENYDDFMASDEDVSIEMEDETEDEAENE
                     GAAENETGSKTRQGSASRRDDSGAENGAGKPQVESGAAVMASAALQEARRMVQEQRWY
                     EARSALDGVLQSSTLDPDRAFGARLELVRCCYLSWVSRQENAAGPAELTEHSELQEAC
                     GHLQQLQAYVDWLEPEVLDSAVSRLLDLFAPPLKSKLLFEGPAASGLGPRAAVTLLEC
                     CAPLARHESAQDLRSRVLQHRLGFNDPPGGSQRRQMLDELATISGGRLDSLEFLITTH
                     VQQFLADPQGLDVPQLQSLVSHASALLQRSLTQPLRLLSLLSFCEAIIALNNYCSPHD
                     HAKRLSECQTAFWNCYKHLEELGDHSRFRDLTLCAFVLSSMLLTGQAANAHQAITPFE
                     LEQIKVIESTPLVQDLKHIYSDFVGYNLSGFADSLRKIKQFHLQLAGLVDALIHLLQT
                     RMLWNRVARLYSCISLSDIRAQLQIGDSPQLSRNDLLTILMKSIMNDTAQVYFKLDLT
                     HDLVYFGKENRRPLCPLSKHLYLSAKSDAVTKSPNTPSCNSLKEWVDNIGVFETKPRR
                     LKDMSAVQFVHELQQSRECTAVADSSDQAKPLKYSQLLQCVRDALS"
     gene            <113770..>114303
                     /locus_tag="KLTH0A01232g"
                     /db_xref="GeneID:8290308"
     mRNA            <113770..>114303
                     /locus_tag="KLTH0A01232g"
                     /product="KLTH0A01232p"
                     /transcript_id="XM_002551470.1"
                     /db_xref="GeneID:8290308"
     CDS             113770..114303
                     /locus_tag="KLTH0A01232g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A01232p"
                     /protein_id="XP_002551516.1"
                     /db_xref="GeneID:8290308"
                     /db_xref="GOA:C5DBB7"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C5DBB7"
                     /translation="MKFSIAASVFAAAGVASATIAAVSQIGDGQIQATVPGASTSAAT
                     TTTTSVATPASTPATVVSASTSATTESASATTFTTTFGGSSISSPVASSQRSSDDITY
                     VDITTTPEVTTSQVKTEKSTSTPYSYTTLATQNSTATGSGSSSSVSLSVFEAGAQNIA
                     AGAGIGALAAGALIALL"
     gene            <114559..>115443
                     /locus_tag="KLTH0A01254g"
                     /db_xref="GeneID:8290309"
     mRNA            <114559..>115443
                     /locus_tag="KLTH0A01254g"
                     /product="KLTH0A01254p"
                     /transcript_id="XM_002551471.1"
                     /db_xref="GeneID:8290309"
     CDS             114559..115443
                     /locus_tag="KLTH0A01254g"
                     /note="some similarities with uniprot|P22148 Saccharomyces
                     cerevisiae YOL116W MSN1 Transcriptional activator involved
                     in regulation of invertase and glucoamylase expression
                     invasive growth and pseudohyphal differentiation iron
                     uptake chromium accumulation and response to osmotic
                     stress localizes to the nucleus"
                     /codon_start=1
                     /product="KLTH0A01254p"
                     /protein_id="XP_002551517.1"
                     /db_xref="GeneID:8290309"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5DBB8"
                     /translation="MDDVSPLIARISGLESQIAMYEKLFQTLSAKLDHHFKKYDTVVN
                     AQQQQINSLTDVLFTLLNDRCRYADIQREKLGNTLAGVASTGASLSGVVATAGLGRQP
                     KQATGPQTSSRHVSGLQSDHQSASLYAEDTPSRREDERRSSDSYYSDNSVTSAESDES
                     EDRENSELRPELHESADAAHKKRKLFDRKFRFLASPQSVAEVWKEYTEGLAGQPSLKE
                     MESTYRSSWRRDAAVSRKFYRRKVLCRAIETGLARGYALEEIIDMLESHRQQREGRQD
                     KLPIGWLCRRSNLPSIFK"
     gene            <115664..>117493
                     /locus_tag="KLTH0A01276g"
                     /db_xref="GeneID:8290310"
     mRNA            <115664..>117493
                     /locus_tag="KLTH0A01276g"
                     /product="KLTH0A01276p"
                     /transcript_id="XM_002551472.1"
                     /db_xref="GeneID:8290310"
     CDS             115664..117493
                     /locus_tag="KLTH0A01276g"
                     /note="similar to uniprot|P53632 Saccharomyces cerevisiae
                     YOL115W TRF4 DNA polymerase sigma involved in mitotic
                     chromsome condensation"
                     /codon_start=1
                     /product="KLTH0A01276p"
                     /protein_id="XP_002551518.1"
                     /db_xref="GeneID:8290310"
                     /db_xref="GOA:C5DBB9"
                     /db_xref="InterPro:IPR002058"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="UniProtKB/TrEMBL:C5DBB9"
                     /translation="MGAKEASKNERAGPKSSSKSKPLKNNQRRTKRLRKSSLSKAQRN
                     FAVFNKDGAHINKYENLELDNIESEGDDGSERTQESSEAPTTEATPESEEPQKEQAQD
                     NALDDNQDYISLSMSSEEEQESEEEAPDEAGGEHPGGDAAQPRTLNTDYPWILNHDHS
                     KQREIADWLTLEIKDFVAYISPSQEEIRVRNSTISKIRNAVKDLWPDADLHVFGSFAT
                     DLYLPGSDIDCVINSSSGDKENRNCLYSLASFLKRRKLATQVEVISKARVPIIKFVEP
                     ISQIHIDISFERVNGLEAARVIRGWLKETPGLRELVLIVKQFLAARRLNMVHTGGLGG
                     FSIICLVYAFLQLHPRVISSDIDSMENLGILLIDFFELYGKNFGYDHVAISVTDSGAR
                     YLSKELYGSLQNPRTSFALAIQDPGDKDNNISRGSFNIRDIKKAFAGAFDLLTNRCFE
                     LDAATFKDRVGKSILGNVIKYRGKQRDFKDERNLVVNKAIAENETYHRKRGRIVHEEV
                     FTDVSDGEKEDDIYTVEEPAKKKPKKAKKAKKAKKETKASSSSVDTLMGLDTQDDADE
                     DGYDPSNEAPSTLALEDARSDIRKKSVDAQTKRDYWLSKGQAL"
     gene            complement(<117599..>118156)
                     /locus_tag="KLTH0A01298g"
                     /db_xref="GeneID:8290311"
     mRNA            complement(<117599..>118156)
                     /locus_tag="KLTH0A01298g"
                     /product="KLTH0A01298p"
                     /transcript_id="XM_002551473.1"
                     /db_xref="GeneID:8290311"
     CDS             complement(117599..118156)
                     /locus_tag="KLTH0A01298g"
                     /note="some similarities with uniprot|Q12322 Saccharomyces
                     cerevisiae YOL114C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A01298p"
                     /protein_id="XP_002551519.1"
                     /db_xref="GeneID:8290311"
                     /db_xref="GOA:C5DBC0"
                     /db_xref="InterPro:IPR000352"
                     /db_xref="UniProtKB/TrEMBL:C5DBC0"
                     /translation="MRFGCRSRLPSLFFMRSVAGLLPIVRQYSAKTSLPAQQWVDSLT
                     VRALPEKAFSYNFDRSSGPGGQNVNKVNSKCTLTIHAFSKCDWIPQEVRDQLVQRRFR
                     YLSSSRDCVVIQSDQSRSRETNRQICLEKLVSELKTTCWFPKEAQPEDLQRWSAIRRK
                     TSQQRLEGKKIKSDKKKLRRKVTDY"
     gene            <118671..>121115
                     /locus_tag="KLTH0A01320g"
                     /db_xref="GeneID:8290312"
     mRNA            <118671..>121115
                     /locus_tag="KLTH0A01320g"
                     /product="KLTH0A01320p"
                     /transcript_id="XM_002551474.1"
                     /db_xref="GeneID:8290312"
     CDS             118671..121115
                     /locus_tag="KLTH0A01320g"
                     /note="similar to uniprot|P48562 Saccharomyces cerevisiae
                     YNL298W CLA4 Involved in localizing cell growth with
                     respect to the septin ring protein kinase homologous to
                     Ste20p interacts with CDC42"
                     /codon_start=1
                     /product="KLTH0A01320p"
                     /protein_id="XP_002551520.1"
                     /db_xref="GeneID:8290312"
                     /db_xref="GOA:C5DBC1"
                     /db_xref="InterPro:IPR000095"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001849"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DBC1"
                     /translation="MSLSAAANKISENDFQNIGPAPRPPGAAFNKTQPITSYLNQLDL
                     QDKRNEQRGAGNGNRKSGWVSYKDDGILSFLWQKRYMVLSDSYLTLYKNEPRAGSDDA
                     VLQIPLTTIVSVSRTQLKQNCFEVVRSSDRNSSASGSSVGSSGNGSGGSDGSRKTMYI
                     ATKTEIDLHSWLDAIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPSNWEKLLK
                     HSRITGEDWNNNSAAVIQVLQFYQEYNGAGTATASNNSSTTSLPKASINQGQYGGQQS
                     RQNSHDMLPQRKPPTPPSVQHRPKLQVSTSHQNYQTSQQSPYQSFNNKYASPLQNKPL
                     NSHLPSPPAHKLPYPQQVQGQNSSQLKQHRQNGYAQDASRFKHNMQNPYLTSTPPSSS
                     PSSSKEQVSQRHAPQQRPPVNNSPYSNSSTPPPQRLHPQRAAPAVLKPPAQPAPSTAA
                     AAAAMNQSRPEAGPKFLQPNREAPKKPDAHPKKDVGVTKQRKPTKPTMSNAEIMAKLK
                     SVTFNTDPTPFFQMVEKAGQGASGSVYLAQRTQLPDYGEGDLNEQIGEQHIGDKVAIK
                     QMILSKQPRKELIVNEILVMKDSQHKNIVNFLEAYLKTEDDLWVVMEYMEGGSLTDLI
                     ENSPTNGSNHAPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDHRARVKIT
                     DFGFCAKLTDKRSKRATMVGTPYWMAPEVVKQREYDEKVDVWSLGIMTIEMLEGEPPY
                     LNEDPLKALYLIATNGTPKLKQPEVLSLKIKRFLSVCLCVDVKYRASTEELLHHSFFD
                     MSCDPRDLTSLLEWKK"
     gene            complement(<121198..>126042)
                     /locus_tag="KLTH0A01342g"
                     /db_xref="GeneID:8290313"
     mRNA            complement(<121198..>126042)
                     /locus_tag="KLTH0A01342g"
                     /product="KLTH0A01342p"
                     /transcript_id="XM_002551475.1"
                     /db_xref="GeneID:8290313"
     CDS             complement(121198..126042)
                     /locus_tag="KLTH0A01342g"
                     /note="similar to uniprot|P48563 Saccharomyces cerevisiae
                     YNL297C MON2 Peripheral membrane protein with a role in
                     endocytosis and vacuole integrity interacts with Arl1p and
                     localizes to the endosome member of the Sec7p family of
                     proteins"
                     /codon_start=1
                     /product="KLTH0A01342p"
                     /protein_id="XP_002551521.1"
                     /db_xref="GeneID:8290313"
                     /db_xref="GOA:C5DBC2"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026829"
                     /db_xref="UniProtKB/TrEMBL:C5DBC2"
                     /translation="MSTKLSFRKFSDELFTELHALSAESKRRSSEVRHASDKSIEILK
                     TVHEFEDLPRHPDFVTPFVLSCASKNAKLTSVSVQCLQKMSSVNCIPEDRIEDVLDAF
                     IDSTHLAAEIQLKVLQIIPLFFKTYSQVVVGKLCSKLLLCCSSLIQIPNKAPVVFGTA
                     SATLQQLINDILERATIDQESRTCKVAVNNIEFIEVGSFRHDANRLFNDLCNLKNASY
                     SPKDCILNVESIPEDYGLEVLESVLRNHRKLFAACPDLQFVLRTRAVPLLLRSISSSK
                     SFPIVVRSARCLTLLIQEEFLAILELELEIILFLLINILSNEIESPIWKKIISLELFQ
                     LVCKNFALVWGIFKSYDVHPDRRQILKSLLSTLKGILSQKEYHEYLKVLHVLTRGDTP
                     IVSQEYSVAKIPFIDLLDKASAPLVDQTYVVYLVLAVTNSISDGMGSQAVSLYQKQAK
                     EEEVKSLKLMYSELFDDLFFIHKMFLYASTLDTPLFHSVVRAFQKLSHSAGVLECENK
                     LNKCLRLFGIATVESCHIMGEAPEDNESDRSLTTASTVINTISESLIGNSSNAKGSFE
                     ANLQHSRAIHQRTISVFRALMSLSLSLGSVFSSDSWKEVLKTWQWMSYYLEGPSRDSD
                     HSTHGFKTAQNPRASSSDISAAKFSIIKLYESTQHYSSSSFNVMVSSVIQQSKECAEL
                     ITSNYAPEGHSPVDGSKMLNTCIFNRDFFIAQLRELSQINIWRLVNESKWRPSWDLVI
                     SYLVEVAASREIANEKLRLSAVDVFNNIISRAAIVSSDPEIPQKTDTEAAQSRLLTAL
                     MQMINSIMSLKRTRDDVRNGAVETEYDILFQVLRTLKGLLDIFGDSLQGAWDVVFKII
                     NCPFVIMSESSITELSDHEEDSSILETISSKHNGVIKLSFEVFKLIFDDFLQTLPLDV
                     VKNVIDTLLNFVRQDRDLNISFSSISQFWLIGDYLRTCVSKVPSEFTDSQKLAFAKKI
                     EDGQLISMISDQNTEPCGLYYGLWLYLLKKLVECTNDERVEVKNGAIQTFFRIIDSHS
                     SSFPPWELIVHEVIKPLLQQRSNFEEYLESGEYVNLTLKGLIHMFALYLAKFSHTSDF
                     TEAWSLLVCYMADLVILPSFEISFIVLSNLRELLQAVLKIQDFPARITSEIYQRWCGY
                     NVIYADPAKSSELKRKTNYDCVEELLLCYPFLHQLMGSQGLLDAEKVENILLILNSAA
                     RYPLLPEFSTDNQKPSTLQNAVLKSIKTFELGQQLDVELLMLDQISTIMALPFDTRTR
                     IQMKLGPKLSSSSRKRIPSFEAMSYEACSCFSQRLSGINDLNQSFVSSKRLLKILKSL
                     SIPIINKSLIKGDMNNSAVLWTLSSRCFFSLAEKILDVFHYEEVDHIPEEVRDAFFDM
                     FVEVAVVPLKRLDSETDLLTEIDDIEEFQHFREKLLQQLNLESLKAKHLKKFVSSVWS
                     ASFFHEVDDIEDEIIKSSESLEEVAQKLAVFPFDEVLESTRGQKLLSKYKTATLCLQD
                     LTNYMMFEGPGFDKLRAVCLPFLVARYAFSLRRYVSDAILLNRAPIAKDRSMEVALVL
                     SGLRKVLDYISKAKGKVACDKAIRDLQVLYPLILRAIPVSQKVSGLETIVQEVSLDFT
                     KLLH"
     gene            <126448..>127878
                     /locus_tag="KLTH0A01364g"
                     /db_xref="GeneID:8290314"
     mRNA            <126448..>127878
                     /locus_tag="KLTH0A01364g"
                     /product="KLTH0A01364p"
                     /transcript_id="XM_002551476.1"
                     /db_xref="GeneID:8290314"
     CDS             126448..127878
                     /locus_tag="KLTH0A01364g"
                     /note="weakly similar to uniprot|P48564 Saccharomyces
                     cerevisiae YNL295W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A01364p"
                     /protein_id="XP_002551522.1"
                     /db_xref="GeneID:8290314"
                     /db_xref="InterPro:IPR014804"
                     /db_xref="UniProtKB/TrEMBL:C5DBC3"
                     /translation="MFRNLAHLYNGKFQTLNRTNALWERCSCMRLCSTDANAAEKSKE
                     EEEEVEVATKENGKKDGGDWNGSNAYSCGRPSRKSGKGVYLVPKVHSTDHIKQDEIHT
                     EGLFAGNKPLFLGELSLSFKRPSGALDGIFGTLTKIKRATDDGGDQEIDVQGIINDLQ
                     TGDKDISSGEKSAAKRPVIPWDASISGMVYNDQPFKQVPRGVVNKLKPFKLLKIERKN
                     KSGNSQDHELVKMRVHNSKVNDELQLVDLNREATRRPPTLELNDSAGKAKRFYTDESK
                     SLTQFKFIRSDQHVFKTDVDKLNNLLVKEFLKRTKLKIDSEFRDNQLPLYIYINKTLS
                     SNALLQRFIRKRVTDHISPLFTTILSSYEREDEAKKFEKRIQLRVNSLVEDLAEYFPS
                     VFFAGDIVDCVHHPSPVPGYGRLYWLKPGKRHKAIWGRNSESDFVFNLSNTYRITRSG
                     VRYMKYPINIHYRTFHQAFTEWEYRK"
     gene            complement(<127952..>129517)
                     /locus_tag="KLTH0A01386g"
                     /db_xref="GeneID:8290315"
     mRNA            complement(<127952..>129517)
                     /locus_tag="KLTH0A01386g"
                     /product="KLTH0A01386p"
                     /transcript_id="XM_002551477.1"
                     /db_xref="GeneID:8290315"
     CDS             complement(127952..129517)
                     /locus_tag="KLTH0A01386g"
                     /note="similar to uniprot|P48565 Saccharomyces cerevisiae
                     YNL294C RIM21 Protein proposed to be involved in the
                     response to alkaline pH; has similarity to A. nidulans
                     PalH"
                     /codon_start=1
                     /product="KLTH0A01386p"
                     /protein_id="XP_002551523.1"
                     /db_xref="GeneID:8290315"
                     /db_xref="InterPro:IPR014844"
                     /db_xref="UniProtKB/TrEMBL:C5DBC4"
                     /translation="MVKKTSWRYSQVPKEYQSCGGIDLGNGVLIWKNKWQPVAYFDSV
                     RFTSYCDEGNPVYSSLKRNRLSFPYSKALQRDWHTFITSGNDRGPFKYSIYAIIMSFT
                     TNFVITLFLTVIVFITIRQKPHRGASNLLKLGSTLASVNLAIFISKALKVLHQDHIYK
                     GVVSTERVLDLLWMDLTFTCLDLLVVLICQLCQVQIIMRLFSRVKEKRTVFLVGVTLS
                     IISQVLWAIPTLAQSINDNFSGLSYDADGLTLLSPFVYLFRIALAASYACIICFNMFN
                     KRHLCFLYQRMMILTLLALIIVLLQPGFFVADVANIWVDDLSEIFNTTCYVGSAVIVW
                     EWVDHILILERKVQAQSVLGRPVYEDDQEDYHFAKYALKVQDAISRDSETGEIGSRND
                     TANSGTEEQRVRWQYGDDTPPRDTNKVEFNEPQPLKNVILEKCSRIWDGMIYYTDHFI
                     VKGLVIKTLSIHSKSSSDDHRKRKAKVRRRIGLDRPNEVYVYATRDVVFDSDEDEAES
                     NQGSSVDEERDFP"
     gene            <129878..>131578
                     /locus_tag="KLTH0A01408g"
                     /db_xref="GeneID:8290316"
     mRNA            <129878..>131578
                     /locus_tag="KLTH0A01408g"
                     /product="KLTH0A01408p"
                     /transcript_id="XM_002551478.1"
                     /db_xref="GeneID:8290316"
     CDS             129878..131578
                     /locus_tag="KLTH0A01408g"
                     /note="similar to uniprot|P48566 Saccharomyces cerevisiae
                     YNL293W"
                     /codon_start=1
                     /product="KLTH0A01408p"
                     /protein_id="XP_002551524.1"
                     /db_xref="GeneID:8290316"
                     /db_xref="GOA:C5DBC5"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5DBC5"
                     /translation="MTKLSDVHDYGSSKTKSRNGGLSGYLASKSPSVPNLTQTFTTRS
                     MKETSPERAGYQQFGSPLVEEPTNLSVIDLYGDEDDEDADDDEDADDDEAEGSQSTSG
                     VIADLPVSSTESPSLEAPNAFGAAKDLSQYDRYGFKKQTAHVSQEEYHMWWDQYSRYC
                     IRRKRKWQDLLEKSGLAPSNDVPDRFPPRSEKLKRYVRKGIPAEWRGQAWWYFARGQE
                     KLNKNAGVYDKLLEGLNNKKDKNNCKDLEVIERDLHRTFPENIHFQKDPKEGQEPLMI
                     QSLRRVLLAFSVYNPKIGYCQSMNFLAGLLLLFLDEEKSFWMLVIITSRYLPGVHNVN
                     LEGVNVDQGVLMLCVKEYLPDFWQRIIPKEQSRSNEFLYKLPPITLCTASWFMSCFVG
                     VVPIETTLRIWDCLFYEESHVLFKISLSIIKICEQELAGSRLAHRGLRARTHGRDDDD
                     IEVFQVIQTVPKKLLDPQDIFDRIIFKRRVPLNNLNQEEIDRCRKYVTSQRLKFKNCA
                     EIMGDRTSAKASAKRDLEIGPDFVNNALSSEVYGFRRSLTGAHWNNSIKEKVRQIRRK
                     "
     gene            complement(<131610..>132350)
                     /locus_tag="KLTH0A01430g"
                     /db_xref="GeneID:8290317"
     mRNA            complement(<131610..>132350)
                     /locus_tag="KLTH0A01430g"
                     /product="KLTH0A01430p"
                     /transcript_id="XM_002551479.1"
                     /db_xref="GeneID:8290317"
     CDS             complement(131610..132350)
                     /locus_tag="KLTH0A01430g"
                     /note="similar to uniprot|Q12285 Saccharomyces cerevisiae
                     YOL111C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A01430p"
                     /protein_id="XP_002551525.1"
                     /db_xref="GeneID:8290317"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DBC6"
                     /translation="MSLIKFNFQKANCATKKYPIDHKELPLPIGIKKQKRASMSLPEK
                     EFISKFLSLVAQQPIVLKSDFKTPMENITNLGVALPPLKYKYDHKRLKRNGGNGSGSA
                     RIQLNLKSIRAPKFVYSQEFDQSETIYQVKEFLIQKEDSIHETSQLKVLLKGKVLHDN
                     ILLSDLKSDKVDLVVMVSKLENAASQGTSAGDSANASIDAEEIAPRSVQVPWVKIEQL
                     LKNEMADPQEATAVLQRLQRGWDLADLD"
     gene            <132363..>133031
                     /locus_tag="KLTH0A01452g"
                     /db_xref="GeneID:8290318"
     mRNA            <132363..>133031
                     /locus_tag="KLTH0A01452g"
                     /product="KLTH0A01452p"
                     /transcript_id="XM_002551480.1"
                     /db_xref="GeneID:8290318"
     CDS             132363..133031
                     /locus_tag="KLTH0A01452g"
                     /note="similar to uniprot|P41912 Saccharomyces cerevisiae
                     YOL110W SHR5 Subunit of a palmitoyltransferase composed of
                     Shr5p and Erf2p that adds a palmitoyl lipid moiety to
                     Ras2p through a thioester linkage palmitoylation is
                     required for Ras2p localization to the plasma membrane"
                     /codon_start=1
                     /product="KLTH0A01452p"
                     /protein_id="XP_002551526.1"
                     /db_xref="GeneID:8290318"
                     /db_xref="InterPro:IPR019383"
                     /db_xref="UniProtKB/TrEMBL:C5DBC7"
                     /translation="MNSALTSSNSKHVVPDDSDQPKALFFNYHEFSVTDYAEIGKECS
                     EHEEELALCITHFPNTYAPLDSIRFKQTRIVRIPRRYEDNLDWPVFCTLLPGHEPAAL
                     VNQDGSLQFVPYGFYENQIYGLSSVSPLSSYLSPEEFKDIVETVNMYLRQGYDPNTWR
                     NIISATFDVLTFNLWNCLMIRLVSSPLLKLENYVETLNKSKLFKNKNIRLISPRRSGF
                     LSVC"
     gene            <133212..>134447
                     /locus_tag="KLTH0A01474g"
                     /db_xref="GeneID:8290319"
     mRNA            <133212..>134447
                     /locus_tag="KLTH0A01474g"
                     /product="KLTH0A01474p"
                     /transcript_id="XM_002551481.1"
                     /db_xref="GeneID:8290319"
     CDS             133212..134447
                     /locus_tag="KLTH0A01474g"
                     /note="similar to uniprot|P48567 Saccharomyces cerevisiae
                     YNL292W PUS4 catalyzes formation of Psi55 (modified
                     uridine) in mitochondrial and cytoplasmic tRNAs
                     Pseudouridine synthase"
                     /codon_start=1
                     /product="KLTH0A01474p"
                     /protein_id="XP_002551527.1"
                     /db_xref="GeneID:8290319"
                     /db_xref="GOA:C5DBC8"
                     /db_xref="InterPro:IPR002501"
                     /db_xref="InterPro:IPR014780"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DBC8"
                     /translation="MNGIFAIEKPSGISSSQFLLKLQNVLMNSSVFSREIQRATAERM
                     QQYQRETGKKPSKRKLRKVSKVKMGHGGTLDPLASGVLVVGVGTGTKKLSQYLSGTVK
                     VYESEALFGVSTTSGDVEGEILSMHSVSHLKMDDLKSVEKKMVGSLKQTPPIFAALKM
                     NGKPLHEYAREGIPLPRAIEPRQVEIYDLEVFPESLTRDHTYKLLRPATDADKEVVSE
                     LSHQGNLLTDKLFFSKQFCESQGWESEEAKVDPPIALSEEEMQQLLAEGDNYRAPLLH
                     FKAKVSSGTYIRSLISDIGKAMRSSCYMVKLVRCQQQEWALDKRNVFRMEDFTENDEA
                     VWTKVLEQVLEQGSSVDIMQELADAQDAFKKQKEDLEQQLKSELQSCSSAEVAEVDGS
                     ANPAKRPLDEDDSNSEAKS"
     gene            complement(<134444..>136030)
                     /locus_tag="KLTH0A01496g"
                     /db_xref="GeneID:8290320"
     mRNA            complement(<134444..>136030)
                     /locus_tag="KLTH0A01496g"
                     /product="KLTH0A01496p"
                     /transcript_id="XM_002551482.1"
                     /db_xref="GeneID:8290320"
     CDS             complement(134444..136030)
                     /locus_tag="KLTH0A01496g"
                     /note="similar to uniprot|P41821 Saccharomyces cerevisiae
                     YNL291C MID1 N-glycosylated integral plasma membrane
                     protein"
                     /codon_start=1
                     /product="KLTH0A01496p"
                     /protein_id="XP_002551528.1"
                     /db_xref="GeneID:8290320"
                     /db_xref="InterPro:IPR024338"
                     /db_xref="UniProtKB/TrEMBL:C5DBC9"
                     /translation="MTNEMYWGLWAITWIAAFLGTVQGYRDFSVSDEEVQRASLLNSN
                     LIQEWTPIESVITAGKRDYFTFQINSTYAHTMSKLDMLVFISGNLHSESARLSNSTEL
                     QLAVWYSFDQEVTSDTSKGSRALFSAGYMEALAATPLEDQDGNLTEYSNLYLVIEAYN
                     VTSNSPLQLTSTTQDLSWNYTIGVSQYDLVFQWDVRSWVELVDSDADSALLVTGNVTS
                     LTTTSANSSLYDVGLYELYLYSYDELIAFDKALPHSLRAVQDGPYLASSVNNSAVKIE
                     LSNSSTPEIVKSLTVRGGSVKEQFYITGLNHSTTYGVYLTKKISDNTEVLSDSGGILF
                     SKATFTTMADDSCSLIFGLDFCDGVAYSVPTAKSAGTNKTVTSLIYDGIASSLYSNFS
                     KALQMIPCDTEKDARFSPLRTCNDCANSYRNWLCAVTIPRCTTENSSYYIHRDKTQNR
                     NDFLNQQIQPIHDYYEILPCIDMCYNLAADCPPDFQFSCPSKTSHSELLYLSYSVWEE
                     NDFHTCNYVGNSRNLHILNS"
     gene            complement(136291..136394)
                     /locus_tag="KLTH0A01518r"
                     /db_xref="GeneID:8290321"
     tRNA            complement(join(136291..136335,136358..136394))
                     /locus_tag="KLTH0A01518r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (GCT) cove"
                     /db_xref="GeneID:8290321"
     gene            <137284..>138270
                     /locus_tag="KLTH0A01540g"
                     /db_xref="GeneID:8290322"
     mRNA            <137284..>138270
                     /locus_tag="KLTH0A01540g"
                     /product="KLTH0A01540p"
                     /transcript_id="XM_002551483.1"
                     /db_xref="GeneID:8290322"
     CDS             137284..138270
                     /locus_tag="KLTH0A01540g"
                     /note="highly similar to uniprot|P38629 Saccharomyces
                     cerevisiae YNL290W RFC3 Subunit of heteropentameric
                     Replication factor C (RF-C) which is a DNA binding protein
                     and ATPase that acts as a clamp loader of the
                     proliferating cell nuclear antigen (PCNA) processivity
                     factor for DNA polymerases delta and epsilon"
                     /codon_start=1
                     /product="KLTH0A01540p"
                     /protein_id="XP_002551529.1"
                     /db_xref="GeneID:8290322"
                     /db_xref="GOA:C5DBD0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR013748"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBD0"
                     /translation="MNRSAENLPWIEKYRPQTLDDVYGQREIVGTVRKFVKEGRLPHL
                     LFYGPPGTGKTSMIVALSREIYGTNYRNMVLELNASDDRGIDVVRNQIKEFASTRQIF
                     SKGFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYAHKLTPALLSRCTRFR
                     FQPLPTDAIEKRVNKVLILENLKLSREAFTALLRLSKGDMRRALNVLQASKATLDDPD
                     AEVTEDTIYECIGAPHPQDIETALESMLKDDWSTAFFTVNKIRTLKGLALIDLVEGIV
                     ETLEGYELKPETRVELLCKLSDIEYAMSKGGNDKVQSSAVIGVVKSSFELEA"
     gene            complement(<138389..>140236)
                     /locus_tag="KLTH0A01562g"
                     /db_xref="GeneID:8290323"
     mRNA            complement(<138389..>140236)
                     /locus_tag="KLTH0A01562g"
                     /product="KLTH0A01562p"
                     /transcript_id="XM_002551484.1"
                     /db_xref="GeneID:8290323"
     CDS             complement(138389..140236)
                     /locus_tag="KLTH0A01562g"
                     /note="similar to uniprot|P39980 Saccharomyces cerevisiae
                     YEL065W SIT1 Ferrioxamine B transporter member of the ARN
                     family of transporters that specifically recognize
                     siderophore-iron chelates transcription is induced during
                     iron deprivation and diauxic shift potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="KLTH0A01562p"
                     /protein_id="XP_002551530.1"
                     /db_xref="GeneID:8290323"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DBD1"
                     /translation="MVSFSILLHSGKNSRNKLKKMSLEGHPAKDAKDHAEQILARRKD
                     AGVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLA
                     TINCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGAC
                     IYQLGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWG
                     IGMWAFIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRL
                     DLLGLLLVCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSR
                     HPLVPWSLVKDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYS
                     FVSVITGFLLGGVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLL
                     GFGAGFFTYTTQTSIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRE
                     LRKRITDVATYTLAYGSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLL
                     LSAFFLRDHRLENAVALEDVDEKSSRKSDELEARIEDNTETKGFERYGI"
     gene            <141289..>142134
                     /locus_tag="KLTH0A01584g"
                     /db_xref="GeneID:8290324"
     mRNA            <141289..>142134
                     /locus_tag="KLTH0A01584g"
                     /product="KLTH0A01584p"
                     /transcript_id="XM_002551485.1"
                     /db_xref="GeneID:8290324"
     CDS             141289..142134
                     /locus_tag="KLTH0A01584g"
                     /note="similar to uniprot|P24867 Saccharomyces cerevisiae
                     YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
                     involved in entry into the mitotic cell cycle and
                     regulation of morphogenesis localizes to sites of
                     polarized cell growth"
                     /codon_start=1
                     /product="KLTH0A01584p"
                     /protein_id="XP_002551531.1"
                     /db_xref="GeneID:8290324"
                     /db_xref="GOA:C5DBD2"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:C5DBD2"
                     /translation="MRRCGMWAGGACGGQSTLSITASNENSVKMSDTKVLKILFKSPV
                     TDDMIRYLTNTTLSVLPCAREPRQAYPSPPSSPGAASKRALPSLMTFITRLVRYTNVY
                     TSTLLTATCYLEKLRRLLPRDAHGLPSTGHRIFLACLILSAKYHNDSSPQNKHWAAYT
                     DGLFCLDDVNLMERQLLQLLDWDLRVEEQELCDALEPLLEPIRHDLARSRKAMARNYY
                     HQRNMSTCSSTSTLVSTPSLPSLASMKSLTAMKSLPSLPRLPSKASLYAPLYSQCDYS
                     SATLV"
     gene            142562..142659
                     /gene="SNR40"
                     /locus_tag="KLTH0A01606r"
                     /db_xref="GeneID:8290325"
     ncRNA           142562..142659
                     /ncRNA_class="snoRNA"
                     /gene="SNR40"
                     /locus_tag="KLTH0A01606r"
                     /product="snRN40"
                     /note="C/D snoRNA monocistronic SNR40"
                     /transcript_id="XR_002432175.1"
                     /db_xref="GeneID:8290325"
     gene            <143444..>144091
                     /locus_tag="KLTH0A01628g"
                     /db_xref="GeneID:8290619"
     mRNA            <143444..>144091
                     /locus_tag="KLTH0A01628g"
                     /product="KLTH0A01628p"
                     /transcript_id="XM_002551486.1"
                     /db_xref="GeneID:8290619"
     CDS             143444..144091
                     /locus_tag="KLTH0A01628g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A01628p"
                     /protein_id="XP_002551532.1"
                     /db_xref="GeneID:8290619"
                     /db_xref="UniProtKB/TrEMBL:C5DBD3"
                     /translation="MTEQSTPLWLQDRDAVIAQTPAHMWRLGKPTYKFTDRRLNRERQ
                     VHFEPGSLGDLVTNLARVFEMEATNKANPDDWISVDPRVFRMTVNGSREYTVQDIVTK
                     GGYNVFLGDLPNYKASESDYAKSEDAFHKAFRTGFLWEILTLEAELPVATFTWRHWGQ
                     QNGVFNGHKGDGSVLDIKGTTRATLNDKLQLVRLEHTFDAPGMIDTLSGVCPMAH"
     gene            <144813..>145172
                     /locus_tag="KLTH0A01650g"
                     /db_xref="GeneID:8290326"
     mRNA            <144813..>145172
                     /locus_tag="KLTH0A01650g"
                     /product="KLTH0A01650p"
                     /transcript_id="XM_002551487.1"
                     /db_xref="GeneID:8290326"
     CDS             144813..145172
                     /locus_tag="KLTH0A01650g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A01650p"
                     /protein_id="XP_002551533.1"
                     /db_xref="GeneID:8290326"
                     /db_xref="UniProtKB/TrEMBL:C5DBD4"
                     /translation="MSESLEHKAEQAQQAAAVNAEHAQAKVAEVGDNAERSAQETQEK
                     AVAAAEEQAQEAKKEANKVEESAKKEAEGVKESAQDKVDEVKKTTAAEKSETAAAEGE
                     KVSPWKRFVAKLKKLLN"
     gene            <145378..>146538
                     /locus_tag="KLTH0A01672g"
                     /db_xref="GeneID:8290327"
     mRNA            <145378..>146538
                     /locus_tag="KLTH0A01672g"
                     /product="KLTH0A01672p"
                     /transcript_id="XM_002551488.1"
                     /db_xref="GeneID:8290327"
     CDS             145378..146538
                     /locus_tag="KLTH0A01672g"
                     /note="similar to uniprot|P53829 Saccharomyces cerevisiae
                     YNL288W CAF40 Evolutionarily conserved subunit of the
                     CCR4-NOT complex involved in controlling mRNA initiation
                     elongation and degradation binds Cdc39p"
                     /codon_start=1
                     /product="KLTH0A01672p"
                     /protein_id="XP_002551534.1"
                     /db_xref="GeneID:8290327"
                     /db_xref="InterPro:IPR007216"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DBD5"
                     /translation="MCRCSCYVVTCPRQYPFPVTNALTANFHTLGSRIARSLELFGPQ
                     TDSTSLQPQLRMFANPAAAPAASLGFAPSQQPQQSQQPQHAQQAQQAQQAQQAQQPGS
                     TAAAAAAKANLHALDDPNVYHWICQLTYGPNKEQALLELGRKREQYEDLAVVLWSSFG
                     VITALLNEITSVYPMLSPPVLSNQLSNRVCNALVLLQCVASHPETKNLFLQAHIPLLL
                     FPFLNTTSRQRTFEYLRLTSLGVIGALVKIDSAEVIAFLLRTDIIPLCLRIMESSSEL
                     SKTVAIFILQKILLDDAGLQYICATPERFLAVSQVLTYMVEQLTLQQTPGRLLKHVVR
                     CYLRLSDNLEARRLLKQVLPRQLKDNTFGEVLRDDLGTKRCLAQLLLTLNED"
     gene            <146853..>149654
                     /locus_tag="KLTH0A01694g"
                     /db_xref="GeneID:8290328"
     mRNA            <146853..>149654
                     /locus_tag="KLTH0A01694g"
                     /product="KLTH0A01694p"
                     /transcript_id="XM_002551489.1"
                     /db_xref="GeneID:8290328"
     CDS             146853..149654
                     /locus_tag="KLTH0A01694g"
                     /note="highly similar to uniprot|P32074 Saccharomyces
                     cerevisiae YNL287W SEC21 Gamma subunit of coatomer a
                     heptameric protein complex that together with Arf1p forms
                     the COPI coat involved in ER to Golgi transport of
                     selective cargo"
                     /codon_start=1
                     /product="KLTH0A01694p"
                     /protein_id="XP_002551535.1"
                     /db_xref="GeneID:8290328"
                     /db_xref="GOA:C5DBD6"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR009028"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013040"
                     /db_xref="InterPro:IPR013041"
                     /db_xref="InterPro:IPR015873"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017106"
                     /db_xref="UniProtKB/TrEMBL:C5DBD6"
                     /translation="MSTHTYKKFEEADSGILPDKMTIYQDCLNAFNESPVNAKRCRLL
                     ISRLLQLLAQGQTFPRTEATALFFAISKLFQHPNDSLRQAVYLAIKELSAVSDDVLMA
                     TSSIMKDVQNGSDMIKPNAIRSLTRVLDESTAFSAERLFKSAVVSKHPSISSAALVSS
                     YHLLPVAESTVKRYANETQEAVSDLKTYPYQSGTSEHYPNSTYIAQYHALGLLYLLRK
                     HDKVALMKLVQQFSAGNLLKNQLAQVQLVKLVGSLLQKDPQLVTQFTPLLLSWLSNKY
                     ESVQLEDAKLITSLPDRFVSPEIFASAVQTLQGLLTVPRVTTRFAAVRVLNRISMVAP
                     EKIVVCNPELESLINDSNRNVSTYAITSLLKTGTSNNIASLIKTITNFIHEISDDFKI
                     IIIDAVRTMALKFPEEWKSILNFLINVLKQGEGGFEFKNSIVEALFDLVQFVPQSREL
                     AFENLCDFIEDCEYNEILVRILHILGKEGPSMKIPSLYVRHIYNRVVLENSIVRSAAV
                     VALSKFALVKNDPTLVESIEILLRRISNDADDEVRDRATISLEFIESIKSKEGASSSA
                     AEDLLQSKYSYDLVSLESKLSQYMSAKQESFKAPFDSSSVHRYTEDERKAIDLKRKQE
                     QLFSALPSAGKSKRAASSSQDAEKRNGSYAGPASNEVDQDLQSTKFVEELESIEELKS
                     LGPIINTSKEVPLTETEAEFVVSGVKHLFKNHVVLQFHITNTLTDVALDNVSVGCTME
                     QEDSTALQETSTIPVDRIMPSETFACYVVYEKSEEVVTEGFLNTLYFTTRELDATTHE
                     PFAGDEGFQDEYEIDSLFLTAGDYIKGSFVGNFSACFDELPHSEVAVYNIKENISLQE
                     VVDKLVVNTSCLTLDNTQFAPTDSNSHTLKLFGKSVLNGARVALVVRMIKSSKGIALK
                     GEIRSDDANLCNDVVDGLI"
     gene            <149859..>150749
                     /locus_tag="KLTH0A01716g"
                     /db_xref="GeneID:8290329"
     mRNA            <149859..>150749
                     /locus_tag="KLTH0A01716g"
                     /product="KLTH0A01716p"
                     /transcript_id="XM_002551490.1"
                     /db_xref="GeneID:8290329"
     CDS             149859..150749
                     /locus_tag="KLTH0A01716g"
                     /note="similar to uniprot|P53830 Saccharomyces cerevisiae
                     YNL286W CUS2 Protein that binds to U2 snRNA and Prp11p may
                     be involved in U2 snRNA folding contains two RNA
                     recognition motifs (RRMs)"
                     /codon_start=1
                     /product="KLTH0A01716p"
                     /protein_id="XP_002551536.1"
                     /db_xref="GeneID:8290329"
                     /db_xref="GOA:C5DBD7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DBD7"
                     /translation="MDEEELQLKKELREKKAQELARRKRARDNTERKEDTKRPLKNCA
                     IYISHLPLEVTKDEVIEEFTKYGVIRKDLKSSEPKCKFYYGVDGSFEGAALIVYMRPE
                     SVRMAVDLMDGYSFMGNKLKVEEATFKKEPKDDKKSPNASQEGSRDVSAEPKLNNIHA
                     KLNEQERELQDWDDTTDEKTTPREEGSEVDSIPDESENASSRTVVLANVLDLYANLAP
                     QQIAEVAADLKEGCEAIGSVSSFEFDEVLGQAKVEYKSSEIAQKCCQLMNGRYFDGRK
                     LVAYNLEQGEEEEEDEVAEW"
     gene            complement(151340..151411)
                     /locus_tag="KLTH0A01738r"
                     /db_xref="GeneID:8290330"
     tRNA            complement(151340..151411)
                     /locus_tag="KLTH0A01738r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (TCC) cove score=66.72"
                     /db_xref="GeneID:8290330"
     repeat_region   complement(151472..151734)
                     /rpt_type=long_terminal_repeat
     gene            <152482..>153663
                     /locus_tag="KLTH0A01782g"
                     /db_xref="GeneID:8290332"
     mRNA            <152482..>153663
                     /locus_tag="KLTH0A01782g"
                     /product="KLTH0A01782p"
                     /transcript_id="XM_002551491.1"
                     /db_xref="GeneID:8290332"
     CDS             152482..153663
                     /locus_tag="KLTH0A01782g"
                     /note="highly similar to uniprot|P38219 Saccharomyces
                     cerevisiae YBR025C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A01782p"
                     /protein_id="XP_002551537.1"
                     /db_xref="GeneID:8290332"
                     /db_xref="GOA:C5DBD8"
                     /db_xref="InterPro:IPR004396"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR013029"
                     /db_xref="InterPro:IPR023192"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBD8"
                     /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCP
                     LGNPANYPFATIDPEEARVIVPSPRFDALCDIYKPASKVPAHLTVYDIAGLTKGASAG
                     EGLGNAFLSHIRAVDSIYQVVRCFDDAEIIHIEGDVDPVRDLDIISTELRLKDIEFAE
                     KHLENVHKITKRGGQSLEVKQKKEEAILVEKIIELLKSGQRVANQNWTTKEVEVINSM
                     FLLTAKPSIYLINLSERDFIRKKNKHLMRIKEWIDKYSTGDLVIPFSVCLEERLSHMS
                     PEEAEEELKNLKVESALPKIVTTMRQKLDLISFFTSGADEVREWTIRRGTKAPQAAGV
                     IHNDLMNTFILAQVMKYEDVVEYKDEVAIKAAGKMQQKGKEYVVEDGDVIYFRAGAGK
                     N"
     gene            complement(<153812..>154807)
                     /locus_tag="KLTH0A01804g"
                     /db_xref="GeneID:8290333"
     mRNA            complement(<153812..>154807)
                     /locus_tag="KLTH0A01804g"
                     /product="KLTH0A01804p"
                     /transcript_id="XM_002551492.1"
                     /db_xref="GeneID:8290333"
     CDS             complement(153812..154807)
                     /locus_tag="KLTH0A01804g"
                     /note="similar to uniprot|P23833 Saccharomyces cerevisiae
                     YBR037C"
                     /codon_start=1
                     /product="KLTH0A01804p"
                     /protein_id="XP_002551538.1"
                     /db_xref="GeneID:8290333"
                     /db_xref="GOA:C5DBD9"
                     /db_xref="InterPro:IPR003782"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017276"
                     /db_xref="UniProtKB/TrEMBL:C5DBD9"
                     /translation="MLSRTGVFTVLKRSTRLSGYALRPLSTRSCLRVEDQGTSRSRVT
                     PRGGAPSGASSSTDPSDQSAFSGNTPPKSTTFEDADPKRKPLSRIAIGGTETKSQKAT
                     SGSIEFATWKAAALVLTLGGTLYYFFSKEKRRLEIEKEAEANRGYGKPLVGGPFKLVD
                     FNGNEFTEKNLLGKFSIIYFGFSHCPDICPDELDKLSEWLDGLKKKGIELQPIFITCD
                     PARDPPHVLKEYLSEFHPDLIGLTGEYNDIKNACKQYRVYFSTPPSLKPGQDYLVDHS
                     IFFYLMDPEGQFIDALGRQYDAETGVAKIEEHVKAYVPREQREKRKEKWYSFLFN"
     gene            <155431..>158223
                     /locus_tag="KLTH0A01826g"
                     /db_xref="GeneID:8290334"
     mRNA            <155431..>158223
                     /locus_tag="KLTH0A01826g"
                     /product="KLTH0A01826p"
                     /transcript_id="XM_002551493.1"
                     /db_xref="GeneID:8290334"
     CDS             155431..158223
                     /locus_tag="KLTH0A01826g"
                     /note="similar to uniprot|P14180 Saccharomyces cerevisiae
                     YBR038W CHS2 Chitin synthase II requires activation from
                     zymogenic form in order to catalyze the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin required for the
                     synthesis of chitin in the primary septum during
                     cytokinesis"
                     /codon_start=1
                     /product="KLTH0A01826p"
                     /protein_id="XP_002551539.1"
                     /db_xref="GeneID:8290334"
                     /db_xref="GOA:C5DBE0"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DBE0"
                     /translation="MDYNPFVVDTNNASPVRSPQRAARRGESPWRSQYSANSSNENDL
                     STAFQGFPQAAQVQPQSPSKAAAKYSPQRRNIFARDSAPSSPLRQDRYTANMRESPHR
                     NARAVIEIDEASDDDEEQDLYDIYAQQADGSPSRAASRATRSTYSFESYRKSLDDDST
                     IYSGDTFEQTQFQVNHPQKNYIRRGKSEVRRLPAPTSKKNILKLDNPIPRGLLEILPR
                     RDSLEFTEMRYTACTSEPDNYVNEGYSLRFAEMNRECQIAICVTMYNEDKFALSSTLH
                     SIMRNITHMCKRKRSHVWGPQGWKKIQVIIVSDGRNNINKGSLDYLSALGVYQEDMAK
                     STVNGEPVKAHIFELTTQVSIDSHLDYVSKDIVPVQVVFCLKEENQKKINSHRWLFNA
                     FCPILDPTVVVLVDVGTKLNDSAIYHLWKAFDRDSNVAGAAGQIKTMKGKWGRKLLNP
                     LVASQNFEYKMSNILDKPLESVFGYISVLPGALSAYRYRALKNHADGTGPLNSYFLGE
                     TQEGRQHDVFTANMYLAEDRILCWELVAKRDAKWVLKYVKEATGETDVPEEPPEFISQ
                     RRRWLNGAMFAALYAQLHFTQIWKTKHSATRKIFFHLEFFYQFVQMLFSWFSISNFFL
                     TFYFLAGSMNKLMKHGDVLFTFFKYLVICDLAALFIISMGNRPQGANHLFIISMIILS
                     ICSTYALVCGLVFSIKTLQNPGESSMVFVNIVVSLLSTYGLYAFTSIMYLDPWHLITS
                     FVQYLLMLPSFICTLQIFAFCNTHDVSWGTKGSTQDVKPKSEATVKQGPNGQQIVEGT
                     EWPQEVDKKYAEIKSRLKEQEIIEPKIDEAQKNNDYYRDIRTRIVMLWMLSNLVLMMI
                     VTQVYGPEDTAKNKYLTFILWSVAILALFRALGSMAFLFLKSLRAIVSFKHKAEDSGS
                     LNIPSAKNLFSKPSKM"
     gene            complement(<158347..>159708)
                     /locus_tag="KLTH0A01848g"
                     /db_xref="GeneID:8290335"
     mRNA            complement(<158347..>159708)
                     /locus_tag="KLTH0A01848g"
                     /product="KLTH0A01848p"
                     /transcript_id="XM_002551494.1"
                     /db_xref="GeneID:8290335"
     CDS             complement(158347..159708)
                     /locus_tag="KLTH0A01848g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A01848p"
                     /protein_id="XP_002551540.1"
                     /db_xref="GeneID:8290335"
                     /db_xref="GOA:C5DBE1"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="UniProtKB/TrEMBL:C5DBE1"
                     /translation="MSTKSTTTTDLTCESGILNIPAAAPLAINPGRLNQTILETGTAY
                     GGVARWGSQEHEFGMRRLAGTEEDGKMRGWFIKECEGLGCKIKVDQIGNIFAIFPGKN
                     GGNPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKENNYTPNYDVCVVVWFNEEGA
                     RFARSCTGSSVWSHDLPLKDAYELMSIGESIPESVYESLSKIGYIGEVSASYQENAID
                     AHFELHIEQGPILEDEKKEIGIVTGVQAYRWEKCTVFGVGAHAGTTPWRCRKDALLAS
                     SKMIVAASEIAKKHQGLMTCGVIDAKPYSVNIIPGEVSFTIDIRHPSDEVVAKIFSEV
                     HAQFDLIVKDNVAGALTYDLEVLQVSPAVNFNEVCIECVSRSALAQFPASKVRQIWSG
                     AGHDSCQTALHVPTSMIFIPSKDGLSHNFYEYSSAEEVENGFKVLLQAIVNYDNHRAI
                     RGY"
     gene            <160925..>164152
                     /locus_tag="KLTH0A01870g"
                     /db_xref="GeneID:8290336"
     mRNA            <160925..>164152
                     /locus_tag="KLTH0A01870g"
                     /product="KLTH0A01870p"
                     /transcript_id="XM_002551495.1"
                     /db_xref="GeneID:8290336"
     CDS             160925..164152
                     /locus_tag="KLTH0A01870g"
                     /note="similar to uniprot|P29465 Saccharomyces cerevisiae
                     YBR023C CHS3 Chitin synthase III catalyzes the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin required for
                     synthesis of the majority of cell wall chitin the chitin
                     ring during bud emergence and spore wall chitosan"
                     /codon_start=1
                     /product="KLTH0A01870p"
                     /protein_id="XP_002551541.1"
                     /db_xref="GeneID:8290336"
                     /db_xref="GOA:C5DBE2"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DBE2"
                     /translation="MVAEDDYYAFDNESLLRSRTGASGVQHGDSLVRRDRNDFADPGN
                     PHHYYAQKAQEQRQKGHVQVQESIPLQDMSDRPQKAAQAKKANSLSLWQLYCYVITFW
                     APAPLLSLFGMTKKERQFAWREKIALLSVIVYAGAFVAYLTFGFTRTVCSGSILRLRN
                     NEVSTGYLIINGKSYSLDSSSHPEAAGIEDGTNVLYPPINAGGMDASFLFQNVNGNCK
                     GLITPKDNCSIPYSDDSLAWYFPCKLFSQDGSTQPNFTKSEYYDGWACHTSETAREAY
                     YSLSAAADVYFTWDDIKNSTRNLVVYNGHVLDLDLLNWLQTDDLDYPPLFDQLRDSKL
                     QGYDISLVLSDSFERRAARCLSEIIKVGEIDSSTIGCLASQVVLYISLVFILSVVVLK
                     FLIACYFRWFVAKKQGAFNDDNKTMNQHAKQIEDWSGDMNAQGPIRKMEPYSRPGDQR
                     RLSTLDLIKRNSRMLLNDTVDVTDKFHGMTTMTTQSYLKANTPDINLDKNAFQSPFTN
                     DLISSSQAQETLDPTIIHPEVVTQPPADYMPSSYPLIHTVCFVTCYSEDEEGLRTTLD
                     SLSTTDYPNSHKLIMVVCDGIIKGSGNDRTTPEIALSMVEDFVVPPEEVEPHSYVAVA
                     SGSKRHNMAKVYAGFYKYNDATIPSELQQRVPMVVVVKCGTPDEQGSMKPGNRGKRDS
                     QVILMSFLQRLTFDERMTAFEYQLLKNIWQITGLMAEFYELVLMVDADTKVFPDSLTN
                     MAAEMVKDPEIMGLCGETKIANKGTSWVTWIQVFEYYISHHQAKAFESVFGSVTCLPG
                     CFSIYRIKAPKGKDGYWVPILANPDIVERYSDNDTGTLHKKNLLLLGEDRFLSSLMLK
                     TFPKRKQVFVPKAACKTIVPDKFKVLLSQRRRWINSTVHNLMELVLVKDLCGSFCFSM
                     QFVIGMELIGTMVLPLAICFSIYVVIFAIVSHPTPIVTLVLLAIILGLPGLLIVVTAT
                     RISYLGWMFIYLLALPIWNFVLPVYAYWKFDDFSWGDTRTIAGGNKSAHEEEEGEFDH
                     SKIRMRTWREFQKEEHSNDDDRGQHSRLNSILNLDLLPESSNFHR"
     gene            complement(<164315..>164866)
                     /locus_tag="KLTH0A01892g"
                     /db_xref="GeneID:8290337"
     mRNA            complement(<164315..>164866)
                     /locus_tag="KLTH0A01892g"
                     /product="KLTH0A01892p"
                     /transcript_id="XM_002551496.1"
                     /db_xref="GeneID:8290337"
     CDS             complement(164315..164866)
                     /locus_tag="KLTH0A01892g"
                     /note="similar to uniprot|P38218 Saccharomyces cerevisiae
                     YBR022W POA1 Phosphatase that is highly specific for
                     ADP-ribose 1''-phosphate a tRNA splicing metabolite may
                     have a role in regulation of tRNA splicing"
                     /codon_start=1
                     /product="KLTH0A01892p"
                     /protein_id="XP_002551542.1"
                     /db_xref="GeneID:8290337"
                     /db_xref="InterPro:IPR002589"
                     /db_xref="UniProtKB/TrEMBL:C5DBE3"
                     /translation="MGVSNVRYVRGNCLAASISHPRILIHSCNCNGSWGGGIAYQLGA
                     KFPKAEGDYIELCEKFGSSLLGKFVLIPSYTDSTLLIGCLFTASFGGSQQGTGDSILS
                     YTKQALEDMRIKIFSDTGSGGEIDSFSRKYIQRFKDKLKVPVADYKLEMPQINSGIFG
                     VPWPKTEQLLAEQSSLSFTVYVL"
     gene            complement(<165071..>169570)
                     /locus_tag="KLTH0A01914g"
                     /db_xref="GeneID:8290338"
     mRNA            complement(<165071..>169570)
                     /locus_tag="KLTH0A01914g"
                     /product="KLTH0A01914p"
                     /transcript_id="XM_002551497.1"
                     /db_xref="GeneID:8290338"
     CDS             complement(165071..169570)
                     /locus_tag="KLTH0A01914g"
                     /note="similar to uniprot|P32568 Saccharomyces cerevisiae
                     YDR011W SNQ2 ABC transporter"
                     /codon_start=1
                     /product="KLTH0A01914p"
                     /protein_id="XP_002551543.1"
                     /db_xref="GeneID:8290338"
                     /db_xref="GOA:C5DBE4"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010929"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029481"
                     /db_xref="UniProtKB/TrEMBL:C5DBE4"
                     /translation="MSADVQAKSGAEPRSGAASSRSEAEHEAAYTGPGTKEEFQDARQ
                     SDGQAARDHIVRLMARRTSSVGEEEDLDPEVLSRVETLARTLSSHRMRNGVLQVDPDD
                     FDAEAIIRAHVRGSEEQGIHLRRAGVIGENFTVVGKDCSSVEAQTFEDILLLPRTIFR
                     GIREAKNRKTRDIVRNANILARPGEMILVLGRPGAGCSSFLKTVSGEVDNFEEVRGEI
                     SYDGISQKEMMAKFKTDVIYNGETDVHFPHLTVQQTLDFALSCTTPQKRLDNASRSEY
                     ITAMRELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALASRGSIYCWDNATR
                     GLDASTALEFAQAIRIMTNLQKSVAFVTIYQASENIYECFDKVTVLFDGRQIYYGHVE
                     DAKAYFKKLGFLCPARQASAEFLTALTDPNGLHEYVPGFENKVPRTADEFEKLWLESQ
                     EYQDLLKDIDNYKRETEAEKTKELFSASLAQEKSKLNRKKSKYTVSFAEQVKLCTKRG
                     VQRIYGDKAYTITNLIASIIQSLVSGSLYYNLPSGVSGAFSRGGVFYFSILYVSLMGL
                     AKISLDGRPVVQKHKSYSLYHPAAEALATSLSEFPFRFLSQTCFYIIIYFLSGLTREA
                     NRFFTSFLFLILCSESINAFFELITAFSSSVAQANSIAGTSLMALVLYSTYMIQLESM
                     HPWFKWISYCIPIRYTFESMLNSEFHARKMDCTGSIIPAGPAYANVATENQVCAFVGS
                     KPGQDYVNGDDYIKANYGYKYDHTWRNLGFLFAFLAVYVALKCLITELNTTSMGSGDT
                     LVFKKGAKRVSPSSDEESREKSLTMSEAKKNLDSNASTSGSSAEALQGLKSTGIFIWR
                     NVCYTIPYRGSTRRLLDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDM
                     LVNGNHIDASFERRTGYVQQQDVHVKEMTVRESLQFAARMRRPQSVPEAEKMAYVEDI
                     IEILDMEEYADALVGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSSW
                     AIVQLMRRLAEAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGKNSRTLLN
                     YFEGNGARKCEHTENPAEYILEAIGAGATASVKEDWHEIWTNSPQFNEANEEIENYLR
                     DSKQNSPPADKNEKISKYATSYSYQFRYVLQRTATIFWRNSEYLIAKMMLYISAGLFI
                     GFTFYNVGTSYRGLQNTMFAAFMALIVSAPAMNQIQARAIASRELFEVRESKSNTFHW
                     IFLLLTQYLCEIPYHLVFSTLFFVAFYFPLRVHFAATYSGVFFLNYCIMFQLYLVGLG
                     LMLLYAAPNLPSAGVLLSLCLSFLISFCGVVQPASLMPGFWTFMWKASPYTYFVQNAI
                     SLVLHKKPVRCKKNEMSYVNPPAGQTCGEYMSAFLKTAAGYINNPNDTENCGYCVFEV
                     GDDYLSQISVKYSYLWRNFGFFWVYICFNIFAMAVLYYIFHVRSFSLKQTKLGKMIMG
                     KMKKE"
     gene            complement(<171070..>172647)
                     /locus_tag="KLTH0A01936g"
                     /db_xref="GeneID:8290339"
     mRNA            complement(<171070..>172647)
                     /locus_tag="KLTH0A01936g"
                     /product="KLTH0A01936p"
                     /transcript_id="XM_002551498.1"
                     /db_xref="GeneID:8290339"
     CDS             complement(171070..172647)
                     /locus_tag="KLTH0A01936g"
                     /note="similar to uniprot|P04385 Saccharomyces cerevisiae
                     YBR020W GAL1 Galactokinase phosphorylates
                     alpha-D-galactose to alpha-D-galactose-1-phosphate in the
                     first step of galactose catabolism expression regulated by
                     Gal4p and similar to YDR009W uniprot|P13045 Saccharomyces
                     cerevisiae YDR009W GAL3 Transcriptional regulator involved
                     in activation of the GAL genes in response to galactose
                     forms a complex with Gal80p and Gal4p to relieve
                     inhibition by Gal80p binds galactose and ATP but does not
                     have galactokinase activity"
                     /codon_start=1
                     /product="KLTH0A01936p"
                     /protein_id="XP_002551544.1"
                     /db_xref="GeneID:8290339"
                     /db_xref="GOA:C5DBE5"
                     /db_xref="InterPro:IPR000705"
                     /db_xref="InterPro:IPR006203"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR006206"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR019539"
                     /db_xref="InterPro:IPR019741"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="UniProtKB/TrEMBL:C5DBE5"
                     /translation="MILSNELTSLKLPMSVHSFDTKGLPAGLRPRVSRIVNDFQSVYG
                     QTPHFVSRSPGRVNLIGDHIDYVDFSVLPMAIDADLLCAVGVLSTEDIPSITLINEDP
                     KFAQRKFDLPLDGSDISIDPSVSDWSNYFKCGLLVAQQHLKTQFPQKFQEAPLAGMEM
                     YVSGNVPTGGGLSSSAAFICAVALAVIRSNTSSNYKVSKQVLTQITVKAEHYVGVNNG
                     GMDQAASVCGESEHALYVEFQPQLKATPFKFPELQNSEIQFIIANTMVVSNKVETAPT
                     NYNLRVVEVTVAANVLASKFKVALQRTGNLEKGTLREFMDAYYSRYHGVSEPWDGNAE
                     DGIIRLTEMLHVVEKSLTQQEGYSVQDAATALQCSQQEFARDYLTNFPVRFEALKLYQ
                     RAKHVFSEALRVLLALKLLTSRKSEGDQRFLESFGDLMNESQKSCDTLYGCSCPETDE
                     LCRIAKANGAYGSRLTGAGWGGCTVHLVTRDNAEQVRSALANQYYRKRFRNMPSEELR
                     EAVFISKPAQGSCLFEI"
     gene            <172931..>174997
                     /locus_tag="KLTH0A01958g"
                     /db_xref="GeneID:8290340"
     mRNA            <172931..>174997
                     /locus_tag="KLTH0A01958g"
                     /product="KLTH0A01958p"
                     /transcript_id="XM_002551499.1"
                     /db_xref="GeneID:8290340"
     CDS             172931..174997
                     /locus_tag="KLTH0A01958g"
                     /note="similar to uniprot|P04397 Saccharomyces cerevisiae
                     YBR019C GAL10 UDP-glucose-4-epimerase catalyzes the
                     interconversion of UDP-galactose and UDP-D-glucose in
                     galactose metabolism also catalyzes the conversion of
                     alpha-D-glucose or alpha-D-galactose to their
                     beta-anomers"
                     /codon_start=1
                     /product="KLTH0A01958p"
                     /protein_id="XP_002551545.1"
                     /db_xref="GeneID:8290340"
                     /db_xref="GOA:C5DBE6"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005886"
                     /db_xref="InterPro:IPR008183"
                     /db_xref="InterPro:IPR011013"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018052"
                     /db_xref="InterPro:IPR025308"
                     /db_xref="UniProtKB/TrEMBL:C5DBE6"
                     /translation="MTGLKQDKDGWVLVTGGAGYIGSHAVAELIESGYRCIVVDNFSN
                     SCYEPIARLKVLLETEIPFFKVDLTDADGLEKVFRKFKIDSVIHFAGLKAVGESTKIP
                     LSYYYNNITGTLVLLDIMKKYGTEMLVFSSSATVYGDATRFPDMIPIPEECPTGPTNP
                     YGKTKLAIEEILEDLHASEPEKWRFAVLRYFNPIGAHPSGLIGEDPLGIPNNLLPYMA
                     QVAVKRREKLFVFGNNYSSRDGTPIRDYIHVVDLAKGHIAALKYLNEIKGGQGLCRAW
                     NLGSGTGSTVLEVYKAFCHSCGIELPYEIVGRRAGDVLNLTAKPDRATRELKWTTNLK
                     VSDACADLWKWTTKNPYGYQLLGVVDTFFNQPGEYESRLITLGRGSGFEVSLSNIGAT
                     IVDLRVDGKPVVLGLTSEAEYLDSSNPYLGATIGRYANRLRDGKFNVKGVDYLLDLNE
                     QWSTVHSSSQSYHRRRFLGPLILNPMKHQYFAKYVLLDSNTQFPGEVLASVTYSLDVR
                     AKELQIQYEGRLLNGDTTIMNLTNHSYFNLNVFQNASYNGTEIQLFSDQAVELDDAKC
                     PSGRIVKVSGPSSFTLDECEPPFDTCFVTGTVPCIDTRANELKPVLKAQHPESGLKLI
                     ISTTEPSFQFYTGGPGILKGYGKKSGFCCEPGRFINAANVPEWKEAVTLESSAVYGSK
                     TSYNFG"
     gene            <175574..>176677
                     /locus_tag="KLTH0A01980g"
                     /db_xref="GeneID:8290341"
     mRNA            <175574..>176677
                     /locus_tag="KLTH0A01980g"
                     /product="KLTH0A01980p"
                     /transcript_id="XM_002551500.1"
                     /db_xref="GeneID:8290341"
     CDS             175574..176677
                     /locus_tag="KLTH0A01980g"
                     /note="similar to uniprot|P08431 Saccharomyces cerevisiae
                     YBR018C GAL7 Galactose-1-phosphate uridyl transferase
                     synthesizes glucose-1-phosphate and UDP-galactose from
                     UDP-D-glucose and alpha-D-galactose-1-phosphate in the
                     second step of galactose catabolism"
                     /codon_start=1
                     /product="KLTH0A01980p"
                     /protein_id="XP_002551546.1"
                     /db_xref="GeneID:8290341"
                     /db_xref="GOA:C5DBE7"
                     /db_xref="InterPro:IPR001937"
                     /db_xref="InterPro:IPR005849"
                     /db_xref="InterPro:IPR005850"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019779"
                     /db_xref="UniProtKB/TrEMBL:C5DBE7"
                     /translation="MTVNSGNFDFTDNSHRRFNPLTNSWVLVSPHRAKRPWMGQQEVP
                     FSPNEPEFDAKCYLCPGNTRASGEINPQYPSTFIFPNDFPAVKLNQPNFIDDGKEMTL
                     KDRFMRAQQVEGKCFVICFSPKHNLTIPRMKIGELKNVVDAWAKLYLELEAEARTKAT
                     PYKYLQIFENKGTAMGCSNLHPHGQAWCLSTIPDEVDKEFRSFAKYSKEHSSCLLGDY
                     IALELEERDRIVLQNDSFLVVVPYWAVWPFETLLMSKQHLCSLADFNDQQKLELASII
                     KKLTTKYDNLFETSFPYSMGLHQAPLNAIQQANNSSWFHMHFYPPLLRSATVRKFLVG
                     FELLGEPQRDLTAEQAAKRLADLEEEVHFTEIR"
     gene            177135..177225
                     /locus_tag="KLTH0A02002r"
                     /db_xref="GeneID:8290342"
     tRNA            join(177135..177171,177190..177225)
                     /locus_tag="KLTH0A02002r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8290342"
     gene            complement(<177329..>178861)
                     /locus_tag="KLTH0A02024g"
                     /db_xref="GeneID:8290343"
     mRNA            complement(<177329..>178861)
                     /locus_tag="KLTH0A02024g"
                     /product="KLTH0A02024p"
                     /transcript_id="XM_002551501.1"
                     /db_xref="GeneID:8290343"
     CDS             complement(177329..178861)
                     /locus_tag="KLTH0A02024g"
                     /note="similar to uniprot|P43590 Saccharomyces cerevisiae
                     YFR006W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A02024p"
                     /protein_id="XP_002551547.1"
                     /db_xref="GeneID:8290343"
                     /db_xref="GOA:C5DBE8"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C5DBE8"
                     /translation="MPFADQLLTFSLAFLAYQLGRDSLEFTFSSRPQQKMSPSDSDLP
                     KGKYPAKKHALKIKKNFLSKKGEEQTESTLFVAGGEIEPIKYCDQTKEFRQNRYFFYL
                     TGVNIPGSAAFFDFKSEKLTLFLPDVDSDDVMWSGLPLSVEAAYEKFDVDEVLYAKKL
                     PSFLSKFESSCIYTTDLDNVHDPNVAEMLVPSDPDLFYALDESRLTKDEYEIGLLRRA
                     AKITDNCHLSVMSALPIEKNEGHFHAEFTYHAIRQGSKHQGYDPICCSGPNCSTLHYV
                     KNDESLENKQSVLMDAGAEWENYTADVTRCFPLNGKFTKEHREIYDTVLKMQTEVMDR
                     IKPGVEWEKLHILAHRVLIRSFLNLGIFKSGYSEEEILDRKASLCFFPHGLGHLLGMD
                     THDVGGRANYEDSNPLLKFLRLRRPLEENMVVTNEPGVYFNPFLIEEFLIKYPKRKEV
                     VNEEIMEKYMYVGGVRIEDDVLVTADGCENLTGITSDPEEIERIVCDGINKGRSHFHV
                     IA"
     gene            <179012..>180424
                     /locus_tag="KLTH0A02046g"
                     /db_xref="GeneID:8290344"
     mRNA            <179012..>180424
                     /locus_tag="KLTH0A02046g"
                     /product="KLTH0A02046p"
                     /transcript_id="XM_002551502.1"
                     /db_xref="GeneID:8290344"
     CDS             179012..180424
                     /locus_tag="KLTH0A02046g"
                     /note="similar to uniprot|P43589 Saccharomyces cerevisiae
                     YFR005C SAD1 Conserved zinc-finger domain protein involved
                     in pre-mRNA splicing required for assembly of U4 snRNA
                     into the U4/U6 particle"
                     /codon_start=1
                     /product="KLTH0A02046p"
                     /protein_id="XP_002551548.1"
                     /db_xref="GeneID:8290344"
                     /db_xref="GOA:C5DBE9"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR001607"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DBE9"
                     /translation="MAPSRTIEMEKRARSPSQSSDGTPSKKISLAGAQVQPYLETVDV
                     RKLDFDLEKLCSVTLSPLNVYCCLVCGRYLQGRGEKTVAFLHSIQEDHHVFINFVSLK
                     TYLLPENREVQGVQLLETIKFAISPKYTQEDLLQFPRMCFDKSNTPYINGFIGLNDLG
                     DNTHLSVIIQMMAHITPIRDFFLLESQSKIDDELIKRLALLIKKLWSPHILKAHLSPY
                     ELLQQLSRVNKNVNSDNRIKDPKSFMLWLINYMIAKAHPLKKVLTRNMRGEVEVRSIV
                     VREKGTTGEKNLEFFEDEATKTIVLPKFWSLTLDLPPVSLFNEGSDTNSIPQVTLDSL
                     LGKFSGHKKIPTREGMKQYKIVKYPRFLAINFDRFNWDAAMPIRNRNRTLVKFADALR
                     FENKDYRLIANVTLYPVGHSRSGDEDVDDEARWKIQLSNPKNAEWFEIDGKNVTAKEK
                     ELLFLDEVYIQVWEMEQNKS"
     gene            complement(<180496..>181434)
                     /locus_tag="KLTH0A02068g"
                     /db_xref="GeneID:8290345"
     mRNA            complement(<180496..>181434)
                     /locus_tag="KLTH0A02068g"
                     /product="KLTH0A02068p"
                     /transcript_id="XM_002551503.1"
                     /db_xref="GeneID:8290345"
     CDS             complement(180496..181434)
                     /locus_tag="KLTH0A02068g"
                     /note="highly similar to uniprot|P43588 Saccharomyces
                     cerevisiae YFR004W RPN11 Metalloprotease subunit of the
                     19S regulatory particle of the 26S proteasome lid couples
                     the deubiquitination and degradation of proteasome
                     substrates"
                     /codon_start=1
                     /product="KLTH0A02068p"
                     /protein_id="XP_002551549.1"
                     /db_xref="GeneID:8290345"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="InterPro:IPR024969"
                     /db_xref="UniProtKB/TrEMBL:C5DBF0"
                     /translation="MERLQRLMMNQRAGVMGGAAAAETPMDDTKETVYISSLALLKML
                     KHGRHGVPMEVMGLMLGEFVDDYTVNVVDVFAMPQSGTGVSVEAVDDVFQAKMMDMLK
                     QTGRDQMVVGWYHSHPGFGCWLSSVDVNTQKSFEQLNSRAVAVVVDPIQSVKGKVVVD
                     AFRLIDTNMIMRNQEPRQTTSNAGLLNKPNIQALIHGLNRHYYSLNIDYHKTVAETNM
                     LLNLHKEQWQSGLKMNDYKEKEHNNLQATQKMLKIAELYSKRIEEEKDLTEEELKTRY
                     VGKQDPKKHLADTAEGVLEENIMSVLTAGVNSVAIK"
     gene            <181671..>182171
                     /locus_tag="KLTH0A02090g"
                     /db_xref="GeneID:8290346"
     mRNA            <181671..>182171
                     /locus_tag="KLTH0A02090g"
                     /product="KLTH0A02090p"
                     /transcript_id="XM_002551504.1"
                     /db_xref="GeneID:8290346"
     CDS             181671..182171
                     /locus_tag="KLTH0A02090g"
                     /note="similar to uniprot|P43587 Saccharomyces cerevisiae
                     YFR003C YPI1 Inhibitor of the type I protein phosphatase
                     Glc7p which is involved in regulation of a variety of
                     metabolic processes overproduction causes decreased
                     cellular content of glycogen"
                     /codon_start=1
                     /product="KLTH0A02090p"
                     /protein_id="XP_002551550.1"
                     /db_xref="GeneID:8290346"
                     /db_xref="InterPro:IPR011107"
                     /db_xref="UniProtKB/TrEMBL:C5DBF1"
                     /translation="MRAGKNAGSSRTRALDSTTTSTVQESAPVLQLRGSPNDQREGAT
                     HTPAATGSQEKREVRWKEDVVDNEHMNKKKSKVCCIFHPQQNFEDMDDECDHCGHSDS
                     SSSSSSSSSSSESESEKDLDRESRHNARKERRKRKLAQKRSTSPNAYEIQPDYSQNKD
                     KQTNNQ"
     gene            complement(<182225..>184768)
                     /locus_tag="KLTH0A02112g"
                     /db_xref="GeneID:8290347"
     mRNA            complement(<182225..>184768)
                     /locus_tag="KLTH0A02112g"
                     /product="KLTH0A02112p"
                     /transcript_id="XM_002551505.1"
                     /db_xref="GeneID:8290347"
     CDS             complement(182225..184768)
                     /locus_tag="KLTH0A02112g"
                     /note="similar to uniprot|P34077 Saccharomyces cerevisiae
                     YFR002W NIC96 Component of the nuclear pore complex
                     required for nuclear pore formation forms a subcomplex
                     with Nsp1p Nup57p and Nup49p"
                     /codon_start=1
                     /product="KLTH0A02112p"
                     /protein_id="XP_002551551.1"
                     /db_xref="GeneID:8290347"
                     /db_xref="GOA:C5DBF2"
                     /db_xref="InterPro:IPR007231"
                     /db_xref="UniProtKB/TrEMBL:C5DBF2"
                     /translation="MHSDKPVSMDTYANNEGVLKGSAKTFGNLIETSKNLPTTSSELG
                     TILLSVNEIKKRAHDLRKKAKPKGDHTRAHYLLAGSGLAIQDVELSLNNLKSRQLIEH
                     NVTNRETDGDLDTYLRTKKDENILSSIEQSLTSAAKDFDNFVNQTFNLDWEQRKDEVR
                     ENFGIILKKRRGNDYGKDSLPHPDYPSWGKSGRGILDGDSRLNVNENFATRTKFERYA
                     KIINGFNNARQSGYEFSLAKEISETFSSSAEQAGRQLPEAWSIIEHAQNSTDVVMSSR
                     TFLEKQFLNYVDNLYKKNLNEGLPTNVNKVKSFIDYKLKNPNNTWKYGNLTIVNGVPI
                     WAFIFYLLRAGLTKEALEVAIANKLSFKKVEQSFLTYFKAYATSKDQRLPNEFVSRLH
                     TEYNQHIKNALDGDPFRLAVYKIVGRCDLTRKNISSITLSIEDWLWFHFMLIKQDVSD
                     DDPVYEKYDLKDFQTIVTSYGISRFSSTYLHVLLLSGLYELAVQHATSINEIDAVHLA
                     IALAYHKKLNISHYKSEHDSNLLSEEDGRFEINFAKLLGNYTKSFKFSDPRIAVEYLI
                     LIALNGNKDQIEVCHESLRELVLETKEFTILLGKVNRDGSRIPGVIEERHSLLFLSDE
                     QDFLHRITEQAARRADEDGRVFDSLLLYQLADEYDIVIRIVNKLLSDLLSNTDLNQPL
                     LNLDDNNETSPVLIAKKLINVYVNNMEISRKVSSKNKETCLLLLKVVDIRRSFYSQNW
                     QEALSKVEDIDVIPFIDEVSSRRKAQEFSSLSPEIAKNIPNLLIITMTCVSNIVAQLN
                     QSEYHSASKDQQIRALRRLAKSCMIYAGMIQYKMPRETYSVLINLEVHL"
     gene            complement(<185373..>186002)
                     /locus_tag="KLTH0A02134g"
                     /db_xref="GeneID:8290348"
     mRNA            complement(<185373..>186002)
                     /locus_tag="KLTH0A02134g"
                     /product="KLTH0A02134p"
                     /transcript_id="XM_002551506.1"
                     /db_xref="GeneID:8290348"
     CDS             complement(185373..186002)
                     /locus_tag="KLTH0A02134g"
                     /note="similar to uniprot|P43586 Saccharomyces cerevisiae
                     YFR001W LOC1 Nuclear protein involved in asymmetric
                     localization of ASH1 mRNA binds double-stranded RNA in
                     vitro"
                     /codon_start=1
                     /product="KLTH0A02134p"
                     /protein_id="XP_002551552.1"
                     /db_xref="GeneID:8290348"
                     /db_xref="UniProtKB/TrEMBL:C5DBF3"
                     /translation="MAGKQTKTAKRSNKQNGKREVNPEVFQDSQARNQLSSAPKLTEK
                     SASRKPSKLKVSKEQALARLYGSKNKKVKAYSEKELNIPSLNRAVIPGVKFKRGKKGK
                     KFVGDHDELLYSRLISTIGDKQEQLTESKLEKARRLEEIRELKRQEIERKEDAKKDKL
                     DSKKDELKKKASVARTLRRKNKRDQYNESKAPAAASNDVGPKKKTVSFA"
     misc_feature    complement(186379..186515)
                     /note="Centromere Klth0A"
     gene            complement(<186546..>187715)
                     /locus_tag="KLTH0A02178g"
                     /db_xref="GeneID:8290350"
     mRNA            complement(<186546..>187715)
                     /locus_tag="KLTH0A02178g"
                     /product="KLTH0A02178p"
                     /transcript_id="XM_002551507.1"
                     /db_xref="GeneID:8290350"
     CDS             complement(186546..187715)
                     /locus_tag="KLTH0A02178g"
                     /note="similar to uniprot|Q12341 Saccharomyces cerevisiae
                     YPL001W HAT1 Catalytic subunit of the Hat1p-Hat2p histone
                     acetyltransferase complex that uses the cofactor acetyl
                     coenzyme A to acetylate free nuclear and cytoplasmic
                     histone H4 involved in telomeric silencing and DNA
                     double-strand break repair"
                     /codon_start=1
                     /product="KLTH0A02178p"
                     /protein_id="XP_002551553.1"
                     /db_xref="GeneID:8290350"
                     /db_xref="GOA:C5DBF4"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR013523"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="InterPro:IPR017380"
                     /db_xref="InterPro:IPR019467"
                     /db_xref="UniProtKB/TrEMBL:C5DBF4"
                     /translation="MADASDLRPEAWTVSSNTAVKLSFVDEEGAVQFTPTFTYPIYGD
                     SEQIFGYQDLQILLAFDSVTFKPFCNVKFGAKLADTDDNVQDKLLKYLPDGDVIVKDE
                     IAWVDTFNKERESFTLPDESKKVASYSREGHNFAVYKVDLHDDNVKKLHRRMQIFTLF
                     LIESASYIDEGDEGWELYMSFNTGNKQCVGYSTTYKYWKYMGARNFDSTDKTFQTGKI
                     SQFLVFPPYQGVGHGSELYNAIINDWLADTKVIEITVEDPNEDFDSLRDRNDLKRLYA
                     SGIASEIPRELPIKNEWIEAQRSIFKIEKRQFQRLIEMLLLHICSPNFRLQVKKRLYE
                     KNYDLLADLDTPTRNDKLQTAFLSIKEEYDSILASLRFKRHEDLDNTQPSKKIKN"
     gene            <187855..>188559
                     /locus_tag="KLTH0A02200g"
                     /db_xref="GeneID:8290351"
     mRNA            <187855..>188559
                     /locus_tag="KLTH0A02200g"
                     /product="KLTH0A02200p"
                     /transcript_id="XM_002551508.1"
                     /db_xref="GeneID:8290351"
     CDS             187855..188559
                     /locus_tag="KLTH0A02200g"
                     /note="highly similar to uniprot|Q12483 Saccharomyces
                     cerevisiae YPL002C SNF8 Component of the ESCRT-II complex
                     which is involved in ubiquitin-dependent sorting of
                     proteins into the endosome appears to be functionally
                     related to SNF7 involved in glucose derepression"
                     /codon_start=1
                     /product="KLTH0A02200p"
                     /protein_id="XP_002551554.1"
                     /db_xref="GeneID:8290351"
                     /db_xref="InterPro:IPR007286"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="UniProtKB/TrEMBL:C5DBF5"
                     /translation="MKHGLAAFNSDQHNRYSTTASILSKQDRELDEQLNVFQQRLVEF
                     AKVHNKELRESPEFRMKFIRMCASIGVDPISLFDKERHLFDVNDFFYEICVKIIEICR
                     KTKNLNGGVISFDELHKGYFEQFKVQLNDLQKAVEMLETLDGGFEVFCIRGKKFLRSV
                     PNELTNDQARILEVCSILGYASISLLRLNLEWEPVRSDAILKEMVANGLLWIDSQAQG
                     ETLYWDPAWIVRSNFA"
     gene            complement(<188580..>189911)
                     /locus_tag="KLTH0A02222g"
                     /db_xref="GeneID:8290352"
     mRNA            complement(<188580..>189911)
                     /locus_tag="KLTH0A02222g"
                     /product="KLTH0A02222p"
                     /transcript_id="XM_002551509.1"
                     /db_xref="GeneID:8290352"
     CDS             complement(188580..189911)
                     /locus_tag="KLTH0A02222g"
                     /note="similar to uniprot|P31115 Saccharomyces cerevisiae
                     YFL001W DEG1 Non-essential tRNA:pseudouridine synthase
                     introduces pseudouridines at position 38 or 39 in tRNA
                     important for maintenance of translation efficiency and
                     normal cell growth localizes to both the nucleus and
                     cytoplasm"
                     /codon_start=1
                     /product="KLTH0A02222p"
                     /protein_id="XP_002551555.1"
                     /db_xref="GeneID:8290352"
                     /db_xref="GOA:C5DBF6"
                     /db_xref="InterPro:IPR001406"
                     /db_xref="InterPro:IPR020094"
                     /db_xref="InterPro:IPR020095"
                     /db_xref="InterPro:IPR020097"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DBF6"
                     /translation="MSLISKLLRFGRNASKSLPEQCEYAKWSKEDLVRKVMELEAENK
                     RKAEDEGDRSESKTKKAKRDDLPEKRKRKKKDKPFDFSKYDTRFVAFKFAYLGWNYNG
                     LAIQKEPTPLPTVEGTILEAMNACKLVPSMVPQDYNFSRCGRTDKGVSAMNQVISLHV
                     RSNLTREEQQDEENDGREIDYIHILNQLLPDDIRISAVCLRPPTNFDARFSCQYRHYR
                     YLFHKDGLDIKKMEEAARMYEGEHDFRNFCKLDGSKQINNYKRNIERSRIISLSEDIY
                     CLDLIGSAFLWHQVRCMMANLFLIGQGLEDTTLLKDLMDVARVKQKPIYDMASDIPLI
                     LFDCKFPEMEWKTVDSNNFKSLQSDRRVYALSLDYNLKSTVANIFRETLCVTTSEIQG
                     RTRINLGDGKGKVVAVYQKMLERGVMESVESVNQKFREKKAAKKRNRMTTT"
     gene            <190077..>191873
                     /locus_tag="KLTH0A02244g"
                     /db_xref="GeneID:8290353"
     mRNA            <190077..>191873
                     /locus_tag="KLTH0A02244g"
                     /product="KLTH0A02244p"
                     /transcript_id="XM_002551510.1"
                     /db_xref="GeneID:8290353"
     CDS             190077..191873
                     /locus_tag="KLTH0A02244g"
                     /note="similar to uniprot|P25808 Saccharomyces cerevisiae
                     YFL002C SPB4 involved in the maturation of 25S ribosomal
                     RNA ATP-dependent RNA helicase"
                     /codon_start=1
                     /product="KLTH0A02244p"
                     /protein_id="XP_002551556.1"
                     /db_xref="GeneID:8290353"
                     /db_xref="GOA:C5DBF7"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBF7"
                     /translation="MARSLSWDNLKYELQPWIRTAIDAMGFEIMTPVQASTIPMFSGN
                     KDVVVESVTGSGKTIAFTIPILEKVVKEVLSGSPLKRGHFYSLIISPTRELSKQIQDV
                     VEAFLAYYPSESCPIKSQLIVGTSSCSVRDDVSKFLENAPQILIGTPGRVLDFMKAST
                     VKTSSCGVVVLDEADRLLDVSFEKDVESILGMLPKQRRTGLFSATISSAGNQIYRTGM
                     RNPVKIAVKSKVQNPESLQINYIVVKPEEKLHHLLNIINNMRYRKCIVYFPTCQAVTY
                     FYSFLKHLSDISKTRDDLEVYSLHGKLQTNSRIGTLAKFSTSLNIAVLLTTDVAARGI
                     DIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFINCGREEDYIDFLGVKNIS
                     LGELEISFRPVDELGVIFKSWVLQDRARFEHGIKAYAAFIRYYSKHSASSIFRLQSLD
                     YVGLAKLYGLIRLPRMPEITKYMSADATPSEGWLIDPPLDLDHFSYLNKQMERARQEE
                     LKKTKEISDKKKLKSELKKKNAAWSNKTTSKETRKERKVKLAEKRKAIEQKIAEAGSE
                     DESDGEEDWKDLVRRNKKAKTCSQIQGDFSDL"
     gene            complement(<191921..>193264)
                     /locus_tag="KLTH0A02266g"
                     /db_xref="GeneID:8290354"
     mRNA            complement(<191921..>193264)
                     /locus_tag="KLTH0A02266g"
                     /product="KLTH0A02266p"
                     /transcript_id="XM_002551511.1"
                     /db_xref="GeneID:8290354"
     CDS             complement(191921..193264)
                     /locus_tag="KLTH0A02266g"
                     /note="weakly similar to uniprot|Q12059 Saccharomyces
                     cerevisiae YPL003W ULA1 Protein that acts together with
                     Uba3p to activate Rub1p before its conjugation to proteins
                     (neddylation) which may play a role in protein
                     degradation"
                     /codon_start=1
                     /product="KLTH0A02266p"
                     /protein_id="XP_002551557.1"
                     /db_xref="GeneID:8290354"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DBF8"
                     /translation="MDKFDRQLRLWGKHGQLELSKAHICIIGNTLLASEILKNLVLPG
                     ATKFHLIKETSYVKSDCFLDVEDLKSINEHAEFNEETWNAHLMGNQEYWRYFDLIILT
                     TRDVSVIESIRCLPMPPMLACNWREYHGYACFVSQEPHFVTECHRQHKSPDLRIDKPP
                     QPLLNFYESIKPSQLSQEQLNDLPFAVIIYHALKSLKENCTKIDRSSLRIEIRRLHEK
                     TLPGPECLNFIEAERYLYLGLQDSEIIPDNLLKCFSLASSECVVPFNSMFTDMISSLK
                     DYLKHPSSEHQLPLSGLIPDMESSSEMYNAIQEAYLRCASKNLNTFADIVTSHNASVP
                     LSQIKNFCSNVQNVRGVVPASHIPTEQDCRTVKQITPAAAAILRKLVKSKHELETIRP
                     SFVESRDELRYYPTCSLLAGIVAQEAVKILTHQFVPLENTLIYDGKAGQVYRVKL"
     gene            <193453..>194400
                     /locus_tag="KLTH0A02288g"
                     /db_xref="GeneID:8290355"
     mRNA            <193453..>194400
                     /locus_tag="KLTH0A02288g"
                     /product="KLTH0A02288p"
                     /transcript_id="XM_002551512.1"
                     /db_xref="GeneID:8290355"
     CDS             193453..194400
                     /locus_tag="KLTH0A02288g"
                     /note="highly similar to uniprot|Q12230 Saccharomyces
                     cerevisiae YPL004C LSP1 Long chain base-responsive
                     inhibitor of protein kinases Phk1p and Phk2p acts along
                     with Pil1p to down-regulate heat stress resistance via
                     regulation of the Pkc1p and Ypk1p pathways phosphorylated
                     by Phk1p and Phk2p"
                     /codon_start=1
                     /product="KLTH0A02288p"
                     /protein_id="XP_002551558.1"
                     /db_xref="GeneID:8290355"
                     /db_xref="InterPro:IPR028245"
                     /db_xref="UniProtKB/TrEMBL:C5DBF9"
                     /translation="MHRTYSLRAQRAPTASQLQSPAPPPSSTRSKFFGKASISSTFRK
                     NAAGNFGPDLARKLSQLVKTEKGVLRALEIVAIERRAAAKQLSLWGLDNDDDVSDVTD
                     KLGVLIYELGELQDQFIDKYDQYRLTLKGIRNIEASVQPSRDRKQKITDDIARLKYKE
                     PNSTKIPVLEQELVRAEAESLVAEAQLSNITREKLKAAFNYQFDSIRELAEKFALIAG
                     YGKALLELLDDSPVTPGETRLAYDGYDASRQIIMDAETALEGWTLDSAAVKPSLSFHQ
                     TVDDVYEEDDEEEGEAAAAEEEWAGEHEGGEEEVESTRV"
     gene            complement(<194663..>196456)
                     /locus_tag="KLTH0A02310g"
                     /db_xref="GeneID:8290356"
     mRNA            complement(<194663..>196456)
                     /locus_tag="KLTH0A02310g"
                     /product="KLTH0A02310p"
                     /transcript_id="XM_002551513.1"
                     /db_xref="GeneID:8290356"
     CDS             complement(194663..196456)
                     /locus_tag="KLTH0A02310g"
                     /note="similar to uniprot|Q12089 Saccharomyces cerevisiae
                     YPL005W AEP3 Peripheral mitochondrial inner membrane
                     protein located on the matrix face of the membrane
                     stabilizes the bicistronic AAP1-ATP6 mRNA encoding
                     subunits 6 and 8 of the ATP synthase complex"
                     /codon_start=1
                     /product="KLTH0A02310p"
                     /protein_id="XP_002551559.1"
                     /db_xref="GeneID:8290356"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:C5DBG0"
                     /translation="MGLLATLGSGIAKNGIREPSVVAEKSFRAVPTKARCGVDLKVDR
                     QGGVQPTKLKNEYVLRNIHVVGKGSNFERSAVQDYLSPFTSHQFARHKLPCAYNEDRA
                     RANFTALKKLKSSKNSETLLFSSSQQYVGEMIPLLVALTPQEVSTGHAKRNFRSEVFE
                     EIPSIIDFTQNAESFANYVTLLTHSKFYYKKSSFLNGVIPKILRNILHPSNMKTMQFR
                     DVGVFNDVIFFFSEKSDYATCRELFSQMKLEGVKPNTKTFNLMLRNALKNSHIRKSRH
                     PLHDAVYYLRQMQHHEIKADAVTWVTCFNLLLEDMSRDVFLENMIKSNVPITPQLVLA
                     VLSSNPLNSSQALKFLSEYSVPLNSKLFNFCIKKLLSEEKYEAAWAFVDHAHKNADFN
                     LDHESLNAFLRRFAESGRLDLALLTFNTACKRYQISGNLHSFDMLFKALVRNGYTQNF
                     PIVFEYLSRKRRRYARGVQIFSYWLSKAHSMVKFNMKHQVTEGDIEKAKSLLDSALWT
                     SKGLRWKCWRESEQSQRKVFRYLGCIPTTVKAKTTHFIHDTSPEASAKKVKYKNRIRF
                     LAIQNAMAKRIPYAHDRYRALKEELRHRGIM"
     gene            complement(<196782..>200321)
                     /locus_tag="KLTH0A02332g"
                     /db_xref="GeneID:8290357"
     mRNA            complement(<196782..>200321)
                     /locus_tag="KLTH0A02332g"
                     /product="KLTH0A02332p"
                     /transcript_id="XM_002551514.1"
                     /db_xref="GeneID:8290357"
     CDS             complement(196782..200321)
                     /locus_tag="KLTH0A02332g"
                     /note="similar to uniprot|Q12200 Saccharomyces cerevisiae
                     YPL006W NCR1 Vacuolar membrane protein that transits
                     through the biosynthetic vacuolar protein sorting pathway
                     involved in sphingolipid metabolism glycoprotein
                     homologous to human Niemann Pick C1 (NPC) protein"
                     /codon_start=1
                     /product="KLTH0A02332p"
                     /protein_id="XP_002551560.1"
                     /db_xref="GeneID:8290357"
                     /db_xref="GOA:C5DBG1"
                     /db_xref="InterPro:IPR000731"
                     /db_xref="InterPro:IPR003392"
                     /db_xref="UniProtKB/TrEMBL:C5DBG1"
                     /translation="MKVARCLLVPVIVSNAVLAGDSFFGISFANSKPASCSIYGSCGK
                     KSLFGGELPCPVTEDFVPDPLSEAERESLVDLCGEEWKDVNQVCCNGAQIENLRKNLK
                     KAENLIASCPACDKNFKSLFCHFTCSPQQRVFTNVTETQSSTDGREIVASMNVFLDSH
                     WASEFYDSCKNVKFGATNGYAMDLIGGGAKNYEQFLKFLGDEKPLLGGSPFQINYIYD
                     SQNSGIELFNETVYSCDDETYKCACTDCDKSCPKLKPLRRNHCKVAGLPCFSFVILMV
                     YVSLFVLILGWHIYYFKNRKEPIIFEQDIEDSYAVANNDRIFQEHAYKAYSFDEKVAS
                     VLGQISGFSYRHPKLVILATGVVVVLLTVLAWIFGDLETDPINLWVSKSSPKYKEKEF
                     FDENFGPFYRTEQIFIVNETGPVLSYPNLEWWFGVESYITEVLRSEEYQTYQDLCFRP
                     TEDSTCVVESVTQYFNQDLPKEGDWENRLKSCTESPVNCLPSFQQPLKPNLLFSDNDV
                     FKSNALVVTLLLSNHSNSALLWEKQLEDYLLNLDLPHGLRLSFNTEMSLEKELNRNND
                     IYIVLVSYLLMFAYASWALRKKGGGSRLLLGFSGILIVLSSVSSATGVLSILGLKSTL
                     IIAEVIPFLILAIGIDNIYLITHEFDRISEGEQTLEVEHIMKKALQKISPSILLSLLC
                     QLCCFLIATFVSMPAVRNFAIYSAVSLVFNVLLQLSAYVSILTLYERTFSATENTVSS
                     ESTPSKLKSAYVELLTKKRKIVGIFVSLTLFSLFFIPYIEIGLDQTLAVPQDSYLVDY
                     FRDIYKYLNVGPPVFFVVKNLDLTSRSNQKKVCGKFTTCDDLSLANTLEQERKRSTVV
                     EPVTNWFDDFMMFLNPQLDTCCRLKKGTEDVCPPSFPSRRCETCFSESEWFYDMSGFP
                     TGDEFMHYFNIWINSPSDPCPLGGKAPYSSAITYNKTSIKSSTFRSAHKPLKSQQDFI
                     EAYKDAERISKSLFELDVFAYSPFYIFFVQYGSLVSLSLKLLASSVLLVLLVSWMFLG
                     SLKTAALVGLTVAMILTDIGALMFFLGISLNAVSLVNLIICVGIAVEFCVHIARAFTI
                     VPSNIKTDRDSRMVHAIETVGGSVFQGITLTKFIGVSILAFTHSKIFQVFYFRMWFIL
                     IIASCAHALFFLPAALSLVGGKSYADSEVELED"
     gene            <200459..>202174
                     /locus_tag="KLTH0A02354g"
                     /db_xref="GeneID:8290358"
     mRNA            <200459..>202174
                     /locus_tag="KLTH0A02354g"
                     /product="KLTH0A02354p"
                     /transcript_id="XM_002551515.1"
                     /db_xref="GeneID:8290358"
     CDS             200459..202174
                     /locus_tag="KLTH0A02354g"
                     /note="similar to uniprot|Q12308 Saccharomyces cerevisiae
                     YPL007C TFC8 One of six subunits of RNA polymerase III
                     transcription initiation factor complex (TFIIIC) part of
                     TFIIIC TauB domain that binds BoxB promoter sites of tRNA
                     and other genes linker between TauB and TauA domains human
                     homolog is TFIIIC-90"
                     /codon_start=1
                     /product="KLTH0A02354p"
                     /protein_id="XP_002551561.1"
                     /db_xref="GeneID:8290358"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR024764"
                     /db_xref="UniProtKB/TrEMBL:C5DBG2"
                     /translation="MKLLKDLAVARKELADWTENLTWAHDGTLYLTTVPDITVCVPVY
                     SEATNSSKDLFHIKEYPLPLVNKFEYDLAQKNVMINSVPESSIKICQASPVSDSLAVL
                     TNNANACIYSGRGLVAQLDQPERALEERSYHSLAWNVEGNMIAVGNEACEVIVFSVNE
                     NFEGAEFIYHRTIKINDDATSWVTRLEWYEEGIIVSLSNNSVHLVREDDGPKQIKCSS
                     RFKNSDLKGMKGNIIITSAGSVHRYEIGSGTLESLDLGACDDFYVVPLPDYNTALLIS
                     NKTSCLLSLGHELRLQNDVIISPHIEAKFKKWNNYFNEFNNYETNFLIHGLATSPDGA
                     CLALAYSLDRLSIRYRIVSEQQYRICLFPLGKAWEIKQGSTGLTWYQNYQIYNKQLPR
                     NFETDEGCLDLDTTLSFKSYLQELMNNKRMNNLRFSNFLEQEKDNNLYKRAVYDYAVA
                     HKDEVVNPLDKACVQSIADLLALESPVVPEIYTMKGEFIEETFSSPASPNTDVVQSEE
                     GHIWKRCRATFLPLLTSKVKVCPVSNYRIIDIKHDARNDYGWLTRTILQFSNNQSIYS
                     GTRML"
     gene            complement(<202248..>204713)
                     /locus_tag="KLTH0A02376g"
                     /db_xref="GeneID:8290359"
     mRNA            complement(<202248..>204713)
                     /locus_tag="KLTH0A02376g"
                     /product="KLTH0A02376p"
                     /transcript_id="XM_002551516.1"
                     /db_xref="GeneID:8290359"
     CDS             complement(202248..204713)
                     /locus_tag="KLTH0A02376g"
                     /note="similar to uniprot|P22516 Saccharomyces cerevisiae
                     YPL008W"
                     /codon_start=1
                     /product="KLTH0A02376p"
                     /protein_id="XP_002551562.1"
                     /db_xref="GeneID:8290359"
                     /db_xref="GOA:C5DBG3"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR006555"
                     /db_xref="InterPro:IPR010614"
                     /db_xref="InterPro:IPR013020"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014013"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBG3"
                     /translation="MNGEENYGHPFQPYDIQLQLMHQVYNTLESGKKIGIFESPTGTG
                     KTLSLICPTVTWLRRNKAHYMGKSKETSSSVDGNLTKSDDESDEEPSWVKEAFAESVI
                     KEKVRALDEYEKYLGSKAFKAKYSSIYLSEDSPKVKRKRNLPHTTVGFEENEFLPDEN
                     SSPSTGCKKYSDVHDDKKKKLINEVNALLGKLDQEAESIDEATQTALPCPIKIFYASR
                     THSQLGQLASQLRLPNFPPSFESMEHERVKFVPLASRKQLCINPKVSKTSSQVINDYC
                     RDAVSKKECVPYTRSKDPEILHAFRDHAFYAIHDIEDMVSLGRATSTCPYYALRELLH
                     DGVEVVTLPYQHLLVESTREALGVDLKDSIVIIDEAHNLIDTINAVNSAEVSLADLQS
                     SKLGITMYENKFAKRLSPHNRVNLKRLLTLVEVLIVFLQQNYKNGKEFESHEVFEGTN
                     ADVLNIHKLEQYMKTTKIAYKIDSYIKSQNESAETAAVERQPVLFKVASFLKTLSNPS
                     LEGQFFFEKGKVMKYMLLEPSNSFKSIVHAARCVLLAGGTMEPISDFTRDLIPFVDEN
                     QINKFACNHVIPDNNLNTFIVTEGFEFTYDKREDSRTLSDLYDFFSRLVKIVPDGVVV
                     FLPSYKFLESLMRFWNSTCKVGACIGNKKIFYESADKADVFAKYAEEVRKLTGGAILF
                     AVVGGRLSEGINFQNELARAVVMVGLPYPNLFSGELIIKRKHLEQKVLKANGSSQDAK
                     RATREFYENICMKAVNQSIGRAIRHAQDYANIYLVDKRYSSIQVQTKLSNWVAKRIRH
                     TTSLDDLFEKSAKWYANKAQDDR"
     gene            <205005..>205982
                     /locus_tag="KLTH0A02398g"
                     /db_xref="GeneID:8290360"
     mRNA            <205005..>205982
                     /locus_tag="KLTH0A02398g"
                     /product="KLTH0A02398p"
                     /transcript_id="XM_002551517.1"
                     /db_xref="GeneID:8290360"
     CDS             205005..205982
                     /locus_tag="KLTH0A02398g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A02398p"
                     /protein_id="XP_002551563.1"
                     /db_xref="GeneID:8290360"
                     /db_xref="UniProtKB/TrEMBL:C5DBG4"
                     /translation="MASPIFLSRPHSGFSWNAFEVGLRLAVWSLHRFASSFTDFCSRE
                     RHALLKVCALTLATRLVVFSLRQVMDHFPLMSLAADSMDLLLACYGLSRFAYPEFKRA
                     FWSSFHSNFNDFENKKLHSEPGPSLYCMLFSLFRSNFMWLISLLLLSDFMVTSAQVGK
                     PEALTAVSKTVISIMLLTLWTSHMSPALGSLASLAVGGALTASLAPFSNLALLLRLWQ
                     LQFLVEYLMVPYVSQARFSPTEYAMWLKVRGGVICGFSTFVYVLLSLCGPNLMSPLLV
                     YILAPLFANLMSKIAEPVPANIIFGTKAYSRWCARQILWIERKRCLQAR"
     gene            <206631..>207812
                     /locus_tag="KLTH0A02420g"
                     /db_xref="GeneID:8290361"
     mRNA            <206631..>207812
                     /locus_tag="KLTH0A02420g"
                     /product="KLTH0A02420p"
                     /transcript_id="XM_002551518.1"
                     /db_xref="GeneID:8290361"
     CDS             206631..207812
                     /locus_tag="KLTH0A02420g"
                     /note="some similarities with uniprot|Q02606 Saccharomyces
                     cerevisiae YPL014W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A02420p"
                     /protein_id="XP_002551564.1"
                     /db_xref="GeneID:8290361"
                     /db_xref="UniProtKB/TrEMBL:C5DBG5"
                     /translation="MLLERFQSKLHGSRLSRHSNSKSRSKCDADAQPVQNIADDLMTG
                     DGMSDSDAYASMRELQISTQLCEPRSGTPLNGVSTPVMQPIMPYMYGNQKRQDSVASF
                     ASSISDMPGPARTATTPLPTTFSTQFVKMLMEVYQDICSDPTATPFDASNPPSGILNR
                     TAKVAVERAEQKGVDMGREKNALLVNSVKQRLLQELRRDAYLSRNSSIVSLPPMPQFN
                     TSDIAPTACVDYFSTHAEASSNGQLSTPFQMPTSSLGSSQPLQTPFDQRPQVPKLSHR
                     SRNDSFISAAGRSRSGSSHMFPSQQQQQQPQPSAALQPSSFIETTTAPRAQFEGNGYF
                     VLTPTNSMLGEPQQPFIARERSNASSAFEDMMSGELSRHRQNSFRIEKGSATGSLAMD
                     F"
     gene            complement(<207945..>208304)
                     /locus_tag="KLTH0A02442g"
                     /db_xref="GeneID:8290362"
     mRNA            complement(<207945..>208304)
                     /locus_tag="KLTH0A02442g"
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /transcript_id="XM_002551519.1"
                     /db_xref="GeneID:8290362"
     CDS             complement(207945..208304)
                     /locus_tag="KLTH0A02442g"
                     /note="similar to uniprot|Q02608 Saccharomyces cerevisiae
                     YPL013C MRPS16 Mitochondrial ribosomal protein of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS16"
                     /protein_id="XP_002551565.1"
                     /db_xref="GeneID:8290362"
                     /db_xref="GOA:C5DBG6"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR020592"
                     /db_xref="InterPro:IPR023803"
                     /db_xref="UniProtKB/TrEMBL:C5DBG6"
                     /translation="MSKGLVRIRLARFGRRHSPLYNIVVANASKARDKTPIEVLGTYN
                     PIPKPLSKRETKSGAIPTKDVQLDFARTKYWVGVGAQPSETVTKLLKKCNILGSDWGK
                     TYTTSRTVVLPKREVLE"
     gene            <208530..>212180
                     /locus_tag="KLTH0A02464g"
                     /db_xref="GeneID:8290363"
     mRNA            <208530..>212180
                     /locus_tag="KLTH0A02464g"
                     /product="KLTH0A02464p"
                     /transcript_id="XM_002551520.1"
                     /db_xref="GeneID:8290363"
     CDS             208530..212180
                     /locus_tag="KLTH0A02464g"
                     /note="similar to uniprot|Q7LH12 Saccharomyces cerevisiae
                     YPL012W RRP12 Protein required for normal pre-rRNA
                     Processing member of a group of seven genes whose
                     expression is repressed during growth on glucose before
                     and during the diauxic shift"
                     /codon_start=1
                     /product="KLTH0A02464p"
                     /protein_id="XP_002551566.1"
                     /db_xref="GeneID:8290363"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR012978"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DBG7"
                     /translation="MNQDEIATLLQLEDKLGQIRQQINSKLENQKHVAIILSAVEENM
                     DEQQVAAKNIVNYLISLMSLLDQAINPETHEIVELQISTSVAYLLDIVLKYTPKQLLR
                     SKFADILTKFAPCITDEKAEAPLIRSAVGCLETLLVAQDAQSWNNTHNLSIAPSRGLN
                     GLLELSLDPRPKVRKRAQEAVGNIMSNPPASPTAEHVAAPLVAEFSISALASAVEEVS
                     STSNKKIRAQGGLKELNAKAIHILKLINTVLSSNQWPSSRFDVLCDLLLEMSRSADQF
                     MVSNAFQCFEALFQSIAESAAAFGLAENKFSKVLDIIFSLKPSNSDTHLVGAWIAVVA
                     KGMTTFGSCSPLSCLEKIPEVINVLSLYLSSEVPEVYTSASQCVEALLTGCIQDDLLL
                     LPPQVNENVYEKVDETISYLAGAFSDFLSIKYAHCAKEILQNLTTAFKKLRIRSNPDL
                     LPPLEIVGGWRTNEDNFLEMRAEIETVIGAAVSAIGPDAVLGCLPLNLTDASGSKPGR
                     AWMIPLIRDNTCNSRLAIFVQEFLPLIQFFDEKVTALPSDSVQSKVFETVSGQLWSTL
                     PNFANLPTDLRDSFSDQFAADLSSLLYSKVDLRPIICHAIKNLVESNVQHASLLDDND
                     KLLEQHFPKSESQKNLEYLSTKASNLLAVLFNVYTQTAPNARSYILETIIAVLKITSP
                     EDLTKTFNNVCALLKKSFDEEPADAKSKTSPVKVSATLLDLVVVMASYVPESCYGALF
                     SIFNTTVNSSDALTQKRAYRIITKLSEVDKSSESVLKYVAEIEQILIQSSKVVHTSAR
                     ASRLSAIKVLVDLLPLGHLDFVIQIVPEVILSTKDNNEKSREGAFETLIAMTHKMNTP
                     GSVMKLSKVPGYDAQTPDQPTSVAEFFKIISAGLIGESQHMVSATITAYSCLVFEFKD
                     YVSTGVLIEIYDTIELYLTSNSREIVKSAIGFAKVCCLALPEELMKSKIPSLLPKLLR
                     WSHEHTGHFKARVKHIIERLIRKFGYEYIEQNFPEEDNRLLVNIRKTRNRNKKKAAES
                     METAPKLSEASKKGSRFMSALDEALYESSDAENSADDETAPKRGKASRFIVESKENPL
                     DLLDSQTLAHISSTRPRKFDAASRKKGRDHVFSFDADGKLLVKDEKKPSESDDVFDSS
                     SSGINAYLEAVKHGPVRGQKNKLKFKKGTRAGDNDFSDDEGANKSFKPNMNGKKVQKK
                     KGGPKFRSNRKL"
     gene            complement(<212453..>213508)
                     /locus_tag="KLTH0A02486g"
                     /db_xref="GeneID:8290364"
     mRNA            complement(<212453..>213508)
                     /locus_tag="KLTH0A02486g"
                     /product="KLTH0A02486p"
                     /transcript_id="XM_002551521.1"
                     /db_xref="GeneID:8290364"
     CDS             complement(212453..213508)
                     /locus_tag="KLTH0A02486g"
                     /note="similar to uniprot|Q12297 Saccharomyces cerevisiae
                     YPL011C TAF3 TFIID subunit (47 kDa) involved in promoter
                     binding and RNA polymerase II transcription initiation"
                     /codon_start=1
                     /product="KLTH0A02486p"
                     /protein_id="XP_002551567.1"
                     /db_xref="GeneID:8290364"
                     /db_xref="InterPro:IPR006565"
                     /db_xref="UniProtKB/TrEMBL:C5DBG8"
                     /translation="MSTSNKEFHFGLLRISMIQLLKSHGFDKAQPSTVDAFTDLYVRF
                     LQLLVLEVMKLSRSRMDEYEDIALQDISQALLNVGLLKPMSTLDVYDENPNLVSDIGM
                     QKFKEWCLLSPIPKEARAVATPTSELLRPKDKLSKPLSMIPEYINQLDKGSAKDRVDS
                     GQDNDIVEQLVRSGDMSDWTRFMIRRQQLMHARKISGREVKDIKSLPPVPGLRSSIFC
                     RDRRFDNSEIMPPEPQETESDEKALKEKALITKLAAHQKDNRLDNIRLSFEEEDVDVS
                     HDDIDLNDVNFDDNDLNEDMAAFEQMENSMNLTLGSENNLQLAEAENLNDTFQRRDSL
                     EFGDEVFQGHEFDFNTY"
     gene            <213735..>214325
                     /locus_tag="KLTH0A02508g"
                     /db_xref="GeneID:8290365"
     mRNA            <213735..>214325
                     /locus_tag="KLTH0A02508g"
                     /product="KLTH0A02508p"
                     /transcript_id="XM_002551522.1"
                     /db_xref="GeneID:8290365"
     CDS             213735..214325
                     /locus_tag="KLTH0A02508g"
                     /note="highly similar to uniprot|P53600 Saccharomyces
                     cerevisiae YPL010W RET3 Zeta subunit of the coatomer
                     complex (COPI) which coats Golgi-derived transport
                     vesicles involved in retrograde transport between Golgi
                     and ER"
                     /codon_start=1
                     /product="KLTH0A02508p"
                     /protein_id="XP_002551568.1"
                     /db_xref="GeneID:8290365"
                     /db_xref="GOA:C5DBG9"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="UniProtKB/TrEMBL:C5DBG9"
                     /translation="MAELSLYSVEAVLLLDNEGNRIYTKYYHSPHEKSDSHITKRAID
                     GMSSSSKQQTEYESRLFKKTHKQNSEILIFEDCLVLYKEYVDVSLYLVGSIDENELVL
                     QQAFSAIKDSLELILATGIDKKNIIEHFDMVALAIDESIDDGIILETDPATIASRVTK
                     PPSKDAPINIELSEKGLLSAWGFAKSKLAERLQQGL"
     gene            complement(<214393..>217569)
                     /locus_tag="KLTH0A02530g"
                     /db_xref="GeneID:8290366"
     mRNA            complement(<214393..>217569)
                     /locus_tag="KLTH0A02530g"
                     /product="KLTH0A02530p"
                     /transcript_id="XM_002551523.1"
                     /db_xref="GeneID:8290366"
     CDS             complement(214393..217569)
                     /locus_tag="KLTH0A02530g"
                     /note="similar to uniprot|Q12532 Saccharomyces cerevisiae
                     YPL009C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A02530p"
                     /protein_id="XP_002551569.1"
                     /db_xref="GeneID:8290366"
                     /db_xref="InterPro:IPR008532"
                     /db_xref="InterPro:IPR021846"
                     /db_xref="UniProtKB/TrEMBL:C5DBH0"
                     /translation="MKQRISSLDLELLYRELKSQLEGYRLSNIYNIAESSRQFLLKFN
                     KPDSKLNAIIDCGLRVHLTDFTRPVPATPSGFVVKLRKHLKSKRLTTVKRVANDRILV
                     LSFNDGQFFLVLEFFSAGNVILLDSDRKIIVLQRIVHEHENKVGHIYNMFDGSFLENT
                     RIEPPKSKVHSADEVNGWIKEAKDFADSSVKAKTGKGAKVLSIHKLLFLREPQLSSDL
                     ISRNLKSRGIAPNSPCLNFLDKIDEIVDLLDATESEVNELLRDGCKLGYIIAKKNPHY
                     DSEKGDANLEFVYEQFHPFPPHLSEDEKGYTKIIEVPGQYNKTVDDFFSTIESSKYAL
                     RIQNQEFQAKNRLESAKLDNEKRIQALIDVQTQNEVRGHAIIAAADLVEEAQNAIKAL
                     VEQQMDWKTIEVLISNEQKKNNRIARLIKLPLDLKNNKFTLSLPRNDEIESDNSDEEE
                     DNLTSSEDETSSSDSSDSSLSDFEADDNDEDELTSVSNIKKDRNDNKKKEKPSIDATI
                     DLTLSAYANASNYFNIKKSNVEKQKKVEKNAQKALKNIEQRIEKDLKKKLKESHDVLN
                     KTRKPYFFEKFHWFVSSEGFLVLMGKSGMESDQIYGKYIHDNDVFVSNSFDTHVWIKN
                     PDETEVPPNTLMQAGIMCMSASPAWSKKIQSSAWWCFAKELSKFDNYGGEVLPAGTFR
                     LKDEKKKSFLPPSQLVMGFALLWKTKDSDEEEEEDGADDEDQDDEEAQKEKSVLDEDA
                     VPGQVQGKDDELEISKDENRRIDEGFVIGKKMEGVKEHQSPTKSTDLKSVKEKSDSDE
                     VPVTTGLYPKISNSDSDVQADKEPSEQSETNNNSENGSAFSDKSGSNKETIKKNVRGK
                     KGKMKKMQKKYADQDEEERLMRLAVLGTLKGSERQQQKAEEEAAKLKEREQKKFRRER
                     QKKQQSLMFGSEQKVNVNYAKIFSEISPVVDDKSKVRDIVPVYAPWPALTKYKYKVKV
                     QPGNAKKTKSLNEILTYFSKRKVDETESDKELDWPCEHELIKKLKELDLVSILYTDKL
                     KITIPGQNEVKSKTKGTPSSKGKKKGKK"
     repeat_region   complement(217982..218242)
                     /rpt_type=long_terminal_repeat
     gene            218302..218375
                     /locus_tag="KLTH0A02574r"
                     /db_xref="GeneID:8290368"
     tRNA            218302..218375
                     /locus_tag="KLTH0A02574r"
                     /product="tRNA-Asn"
                     /note="tRNA-Asn (GTT) cove score=76.93"
                     /db_xref="GeneID:8290368"
     gene            <219197..>220147
                     /locus_tag="KLTH0A02596g"
                     /db_xref="GeneID:8290369"
     mRNA            <219197..>220147
                     /locus_tag="KLTH0A02596g"
                     /product="KLTH0A02596p"
                     /transcript_id="XM_002551524.1"
                     /db_xref="GeneID:8290369"
     CDS             219197..220147
                     /locus_tag="KLTH0A02596g"
                     /note="similar to uniprot|P53686 Saccharomyces cerevisiae
                     YPL015C HST2 Cytoplasmic member of the silencing
                     information regulator 2 (Sir2) family of NAD()-dependent
                     protein deacetylases modulates nucleolar (rDNA) and
                     telomeric silencing possesses NAD()-dependent histone
                     deacetylase activity in vitro"
                     /codon_start=1
                     /product="KLTH0A02596p"
                     /protein_id="XP_002551570.1"
                     /db_xref="GeneID:8290369"
                     /db_xref="GOA:C5DBH1"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR017328"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DBH1"
                     /translation="MKDNKDTAIKKIAKLISDKPNSKVVFLVGAGISTSCGIPDFRSP
                     GTGLYDNLAKLNLPFAEAVFDIEYFEQNPKPFYTLAKELYPGNYKPSKFHQLMRVFQD
                     KGKLHRVFTQNIDTLERAAGIHPDLLVEAHGSFAHNHCISCKKEYPQNVFKDKMLVGK
                     NFANCEECKGLIKPQIVFFGENLPRKFFSTWDKDVTELDDESIVVVAGTSLAVYPFAS
                     LPEEVPTTTTRALINLERVGDFKTTPRNSDVFYKGSADAAATELAKELGWLSELEFLS
                     GLLDNDKSSSKTVDEGHEDEAAKVDSITKDLEKLGLKENK"
     gene            complement(<220657..>222417)
                     /locus_tag="KLTH0A02618g"
                     /db_xref="GeneID:8290370"
     mRNA            complement(<220657..>222417)
                     /locus_tag="KLTH0A02618g"
                     /product="KLTH0A02618p"
                     /transcript_id="XM_002551525.1"
                     /db_xref="GeneID:8290370"
     CDS             complement(220657..222417)
                     /locus_tag="KLTH0A02618g"
                     /note="similar to uniprot|Q02724 Saccharomyces cerevisiae
                     YPL020C ULP1 Ubl (ubiquitin-like protein)-specific
                     protease that cleaves Smt3p protein conjugates
                     specifically required for cell cycle progression
                     associates with nucleoporins and may interact with septin
                     rings during telophase"
                     /codon_start=1
                     /product="KLTH0A02618p"
                     /protein_id="XP_002551571.1"
                     /db_xref="GeneID:8290370"
                     /db_xref="GOA:C5DBH2"
                     /db_xref="InterPro:IPR003653"
                     /db_xref="UniProtKB/TrEMBL:C5DBH2"
                     /translation="MPNLETKTGSKRKRTENYFAPTHSHIATFSFVNGPTVFSPRRRT
                     APFHSCTTEYTTEGPLRMSARLNGPENQTPGIVQDIKGAFFYASRAFKGLIGSTGDSN
                     TQKDLQGSRPVAESTEQSGRSLKRNALQTSSAPCKRPRSSPGVDARLSVPTQKELPGK
                     KSDDLTQKLDNCITPEKNGSFAFATKKDPFGWDSSEISLSPAPAHQVPYGSSFYRRKA
                     SRAQKPEDSRSLTIRKPSEELSYLRMIFNGEYRAPALIEEQRDTQLKLREQEREGLKS
                     TFKNSVASLTERFKAVLAENLGKRESPDDLIIIKERRLPEHENPLKHRTGFQKLRFDT
                     SVLTFEEEFKSYKRLIEERRRIQTEVREKRQKKRELVPKLTNEDVVYVKKALSRTDNG
                     VLMNKNNIEIKVYDFKTLAPKRWLNDIIVEFFMKHVEITTEHCVAFNSFFYTTLSQRG
                     YQGVRRWMKKKKVQVEKLSKIFVPINLNQSHWALGFINIDKKTISYIDSLSSGPSTMG
                     HAILKVLQEYLLEESSGKIGRDFELIHEQCPQQPNGFDCGIYVCVNALYLSKELPLSY
                     NHDDANRMRPYIGHLILSGD"
     gene            complement(<223366..>225870)
                     /locus_tag="KLTH0A02640g"
                     /db_xref="GeneID:8290371"
     mRNA            complement(<223366..>225870)
                     /locus_tag="KLTH0A02640g"
                     /product="KLTH0A02640p"
                     /transcript_id="XM_002551526.1"
                     /db_xref="GeneID:8290371"
     CDS             complement(223366..225870)
                     /locus_tag="KLTH0A02640g"
                     /note="similar to uniprot|P43585 Saccharomyces cerevisiae
                     YFL004W VTC2 Phosphate metabolism transcription is
                     regulated by PHO system polyphosphate synthetase
                     (putative)"
                     /codon_start=1
                     /product="KLTH0A02640p"
                     /protein_id="XP_002551572.1"
                     /db_xref="GeneID:8290371"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:C5DBH3"
                     /translation="MLFGVRLANQMYPPWKDSYIEYERLKKLLKESIIEDSKFKGRKS
                     QQNKGDLWSEKDESNFVAVLDAELEKVYSFQSTKFNSIMEKLVRLERKTDDEEAIKHL
                     DFKHFQQVLEEALSEAQELDNFCRVNYTGFIKIVKKHDKLHPRYPSVKSLLQVRLKEL
                     PFNSEEYSPLLYKISFLYNILRTNSSTVSKSLANSSKLSSVHNHEESSFRSYTFWIHP
                     DNLMEVKTRILRHLPVLVYAAPPSENDDLIGRVESTVMNSDVSFPAAPSSSASDSASL
                     GNKGYDPVIRTIYLDNEAFELYNDKLLKSSFNPTLRLRWTGKLADKPDIFLEKRMLVE
                     DRNTGASDFDETRIKLKPKFINGFIFNGDNDYKEKTLKKLKDRGTVDNEISKLSNNFN
                     TIQQFVLENELQPVLRAMYTRTAFQIPGDDRIRISIDSDLMYIREDSFDKENPIRDPK
                     NWHRSDIDADIPNPLKFLRPGEYVKFPYAVLDIRIRNPIGDKGGVKDSMRSQLPGKHA
                     QWVEELTNSHLVKEVANFSKYAQGVASLYGDDENLDMLPFWLPDLETDIRKDPKQAYE
                     EEKKKLEEQKANQARLAKIKRLSVVQGSGNGSGTPSSQQSGAGSPKAEERDADLEDPE
                     SSDDEATEHHSRTRKRKQNPNFLNVLVGRNAKLTGVDSEDEEITLPPGVKKPTSYLKN
                     AGPVKVEAKVWLANERTFNRWLSLTSLMSVLTFTIYNSVRRAEFPQLATFLAYAYFCI
                     TIFTGLWAYRTYIKRLNVIKARSGQHLDAPFGPLMVALVVVFTLVVNFVIAFKEAACK
                     ERTEGSSMSLNDAEQLPVFARFIERLVFKAIGASEP"
     gene            complement(<226313..>226954)
                     /locus_tag="KLTH0A02662g"
                     /db_xref="GeneID:8290372"
     mRNA            complement(<226313..>226954)
                     /locus_tag="KLTH0A02662g"
                     /product="KLTH0A02662p"
                     /transcript_id="XM_002551527.1"
                     /db_xref="GeneID:8290372"
     CDS             complement(226313..226954)
                     /locus_tag="KLTH0A02662g"
                     /note="highly similar to uniprot|P07560 Saccharomyces
                     cerevisiae YFL005W SEC4 Secretory vesicle-associated Rab
                     GTPase essential for exocytosis associates with the
                     exocyst component Sec15p and may regulate polarized
                     delivery of transport vesicles to the exocyst at the
                     plasma membrane"
                     /codon_start=1
                     /product="KLTH0A02662p"
                     /protein_id="XP_002551573.1"
                     /db_xref="GeneID:8290372"
                     /db_xref="GOA:C5DBH4"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003579"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBH4"
                     /translation="MSGVRTVSSSSANAKSYDSIMKILLVGDSGVGKSCLLVRFVEDK
                     FSPSFITTIGIDFKIKTVDINGKKVKLQLWDTAGQERFRTITTAYYRGAMGIILVYDV
                     TDERTFSNIKQWFSTVNQHANDEAQLLLVGNKSDMDTRAVSTDQGEALAKELGIPFVE
                     ASAKDDTNVNDIFFLLAKLIQEKIDSEKLVGNTGRDGSVNVGAAGNNSKSNCC"
     gene            complement(<227861..>234283)
                     /locus_tag="KLTH0A02684g"
                     /db_xref="GeneID:8290373"
     mRNA            complement(<227861..>234283)
                     /locus_tag="KLTH0A02684g"
                     /product="KLTH0A02684p"
                     /transcript_id="XM_002551528.1"
                     /db_xref="GeneID:8290373"
     CDS             complement(227861..234283)
                     /locus_tag="KLTH0A02684g"
                     /note="similar to uniprot|P43583 Saccharomyces cerevisiae
                     YFL007W BLM3 Protein involved in assembly of proteasomal
                     core particles in the nucleus required for normal
                     resistance to bleomycin may be involved in protection
                     against oxidative damage"
                     /codon_start=1
                     /product="KLTH0A02684p"
                     /protein_id="XP_002551574.1"
                     /db_xref="GeneID:8290373"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021843"
                     /db_xref="UniProtKB/TrEMBL:C5DBH5"
                     /translation="MEHFIQAPSPLKPYQNRSLSLKDMKTARSNSGSDLSKSKKAKFL
                     SGALKSSMSPSRRPRSTTPLSSQVSYDESSSDSILRERLNHYGLDYIDDQEAHLKEIY
                     DPKSKWFCRDIKPKFVIENCLPYKIESHTEQAKYLCHVLVNLYIAICSLDIQGLISIS
                     SKDLADLKAEIDELALNTDLFRLSTDDEASFNDINNYDEDEDEDEEDEEMVDFDGPQF
                     TATGKITAKSATIVNVNHWANELKNCLHFEFPLKLRKVLASTFYSLSLVQGQKVYRVM
                     HVNIFEALVSTDDEQTNFTELLLGEGLELDYRPMKKFLDEFLPPPDSTCTRYEISSKS
                     DNQLFRLLLKLAHAAKPFYGLNDDSVLKDTMDHYISSLSPTTAYCVFPIITSFVPYRY
                     QKSASITDYFPLIFTLWTTTTPSVGFDTHFYDFIGCIAEDALNKLLHEKAPHLQVLGN
                     VSFREFGLLTEDQINFIFNRVQNHLRNDFQVVSFSRTVRPLVFSMNGSRNHEFLDKLQ
                     GLVKSIETFAHPSNNGPWTKVIAKFVHGFIKMYHERVKMEKNPKANHRCHLKLNSACH
                     TRVVNIFQEVIFLGAQNKNSEMANYYISCLAYLLDINPGNKDLVFSKVVLDLYDSLGD
                     LYVHSVHRLVSSLKQFTKVARFMIEDHIFRVHITNILFMLVSKIDYNDILLTSNIINC
                     IVSIASFVPIDNLVSEDDHLSFTSHAAPFIEKHVFFLKYNKELDSFEYDKSELVAAFK
                     ASTTIFEDVLKIYLNKVIQLVDSDLEEGFISKVNQTTMIMMESMPDPMFKYFSGVLER
                     TFWENDYFKEKHPNYELITIPLGAAARREPAIGAKLFSTLCVNIKDQIAKGAGSVRSS
                     SEIQHRDVKLLTYLTALSDILRQAHSSMLSYREELKDILFFIFDNITNPPLDVHTSLV
                     LHNVLTSLSSTEVIDYRLYPEKCSMPRDERWGGLQFDSKRFSKEMMTFKWHVPSKLEV
                     EFGTELLENFTDYCSTNISEMMRSPHTDSAYSDKMKKYILIVTHALSGASLLFDADYS
                     KNKTEILPVDSYKAKLLLLKSVRDKICDSQELNMDIEQIRNDTKADSEAESSIDLSED
                     GLDEIQFTEGGEGSLGGNTLFDGVSSAAPSGIATPEPGSRHHTYGVESAINSTLAMRD
                     LDIMGCNYFFGSDKNKKMENFTYLKIHSIRSKIGSLFHKLFKFFSANFEDNTILFKIL
                     LHGIKVWFTDIGQETIFDEEPTSFLDLEFVENIQNLSHVDDPYTRTCFAAKAHALHEM
                     RVLLHSTNRTPSKLEKVLLNDVLRLSTSLYPTIFKPAQGCLAHAMKQLIGSYSMIMKF
                     LLTSLESAMNEGSYKKVEVMLEVLLLKKIHRKIMSDYKNLEEIVNLLIRACRVKDFNV
                     SKYADSILTDIALSLKVPSSVCLLDMKTIEALRPADKSIGQQVDAVKKAKDKKRYSYI
                     SLLSHLQDSLINTLSSGSDLGWKIPVFIMKLTYRLQSNLELPPSENVLPCLYEMTKTK
                     HPVMVHLAIKTLLGMCNKIISLGEFNYEIRNAFDFDFMKNNIELIKTDTANFNSYFKT
                     EMKNFANPNFFIDSKAYVGYIAWGRSLKVIKSSNETKFNLKEKEINCLNLFGQLIDKE
                     WVLQIAKVLIQDNENKGVFSNANIEFFELLVSLITNSCTALKYEDLLNLCRTLYDKSD
                     KASMIMSVEIMAGLIVASKITSSNDLEKRDSFLVGFFDECLDHELNQDAVDIWSIVCW
                     WLPTSVDIRRCAPLYRKLFKIKNVLDTASDSSADQASKISLLRNMMLSLDFKTPVAEE
                     LIPFLTIDHPYDQVRQSISKLLSTLLQSQISPCFSSTSKLVKFTSNETGLGRMIRNIP
                     RAFDDKLKDTFNEIEKERGAITNLPAQEVLKTRYYYMTATMLNWITELMKGQNSVILV
                     LYMEKYLAPFLMNLIRMKDVCNLANLEPTTCYIAISFWPLRKEYISIMMRVIENMDMQ
                     TSHEIRVQLVFAENFYSKNMLQLSMDQKQSILRFVVNQIYNRHFVEVRLRAAEVLSGI
                     IHTLSDTEIPNKLIDEFANGLGNHSFANKKKLSKTNSQIHSCVIGLGAIISAFPYVSP
                     LPQWIPSKLSSLSSWARTSGMSGTAAKEIISDFKKVRADTWHLDREQFSYDELEDLEG
                     VLWRSYYA"
     gene            complement(<234723..>238409)
                     /locus_tag="KLTH0A02706g"
                     /db_xref="GeneID:8290374"
     mRNA            complement(<234723..>238409)
                     /locus_tag="KLTH0A02706g"
                     /product="KLTH0A02706p"
                     /transcript_id="XM_002551529.1"
                     /db_xref="GeneID:8290374"
     CDS             complement(234723..238409)
                     /locus_tag="KLTH0A02706g"
                     /note="similar to uniprot|P32908 Saccharomyces cerevisiae
                     YFL008W SMC1 Subunit of the multiprotein cohesin complex
                     essential protein involved in chromosome segregation and
                     in double-strand DNA break repair SMC chromosomal ATPase
                     family member binds DNA with a preference for DNA with
                     secondary structure"
                     /codon_start=1
                     /product="KLTH0A02706p"
                     /protein_id="XP_002551575.1"
                     /db_xref="GeneID:8290374"
                     /db_xref="GOA:C5DBH6"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR010935"
                     /db_xref="InterPro:IPR024704"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR028468"
                     /db_xref="UniProtKB/TrEMBL:C5DBH6"
                     /translation="MGRLLGIELYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMD
                     AISFVLGMKSIHLRSHTLADLIYRGTLQDGDADSGYSETHDNENNPSSAYVKAFYSPS
                     GQENDVAELTRTITLSQESTYKLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQ
                     VASQKPRELTTLFEQVSGSIQYKQEYDRLREELEKARSATSELIQSRKRANIGLKSFK
                     EGVNKDEEYRKHLEERNKLQQQLIVWQLFHLQAKRDSLTESLKSSQRELQSLDSELNS
                     EEQIVAKKKLSYAKKQTLAAKQRTRLSDKTKKVDHLTSSLLPIKSSKESIDKRLSAAV
                     TKIESLQRDIDRQESLVKQYEHQLKVVNKAKTNFQAEIDESAKSSGDFKLNEANLKRY
                     EDLKETFLSSGGSELEDKLLLEKNESQEISDEIELYSRQLDASRLKVNEELGAEKEAL
                     ENEVSELTKELSGKTSQVSAAVKKLKELQSRAEYNNNREYEVSFKLKETLTKLDDMNA
                     TQRETAKERKLRENVSILRRLFPGVRGLVHELCRPKKEKYTVAVSTILGKSFDAVIVD
                     HFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALDTKGCTLAIDAIDYERDLER
                     AMQYVCSDSIICDSLAIAKDLKWRRNVRAKLVSLDGSIVHKAGLMTGGTTKSSGNRWD
                     KEEYQGLMSLKDTLLGEISELSSANTIDSERIRSTENELSFLNSDVMSLRTQLNQVKR
                     SLNEKETEIQYQQELIKGEFEPKIQSLKEAMTAHAKTTARFEEEKDRLLDSVYADFEG
                     DIGFKVSQYEKHSGEMMRRQLEDLRKLQMQIAGIEKKLEFETERLQSTQERQQRVQVD
                     IEKAKIKLEALNSDEQRITDEIQGVELTINEEQTRLDNLQNEINKDLVELNSSEETIQ
                     EATEHLQSAKRMHEALAEDIDKNSLEKANVLKNCKMLNIKLPDGSSSLERVPLDGVSD
                     ATIEAANAVFVNFTRLNRRLKQSGEAETGNELQRSIDELNELLTVLQPNSKAAGRYEE
                     AKVKYESIFKETEKCKTKEKKVNEQFAKIRRLRKDAFESAFDHVSNAIDDVYRELTRD
                     PHSTAELAGGNASLTLEDEDEPYLAGIRYHATPPTKRFKDMEFLSGGEKTIAALALLF
                     AINSFQPSPFFVLDEVDAALDILNVERIATYIRQRALSNLQFIVISLKNTMFEKSQAL
                     VGVFRQQRDNTSRALTLNLENYED"
     gene            complement(<238679..>239092)
                     /locus_tag="KLTH0A02728g"
                     /db_xref="GeneID:8290375"
     mRNA            complement(<238679..>239092)
                     /locus_tag="KLTH0A02728g"
                     /product="KLTH0A02728p"
                     /transcript_id="XM_002551530.1"
                     /db_xref="GeneID:8290375"
     CDS             complement(238679..239092)
                     /locus_tag="KLTH0A02728g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A02728p"
                     /protein_id="XP_002551576.1"
                     /db_xref="GeneID:8290375"
                     /db_xref="UniProtKB/TrEMBL:C5DBH7"
                     /translation="MENDGSSSGLLRNRNVARSGKTSEERVFGPRFKSKLLKVQNQPV
                     STLGVFISACSIALSAVAMFLLGVNIVIQYRTIVPEDRAGMTRKASYIVLSAGAIYLL
                     NKFNLWFFRKVVSYFSSGPYDRLPAQESFEMEQRA"
     gene            complement(<239284..>241545)
                     /locus_tag="KLTH0A02750g"
                     /db_xref="GeneID:8290376"
     mRNA            complement(<239284..>241545)
                     /locus_tag="KLTH0A02750g"
                     /product="KLTH0A02750p"
                     /transcript_id="XM_002551531.1"
                     /db_xref="GeneID:8290376"
     CDS             complement(239284..241545)
                     /locus_tag="KLTH0A02750g"
                     /note="similar to uniprot|P07834 Saccharomyces cerevisiae
                     YFL009W CDC4 F-box protein required for G1/S and G2/M
                     transition associates with Skp1p and Cdc53p to form a
                     complex SCFCdc4 which acts as ubiquitin-protein ligase
                     directing ubiquitination of the phosphorylated CDK
                     inhibitor Sic1p"
                     /codon_start=1
                     /product="KLTH0A02750p"
                     /protein_id="XP_002551577.1"
                     /db_xref="GeneID:8290376"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DBH8"
                     /translation="MTSDSTEYPLMGIPIPFRYQVRESGDNVVEEMDLLLCDEPAKNS
                     SKRAREGENEASFDSKRLRGNCKSPQRSIIPGNSNFAEDIVPTSTQEPSFSTNSRHKS
                     TPHRNNSPLLLEGTKEGLWNGKCDPQYNQQSTQCNNCTPVDDTPAIVANNNSVTNGNG
                     TNPLVSAQNEEGLPLSPIASPSCSSSGAPCSPRDAISQQDYLDLVASTAHSRLSPSAY
                     QNLVFQLVSKLTRSELSDLGTLVKDNLKRDLISSLPLEVSMNILTNLGFEDISRCLSV
                     NRTWNSLINNTSYLWRKLMVTEGFISQEEFKKYSNETPEKSNDESQDGDLFRVHFLKN
                     QSYLKNWYNGRFKPHRTTLRGHTMKIVTCLQFEDDYVITGADDKMIRVYDVKSGRFLA
                     QLSGHDGGVWALKYGQDGILVSGSTDRSVRVWNIKTGKCTHVFKGHTSTVRCLDIVEH
                     NGGKFIITGSRDHTLHVWRLPNCHSENYDPEVCEIFNTTDTNPYFVGVLRGHMAAVRT
                     VSGHGNIVISGSYDFNLMVWDIAKMKCLYVLTGHTDRIYSTIYDYTRNRCISAGMDST
                     IKVWDLQNIQKNGHCTTINSTSNPCTKVTGSVLTLQGHTALVGLLGLSDKFLVSAAAD
                     GTLRGWDSDNYSRQFAYHHKDLSAITTFYVNDNILVSGSEGQFNVYNLRSGKLIHSDL
                     LSDADQIWSVKFDNRRLVAAVERDGRSFVEFLDFGKPEQEANVENLPYSSEDREDAEY
                     ATLGSRATRLYDP"
     gene            <242885..>244036
                     /locus_tag="KLTH0A02772g"
                     /db_xref="GeneID:8290377"
     mRNA            <242885..>244036
                     /locus_tag="KLTH0A02772g"
                     /product="KLTH0A02772p"
                     /transcript_id="XM_002551532.1"
                     /db_xref="GeneID:8290377"
     CDS             242885..244036
                     /locus_tag="KLTH0A02772g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A02772p"
                     /protein_id="XP_002551578.1"
                     /db_xref="GeneID:8290377"
                     /db_xref="GOA:C5DBH9"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="InterPro:IPR006181"
                     /db_xref="InterPro:IPR023209"
                     /db_xref="UniProtKB/TrEMBL:C5DBH9"
                     /translation="MLPGISTEVVAGSKMADLVIAGSGVIGLSVAFELLQSPGLQPAR
                     IHIIAQHFPGEEPISHEFTSPWAGAHFRPFPHRPESFGADRRESGYTRVTYKRMKTIA
                     AEHPESTIEFMKGADYLEQPPSEYDGMSPGYNKDSLENFREIPKGELPPNVKSGFEYT
                     TYCLNAPEYLGFLQRQVTALCKAKGVELCFKRMTLRSLAQVYEVVPSCDVIFNCTGLG
                     LQLDGSYDPSCFAIRGQTLLLDVPHKTKFAAATVTHQGRDGNWTFVIKRPPVGGKPAQ
                     YILGGTKQPGDNCVTPRDMDSHAIMERARALYPELLCESEFSVARVNVGFRPARNGGS
                     RVELESASPGPVIHAYGLGGMGYETSLGVAEHCLRIYRGLKCQRSKAKL"
     gene            <244936..>245586
                     /locus_tag="KLTH0A02794g"
                     /db_xref="GeneID:8290378"
     mRNA            <244936..>245586
                     /locus_tag="KLTH0A02794g"
                     /product="KLTH0A02794p"
                     /transcript_id="XM_002551533.1"
                     /db_xref="GeneID:8290378"
     CDS             244936..245586
                     /locus_tag="KLTH0A02794g"
                     /note="weakly similar to uniprot|P43582 Saccharomyces
                     cerevisiae YFL010C WWM1 WW domain containing protein
                     interacting with Metacaspase (MCA1)"
                     /codon_start=1
                     /product="KLTH0A02794p"
                     /protein_id="XP_002551579.1"
                     /db_xref="GeneID:8290378"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="UniProtKB/TrEMBL:C5DBI0"
                     /translation="MGHSKSNPPKVPNGWKAVFDEEYRTYFFVDLSNGKSQWEEPKGT
                     TWNAESPPPYQEQRPAGAPSAVKGDRKTPATEQRSGYPQQAYPQQPYSQQAYPQQGYG
                     QQAYPQQGYPQQGYPQQGYYPQAYPQQPYYPQAYPQQQYPQQQQGRKKFGGAMTGGLL
                     GVGGGLLAGSLLGSALSPHETIVENNYYDDNGGGDYGGGDFGGGDFGGGDFGGGDF"
     gene            <245846..>247783
                     /locus_tag="KLTH0A02816g"
                     /db_xref="GeneID:8290379"
     mRNA            <245846..>247783
                     /locus_tag="KLTH0A02816g"
                     /product="KLTH0A02816p"
                     /transcript_id="XM_002551534.1"
                     /db_xref="GeneID:8290379"
     CDS             245846..247783
                     /locus_tag="KLTH0A02816g"
                     /note="similar to uniprot|P43579 Saccharomyces cerevisiae
                     YFL013C IES1 Subunit of the INO80 chromatin remodeling
                     complex"
                     /codon_start=1
                     /product="KLTH0A02816p"
                     /protein_id="XP_002551580.1"
                     /db_xref="GeneID:8290379"
                     /db_xref="UniProtKB/TrEMBL:C5DBI1"
                     /translation="MGNRVYDPIHDVFQNKSEQEDVPPNEKLAGAEAPYPEEEDGDST
                     QSDDNATPMNESGPHKRRTKEPSKYMRHLKKPDGEFFTRKDIQFEFLHELCSDRRALF
                     TNRYQDFFTIAPTEESEPLNVTDESYVARKFIKNEKLTFSEYYLLTIASSTKCSKILR
                     DKLLFDRNVAFSTCALSLLVNTGRLNTTINFFLEMTSQLRTFHSIPCLQRDARDPKSL
                     QDTPRLKSILKNLPLGNENLPLTEYYEAPVAGKRLDSNPVNLMFHLCDNVALVNLKFI
                     QEYISGASDLSFFDILENPDYDPSQRAQILLWLVYVHLETDMTDSAIEKSLELFEVDG
                     KFKLESAPENVDIDTPEEVEFGESQKTKRREFLVKNNRLAHDGYRRSDANRPLMEQTR
                     LDNSSAEDVESIDEDKSFTEKTPSRAVQRANQRASRRTGQKPGPKPGAKAAARALAPK
                     RQSRKHAREQANDSMEEEHMPETTSKLEDEDFLAEEEPKLQVQLQSQSQPDDPEALQA
                     PAKKKQKRKTGPAAPASQVQRNEALDEKKKDEMEALIEFDKSEEVAQHRTQDALMQEL
                     ERAQALTRRKREELGLVKMFYEFEDVTMATVIGVRGKKRKKFKDGLLGFETDFIRTIS
                     GAKRAMLTAQHDANEDIYEFK"
     gene            complement(<247830..>248717)
                     /locus_tag="KLTH0A02838g"
                     /db_xref="GeneID:8290380"
     mRNA            complement(<247830..>248717)
                     /locus_tag="KLTH0A02838g"
                     /product="KLTH0A02838p"
                     /transcript_id="XM_002551535.1"
                     /db_xref="GeneID:8290380"
     CDS             complement(247830..248717)
                     /locus_tag="KLTH0A02838g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A02838p"
                     /protein_id="XP_002551581.1"
                     /db_xref="GeneID:8290380"
                     /db_xref="UniProtKB/TrEMBL:C5DBI2"
                     /translation="MHEIPKGPREPGEPAEPTEPVEPGALGEHAGHALRERDALRLRV
                     RALEEQLGSQSATEPQAPSPAGHAQELLHLLARDASASAPASLPASHRFHALPLLDPG
                     SRLSCLQEFLPLLQVRSLGPPATVVSFGTQLQLTLEWATQSARVTSLRVLEVSPPQAK
                     LALRPLVTHCERALNVSYLLLGCYEYSRLHAARSDLWQEIARASRRWLVQQRSESCLR
                     VSSLPAPAAAAATAPSLAVFVHYRIDFESVPLPQSLLSVELFNGPSTVPHANHVCNAL
                     IQEYGLRHGLQEFLRAVLS"
     gene            complement(<248935..>249249)
                     /locus_tag="KLTH0A02860g"
                     /db_xref="GeneID:8290381"
     mRNA            complement(<248935..>249249)
                     /locus_tag="KLTH0A02860g"
                     /product="KLTH0A02860p"
                     /transcript_id="XM_002551536.1"
                     /db_xref="GeneID:8290381"
     CDS             complement(248935..249249)
                     /locus_tag="KLTH0A02860g"
                     /note="similar to uniprot|P22943 Saccharomyces cerevisiae
                     YFL014W HSP12 Plasma membrane localized protein that
                     protects membranes from desiccation induced by heat shock
                     oxidative stress osmostress stationary phase entry glucose
                     depletion oleate and alcohol regulated by the HOG and
                     Ras-Pka pathways"
                     /codon_start=1
                     /product="KLTH0A02860p"
                     /protein_id="XP_002551582.1"
                     /db_xref="GeneID:8290381"
                     /db_xref="GOA:C5DBI3"
                     /db_xref="InterPro:IPR007250"
                     /db_xref="UniProtKB/TrEMBL:C5DBI3"
                     /translation="MSDSYRKDFSDKAAEKVKPDSQKSYAEQGKEFVTDQADKVAGKM
                     QPEQEKGAFQGVNDAAHKGKSEATGKSMTEQAGEYVDAAKAKLNDAAEYVSSSLHGGE
                     KN"
     gene            <250221..>251642
                     /locus_tag="KLTH0A02882g"
                     /db_xref="GeneID:8290382"
     mRNA            <250221..>251642
                     /locus_tag="KLTH0A02882g"
                     /product="KLTH0A02882p"
                     /transcript_id="XM_002551537.1"
                     /db_xref="GeneID:8290382"
     CDS             250221..251642
                     /locus_tag="KLTH0A02882g"
                     /note="similar to uniprot|P35191 Saccharomyces cerevisiae
                     YFL016C MDJ1 Protein involved in folding of
                     mitochondrially synthesized proteins in the mitochondrial
                     matrix localizes to the mitochondrial inner membrane
                     member of the DnaJ family of molecular chaperones"
                     /codon_start=1
                     /product="KLTH0A02882p"
                     /protein_id="XP_002551583.1"
                     /db_xref="GeneID:8290382"
                     /db_xref="GOA:C5DBI4"
                     /db_xref="InterPro:IPR001305"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR002939"
                     /db_xref="InterPro:IPR008971"
                     /db_xref="InterPro:IPR012724"
                     /db_xref="UniProtKB/TrEMBL:C5DBI4"
                     /translation="MYRRTLLRLSNPRALAPRLATGPSARLFHASTRLLDELKDPYAT
                     LGVSKSASGSEIKKAYYKLAKKYHPDINKAEDAQKKFHDLQNAYEILSDDSKRQQWDQ
                     FGPAAFSQGGAGAPGGGAGGAGAEGFGGFGGFGGAGFGGINFEDLFGAAFGGGAGAGG
                     AGARSRGSMFREYQGSPIELTHRISFKDSVFGTKNVNLKFSAYDPCGTCDGSGLKPGA
                     SRTTCPGCSGTGTRVHIRAGFQMASTCNQCGGEGSVVRDSDTCATCHGEGASLNKDHA
                     IKVDLPHGLQDGDVIRISGQGSYPNIAVDPAMKDTVRLSRGDVLLRIRVDKDPRFQIK
                     NKYDIWLTQDIPITTAALGGIVTVPTVDGEQVRLKVAPGTQHNDVVSISQKGVPRGAF
                     GSRGDMKVQYKISIKKPQSQAERCLWEALADVTGDTLARRSVLSSQPQQSSHTDNPDA
                     PGALGKLENFISNTFKKIKGDKK"
     gene            <251941..>252447
                     /locus_tag="KLTH0A02904g"
                     /db_xref="GeneID:8290383"
     mRNA            <251941..>252447
                     /locus_tag="KLTH0A02904g"
                     /product="KLTH0A02904p"
                     /transcript_id="XM_002551538.1"
                     /db_xref="GeneID:8290383"
     CDS             251941..252447
                     /locus_tag="KLTH0A02904g"
                     /note="similar to uniprot|Q12155 Saccharomyces cerevisiae
                     YLR050C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A02904p"
                     /protein_id="XP_002551584.1"
                     /db_xref="GeneID:8290383"
                     /db_xref="InterPro:IPR016964"
                     /db_xref="UniProtKB/TrEMBL:C5DBI5"
                     /translation="MLSNGLQKFYYYYFIIHIFTTILIDSSVILPAKFQFTQPLVEWH
                     IAQNNDFLLFEKPDWLWYFVLIECVGQLPGFFWFAGKFRQLWSLKESQTKADKMAIRD
                     CEKSLSKWLRVYGWNASVTTLICLWTVWTRGYYPSGEFLPMNVQDKIKLMAIYVPYVL
                     IPLRLCLA"
     gene            <252789..>254021
                     /locus_tag="KLTH0A02926g"
                     /db_xref="GeneID:8290384"
     mRNA            <252789..>254021
                     /locus_tag="KLTH0A02926g"
                     /product="KLTH0A02926p"
                     /transcript_id="XM_002551539.1"
                     /db_xref="GeneID:8290384"
     CDS             252789..254021
                     /locus_tag="KLTH0A02926g"
                     /note="weakly similar to uniprot|Q12110 Saccharomyces
                     cerevisiae YLR049C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A02926p"
                     /protein_id="XP_002551585.1"
                     /db_xref="GeneID:8290384"
                     /db_xref="UniProtKB/TrEMBL:C5DBI6"
                     /translation="MDGPRYVAPSQRLYRARHKITRKDLWKSYTVDDLTLSVDEPALL
                     DFSVPVLDFKKPPKKTVSSSERSSSIFSQPCGAGSEYGSQDDLGSTANGELQNLMFRN
                     YSLDSMILQNKKRITDHENNVSLLKAVSETSAANNKNYRTCSRPSSLPPKLSKEKVLH
                     ENAIEELVRHAERLEHRDARVLKYTNRKLLRREAHAQKQWAEIGQKKNKDILLEVRRR
                     GLVLDGLPWQHRQRVYDLCLIKNLEAPPSAPLLADIRSAIEDAVEDRGDEIFCNLYAR
                     SKWLKNGAPPAFNFYQVFELEFESLYYHITITLGLDPVREFVWPLLATVLCHYLNRGP
                     ADMVVRLVDTLVLTSYYGEIDEVFDKIWEIVLKEQSHKFFGSRESVHDELRSIHAHLP
                     TLLQTLQAQSGQAKEVKQ"
     gene            <254216..>254689
                     /locus_tag="KLTH0A02948g"
                     /db_xref="GeneID:8290385"
     mRNA            <254216..>254689
                     /locus_tag="KLTH0A02948g"
                     /product="KLTH0A02948p"
                     /transcript_id="XM_002551540.1"
                     /db_xref="GeneID:8290385"
     CDS             254216..254689
                     /locus_tag="KLTH0A02948g"
                     /note="similar to uniprot|P43577 Saccharomyces cerevisiae
                     YFL017C GNA1 Evolutionarily conserved
                     glucosamine-6-phosphate acetyltransferase required for
                     multiple cell cycle events including passage through START
                     DNA synthesis and mitosis involved in
                     UDP-N-acetylglucosamine synthesis forms GlcNAc6P from
                     AcCoA"
                     /codon_start=1
                     /product="KLTH0A02948p"
                     /protein_id="XP_002551586.1"
                     /db_xref="GeneID:8290385"
                     /db_xref="GOA:C5DBI7"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DBI7"
                     /translation="MPVLPNEYSIRRVKPSDYEGIVETLRVLTVVGDVTKEQFEETVA
                     YWNEVTVKSKGEPIKAYNPHVITDGSGKVVATGTVFIERKILHDCGLVGHIEDIAVAK
                     DQQGKKLGQLLIEHLTELALSRGCYKVILDCDEKNVGFYQKCGYSIKGVEMDRRS"
     gene            complement(<254751..>255041)
                     /locus_tag="KLTH0A02970g"
                     /db_xref="GeneID:8290386"
     mRNA            complement(join(<254751..254954,255015..>255041))
                     /locus_tag="KLTH0A02970g"
                     /product="KLTH0A02970p"
                     /transcript_id="XM_002551541.1"
                     /db_xref="GeneID:8290386"
     CDS             complement(join(254751..254954,255015..255041))
                     /locus_tag="KLTH0A02970g"
                     /note="highly similar to uniprot|P40204 Saccharomyces
                     cerevisiae YFL017W-A SMX2"
                     /codon_start=1
                     /product="KLTH0A02970p"
                     /protein_id="XP_002551587.1"
                     /db_xref="GeneID:8290386"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5DBI8"
                     /translation="MVSTPELKKYMDKKVYIQLNGSRKLVGVLRGFDIFLNVVLDDAV
                     EVRKDGTKFAMGSQSVVRGNSIVSLEALETFA"
     gene            <255982..>257478
                     /locus_tag="KLTH0A02992g"
                     /db_xref="GeneID:8290387"
     mRNA            <255982..>257478
                     /locus_tag="KLTH0A02992g"
                     /product="KLTH0A02992p"
                     /transcript_id="XM_002551542.1"
                     /db_xref="GeneID:8290387"
     CDS             255982..257478
                     /locus_tag="KLTH0A02992g"
                     /note="highly similar to uniprot|P09624 Saccharomyces
                     cerevisiae YFL018C LPD1 Dihydrolipoamide dehydrogenase the
                     lipoamide dehydrogenase component (E3) of the pyruvate
                     dehydrogenase and 2-oxoglutarate dehydrogenase
                     multi-enzyme complexes"
                     /codon_start=1
                     /product="KLTH0A02992p"
                     /protein_id="XP_002551588.1"
                     /db_xref="GeneID:8290387"
                     /db_xref="GOA:C5DBI9"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR004099"
                     /db_xref="InterPro:IPR006258"
                     /db_xref="InterPro:IPR012999"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="InterPro:IPR016156"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="UniProtKB/TrEMBL:C5DBI9"
                     /translation="MLRMRLQAGASRRFLSGTSRMLAEKKKHDLVVVGSGPGGYVAAI
                     KAAQLGFDTACVEKRGRAGGTCLNVGCIPSKALLNNSHLYHQMKHEAKQRGIDISGDV
                     SVNVAQLQKAKDTSVKQLTGGIEMLFKKNGVTYYKGHGSFEDENNIKVSPVEGVEGSV
                     TEETILEAKNIIVATGSEVTPFPGIKIDEERIVSSTGALSLKEVPKRLAIIGGGIIGL
                     EMGSVYSRLGSKVSVVEFLPKIGATMDDEVASATQKFLKKQGFDFKLGTKVLSAERNG
                     DVVNIEVENVKSGKKESLEADVLLVAIGRRPYIQGLNAEKLGLEVDKRGRLVIDEQFN
                     TKFPHIKVIGDVTFGPMLAHKAEEEGIAAVEYLKEGHGHVNYANIPSVMYTHPEVAWV
                     GKTEEQLKEAGISYKIGKFPFMANSRAKTNQDSDGFVKILIDAETERILGAHIIGPNA
                     GEMIAEAGLALEYGASAEDVARVCHAHPTLSEAFKEANLAAYSKSINF"
     gene            complement(257643..257715)
                     /locus_tag="KLTH0A03014r"
                     /db_xref="GeneID:8290388"
     tRNA            complement(257643..257715)
                     /locus_tag="KLTH0A03014r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8290388"
     gene            complement(<258170..>260332)
                     /locus_tag="KLTH0A03036g"
                     /db_xref="GeneID:8290389"
     mRNA            complement(<258170..>260332)
                     /locus_tag="KLTH0A03036g"
                     /product="KLTH0A03036p"
                     /transcript_id="XM_002551543.1"
                     /db_xref="GeneID:8290389"
     CDS             complement(258170..260332)
                     /locus_tag="KLTH0A03036g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A03036p"
                     /protein_id="XP_002551589.1"
                     /db_xref="GeneID:8290389"
                     /db_xref="GOA:C5DBJ0"
                     /db_xref="InterPro:IPR000679"
                     /db_xref="InterPro:IPR013088"
                     /db_xref="InterPro:IPR013860"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ0"
                     /translation="MTERKEDARSRERQCQKKLQEAISDSSAEALWHMYSSAQASLPY
                     RDRMVNLTWRMLGARMRKNVPVARQDQDQLYPEQVKYLSQSDKSSPMVPEEIDYMAEL
                     REIRGQSLSTAASSTLNMQATDGLAEGRASSSSASAPVKTEPLESKLSISDQIVSGMG
                     RGPTSGPTPSNSMKPFSQRDMEPSALGFDDNVHFGSFSNISQHVGFMADVDVDSFNIL
                     DGRESASGRELSHEEDEDMGMRAATYSSPALISDSGVSSADNPSYGQQSMSNSTLLNN
                     MDQASALSTVPNSVTIGGLNSSILGGQTFFDDHDFLHPVNEGNQDNENIFPPLHATNS
                     QISLPDLYDRTSNITPISIRRPSSAWQALPNGLGASAPGTSAIAPSSLPNPQVSRRPV
                     SVNSVRKKQIKSSNSRRGSLSFTSINGGSIPTGFVGQQEKGSNDAARKPTTNEGTSGA
                     SASGGKTDTKCTNCHTKTTPLWRRDPQGNPLCNACGLFLKLHGVVRPLSLKTDVIKKR
                     QRSSNKATAANSSAVVGQDNSPSKDAVQNSKSKRPLSRKKTSSVNILGEARPSLPRSQ
                     SSFSRRKSKASFNTRDAENASSESGSGTPTPVQASGADTQTMSNTASEMDIDQHSTAN
                     VDEGTKHNESSFDLILEQWSQPTNSENNSGRTHPQQGSQPQSKQPEGQSAFYFSSSHG
                     REGRRKPEPASGLSGPQNPADKKNAGENANWDWLTLSL"
     gene            complement(<261659..>262357)
                     /locus_tag="KLTH0A03058g"
                     /db_xref="GeneID:8290390"
     mRNA            complement(<261659..>262357)
                     /locus_tag="KLTH0A03058g"
                     /product="KLTH0A03058p"
                     /transcript_id="XM_002551544.1"
                     /db_xref="GeneID:8290390"
     CDS             complement(261659..262357)
                     /locus_tag="KLTH0A03058g"
                     /note="similar to uniprot|Q12035 Saccharomyces cerevisiae
                     YLR051C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0A03058p"
                     /protein_id="XP_002551590.1"
                     /db_xref="GeneID:8290390"
                     /db_xref="InterPro:IPR014810"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ1"
                     /translation="MASDSIEDLFAELKKLETAGVTHSAPAGESSTPGENEGFDQDKL
                     EFEDDSKIAQQQKTFREIEQRMRKLPRMETGFDSLTLPAGSAVEGTKAVTKVEDPVSI
                     LHSRKKDAATKKPSTTEQWFTLPKPELTRELKRDLLVLKHRAALDPKRHYKKEKWTVP
                     ERFSVGTIVEDKTEFYSSRLNNKQRKSTMVGELMDSENTNKYFKRKYTEVQAKKTSGA
                     KGHYRKVREKRNKM"
     gene            <262571..>263257
                     /locus_tag="KLTH0A03080g"
                     /db_xref="GeneID:8290391"
     mRNA            <262571..>263257
                     /locus_tag="KLTH0A03080g"
                     /product="KLTH0A03080p"
                     /transcript_id="XM_002551545.1"
                     /db_xref="GeneID:8290391"
     CDS             262571..263257
                     /locus_tag="KLTH0A03080g"
                     /note="weakly similar to uniprot|Q12345 Saccharomyces
                     cerevisiae YLR052W IES3 Subunit of the INO80 chromatin
                     remodeling complex"
                     /codon_start=1
                     /product="KLTH0A03080p"
                     /protein_id="XP_002551591.1"
                     /db_xref="GeneID:8290391"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ2"
                     /translation="MSDESALSICEDSVREFTELLAKDTQIRYAQNAIRRYKSSEAVD
                     VDDERKSRHKRNIIAVDDNLKINYEMVKMTPGTFIESSVSTSKNKALKEKAGKVTKMK
                     TNYYKKRLYNMNEQFLAEQGTLEPVSCSDSQSPESAADAGDAGDTAGAASIADDAPLD
                     QQARWLAEIHKDLLQQYNTLLQEEKKWFLKKEVLLDANAKLDLFTTRDEDQSTLQLGS
                     KDTAGLCMFH"
     gene            <263585..>265084
                     /locus_tag="KLTH0A03102g"
                     /db_xref="GeneID:8290392"
     mRNA            <263585..>265084
                     /locus_tag="KLTH0A03102g"
                     /product="KLTH0A03102p"
                     /transcript_id="XM_002551546.1"
                     /db_xref="GeneID:8290392"
     CDS             263585..265084
                     /locus_tag="KLTH0A03102g"
                     /note="highly similar to uniprot|P15625 Saccharomyces
                     cerevisiae YFL022C"
                     /codon_start=1
                     /product="KLTH0A03102p"
                     /protein_id="XP_002551592.1"
                     /db_xref="GeneID:8290392"
                     /db_xref="GOA:C5DBJ3"
                     /db_xref="InterPro:IPR002319"
                     /db_xref="InterPro:IPR004529"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ3"
                     /translation="MSDLQLEILQKLDQLGEIQSTLEVFPNINPQVVLSSLNSLKAHG
                     KLEYTKQDKTYYTLSKEGEEIMGKGSHEIRLLQLVDKFTKLQIKDVATHMGADGKVGQ
                     ARAFKNGWISKNKDNELTVSDKISSVNDVQDETKDILVQIKNGNYEGVNDKTLNDLKK
                     RKLVAAKKEISFHVTKGADFSTELTKLETDLTADMVASGTYKDLKFKPYNFNSEGILP
                     ESGALHPLNKVREEFRQIFFSMGFTEMPANQYVDTGFWNFDALYVPQKHPARDLQDTF
                     YLKDPIKSDLPEDKAYLENIKAVHEQGKFESIGYRYDWKPEESQKLVLRTHSTATSAY
                     MLKKLAEDPKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIQFMEGF
                     FEKMGVTGLRFKPTYNPYTEPSMEIFSWHEGLGKWVEIGNSGMFRPEMLESMGLPPNM
                     RVLGWGLSLERPTMIKYGVQNIRELLGHKVSLDFIETNPAARLDEDLYE"
     gene            complement(<265273..>265863)
                     /locus_tag="KLTH0A03124g"
                     /db_xref="GeneID:8290393"
     mRNA            complement(<265273..>265863)
                     /locus_tag="KLTH0A03124g"
                     /product="KLTH0A03124p"
                     /transcript_id="XM_002551547.1"
                     /db_xref="GeneID:8290393"
     CDS             complement(265273..265863)
                     /locus_tag="KLTH0A03124g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A03124p"
                     /protein_id="XP_002551593.1"
                     /db_xref="GeneID:8290393"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ4"
                     /translation="MIFAHTDLDFQETSMGLARSYPSLDAGSLSEGAEQEQQPRAPIE
                     DVLELIISGTESELDPPIFEAELLTSDMAVDGLRQDSIFSLDGDADLSLPDLQETESF
                     DTSLEQLPYEAFNACADQPAETPGAPARPRLSHRKSNPFYLPSKHIKNMISKDRHRQS
                     ARKVESASRSQWGGAGEALIPDQCTKPFLERRQTIG"
     gene            complement(<266666..>268573)
                     /locus_tag="KLTH0A03146g"
                     /db_xref="GeneID:8290394"
     mRNA            complement(<266666..>268573)
                     /locus_tag="KLTH0A03146g"
                     /product="KLTH0A03146p"
                     /transcript_id="XM_002551548.1"
                     /db_xref="GeneID:8290394"
     CDS             complement(266666..268573)
                     /locus_tag="KLTH0A03146g"
                     /note="some similarities with uniprot|Q12202 Saccharomyces
                     cerevisiae YLR054C OSW2 Protein of unknown function
                     proposed to be involved in the assembly of the spore wall"
                     /codon_start=1
                     /product="KLTH0A03146p"
                     /protein_id="XP_002551594.1"
                     /db_xref="GeneID:8290394"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ5"
                     /translation="MIILSCLSFPSLNRYCDLLSRYSGKHTIVLVDASFAAQLEKLVL
                     DKFYDTCACVLSVLCDVETRQLSSGSYALVNDSCKFYLGLTYARKGFNKQANKQDRLS
                     VNLQCVQNTFFDESSTLNAMVAQLEGTNVDTIIKLAPEESCEMALKVWEHIIPRISLH
                     ILSIVFEQFDYDKLLENSSSRFIFEDLVRELSSICYAQCGEVSEKYLKSKSGPRNPPT
                     SAEDWISQLDFDKVLEETKRRKRQMDRSTINEYPEFLTLSFEAYCFYHRLEFPAHILL
                     HQPIQLASAYRINYSSINFLYGFYSRLLAISGFSIEGEPNKVSAPSLLFGIRTQLANQ
                     SEQTLVSKHCLNDDKNAPGSASKSKGVKSKLRARFKKIGHGNRERTSGATYSSEDPEL
                     SDEESGSSLDNLLAGDARDRSSTDPEDTGEAQAGRDFMFWCSEEFQDANSEPEIDDND
                     NSSIVDELIKLPNFRKRNFRKQGTQAELTLTTVPLFEQEIRSDPFAMSRYYFDAYKLG
                     DPKTFLSLKERDSRPASARRFQRRYPRERAGVTGASTLPENYFRDHVDLMKRVNMGGI
                     LSVTTSRYGHVDSSQKMLDNWNRGLGYLKTLALRESASQVGASCHVVREPPARLQLRH
                     SRRSSFSPEVD"
     gene            complement(<269073..>270239)
                     /locus_tag="KLTH0A03168g"
                     /db_xref="GeneID:8290395"
     mRNA            complement(<269073..>270239)
                     /locus_tag="KLTH0A03168g"
                     /product="KLTH0A03168p"
                     /transcript_id="XM_002551549.1"
                     /db_xref="GeneID:8290395"
     CDS             complement(269073..270239)
                     /locus_tag="KLTH0A03168g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A03168p"
                     /protein_id="XP_002551595.1"
                     /db_xref="GeneID:8290395"
                     /db_xref="InterPro:IPR022210"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ6"
                     /translation="METDKVSSVSERLQLLMDVNHEQHDRPSGSLLTHLISTLDQETT
                     APPTLAEDAPSLQEDAAERTFTASSYYTSFVPARPHADYFDFDTEYNEKAKDLYGDVE
                     EAEAAAGRSDTGVERRLETMEESTLEASPVGLPTDDPSDDADQNVQMILDKLDTFKRE
                     FRHLIKRMDEASLVSRISGSATLPDMTARPRVMNTLVGEIIDTLQSFVPQPSRKRSRC
                     DSDVGIAEKDEESSLLDAVAKETLEHDPCYGVPNFGVVLIKSPTTVSQLWNEYTKLPS
                     EWALPDWFDVASQQSSGANNARRPAILLKRRTSIRDLERIYGSSWRNGDKNFSRQVNR
                     RKKIWHAIEEGLESGIPLEECFRLLESYVKERGKGLSWYYNGVPFKLAELRGGN"
     gene            complement(<270862..>273408)
                     /locus_tag="KLTH0A03190g"
                     /db_xref="GeneID:8290396"
     mRNA            complement(<270862..>273408)
                     /locus_tag="KLTH0A03190g"
                     /product="KLTH0A03190p"
                     /transcript_id="XM_002551550.1"
                     /db_xref="GeneID:8290396"
     CDS             complement(270862..273408)
                     /locus_tag="KLTH0A03190g"
                     /note="similar to uniprot|P43573 Saccharomyces cerevisiae
                     YFL023W BUD27 Protein involved in bud-site selection
                     nutrient signaling and gene expression controlled by the
                     TOR kinase diploid mutants display a random budding
                     pattern instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="KLTH0A03190p"
                     /protein_id="XP_002551596.1"
                     /db_xref="GeneID:8290396"
                     /db_xref="GOA:C5DBJ7"
                     /db_xref="InterPro:IPR004127"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR024325"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ7"
                     /translation="MSFQKKCNKAYADTQSAMDSLVDIVSKTSVNLENKLRFLKEQKQ
                     HYSGIRRNLVDYDKDSYDDNEDGNKRGLVFGEIIISSKIYLNIGYEYFVEKSQLEAID
                     FITEKLRLIDEAAARFEGKIQEAKETLKNLKEAQKLEEDQASSDNQDSFPNPSENEDG
                     LPFMEIREDLDEEGNILSSSVNPTATAQPSNPRIEEISDETETVVSGKRATGDAEPSI
                     HNARFDKGFDKDFEHRVRDKTLKDSTEFREKDEAKAASEPSPIVKDVDIEDLNIKGPN
                     IKKHGPAIEPGDIYTFDDIVAQLEKEDGIEGGDIKDEDIHYDFDSYNHKSLLNDSESE
                     EDEDDYDDYDESSMPSIIPGFAQRRFLDQINHLRSQKQQPQQPQEPQEPQKLQRPSQV
                     QHVSETVKTKSILKKDKGAKKASKKVGFAPTLDVHEIESVKRETKANTYIASPFAAQS
                     SVEDITHADADEGFDADLFAQLIGAKDSNEVHEKYEKEIEQQPAKRKPKVSRFKKDRN
                     PSAAVESTKFATNKEVQNPINGQAVEDIMERDPEAAERVTQVTKDFSRVRLDNSGPVT
                     GVLERDSETDAPSSPSSGLSATNIPRNSEALANKASNPGWDSKFKKNLSSLQKPVKRR
                     PAKEKLPELPEQEEIETTEPKGLESRPVLEKQDQPQAFPKEINAAVNNNPSEVVQNPH
                     VDFHKLGEDLDDMARAYLLGLYNSDVEDPGAVLEKLGDLNSYNKEVETLKGEISTFLK
                     ENPLATVDEASGADDDEKGPIMTDVVEKEVELPSDYDEVDVELSSEALNHSVAVEYHR
                     LRERMIASQGTIERSPEELQLEAIDEYGNPIRTSKFKANKLRIGTDENHG"
     gene            <274770..>277055
                     /locus_tag="KLTH0A03212g"
                     /db_xref="GeneID:8290397"
     mRNA            <274770..>277055
                     /locus_tag="KLTH0A03212g"
                     /product="KLTH0A03212p"
                     /transcript_id="XM_002551551.1"
                     /db_xref="GeneID:8290397"
     CDS             274770..277055
                     /locus_tag="KLTH0A03212g"
                     /note="similar to uniprot|P43572 Saccharomyces cerevisiae
                     YFL024C EPL1 Component of NuA4 which is an essential
                     histone H4/H2A acetyltransferase complex homologous to
                     Drosophila Enhancer of Polycomb"
                     /codon_start=1
                     /product="KLTH0A03212p"
                     /protein_id="XP_002551597.1"
                     /db_xref="GeneID:8290397"
                     /db_xref="GOA:C5DBJ8"
                     /db_xref="InterPro:IPR019542"
                     /db_xref="InterPro:IPR024943"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ8"
                     /translation="MAAPSSQEAANTRFRHRKISVKQRLQVYKASDLRKLDKDELQQR
                     ELVEIETGVEKNEEKEEHLHKILQKNQLTRKELYIPTPDASQTWGEYENFYRGKFEEP
                     VSYIRFSATVEDCCGSCYNMDERDERFLESKVNNKLKDGEKLSETEFELMCSSLEAAI
                     HERQPFLSIDPENILSLEEIKPTILKRDLGDAGIKDKLAEEIGVQPQHFITQFDSAVQ
                     QDSRPITVLFEKFGKQVYNHWKGRKIEAHGGKICPQLKSERPGDRDDNDPYVCFRRRE
                     VRQARKTRRVDYQNSHKLRLLHQQLLFTKKLALLVAKREKVSLDMLENDLRVFELRRD
                     IKPIKRSAVIRGDDDLLLDQKKRRLVSNVVTSTALESNPKKLRTKSKKANADAANSKV
                     AVAAKPQSRSSQAQSQQSAQQLHSQQQALLQQQQAQQQAQQQKQQANAIAAHVYVKLP
                     SSKIPDILLEDVDDILLKKERSARNYVEERMRKRRLEDGERFFNLTDDPYNPVFDISV
                     PAGVSPTNAPFSSIASSKFEIEKSYYVPGLDNYLEGKADDVVVLNRDGDRIDNPKYRK
                     IERYRPFQQNSGVHTRELPFRLRRRVGRLGLEYIDRRRPSEAFEPLKSFINLAEVEKQ
                     ERENDVIDVYDSKLDALSRLHDRWKHDSDYNDHGAKFSHEPARLNQISNDTQVIRFGT
                     MLGTKSYEQLRDATFKYRQEIYNQRRIQKNSISQKHPRVNGVTPASASTPSMSSTPAR
                     TSSSSSIKRNSNTKQHVASIN"
     gene            <277333..>280440
                     /locus_tag="KLTH0A03234g"
                     /db_xref="GeneID:8290398"
     mRNA            <277333..>280440
                     /locus_tag="KLTH0A03234g"
                     /product="KLTH0A03234p"
                     /transcript_id="XM_002551552.1"
                     /db_xref="GeneID:8290398"
     CDS             277333..280440
                     /locus_tag="KLTH0A03234g"
                     /note="similar to uniprot|P43571 Saccharomyces cerevisiae
                     YFL025C BST1 GPI inositol deacylase of the ER that
                     negatively regulates COPII vesicle formation prevents
                     production of vesicles with defective subunits required
                     for proper discrimination between resident ER proteins and
                     Golgi-bound cargo molecules"
                     /codon_start=1
                     /product="KLTH0A03234p"
                     /protein_id="XP_002551598.1"
                     /db_xref="GeneID:8290398"
                     /db_xref="GOA:C5DBJ9"
                     /db_xref="InterPro:IPR012908"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DBJ9"
                     /translation="MGLRRSVNALAHKGVYFAGRYLKMGEHKISNSAGSEVGGAQTKR
                     KRSGLKSVTGDALRNQKSSGDKVPLRIITLGFLLVLLVVAASFFKKFTGADSPKCRSI
                     YMYPSYARIDGFDERFTKLAKKYHLYLYREQGKDREPLENNLIQLDGVPVLFIPGNAG
                     SFKQARSIAAASADMYFDEPELIDNHWTKNLDFFTADFNEDFTAFHGRSLLDQAEYLN
                     DAIKYILSLYSANEDRTEPQPQSVLVLGHSMGGVVARVMPTLKNFVPESINSYITLSA
                     PHTASPVTFDGDMLKIYESTSKFWKSQFSDNSSFFSQNVSLISITGGVLDTTLPADLT
                     LVEDIIPYSNGFTTYTTTIPQVWTPIDHLAIVWCDQLRKVLAKLLLETVDVHSSYKSR
                     PLKERMRFYRKSLISGLEDYAVQDLKIDDRSESSYKPFELPDDFEEMVTGEKLILTRE
                     TAEAHRLLNLFKIPTNKKDYQFSLLTSMAPPEVFFCQNNIVRARIDDKLEDTKFECVS
                     AKDDFTRIPRSTKDSLFPSDSSVGEPMSPFYLLKINGAVLSRFEFVAFSAPEGFVHDD
                     DFLIAEMKATNSTRSLGDNPLTVLLKSLIKRKVRIDTSFLISTISFPNLWSSVISYRL
                     KTTTIGENLIFEPLIRQFIELPFETKWHVNLKQGPQDVNFHNVAPFIPSNSSNDRSLK
                     LDFISPPGCEMTMSLEINWALTMKMLLIRFRLTIAAFTVGLVSLVAFLQYYQYNQTGQ
                     FLAFDAALKLLLSKYWVLILALASLLTPLYSFFCLEKLSNITKFADRTRPTMSASHSW
                     ASNTFFLGIDELFLWWLGPVFFLMTVSSVYLLFRLITMVEAAARVAFSKVLPFRRTVE
                     VSSIANEASSNRQFNLRQFAGALILVLGVVFYIPYQFAFIILTVVQSLFCLKIAVSAE
                     EGIKRNVVNYNNSVLLLMLLLLPINAPIVMVFMRNFAIRWETPFRSHHNCLAILPIIL
                     LIESNARSRIPLRSLTNNLVSLAILGWLLHMSLYSFIFGTRNLYWLHYLFNSLCAMLF
                     LKTFA"
     gene            complement(<280633..>281961)
                     /locus_tag="KLTH0A03256g"
                     /db_xref="GeneID:8290399"
     mRNA            complement(<280633..>281961)
                     /locus_tag="KLTH0A03256g"
                     /product="KLTH0A03256p"
                     /transcript_id="XM_002551553.1"
                     /db_xref="GeneID:8290399"
     CDS             complement(280633..281961)
                     /locus_tag="KLTH0A03256g"
                     /note="similar to uniprot|P06842 Saccharomyces cerevisiae
                     YFL026W STE2 Receptor for alpha-factor pheromone seven
                     transmembrane-domain protein that interacts with both
                     pheromone and a heterotrimeric G protein to initiate the
                     signaling response that leads to mating between haploid a
                     and alpha cells"
                     /codon_start=1
                     /product="KLTH0A03256p"
                     /protein_id="XP_002551599.1"
                     /db_xref="GeneID:8290399"
                     /db_xref="GOA:C5DBK0"
                     /db_xref="InterPro:IPR000366"
                     /db_xref="InterPro:IPR027458"
                     /db_xref="UniProtKB/TrEMBL:C5DBK0"
                     /translation="MGSEFSPSTANTTMATLRSASEMLLTFESAFSNDTQVDFGQLQA
                     LADTRITQGILFGTRIGTSVLTIITLYMVSKNRKTPIFISNFVSLFLVALHSALYLGY
                     LTTPFASLTFNLTLFPDLIPRSNLHLFAVTNVVQVLLVAAVEASLILQVRIIFHSNTL
                     KPVGRVLVALSSVLAAATTVLFFVSAVKSIRSVYADVLAIQDTLFFNLATIMLATSVN
                     FMTLLLTVKLVLAIRSRRFLGLKQFDSFHILLIMSFQTLVFPSLLLILSYALNGKKGT
                     NTLSTLATLLVTLSLPLSSMWATSANNSPRPSSVNTRFSPCLSDNGSSKFDNHSLFSH
                     SMNSTAYQRHEDRAYDLYPISRSGNIDEDYGYGMEPLDKDNCRTLAVSVKSGDTSPGS
                     SSHGELSRLPSSDANQQTLETLERAIQAGSFTPNTVDDEAARSFWANAKP"
     gene            <283065..>284783
                     /locus_tag="KLTH0A03278g"
                     /db_xref="GeneID:8290400"
     mRNA            <283065..>284783
                     /locus_tag="KLTH0A03278g"
                     /product="KLTH0A03278p"
                     /transcript_id="XM_002551554.1"
                     /db_xref="GeneID:8290400"
     CDS             283065..284783
                     /locus_tag="KLTH0A03278g"
                     /note="highly similar to uniprot|P50276 Saccharomyces
                     cerevisiae YGR055W MUP1 High affinity methionine permease
                     integral membrane protein with 13 putative
                     membrane-spanning regions also involved in cysteine
                     uptake"
                     /codon_start=1
                     /product="KLTH0A03278p"
                     /protein_id="XP_002551600.1"
                     /db_xref="GeneID:8290400"
                     /db_xref="GOA:C5DBK1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C5DBK1"
                     /translation="MFRSKYASQLNPFSKSEGRGPSESKAATTEFSGSDDIEHGEQFV
                     TELDQGSKRLGLVSCIGLICNRMLGTGVFAVSSTIYTLCGSVGLALIMWAVGAIIALS
                     GLYVYMEFGTAIPRNGGEKNYLEHICEKPRFFITCMYAAYVFFLGWAASNSVNSAVMF
                     LTAADVEITTWKQRGVAVAVVCFCFLVNAINVRVGLLIQNVLGIFKIVIVLFISVTGW
                     VALGGGLRDGVKTNNFHNAFEGTKDATAYGVVNALYNVIWSFVGYSNVNYALGEVKNP
                     VRTLKIAGPTSLIFLAIVYIFVNIAYFAVVPKEKLISSKLVLAADFFDIVFGGSGKKA
                     ASVIVGLSAVGNVMSVIFSQGRIIQQLGREGVLPFSSFFATSKPFDSPLVGLLQHFIV
                     CVVTILAPPPGDAYNFILNLISYPMNVVNLVVSSGLLWIYWKRRQGKITWNPPIKAGV
                     VITTFFTLSNLYLVVAPYVPPTGDQSVYNSLPYWIHCVVTWGIFAFGAAYWVVWAYLM
                     PKFGKYELVDTEVIGDDGFWRKKITKHYLDDAENDGESENNIVSETISIKNTADSSKE
                     SNKAGL"
     gene            complement(<284917..>286008)
                     /locus_tag="KLTH0A03300g"
                     /db_xref="GeneID:8290401"
     mRNA            complement(<284917..>286008)
                     /locus_tag="KLTH0A03300g"
                     /product="KLTH0A03300p"
                     /transcript_id="XM_002551555.1"
                     /db_xref="GeneID:8290401"
     CDS             complement(284917..286008)
                     /locus_tag="KLTH0A03300g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A03300p"
                     /protein_id="XP_002551601.1"
                     /db_xref="GeneID:8290401"
                     /db_xref="GOA:C5DBK2"
                     /db_xref="InterPro:IPR003000"
                     /db_xref="InterPro:IPR026590"
                     /db_xref="InterPro:IPR026591"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="UniProtKB/TrEMBL:C5DBK2"
                     /translation="MAESDGQMQQFQRYLSKARKILCIVGSGVSASSGIATYQLQKGS
                     WHGYTALDLATPEAFQNDPGLVWLFYSNRRYEALRAKPNEGHYALAELCRRYPSGISR
                     RGDSASGQHPPASVNDKKKVLVVSQNVDGLHQRAGHPPESLVELHGSVFGLRCTQFFC
                     NYRSRNSNDRFLTPALYRYTPRNRGANKKRTKRVSLHDGTETKKRRLDSTANGVQGQE
                     TDLEPPSSEEESERPEMFPTLEPGDLPSCPQCHQGILRPAVVWYGESLPLDQMDEVDQ
                     FFNKGGPVDLVLVIGTSGKVWPAMGYVERAKKSGSRVAIFNRVIEDLDQVRDSKDIWG
                     FQGDAAQLLPKALKPLIGERYKPRDWRRR"
     gene            <286223..>288904
                     /locus_tag="KLTH0A03322g"
                     /db_xref="GeneID:8290402"
     mRNA            <286223..>288904
                     /locus_tag="KLTH0A03322g"
                     /product="KLTH0A03322p"
                     /transcript_id="XM_002551556.1"
                     /db_xref="GeneID:8290402"
     CDS             286223..288904
                     /locus_tag="KLTH0A03322g"
                     /note="similar to uniprot|Q06488 Saccharomyces cerevisiae
                     YLR357W RSC2 One of 15 subunits of the 'Remodel the
                     Structure of Chromatin' (RSC) complex required for
                     expression of mid-late sporulation-specific genes contains
                     two essential bromodomains a bromo-adjacent homology (BAH)
                     domain and an AT hook"
                     /codon_start=1
                     /product="KLTH0A03322p"
                     /protein_id="XP_002551602.1"
                     /db_xref="GeneID:8290402"
                     /db_xref="GOA:C5DBK3"
                     /db_xref="InterPro:IPR001025"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR027180"
                     /db_xref="UniProtKB/TrEMBL:C5DBK3"
                     /translation="MSEEKKQLQKRLKPLYDEVLKIKEPNGLEIYPIFQILPPRKDYP
                     DYYRVIKHPMSLSTIKKRLSHHYGSANEFVRDLVQITWNARTYNTKQSDIYLYATILD
                     DYIKAHIIPELRKFDSKVSYPNLGPLPDEIDSASRAHKDQDVTDIPVSNEILATSNGA
                     DSGNGADDTHEQDDDEDYNAQQQEEDEDEEYTEQKKPLPKIRIPPATQSPVPHQLPSH
                     SMTPTPLYQRHQQQKTHMRRGRPPVIDLPYEQRIKNVLKVLKKDINERGENITAAFDR
                     LPDEEREPQYYAMIANPISVDDIRKKVKQRKYKTFQLFQQDFKLAISNYQLYHRSQPA
                     ELRRAAELEKRFNELAQYELSRPDEDYMTDGELKYPMNQVEHNGSTYKIGDWILIHNS
                     NDASKPTIAQIFRLWHTSDGRRWLNACWYLRPEQTVHRVDRLFYKNEVVKSGQYRDHL
                     VDEIVGKCYVCHFTRFQRGDPDLEIEGPLFVCEFRYNESEKVFNKIRTWKGCLPEEIR
                     DVEEATIPVLGRKFFKYESPIKHLLPPNATVNDPIPMPTEGAVNAPPLVGAVYLRPKV
                     KKDDLGEYSTSDECPRYIMRPGDPVEHGKVDIETGTIVTNTQTTTALPKGGPSTTRLA
                     SLTKSRSASGLASMRQSNTAVYNPPAMKSTQYFPPGQSPASGQSPLPMQQTPLPSQAS
                     ISQQQANGKSGSAGSTPAYQPPTIINSLAAQARTNNSVIGTISTDTPGAYVLPLQITK
                     NVELLQRADYSSQARRLGKDQVPKRKRTKGEVLWFKGPSVAITERLLNSKNEYTDIPL
                     NRWFKKRRMEYEEVDAEDNDYVNDDQEEDNQGDEDSEDEESSLAGTFPLGLRPSVSYM
                     AFKIAQQAQHTQQAQQTQETQQTPQTQQTQPATIQAD"
     gene            <289188..>290636
                     /locus_tag="KLTH0A03344g"
                     /db_xref="GeneID:8290403"
     mRNA            <289188..>290636
                     /locus_tag="KLTH0A03344g"
                     /product="KLTH0A03344p"
                     /transcript_id="XM_002551557.1"
                     /db_xref="GeneID:8290403"
     CDS             289188..290636
                     /locus_tag="KLTH0A03344g"
                     /note="highly similar to uniprot|Q05911 Saccharomyces
                     cerevisiae YLR359W ADE13 Adenylosuccinate lyase catalyzes
                     two steps in the 'de novo' purine nucleotide biosynthetic
                     pathway"
                     /codon_start=1
                     /product="KLTH0A03344p"
                     /protein_id="XP_002551603.1"
                     /db_xref="GeneID:8290403"
                     /db_xref="GOA:C5DBK4"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR004769"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR019468"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="InterPro:IPR024083"
                     /db_xref="UniProtKB/TrEMBL:C5DBK4"
                     /translation="MSEFDKYTTPLSSRYASEEMSSIFSLRNRFSTWRKLWLNLAVAE
                     KELGLSVITDEAIEEMRQHLKITDAEIGEASKQEAIVRHDVMAHVHAFGQTCPSAAGI
                     IHLGATSCFVTDNADLIFLRDAYDILIPKLVNVINRLSQFALQWKDLPVLGWTHFQPA
                     QLTTLGKRVTLWIQELLWDLRNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEA
                     LDKRVTELLGFDTVYPVTGQTYSRKIDIDVLAPLCSFAATAHKMATDIRLLANLKEIE
                     EPFEKSQIGSSAMAYKRNPMRCERVCSLARHLGSLFNDAVQTASVQWFERTLDDSAIR
                     RISLPSAFLTTDILLSTLLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVGKGAS
                     RQEVHEAIRVLSHQAAAVVKEEGGDNDLIERIKKDNFFQPIWDELDSLLEPSTFVGRA
                     PQQVEKFVGGDVAQALAPFQDKITDEQVKLSV"
     gene            complement(<290685..>291389)
                     /locus_tag="KLTH0A03366g"
                     /db_xref="GeneID:8290404"
     mRNA            complement(<290685..>291389)
                     /locus_tag="KLTH0A03366g"
                     /product="KLTH0A03366p"
                     /transcript_id="XM_002551558.1"
                     /db_xref="GeneID:8290404"
     CDS             complement(290685..291389)
                     /locus_tag="KLTH0A03366g"
                     /note="similar to uniprot|P53237 Saccharomyces cerevisiae
                     YGR057C LST7 Protein possibly involved in a post-Golgi
                     secretory pathway required for the transport of
                     nitrogen-regulated amino acid permease Gap1p from the
                     Golgi to the cell surface"
                     /codon_start=1
                     /product="KLTH0A03366p"
                     /protein_id="XP_002551604.1"
                     /db_xref="GeneID:8290404"
                     /db_xref="InterPro:IPR021713"
                     /db_xref="UniProtKB/TrEMBL:C5DBK5"
                     /translation="MPNMLISLAHFCDKHGPRILLGTQFAKDGEELFLPDYPTDTYCD
                     SCSIHFPGSDKSSRSMRSTLHSIDYVSTNYPSVRYQLISSVIRHIFSEETMTYDGSPL
                     TFYDQSRGLNLVIGFKLQDNDARGDERRYGLILTIDSPDHASAMKLLSRHWEFVNYSF
                     NKVIQYTKQQREDELRRRQISESYGEFTPMAGSYLRGNKLKIPRNLAYLTNDDLLFVR
                     LHKWNTYMLDVLNMDE"
     gene            complement(<291551..>293413)
                     /locus_tag="KLTH0A03388g"
                     /db_xref="GeneID:8290405"
     mRNA            complement(<291551..>293413)
                     /locus_tag="KLTH0A03388g"
                     /product="KLTH0A03388p"
                     /transcript_id="XM_002551559.1"
                     /db_xref="GeneID:8290405"
     CDS             complement(291551..293413)
                     /locus_tag="KLTH0A03388g"
                     /note="some similarities with uniprot|P43609 Saccharomyces
                     cerevisiae YFR037C RSC8 One of 15 subunits of the 'Remodel
                     the Structure of Chromatin' (RSC) complex essential for
                     viability and mitotic growth homolog of SWI/SNF subunit
                     Swi3p but unlike Swi3p does not activate transcription of
                     reporters"
                     /codon_start=1
                     /product="KLTH0A03388p"
                     /protein_id="XP_002551605.1"
                     /db_xref="GeneID:8290405"
                     /db_xref="GOA:C5DBK6"
                     /db_xref="InterPro:IPR000433"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR007526"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR017884"
                     /db_xref="UniProtKB/TrEMBL:C5DBK6"
                     /translation="MSEPEVPQSVEKMLPHLQQQQQQQENSKIDYEQEAAKLEEKAIR
                     FLAKQAHPVIVPSFASWFQFSDVHEIERRILPDFFDDSSRFKTEKAYKDVRNFMINTY
                     RLSPYEYLTVTAIRRNVAMDVASIVRIHNFLEQWGLINYQVDPRSKPSLLGPSFTGHF
                     QVVLDTPQGLKPFVPTRVITKTPPESQVTTEPEAASEQQTNAENDAATEPQGDSNSEP
                     SVETQGATEPQSAHPVPGLEEAETKSTTPSGAAVNANAQNKAEQGSNDDQELVTEVKS
                     EPKSDIKLEHKSEVKPEIEFVKPEKFPVNLSLRKNIYDSAQNFNSLQTDSQQSKQINR
                     AYICHTCGNDAVGVRYHNLRSRDTNLCSRCFQEGHFSAHFSSSDFLRLENNAHTKKQW
                     SDQEVLLLLEGIEMYEDQWDRVVEHVGGSKTLEECVEKFLTLPIEDKYIDEVIPAQPR
                     KSGQGNATPEVTQAVDATVEALLNGFNDKVLKGTLPENAKHISEKYLQEAQLVVQDLV
                     KLTLEKVDLKFQKLNTLEETLNKERQRYTQESDKLLGERQSLSKQVTELNEELAKLNI
                     SKKLVMLSEQADSGVKLVEKDVESQNKNKLVKSVDEFESVSHIDPQQYKSWSMS"
     gene            <293799..>296219
                     /locus_tag="KLTH0A03410g"
                     /db_xref="GeneID:8290406"
     mRNA            <293799..>296219
                     /locus_tag="KLTH0A03410g"
                     /product="KLTH0A03410p"
                     /transcript_id="XM_002551560.1"
                     /db_xref="GeneID:8290406"
     CDS             293799..296219
                     /locus_tag="KLTH0A03410g"
                     /note="similar to uniprot|P43610 Saccharomyces cerevisiae
                     YFR038W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A03410p"
                     /protein_id="XP_002551606.1"
                     /db_xref="GeneID:8290406"
                     /db_xref="GOA:C5DBK7"
                     /db_xref="InterPro:IPR000330"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBK7"
                     /translation="MVKTRNASRRSQRVDYKEKQESNLEPDTLVSSESSDDEEKGDAP
                     IWLSENNELGVQDVDLSSGDEEDDTELNNLIQEQESKRQEAQLKKDEEEKSEEEFDDT
                     TVSMKLNRLQEFVKQSQVYSRIIADTLLTRSQERQTEKEAKEPPRKRTKVTDFFRKSK
                     KEPVADSEEPEPVLHQQPSMLKNCQLKPYQLEGVNWLITLYENGLNGILADEMGLGKT
                     LQSIALLAFITEMDTGGPFLIAAPLSTLDTWVNEFSRFAPDIKVLKYYSSQGQRQRQQ
                     LLKDFFRKTKNEGVIVTSYEVIIRDIEQILSYQWKFLIVDEGHRIKNINCKLIRELKR
                     INTLNRLLITGTALQNNLSELWSLLNFIMPDIFADFEIFHKWFDFSDLELKSSSQGLN
                     RLINDELEKNLISNLHTILKPFLLRRLKKVVLAKSLPPKREYIVNCPLTPIQRKFYKA
                     ALGGKLKQAIFKQAIKNFFTLNQDQIGCVSNKSIREFLEWRLKHGREEPETKVLRQMN
                     ELYNQHIHRALLHKRLQNPMIQLRQVVDSTLLFFFPFLDPEHLTLEFLLQTSGKLQIL
                     QQLVPPLVAKKHKVLIFTQFVSMLDLIEDWCELNEIRVCRIDGSMDNEARQEHIERFN
                     DGHDSYDAFLISTRAGGLGINLTAADTVVLFDSDWNPQVDLQAMDRTHRIGQTKPVIV
                     YRLCCDNTVEHVILTRAASKRKLEKMVIQLGNFGTLKRLAGNESSFISQGHTPANSNK
                     ELMHELSQLLMSDESSISGFPRSGNPELTTDELAELFDRSEKAFRIENAKKEWPHIRL
                     FESTTAAK"
     gene            <296563..>297951
                     /locus_tag="KLTH0A03432g"
                     /db_xref="GeneID:8290407"
     mRNA            <296563..>297951
                     /locus_tag="KLTH0A03432g"
                     /product="KLTH0A03432p"
                     /transcript_id="XM_002551561.1"
                     /db_xref="GeneID:8290407"
     CDS             296563..297951
                     /locus_tag="KLTH0A03432g"
                     /note="similar to uniprot|P07278 YIL033C Saccharomyces
                     cerevisiae BCY1 Regulatory subunit of the cyclic
                     AMP-dependent protein kinase (PKA)"
                     /codon_start=1
                     /product="KLTH0A03432p"
                     /protein_id="XP_002551607.1"
                     /db_xref="GeneID:8290407"
                     /db_xref="GOA:C5DBK8"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR002373"
                     /db_xref="InterPro:IPR003117"
                     /db_xref="InterPro:IPR012198"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018488"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="UniProtKB/TrEMBL:C5DBK8"
                     /translation="MPLSSNQMEELNLFQRKVHEDQPKDLLQFAANYFNRRLEQQRFF
                     ARNQESLALSKGIVLFPSATRNDSVVASGSLGGRIGGLGSLGGTDDQDVLFKAPFAEQ
                     DPHAHDPHATHENSQDGDQQNDSDAGGLFKNNFRVNQSSDKDIKKPVDPMAPDHTKSP
                     SPQPTKIPRRSTLAPQPLPLNFNAQRRTSVSAETMTPDNLDDWTPENFNEKTGEQLAR
                     LEKAIGRNFLFNKLDSESKRLVINSLEEKTVKQSQEIIKQGDEGDYFYIVEKGTVDFY
                     VGNEKVNTSGPGSSFGELALMYNSPRAATVVANTDCVLWALDRLTFRRILLGGSFKKR
                     ILYDEFLKSMPVLQSLSTYDRAKLADALDTELYHPGQVIIREGDNGENFYFIEYGEAE
                     VSKEGQGIIAHLKQGDYFGEVALLNDLPRQATVKAIKKTKVATLGKSGFQRLLGPAVE
                     VLKLNDPTRVDH"
     gene            complement(<298086..>298532)
                     /locus_tag="KLTH0A03454g"
                     /db_xref="GeneID:8290408"
     mRNA            complement(<298086..>298532)
                     /locus_tag="KLTH0A03454g"
                     /product="KLTH0A03454p"
                     /transcript_id="XM_002551562.1"
                     /db_xref="GeneID:8290408"
     CDS             complement(298086..298532)
                     /locus_tag="KLTH0A03454g"
                     /note="highly similar to uniprot|P40030 Saccharomyces
                     cerevisiae YER044C ERG28 Endoplasmic reticulum membrane
                     protein may facilitate protein-protein interactions
                     between the Erg26p dehydrogenase and the Erg27p 3-
                     ketoreductase and/or tether these enzymes to the ER also
                     interacts with Erg6p"
                     /codon_start=1
                     /product="KLTH0A03454p"
                     /protein_id="XP_002551608.1"
                     /db_xref="GeneID:8290408"
                     /db_xref="GOA:C5DBK9"
                     /db_xref="InterPro:IPR005352"
                     /db_xref="UniProtKB/TrEMBL:C5DBK9"
                     /translation="MLSFQQVVNFTQNTLSSMPPGYLPKWLLFISVVSVLNSIQTYIS
                     GLELTRRVYERKPSETTSLSARTFGTWTFISCVIRLYGALFLYEEHIYQLVCISYLVA
                     LFHFGSELLVFRTCKLGKGFMGPLVVSTTSLLWMYNQKEFYTGKGW"
     gene            complement(<298735..>299661)
                     /locus_tag="KLTH0A03476g"
                     /db_xref="GeneID:8290409"
     mRNA            complement(<298735..>299661)
                     /locus_tag="KLTH0A03476g"
                     /product="KLTH0A03476p"
                     /transcript_id="XM_002551563.1"
                     /db_xref="GeneID:8290409"
     CDS             complement(298735..299661)
                     /locus_tag="KLTH0A03476g"
                     /note="similar to uniprot|Q12458 Saccharomyces cerevisiae
                     YDR368W YPR1 2-methylbutyraldehyde reductase may be
                     involved in isoleucine catabolism"
                     /codon_start=1
                     /product="KLTH0A03476p"
                     /protein_id="XP_002551609.1"
                     /db_xref="GeneID:8290409"
                     /db_xref="GOA:C5DBL0"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR018170"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DBL0"
                     /translation="MSAPKPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKV
                     GYRHIDCAALYKNEDFVGRAIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGL
                     DYVDLFLMHWPQALRTERITDGNMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGK
                     TKAVGVSNFSVKQLEKLLADPGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYS
                     PLGSQKAPLLDDPVILEIAAKHKADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIV
                     NLTDSELEKINEIHKKGEKRVVDPEWFDFEED"
     gene            complement(<301696..>303915)
                     /locus_tag="KLTH0A03498g"
                     /db_xref="GeneID:8290410"
     mRNA            complement(<301696..>303915)
                     /locus_tag="KLTH0A03498g"
                     /product="KLTH0A03498p"
                     /transcript_id="XM_002551564.1"
                     /db_xref="GeneID:8290410"
     CDS             complement(301696..303915)
                     /locus_tag="KLTH0A03498g"
                     /note="weakly similar to uniprot|Q6B2M3 Saccharomyces
                     cerevisiae YOR172W YRM1 Zn2-Cys6 zinc-finger transcription
                     factor that activates genes involved in multidrug
                     resistance paralog of Yrr1p acting on an overlapping set
                     of target genes"
                     /codon_start=1
                     /product="KLTH0A03498p"
                     /protein_id="XP_002551610.1"
                     /db_xref="GeneID:8290410"
                     /db_xref="GOA:C5DBL1"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DBL1"
                     /translation="MARDIGAASIIDNDAAVRRRRRKIIKSCTFCRQRKLKCDHKRPK
                     CGSCLARKLPECIYLDTLNLQLTSTDLYSNKPNVALLRRIQELELELDKTYMDDASEG
                     SEKGLSSEAGSRTSTSGISDTVLSGEPCRNEVLNFNALRVKNGRFVYYGPTSIRATIS
                     ASGERFVAEYSKFWDRVKSDLADWKTAHGRFPTMEHNIITAPQTSNVLESIIPDLPCY
                     EVVGLRINEFFDDPLHDYFRFLDKQKVLADFARCFVPGYAATPEIDGVPKQQVIMIVA
                     PENKNFYTIGVILMILCLNHYKTGIPVSIERFIVTLEGFTMASSMFVERAQLLLLVYV
                     FRVYNGMGGNGSSNLVSLVSLLTSAALRLGLHKDIDMMYGGQEHLVGSLYSLKNLWYW
                     TLFADLCVAFDMGVLMSVTSAHFDDSTLPTSERGRIPLLRNFLFLGRKCMQSLLNPNT
                     APDLHLKAGELISFVESQFRPIRFYTNIALISQVDLFEVIILSPALAMITNFFDLMRI
                     IDSQRDTHKEMTVYLKNKFVKCMLVATSLMVNTIIQCYKLDKERLSAAKFIQLKHLTP
                     WLNLCVLLLNSFPIRVLTEMYALMLYKISLFEKGQRITVDKGQFSNFPSLDDLSVPRN
                     SYLHFKDSFEAFCSTFDELWTPENTGMIQILMNSHYFVIMMALERVNRKVFQLALQSR
                     TEVEKVHNWPKLIQNNVSDDVIKMLADEVWNNYSTGLSGLTEMPASDFLANLEMPDR"
     gene            <305601..>306446
                     /locus_tag="KLTH0A03520g"
                     /db_xref="GeneID:8290411"
     mRNA            <305601..>306446
                     /locus_tag="KLTH0A03520g"
                     /product="KLTH0A03520p"
                     /transcript_id="XM_002551565.1"
                     /db_xref="GeneID:8290411"
     CDS             305601..306446
                     /locus_tag="KLTH0A03520g"
                     /note="similar to uniprot|P13517 Saccharomyces cerevisiae
                     YIL034C CAP2 Beta subunit of the capping protein (CP)
                     heterodimer (Cap1p and Cap2p) which binds to the barbed
                     ends of actin filaments preventing further polymerization
                     localized predominantly to cortical actin patches"
                     /codon_start=1
                     /product="KLTH0A03520p"
                     /protein_id="XP_002551611.1"
                     /db_xref="GeneID:8290411"
                     /db_xref="GOA:C5DBL2"
                     /db_xref="InterPro:IPR001698"
                     /db_xref="InterPro:IPR019771"
                     /db_xref="UniProtKB/TrEMBL:C5DBL2"
                     /translation="MSPYEAALDLLRRLDPTKVEQNLNQLIKLDPDLAEDLLASVDTP
                     LKVKKDPNASQKEFLCCDYNRDIDSHRSPWSNNYVPALSAQELEESPFPSDAIRAVEV
                     LANDSFDIYRDLYYEGGVSSVYLWDLGDDADADGAPNDFAGVVLLKKGENSRSSWDAI
                     HVFEVLQEGSTQSQVSYRITTTIILHLNSEKKMTLAGNLTRQTERSFALPGHLSPEQS
                     GIWHVSNLGSVIEEVESQMRNQLEVVYFEKTKDIYRELRDSSQEATTQNRSVHEEVVK
                     GLQGM"
     gene            <306667..>307803
                     /locus_tag="KLTH0A03542g"
                     /db_xref="GeneID:8290412"
     mRNA            <306667..>307803
                     /locus_tag="KLTH0A03542g"
                     /product="KLTH0A03542p"
                     /transcript_id="XM_002551566.1"
                     /db_xref="GeneID:8290412"
     CDS             306667..307803
                     /locus_tag="KLTH0A03542g"
                     /note="highly similar to uniprot|P15790 Saccharomyces
                     cerevisiae YIL035C CKA1 alpha subunit of protein kinase
                     CK2"
                     /codon_start=1
                     /product="KLTH0A03542p"
                     /protein_id="XP_002551612.1"
                     /db_xref="GeneID:8290412"
                     /db_xref="GOA:C5DBL3"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DBL3"
                     /translation="MKCRTWSEARVYTTANVRRGQAYWDYENTVIDWVPNNGTYEIET
                     KVGRGKYSEVFQGVQLSTKSKIVIKMLKPVKKKKIKREISILTNLSNETNPPTAQPFN
                     KDAYYENKKEEVLQFTRSEVYELAHDGHKNIIQLLDVVKDQVSRTPALIFEHVDNVDF
                     RTLYPTFTDLDVRFYMFELLKALDYCHSMGIMHRDVKPHNVMIDHKRKKLRLIDWGLA
                     EFYHPNMEYNVRVASRFFKGPELLVDYRMYDYSLDLWSFGTMLASMIFKKEPFFHGTS
                     NTDQLVKIVRILGSDDFENYLNKYQITLPQEFHDIDQYIRRPWHRFVNDSNKHLSGNG
                     DIIDLIDNLLRYDHQERLTAREAMQHSWFAPIRRGEYNGEPDAK"
     gene            complement(<307859..>309100)
                     /locus_tag="KLTH0A03564g"
                     /db_xref="GeneID:8290413"
     mRNA            complement(join(<307859..308965,309038..>309100))
                     /locus_tag="KLTH0A03564g"
                     /product="KLTH0A03564p"
                     /transcript_id="XM_002551567.1"
                     /db_xref="GeneID:8290413"
     CDS             complement(join(307859..308965,309038..309100))
                     /locus_tag="KLTH0A03564g"
                     /note="weakly similar to to YER044C-A uniprot|P29467
                     Saccharomyces cerevisiae YER044C-A MEI4 Functions in early
                     recombination; mRNA is meiosis-specific and has 88 bp
                     intron at 5' end spliced independently of MER1[INTRON]"
                     /codon_start=1
                     /product="KLTH0A03564p"
                     /protein_id="XP_002551613.1"
                     /db_xref="GeneID:8290413"
                     /db_xref="UniProtKB/TrEMBL:C5DBL4"
                     /translation="MVFSNPICQTDDNPGSLDLALALSLIKQRNPRLWHKLASQGFFQ
                     ETAGASELFPAERHVVKGSAANKADTGIESIGESFLYKFTTNNISSHIERATAFLGCN
                     RHTWKCLSSQISTLESFGCGLEESDIAKWVLPNYRLLKWLYAKDPPQLQKRDRALRTV
                     NSFQLLLISHYAFSGERNKVVHVLCQSLIYRFIKDELISFGPSKVRVLKLLRDYTDSN
                     VVQVADVSLFSLSEGHLKLVKLILNIRISFQDHEVLSKTLQFLLKLLESLVVCLIKLN
                     SSRYSPARKPRAYEIMYKARSKLMNYQYVTKVLEACHLLSRKEATIRLKISFTFVLKL
                     VTSVEWLNAFDNSGAGQNELMRTLREHRTYIISSLLVLNDSRLISKFLKTRWPAQ"
     gene            complement(<309596..>310870)
                     /locus_tag="KLTH0A03586g"
                     /db_xref="GeneID:8290414"
     mRNA            complement(<309596..>310870)
                     /locus_tag="KLTH0A03586g"
                     /product="KLTH0A03586p"
                     /transcript_id="XM_002551568.1"
                     /db_xref="GeneID:8290414"
     CDS             complement(309596..310870)
                     /locus_tag="KLTH0A03586g"
                     /note="some similarities with uniprot|P40535 Saccharomyces
                     cerevisiae YIL036W CST6 Basic leucine zipper (bZIP)
                     transcription factor of the ATF/CREB family activates
                     transcription of genes involved in utilization of
                     non-optimal carbon sources"
                     /codon_start=1
                     /product="KLTH0A03586p"
                     /protein_id="XP_002551614.1"
                     /db_xref="GeneID:8290414"
                     /db_xref="GOA:C5DBL5"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="UniProtKB/TrEMBL:C5DBL5"
                     /translation="MERVHIKTEESRAGLPPAHAQGVLVGGAMNHGQVGANYGAPAGG
                     GMGFGGLGSPGTLGMHGASGTPGAAETGNLREAGGVFPHLSKYQLNNSGGMADSSLQE
                     CLSPFFQPFGVDVSHFPLTNPPIFQSSLTNFSDHPRRRRISISNGQISQLGDATHTFD
                     DLYYTQPPPMPIRHERQDAQPHIGESKSVPPQGAKAAPAPVQVQGAPTAQHFLPQPAA
                     ADVVPGQQHGQLQVPPQHAQHPQHPQHTQPVQHAQQPMDGPHQHAPVPDELYSKDSAF
                     SSSFSTPTDASLLVPENSRPPVQALPKEYQVRPRTTYEDGPGTPEWKRARLLERNRIA
                     ASKCRQRKKIAQQQLQKDVSQLTQENRFMRKKLDYYEKLVNKFKKFTEIHMASCGGSE
                     QLSVIEDLLKIDHNIDDKQGGSSQSTEEEARL"
     gene            <311369..>312109
                     /locus_tag="KLTH0A03608g"
                     /db_xref="GeneID:8290415"
     mRNA            <311369..>312109
                     /locus_tag="KLTH0A03608g"
                     /product="KLTH0A03608p"
                     /transcript_id="XM_002551569.1"
                     /db_xref="GeneID:8290415"
     CDS             311369..312109
                     /locus_tag="KLTH0A03608g"
                     /note="similar to uniprot|P40031 Saccharomyces cerevisiae
                     YER046W SPO73 Meiosis-specific protein of unknown function
                     required for spore wall formation during sporulation
                     dispensible for both nuclear divisions during meiosis"
                     /codon_start=1
                     /product="KLTH0A03608p"
                     /protein_id="XP_002551615.1"
                     /db_xref="GeneID:8290415"
                     /db_xref="UniProtKB/TrEMBL:C5DBL6"
                     /translation="MLFGTQDIIVEHQRGAMVLGYPVFSPNLLIRGIDPPQFQLVGED
                     GHTVEKGEIKAGGGMYPFDLGTPLKGFKWFVSMDHGNRYDTDDQGWCYSWRFRSRRWK
                     AHGGFVRKRFWVRLPINGREMTPAEPEVCAGSVRPGEHASSGADEPAYSVAGPVVAAQ
                     TRSEELFEALLEELHKPSLDRQKADLALRYIAELPEEERRRAASPGSELMERVPCAFQ
                     FEESRLKFLQVQVPALLDSVSGRNTILT"
     gene            <312223..>314028
                     /locus_tag="KLTH0A03630g"
                     /db_xref="GeneID:8290416"
     mRNA            <312223..>314028
                     /locus_tag="KLTH0A03630g"
                     /product="KLTH0A03630p"
                     /transcript_id="XM_002551570.1"
                     /db_xref="GeneID:8290416"
     CDS             312223..314028
                     /locus_tag="KLTH0A03630g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A03630p"
                     /protein_id="XP_002551616.1"
                     /db_xref="GeneID:8290416"
                     /db_xref="UniProtKB/TrEMBL:C5DBL7"
                     /translation="MHGPLELFPSLRQRLLSCMFKPQIFAPHAVFWFSTWMLYFLFQD
                     ETASLSSTASLAAAGATLVTTTATATATMTATTTKTIAYTSSVETEAAGANITSAVET
                     FLSLKANDSARQVATYIEGFNENCKLKLRLWNASLETQLGFWEREYESLKAYNNTIFS
                     NLLEQAQTINSSVDYLSNSGFLVASDSQSSVLRGLSLNTSFLQSVFGNVSSNLGKIRN
                     LTLPAAPTATASALSASEILDSITSNKTTSNFTSMLGVLGSDKKIRTTLLVKRDSASD
                     TSGKYKQKAIRISSALAATYVAATFAFVCLEYVTYKIEVRGAQDTLQHQLECIDELYK
                     GETVISVARIRAHESFQQLLICYNDFAKHPVTYTFTEMALELLRRPLSKTWSPVAVAK
                     FVKAYNWWLTTNGLHVFCLFLAAVVEGQILRAFLDVSHSTHPTSLYPRSKFSEAALST
                     KTLGSISSSCALFESTVNAEINSVVHERLWNASRGNVTQINSLLDEYFSNVNATLKDQ
                     VPAIDMNMSYWSSELNSEQTFNFTSFSETLAHEIYEVVAPSENLETKRLVRRSEAAQS
                     QAMGKTILARYEKGCLCLLGSVVFYLLCGFLAAAV"
     gene            <314336..>316654
                     /locus_tag="KLTH0A03652g"
                     /db_xref="GeneID:8290417"
     mRNA            <314336..>316654
                     /locus_tag="KLTH0A03652g"
                     /product="KLTH0A03652p"
                     /transcript_id="XM_002551571.1"
                     /db_xref="GeneID:8290417"
     CDS             314336..316654
                     /locus_tag="KLTH0A03652g"
                     /note="some similarities with uniprot|P06102 Saccharomyces
                     cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
                     which is a global transcriptional regulator with roles in
                     transcription initiation and elongation and in mRNA
                     degradation"
                     /codon_start=1
                     /product="KLTH0A03652p"
                     /protein_id="XP_002551617.1"
                     /db_xref="GeneID:8290417"
                     /db_xref="GOA:C5DBL8"
                     /db_xref="InterPro:IPR007207"
                     /db_xref="InterPro:IPR007282"
                     /db_xref="InterPro:IPR012270"
                     /db_xref="UniProtKB/TrEMBL:C5DBL8"
                     /translation="MAHRKLQQEVDRVFKKISEGLEIFDTYYERHENCTNNPSQKDKL
                     ECDLKREVKKLQRLREQIKSWQSSPDIKDKDSLLEHRRSVEVAMEKYKAVEKASKEKA
                     YSNNSLKRSDNLDPKERERQEITDYLSQSIEELERQYDSAQVEVDKLILLNKKKKTAT
                     TANEEKKNQLKDLQGRYRWHLQQMELALRLVANQELDPEDVKRVKDDINYFIESNQEP
                     DFVEDETIYDGLDLTSNEAIAHEVAAAFAAQRSEELEEDMVKEGAKLSKKEQRKLERE
                     AKKAAKASAKTGSGTETLPESAGIVIPQKNEPRQIDSVSESASVSASRSPSPDVSSAG
                     TSIPNTANSKSTIQPSSSAGPVNLMGKLPGSQIKQQTISREATPELQGHTHIHQSLNG
                     ITTTSTLKPATVPARPVGDLRWAAAASQAAEKEKKAEHLNHQAAKSQSTSSSVNNSAT
                     TSAASTPIVTKQALTPVGQKRILSNSQMLTATVPSSVGIQVSNNTLPSQKTVNSQDAK
                     AGEPAVEEVIDDTYDSDYSLDDFDESSDDEIIDDEESATKSQIRENLRETLSDDLELL
                     VLPGGVQDFIMSSLLSRNGLNRSNGSCSKLRTLRDACRVSRLDNIPRSVNPPSPLDAF
                     RSTSVWDVTRCSLRDEIGEFGGDKPAERAHLLEKFRGLETFFLFYCFYYSITPLEQEI
                     AYTLLGERNWKVSKTGENWFSRHSLPKFSNELCEVADFKIFNLDDWTVTDKLNFKLDY
                     SILRDPPSTEAEPSLVDDANESGAWTKSTVVQ"
     gene            complement(<316868..>317992)
                     /locus_tag="KLTH0A03674g"
                     /db_xref="GeneID:8290418"
     mRNA            complement(<316868..>317992)
                     /locus_tag="KLTH0A03674g"
                     /product="KLTH0A03674p"
                     /transcript_id="XM_002551572.1"
                     /db_xref="GeneID:8290418"
     CDS             complement(316868..317992)
                     /locus_tag="KLTH0A03674g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A03674p"
                     /protein_id="XP_002551618.1"
                     /db_xref="GeneID:8290418"
                     /db_xref="GOA:C5DBL9"
                     /db_xref="InterPro:IPR003819"
                     /db_xref="UniProtKB/TrEMBL:C5DBL9"
                     /translation="MPVKVTKLEGKPLGAVITLPEGCTDPSELSPEDFDTVYKALHEH
                     LVIVIPGMEDLPPKSQWKLTTMFDPTCDQSGKSYGHGKEFRHDKSVLRRDGTSIPDQP
                     QVQVLGQGEWPAGHYGLGDISLRHPTHFDFHKKPLTQEQAFEQDMTRFYRWHIDSALY
                     GLSPPVATTLLGIHVPPHSRKQKVVYEDNGDVLELTQGATAFVSGAKAFEMLSPEDQE
                     RALKTTVVYAPHPYIFISSARATPDGLTMVSEGKETPFDELPPWEESKIKKLPLVWTN
                     PITKKHHLQVHGCCIHKLELPDGTVLELDDARKEVYRMMRPAIAPENVYAHDWNKGDL
                     AIFFNRGVWHSVTGQFSEGERRLMHQCNIASGQDPQTLTA"
     gene            complement(<318721..>321066)
                     /locus_tag="KLTH0A03696g"
                     /db_xref="GeneID:8290419"
     mRNA            complement(<318721..>321066)
                     /locus_tag="KLTH0A03696g"
                     /product="KLTH0A03696p"
                     /transcript_id="XM_002551573.1"
                     /db_xref="GeneID:8290419"
     CDS             complement(318721..321066)
                     /locus_tag="KLTH0A03696g"
                     /note="similar to uniprot|P39955 Saccharomyces cerevisiae
                     YER047C SAP1 Putative ATPase of the AAA family interacts
                     with the Sin1p transcriptional repressor in the two-hybrid
                     system"
                     /codon_start=1
                     /product="KLTH0A03696p"
                     /protein_id="XP_002551619.1"
                     /db_xref="GeneID:8290419"
                     /db_xref="GOA:C5DBM0"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR015415"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBM0"
                     /translation="MDASKEGGLLTRFARMRKKPQQPLTDLTELYSQIANESIYYLKL
                     EEKHEYKKAVLGWKALNTHVLYELTQIEYHYPNTGAYTRDEISIQNGVRELYHRSLSH
                     LERVSKLCQEDEKSHEHYKPHSSSLPGRPRPPTANSRSMLKTLREPGRLKYNRNHPSS
                     APNITSPTSRSNSNVNFTTSKPLGHDNVFQGFDEDHNLIEFSDDEPAAKLEEDAKSDT
                     KSDITFDFDVHDYFDDYLDMDQEELKRLETLNNLEGVQKSVGNMSIESSALDPKIKEK
                     PSVTKSAQTSATVPKEKVMHKTTKKIVPKAAPKAASRPGVSTQTTRSRVPAAKPKTRP
                     TVKAAQSTPVLRSRVASPPPKSSALINKRVVRKNTPAAAKTSESLPSRTPGKPPPSKK
                     GGTVAAKNASNGTKKQPAKTATPTSSINSNSSASRKRLLKSPTPPPVAPTESAPKESE
                     VSPDDEKILKEALEDELIDQMRGIDKTAAKQIFSEIVVHGDEVHWDDIAGLESAKSSL
                     KEAVVYPFLRPDLFRGLREPVRGMLLFGPPGTGKTMLARAVATESNSTFFSISASSLT
                     SKYLGESEKLVRALFAIAKKLSPSIVFVDEIDSIMGSRNNDGENESSRRIKNEFLIQW
                     SSLSNAAAGNKEGSEDEEDERVLVLAATNLPWSIDEAARRRFVRRQYIPLPEPETRKK
                     QMNKLLAHQTHTLTEEDFEELLALTDGYSGSDITSLAKDAAMGPLRELGDQLLFTPRD
                     QIRPITLQDVKNSLEYIKPSVSKEGLTEYEDWAKKFGSSGA"
     gene            complement(<321327..>322751)
                     /locus_tag="KLTH0A03718g"
                     /db_xref="GeneID:8290420"
     mRNA            complement(<321327..>322751)
                     /locus_tag="KLTH0A03718g"
                     /product="KLTH0A03718p"
                     /transcript_id="XM_002551574.1"
                     /db_xref="GeneID:8290420"
     CDS             complement(321327..322751)
                     /locus_tag="KLTH0A03718g"
                     /note="similar to uniprot|P40533 Saccharomyces cerevisiae
                     YIL039W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A03718p"
                     /protein_id="XP_002551620.1"
                     /db_xref="GeneID:8290420"
                     /db_xref="GOA:C5DBM1"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DBM1"
                     /translation="MIRPLLKKFTGFTLVLAIVSNIYIFTYPSLFPERCSWRCASQPS
                     VVGATDSMHVGEKVLYYSKRYVNDLMRQWKKSHEETQSSPADVHLMAFGDPQIKGIWR
                     NTPYVTRLDIFGNDFYLGHIFSTMRNRLNPTHVAVMGDLFSSQWIGDSEFFNRTMRYT
                     KRIFKRDTTSLENIRNDSHDENGLYKNYWVQFADEFKRRLTEEPKTLGFGYENVHTWD
                     PEHEDYLFINLTGNHDIGYSGDATFQHMSRFHQLFGKDNYWIEYDRDTDHPWRIVVLD
                     SMLLEGPPLQQEFVNATWEFLLQLFEQRFEGSTVLLTHVPFYKKEGLCTDGELFRYYP
                     DDYPREPYKQNLLRSQNHLSEDVTKRVLNLIFDNGKPGIILTGHDHEGCETVYNKDSK
                     TGDWNAAKTMQSPDFHVREVTVRSMMGEFNGNTGLVTGHFNHETKTWEWSFSLCPFSI
                     QHVWWFTKVVTILSGFLLSALLVT"
     gene            complement(<322936..>324123)
                     /locus_tag="KLTH0A03740g"
                     /db_xref="GeneID:8290421"
     mRNA            complement(<322936..>324123)
                     /locus_tag="KLTH0A03740g"
                     /product="KLTH0A03740p"
                     /transcript_id="XM_002551575.1"
                     /db_xref="GeneID:8290421"
     CDS             complement(322936..324123)
                     /locus_tag="KLTH0A03740g"
                     /note="similar to uniprot|P39101 YER048C Saccharomyces
                     cerevisiae CAJ1 Nuclear type II J heat shock protein of
                     the E. coli dnaJ family"
                     /codon_start=1
                     /product="KLTH0A03740p"
                     /protein_id="XP_002551621.1"
                     /db_xref="GeneID:8290421"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR026894"
                     /db_xref="UniProtKB/TrEMBL:C5DBM2"
                     /translation="MVKDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEA
                     QAKFQAIGQAYQVLSDPELRSRYDEFGKEDAVPQQGFEDAAEFFSTIFGGDAFQDWIG
                     DFAFLKNLTKGAEIMGEDGEEAGTAAENSEDPSKDVVQHDGKTAKPKSSDNKLTKEQR
                     AKLVEMENERRAEKKKQVEDLVRKLETRIEQYVAAVQNKHLDEFDAKLNQEIEDLKLE
                     SFGLELLQLIAKVYKTKANNFLASQKTYGFSKLFTGVRDKTKTAKSAWGILSSAMDAQ
                     SAMKELEKLDVETMDEYERAEVEKLITGKVLGTAWVMSKFEAQGKLKDVCDKILGDKN
                     VPSKQRVVKAKALLYMANKFASAQRSPDEAEDARVFEELIFDAQGKKKKADHKRKDST
                     VKA"
     gene            complement(<324351..>324800)
                     /locus_tag="KLTH0A03762g"
                     /db_xref="GeneID:8290422"
     mRNA            complement(<324351..>324800)
                     /locus_tag="KLTH0A03762g"
                     /product="KLTH0A03762p"
                     /transcript_id="XM_002551576.1"
                     /db_xref="GeneID:8290422"
     CDS             complement(324351..324800)
                     /locus_tag="KLTH0A03762g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A03762p"
                     /protein_id="XP_002551622.1"
                     /db_xref="GeneID:8290422"
                     /db_xref="InterPro:IPR024316"
                     /db_xref="UniProtKB/TrEMBL:C5DBM3"
                     /translation="MEPKYEQVQAAISWFASYVLRTLAWILPLTYRFAQSHPTITNIL
                     GYMLSAYILWKVVCHLWAIIKKLLLVAAVLFSVLLWYRGLHQVLSVDAPILLEYLRND
                     SYLRDRWSQAVRAMNPTYLGIYSPFLLGQHLQELRNRSLRFLASASN"
     gene            324954..325025
                     /locus_tag="KLTH0A03784r"
                     /db_xref="GeneID:8290423"
     tRNA            324954..325025
                     /locus_tag="KLTH0A03784r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (CTG) cove score=70.60"
                     /db_xref="GeneID:8290423"
     gene            complement(325271..325342)
                     /locus_tag="KLTH0A03806r"
                     /db_xref="GeneID:8290424"
     tRNA            complement(325271..325342)
                     /locus_tag="KLTH0A03806r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (CTG) cove score=70.60"
                     /db_xref="GeneID:8290424"
     gene            325659..325730
                     /locus_tag="KLTH0A03828r"
                     /db_xref="GeneID:8290425"
     tRNA            325659..325730
                     /locus_tag="KLTH0A03828r"
                     /product="tRNA-Gln"
                     /note="tRNA-Gln (TTG) cove score=68.39"
                     /db_xref="GeneID:8290425"
     gene            <325998..>326291
                     /locus_tag="KLTH0A03850g"
                     /db_xref="GeneID:8290426"
     mRNA            <325998..>326291
                     /locus_tag="KLTH0A03850g"
                     /product="KLTH0A03850p"
                     /transcript_id="XM_002551577.1"
                     /db_xref="GeneID:8290426"
     CDS             325998..326291
                     /locus_tag="KLTH0A03850g"
                     /note="similar to uniprot|Q6Q560 Saccharomyces cerevisiae
                     YER048W-A"
                     /codon_start=1
                     /product="KLTH0A03850p"
                     /protein_id="XP_002551623.1"
                     /db_xref="GeneID:8290426"
                     /db_xref="InterPro:IPR008011"
                     /db_xref="UniProtKB/TrEMBL:C5DBM4"
                     /translation="MSASPGPSRAQVLALYKQFIKNANGFNNYNYREYFLRKARTTFR
                     KNRALEDPATISAAWDTALKDLGVLKRQSVISQMYTFDKQVVEPLDPKHHSRG"
     gene            <326673..>328547
                     /locus_tag="KLTH0A03872g"
                     /db_xref="GeneID:8290427"
     mRNA            <326673..>328547
                     /locus_tag="KLTH0A03872g"
                     /product="KLTH0A03872p"
                     /transcript_id="XM_002551578.1"
                     /db_xref="GeneID:8290427"
     CDS             326673..328547
                     /locus_tag="KLTH0A03872g"
                     /note="similar to uniprot|P40032 Saccharomyces cerevisiae
                     YER049W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A03872p"
                     /protein_id="XP_002551624.1"
                     /db_xref="GeneID:8290427"
                     /db_xref="GOA:C5DBM5"
                     /db_xref="InterPro:IPR005123"
                     /db_xref="InterPro:IPR006620"
                     /db_xref="InterPro:IPR019601"
                     /db_xref="UniProtKB/TrEMBL:C5DBM5"
                     /translation="MKRNSAPSGDQQPKKQPTNEVGKVKSLFNAKIWDPKFQKDLRQE
                     IHDSKPYNWGTIRDLVDDDLLRAVRKEVETQIHFTKKETDIYKVNQSGDLANLSGLDW
                     EDLSRLPNLCKLREILYSEVYRDVISYVTGAGKLSGSKMDMSINTYTKGCHLLTHDDV
                     IGSRRVSFILYLPDPNTRWKDHYGGGLRLFPSIVANVPHSDHSAKLVPQFNQIAFFQV
                     QPGFSFHDVEEVRVNRHRLSIQGWYHIPQEGEKGYIPGEEEEWVKTNTSTLAQLESNV
                     LQDYEFPKGERDVLPPHQIKHFENLLHNQPANQEAENEATEQPLPDMRFLTKEEMKFL
                     SSFVSPEYLTPEGISRLQTQFLEKSHLQIEDFLNDERSDLLKKLIKRDEFEKDCPYES
                     VNVERPWKTAMPPHKWRYLYIDGKSHENFRNEQDILDNLNNEERPNYVLLKQTLDKSK
                     HDTETELITVAEFLQSTAFKKYLALVTLLSPISEQVLIRRFRPGKDFTLATQLNKNAL
                     LKDVEGLVDAVLEGTLCLTPSNGWESGEVGGYELYMDNQEESENMDKDIEDAAVYKSD
                     DTGDAVLINKPPSWNSLNLVLRDESVLQFIKYVSWSAKSSRWDITAQWDVKAVDGDDK
                     "
     gene            complement(<328648..>329619)
                     /locus_tag="KLTH0A03894g"
                     /db_xref="GeneID:8290428"
     mRNA            complement(<328648..>329619)
                     /locus_tag="KLTH0A03894g"
                     /product="KLTH0A03894p"
                     /transcript_id="XM_002551579.1"
                     /db_xref="GeneID:8290428"
     CDS             complement(328648..329619)
                     /locus_tag="KLTH0A03894g"
                     /note="similar to uniprot|P40531 Saccharomyces cerevisiae
                     YIL041W GVP36 Golgi-vesicle protein of unknown function
                     green fluorescent protein (GFP)-fusion protein localizes
                     to the cytoplasm"
                     /codon_start=1
                     /product="KLTH0A03894p"
                     /protein_id="XP_002551625.1"
                     /db_xref="GeneID:8290428"
                     /db_xref="InterPro:IPR018859"
                     /db_xref="InterPro:IPR027267"
                     /db_xref="UniProtKB/TrEMBL:C5DBM6"
                     /translation="MSFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQR
                     TQDLTTQLPSFAQSTQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQ
                     VYENESYDYPNNVRDSVNEFSSVVAGKLHDLSRATSTNEAQSVLIAPGPHKDPKTLNY
                     ALSKVALTSSEYLNKSVGGDDSEVSNALLKYSDVQAKVAQARLQQDTLIQTRFNKKLR
                     DILANDLNEAQKARKNVEHKRLQYDIARSNLANAKPEKEASLRVQMESLEDEFAQATD
                     DAVVVMQKVAGSSELLKELRELVAAQADYHKQSYELLSEFLPQLESA"
     gene            <329926..>331167
                     /locus_tag="KLTH0A03916g"
                     /db_xref="GeneID:8290429"
     mRNA            <329926..>331167
                     /locus_tag="KLTH0A03916g"
                     /product="KLTH0A03916p"
                     /transcript_id="XM_002551580.1"
                     /db_xref="GeneID:8290429"
     CDS             329926..331167
                     /locus_tag="KLTH0A03916g"
                     /note="similar to uniprot|P40530 Saccharomyces cerevisiae
                     YIL042C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A03916p"
                     /protein_id="XP_002551626.1"
                     /db_xref="GeneID:8290429"
                     /db_xref="GOA:C5DBM7"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR004358"
                     /db_xref="InterPro:IPR005467"
                     /db_xref="InterPro:IPR018955"
                     /db_xref="UniProtKB/TrEMBL:C5DBM7"
                     /translation="MFARHSQLAGRGLKQLAITVKLPRLIFHSCATRQSYSTKTSMRE
                     KLKEVGFEELYRIRSNTQLLIQDFAKKPIPPLSYEFLTQYKVPLTENQKYTLTIQTVN
                     LLLMYTCRRLVAIQRLPYIAVLNPNIEQTNRLYLRTLESLLSLNYPYGLHDQGVMTKK
                     LTEFLDDHQDTLVTLSRGFQEIMDFFPKEAVFDFLNLHLRDRIAMKLLATHYLALVSQ
                     KSNEEPVIGVLHKNLKISELVRRVEEFVGDLCFVKYDHQLPIEILEGEDVTFPCIPTD
                     LEYVLTEILKNSSRAHIENSVPENNTAEKPIEVTIVRNDNDLKIRIRDFGGGIPPDVE
                     DRMFDYSYSTVNSDAKDSGMSAYVIPGEDVCNVSGMGFGLPMCKAYMEMFGGSVDIQS
                     LWGWGTDAYICLKGPSPNLLK"
     gene            complement(<331257..>331772)
                     /locus_tag="KLTH0A03938g"
                     /db_xref="GeneID:8290430"
     mRNA            complement(<331257..>331772)
                     /locus_tag="KLTH0A03938g"
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /transcript_id="XM_002551581.1"
                     /db_xref="GeneID:8290430"
     CDS             complement(331257..331772)
                     /locus_tag="KLTH0A03938g"
                     /note="weakly similar to uniprot|P40033 Saccharomyces
                     cerevisiae YER050C"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM18"
                     /protein_id="XP_002551627.1"
                     /db_xref="GeneID:8290430"
                     /db_xref="GOA:C5DBM8"
                     /db_xref="InterPro:IPR001648"
                     /db_xref="UniProtKB/TrEMBL:C5DBM8"
                     /translation="MLSLRTSWHVSIPKRAFTSGIPKQNLSFKIKLTPNEKSQINVKA
                     RDPGSASSQPKRIDPRLVKKFQSGTTYDPFDFSLARLHLDKKFSSKNSSNDLFDKNGV
                     DPLDLYTNPEFLSQFVTSSGKILHRDVTGLSAKNQRRLSKAIRRCQAIGLMSKTHRDV
                     SYLPSRIMGKI"
     gene            <332436..>333842
                     /locus_tag="KLTH0A03960g"
                     /db_xref="GeneID:8290431"
     mRNA            <332436..>333842
                     /locus_tag="KLTH0A03960g"
                     /product="KLTH0A03960p"
                     /transcript_id="XM_002551582.1"
                     /db_xref="GeneID:8290431"
     CDS             332436..333842
                     /locus_tag="KLTH0A03960g"
                     /note="similar to uniprot|P40034 Saccharomyces cerevisiae
                     YER051W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A03960p"
                     /protein_id="XP_002551628.1"
                     /db_xref="GeneID:8290431"
                     /db_xref="GOA:C5DBM9"
                     /db_xref="InterPro:IPR001965"
                     /db_xref="InterPro:IPR003347"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DBM9"
                     /translation="MTKDVCSYCSSDGADGAVWVQCEVCDQWVHVTCIPIKYLTNEMR
                     EPLDSYPKLARQIKRFSCSAHGSPVLEVKSTSKKRKIEPTAPAKVGKRQGLRKKKQVD
                     YISLNEGDDKRLKDEHPHMHAFLACFSKWENKTNVIESSRLERDFNAITIPMKVQDPE
                     NSGMRIPEYSEGRAFTVDTVTKFLGADYPVDVMDVQSQQNSTWSMSQWNQYFTETAAD
                     ARDRIRNVISLEVSHVDQFKTGLRRPRVVESHDLVDLLWEEVKDDIPRPKVTKYVLMS
                     VGNAYTDFHLDFAGTSVYYKVIFGSKKFILFPPTPHNLKAYESWCGNDHQNLIFLGDQ
                     LEQGVAMELRAGDLFMIPSGFIHAVFTPQDSLVVGGNFLTLRDLATQLVVTEIEKLTK
                     VPKKFTFPQFEAVMGKTAELTLQKSGTDEDLALSIEKEEALLEYIKTPTFKYKPVNFS
                     TKRELISQFQKHIEARSD"
     gene            <334027..>334890
                     /locus_tag="KLTH0A03982g"
                     /db_xref="GeneID:8290432"
     mRNA            <334027..>334890
                     /locus_tag="KLTH0A03982g"
                     /product="KLTH0A03982p"
                     /transcript_id="XM_002551583.1"
                     /db_xref="GeneID:8290432"
     CDS             334027..334890
                     /locus_tag="KLTH0A03982g"
                     /note="similar to uniprot|P38626 Saccharomyces cerevisiae
                     YIL043C CBR1 cytochrome b reductase"
                     /codon_start=1
                     /product="KLTH0A03982p"
                     /protein_id="XP_002551629.1"
                     /db_xref="GeneID:8290432"
                     /db_xref="GOA:C5DBN0"
                     /db_xref="InterPro:IPR001433"
                     /db_xref="InterPro:IPR001709"
                     /db_xref="InterPro:IPR001834"
                     /db_xref="InterPro:IPR008333"
                     /db_xref="InterPro:IPR017927"
                     /db_xref="InterPro:IPR017938"
                     /db_xref="UniProtKB/TrEMBL:C5DBN0"
                     /translation="MDSLPFDSKTLLIGGFVAFFVITLASRFLGSKKAIPVLIKDQYQ
                     EFPLVSKTVLTHNTAVYRFGLPKQSDVLGLPIGQHISIKGNLPDGKEIMRSYTPTSLD
                     SDSVGFFELLIKSYDQGNVSKMIGELQIGDKIKVRGPKGFYTYTPNMNSEIGMIAGGT
                     GIAPMYQIIKAIHSDPKDRTKVSIVYGSQTEDDILLKKELDAIVESNPEQFKVHYLLD
                     KPARDTWTGGVGYVTPDVMKSYLPAPGPGAQLLVCGPPGMVSSVKKNAVALGFEKAKP
                     VSKMGDQVFVF"
     gene            complement(<335054..>336622)
                     /locus_tag="KLTH0A04004g"
                     /db_xref="GeneID:8290433"
     mRNA            complement(<335054..>336622)
                     /locus_tag="KLTH0A04004g"
                     /product="KLTH0A04004p"
                     /transcript_id="XM_002551584.1"
                     /db_xref="GeneID:8290433"
     CDS             complement(335054..336622)
                     /locus_tag="KLTH0A04004g"
                     /note="highly similar to uniprot|P10869 Saccharomyces
                     cerevisiae YER052C HOM3 Aspartate kinase (L-aspartate
                     4-P-transferase) cytoplasmic enzyme that catalyzes the
                     first step in the common pathway for methionine and
                     threonine biosynthesis expression regulated by Gcn4p and
                     the general control of amino acid synthesis"
                     /codon_start=1
                     /product="KLTH0A04004p"
                     /protein_id="XP_002551630.1"
                     /db_xref="GeneID:8290433"
                     /db_xref="GOA:C5DBN1"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR001341"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR018042"
                     /db_xref="UniProtKB/TrEMBL:C5DBN1"
                     /translation="MALQTNWIVQKFGGTSVGKFPEQIVDEIVKVYTTQFKNNVAVVC
                     SARSSDTKAEGTTSRLLRACDLVCNSDPSFAEVLQKVRDDHISNAKQRISNPELQKKL
                     IQDTIAELDLVEKYLNASQVLGEVSLRTMDLVMSCGEKLSCLFMAALCNEHGVPAQYV
                     DLSSVIPHDYECRQGTLDTSFYTFLVMAFKEKLQPVLDLHAKGEPVVPVITGFFGLVP
                     MGLLNGVGRGYTDLCAALIAVGLNADELQVWKEVDGIFTADPRKVPQARLLASVTPEE
                     ASELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPRGDGTVIYPDNVAKKGESTPPHP
                     PVTLSNSFFEQRRRGATAITSKSDIYVVSIHSNKKTLSHGFLAQIFTTLDKYKLVVDL
                     ISTSEVHVSMALPVPDNDSAKALKKAVEELKKLGSVELTKKLVIISLVGKQMKQFIGI
                     AGTMFTTLAEQGINIEMISQGANEINISCVIDEDNAIKALQSIHSKLLDLNTEVELGK
                     AVNEKLEQIKRLAL"
     gene            complement(<337200..>337901)
                     /locus_tag="KLTH0A04026g"
                     /db_xref="GeneID:8290434"
     mRNA            complement(<337200..>337901)
                     /locus_tag="KLTH0A04026g"
                     /product="KLTH0A04026p"
                     /transcript_id="XM_002551585.1"
                     /db_xref="GeneID:8290434"
     CDS             complement(337200..337901)
                     /locus_tag="KLTH0A04026g"
                     /note="weakly similar to uniprot|P40312 Saccharomyces
                     cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
                     sterol and lipid biosynthesis pathways"
                     /codon_start=1
                     /product="KLTH0A04026p"
                     /protein_id="XP_002551631.1"
                     /db_xref="GeneID:8290434"
                     /db_xref="GOA:C5DBN2"
                     /db_xref="InterPro:IPR001199"
                     /db_xref="UniProtKB/TrEMBL:C5DBN2"
                     /translation="MPLESQKKVRFCLEKEEQDLGAAEHTVLEQPPVISREELATHTS
                     AEDCWLAIHGAVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDDVGHSMESLMFDLGSG
                     ACVGVLKARPVTTALSTPQKQQQASEFAPEHSSYWEQLWTWVKHVPETPLGFRNLKWA
                     TGELRSRNPSVYKGDAEVRRELNALAIAVVMGVCIIMLVYVKLRCPSMMEHVVLGALP
                     EEMAGENFDIPSWSL"
     gene            <339253..>340128
                     /locus_tag="KLTH0A04048g"
                     /db_xref="GeneID:8290435"
     mRNA            <339253..>340128
                     /locus_tag="KLTH0A04048g"
                     /product="KLTH0A04048p"
                     /transcript_id="XM_002551586.1"
                     /db_xref="GeneID:8290435"
     CDS             339253..340128
                     /locus_tag="KLTH0A04048g"
                     /note="similar to uniprot|P40529 Saccharomyces cerevisiae
                     YIL044C AGE2 ADP-ribosylation factor (ARF) GTPase
                     activating protein (GAP) effector ARF GAP with effector
                     function(s)"
                     /codon_start=1
                     /product="KLTH0A04048p"
                     /protein_id="XP_002551632.1"
                     /db_xref="GeneID:8290435"
                     /db_xref="GOA:C5DBN3"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:C5DBN3"
                     /translation="MSNFLWKLQKSGSRIGPMSSPAIKKALAALLRDPNNSTCADCKT
                     AGHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWQEEHMRKVVEFGNNAAA
                     NAVYECKLSGNHTPEASKIADFIRNKYELKKWIGNAAEVSAPPSRPKTVEKKPQVAQQ
                     AHGSQTSLVSQTSSAPSRSATSSQVDLNLASPSVASRTTLNAAAREPSGRPDLKKSIL
                     SLYSRPRTSTASVASGASNASFSSSTGTPSIASNSTPAAGYPLPGASFSLPAQTNTTS
                     SASLEDNDLFKNVWS"
     gene            complement(<340333..>341373)
                     /locus_tag="KLTH0A04070g"
                     /db_xref="GeneID:8290436"
     mRNA            complement(<340333..>341373)
                     /locus_tag="KLTH0A04070g"
                     /product="KLTH0A04070p"
                     /transcript_id="XM_002551587.1"
                     /db_xref="GeneID:8290436"
     CDS             complement(340333..341373)
                     /locus_tag="KLTH0A04070g"
                     /note="similar to uniprot|P40035 Saccharomyces cerevisiae
                     YER053C PIC2 Mitochondrial phosphate carrier imports
                     inorganic phosphate into mitochondria functionally
                     redundant with Mir1p but less abundant than Mir1p under
                     normal conditions expression is induced at high
                     temperature"
                     /codon_start=1
                     /product="KLTH0A04070p"
                     /protein_id="XP_002551633.1"
                     /db_xref="GeneID:8290436"
                     /db_xref="GOA:C5DBN4"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DBN4"
                     /translation="MVRSQLRDYISERPRQLPGRLPVHPLEPRSRPRPHSALMSQNSS
                     IFNSPKLYSPDYYAACTIGGLVACGPTHSAVTPLDLVKCRRQVDSSLYKSNLEGWRQI
                     IKTEGGVGKIFTGVGATAIGYSLQGAFKYGGYEFFKHQYSQLVSPETAHQYRTGIFLA
                     ASASAEFIADLFLCPWEAIKVRQQTAVPPPFARNVFEAYSKMVGAEGFASLYKGITPL
                     WCRQIPYTMCKFTSFERIVEMIYARLPTPKREMSQLGQIGVSFAGGYLAGILCAVVSH
                     PADVMVSKVNNERKKGESMMEATSRIYAKIGFPGLWNGLAVRILMIGTLTSFQWLIYD
                     SFKATVGLPTTG"
     gene            complement(<342925..>344223)
                     /locus_tag="KLTH0A04092g"
                     /db_xref="GeneID:8290437"
     mRNA            complement(<342925..>344223)
                     /locus_tag="KLTH0A04092g"
                     /product="KLTH0A04092p"
                     /transcript_id="XM_002551588.1"
                     /db_xref="GeneID:8290437"
     CDS             complement(342925..344223)
                     /locus_tag="KLTH0A04092g"
                     /note="weakly similar to uniprot|P40036 Saccharomyces
                     cerevisiae YER054C GIP2 Putative regulatory subunit of the
                     protein phosphatase Glc7p proposed to be involved in
                     glycogen metabolism contains a conserved motif (GVNK
                     motif) that is also found in Gac1p Pig1p and Pig2p"
                     /codon_start=1
                     /product="KLTH0A04092p"
                     /protein_id="XP_002551634.1"
                     /db_xref="GeneID:8290437"
                     /db_xref="InterPro:IPR005036"
                     /db_xref="UniProtKB/TrEMBL:C5DBN5"
                     /translation="MYIRRPPSDTNGDVMNRSLAFLHKPQRVSQPKPFAEESLRRNTD
                     LNRGKVQVNEMHDDYFSSQTPASADGSVAGDVSSQLRVNPYFPANENYYYNSSGDGDD
                     ADNEPPPLVRKKSGEVVRSNLKLAQRSRSLPATPSGREPDKRIGAPPPGPQRSKSVHF
                     DQRDVVKFKYFWQEDSPLDVASQDVLEGPLDEDPHTLTLQADAAVRSDGSDAEPRDLT
                     MTMSNLQIEKRMSSGLRRSKRYQRLRSKGAEKDGATKPGLYRENFATLSDDDQSSLKS
                     NIFLNIAHNSYCFLQDLSLIADQHYLVGHVLVKNIFYDKEVVVRYTRDHWRTVHEVEC
                     VWESSGDDVLPGMGMDRFKLVIDLATLGDDGGAAPRAPRAGPAAAFALVKLEFCIRYT
                     TRSSHERVEHWDNNGGRNYVVDVVCAAQRMGFTDPFGPPH"
     gene            complement(<344618..>346594)
                     /locus_tag="KLTH0A04114g"
                     /db_xref="GeneID:8290438"
     mRNA            complement(<344618..>346594)
                     /locus_tag="KLTH0A04114g"
                     /product="KLTH0A04114p"
                     /transcript_id="XM_002551589.1"
                     /db_xref="GeneID:8290438"
     CDS             complement(344618..346594)
                     /locus_tag="KLTH0A04114g"
                     /note="similar to uniprot|P39014 Saccharomyces cerevisiae
                     YIL046W MET30 F-box protein containing five copies of the
                     WD40 motif controls cell cycle function sulfur metabolism
                     and methionine biosynthesis as part of the ubiquitin
                     ligase complex interacts with and regulates Met4p
                     localizes within the nucleus"
                     /codon_start=1
                     /product="KLTH0A04114p"
                     /protein_id="XP_002551635.1"
                     /db_xref="GeneID:8290438"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR001810"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DBN6"
                     /translation="MSQSNHSASNKTTITVEDKHIGTCIKGIKKLESLPWRRRRKLTV
                     MLEEFPNQMGALIKPEVRSTQSTNMHAKEEAPDAANSSVVASGRLNGKRGLEEYEEDQ
                     PSTAEVSSEASAQNVNKRRRGLPQYNFLRFCYRHNPDIQQSPTHTACRKQDQQRHSLL
                     QRKIEKLEPEEQRQVQNVLSTFTSCNDKMRKLLLEGMLTNCCFPQLSFVASEVQNMIK
                     IDFISTLPEEVSLKILGYLDCESLCNAARVCRRWKQLADDDKVWYHMCQQHIDRKCPN
                     CGWGLPLLHMKRARFIDSTEQKSDPKDACATAAASGGHRKTRPWKVIYRERFKVESNW
                     RKGAAHIQDFKGHMDGVLTLQFNYRLLFTGSYDSTVAIWDLATGKLVRRLTGHRDGVK
                     TLYFDDQKLITGSLDRTIRVWNYVTGACVSTYRGHSDSVLSVDSYKKIIVSGSADKTV
                     KMWHVESRTCYTLRGHSEWVGCVKLHPKSFTCFSGSDDTTIRMWDIRSNTCLKVFRGH
                     VGQVQKVLPLNILDTENLVTDPASEAQRNDEPAANDPSEGQLAPLDDSLPYPSHLLSC
                     SLDNTIKLWDVRTGKCVRTHFGHLEGIWDIAADNFRIISGAHDKTVKVWDLQSGKCIH
                     TFDSHHAPITCVGIGDSEFVSGDELGCVKLHRFD"
     gene            complement(<347041..>348000)
                     /locus_tag="KLTH0A04136g"
                     /db_xref="GeneID:8290439"
     mRNA            complement(join(<347041..347882,347949..>348000))
                     /locus_tag="KLTH0A04136g"
                     /product="KLTH0A04136p"
                     /transcript_id="XM_002551590.1"
                     /db_xref="GeneID:8290439"
     CDS             complement(join(347041..347882,347949..348000))
                     /locus_tag="KLTH0A04136g"
                     /note="highly similar to uniprot|P00498 Saccharomyces
                     cerevisiae YER055C HIS1 ATP phosphoribosyltransferase a
                     hexameric enzyme catalyzes the first step in histidine
                     biosynthesis mutations cause histidine auxotrophy and
                     sensitivity to Cu Co and Ni salts transcription is
                     regulated by general amino acid control"
                     /codon_start=1
                     /product="KLTH0A04136p"
                     /protein_id="XP_002551636.1"
                     /db_xref="GeneID:8290439"
                     /db_xref="GOA:C5DBN7"
                     /db_xref="InterPro:IPR001348"
                     /db_xref="InterPro:IPR011322"
                     /db_xref="InterPro:IPR013115"
                     /db_xref="InterPro:IPR013820"
                     /db_xref="InterPro:IPR015867"
                     /db_xref="InterPro:IPR018198"
                     /db_xref="InterPro:IPR020621"
                     /db_xref="UniProtKB/TrEMBL:C5DBN7"
                     /translation="MDLVNHLNDRLLFAIPKKGRLYEKAVSILKGSDIRFHRSQRLDI
                     ALSTNMPIALIFLPAADIPMFVGEGKCDLGITGVDQVKESQVDVLLPMDLQFGACKLQ
                     VQVPEAGPYQKPEQLIGKTIVSSFTQLTKEYFAELEGVPIDQITTKIRYVGGSVEASC
                     ALGIADAIVDLVESGETMRAAGLKDIATVLETSAHLIESKNPKGDTELLQTIKSRIEG
                     VMTAQKYVSCNYNVPVSCLPQVLKITPGRRAPTISKIDDEGWVAVSAMIDRKQKGTIM
                     DDLKKNGAADIMVFEISNCRV"
     gene            <348896..>351466
                     /locus_tag="KLTH0A04158g"
                     /db_xref="GeneID:8290440"
     mRNA            <348896..>351466
                     /locus_tag="KLTH0A04158g"
                     /product="KLTH0A04158p"
                     /transcript_id="XM_002551591.1"
                     /db_xref="GeneID:8290440"
     CDS             348896..351466
                     /locus_tag="KLTH0A04158g"
                     /note="similar to uniprot|P40528 Saccharomyces cerevisiae
                     YIL047C SYG1 Protein for which truncation and
                     overexpression can suppress lethality of G-alpha protein
                     deficiency plasma membrane protein"
                     /codon_start=1
                     /product="KLTH0A04158p"
                     /protein_id="XP_002551637.1"
                     /db_xref="GeneID:8290440"
                     /db_xref="GOA:C5DBN8"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR004342"
                     /db_xref="UniProtKB/TrEMBL:C5DBN8"
                     /translation="MKFAEHLRESAVPEWIDKYIDYKKGKKKIKACRNTIAASEVLVN
                     NVSTTNSVAMYRDSSSSSRYNSQNVYSPVQRRFVQEFIDKWVIDQELEKCNDFYLWEF
                     KRCSRRFAILREQIERFEAHRTQLTVTESDPKYYGAVDRDERVVPAKSRKRSSWATRT
                     FRTLQDLELIPSLPSLKPFKQLFLNEPDTNSLSVGYGDTFAPSSLTTNQIQHRLSDAL
                     IEFYLLVQLIKNYRDINVTGFRKIVKKFDKSCGTRELFSFIEYAKSSYPLFQHAEANA
                     RMVAQQIHDSVATRTSAASSNDPNFEDPLVVWEHEVTTWYTDVLSSSAKDRKRKIERI
                     KNLSLEYSLNEQKVHRFNKSILQVFVGGVLMGGSLTLVAYTLWVGFKAPSSSKIHHIL
                     LPLWGGWYMVFLITFLFLLNCFIWHRSNVNYRFIMFGEMHSRRGAVLFNNDFSTTQIP
                     ILFYFASVLAFPMTLLGALSFYENALDPFAIIWIVLVSVLFFLPLFGKTPYLNLPYWN
                     KLTKSVRWILVSFVRLIFSGFYPVQFGDFFLGDIFCSLTYSLADIAMFFCIYSPTPNG
                     MCGSSHSKAMGAMTCLPNFWRFMQCLRRFSDSGDWFPHLVNGVKYSMSVLYYASLCAY
                     RIGHTRNRRNVFIIFATLNATCTAIWDIIMDWSLLQPGSKNWLLRDDLYLAGRKNWKT
                     GAYSRKRKSVYYLAMVWDVSMRFQWIVYAIAPDTIQQSAITSLVLAVLEVGRRFVWII
                     FRVENEHVANVHLFKVSGEATLPFPSTVEGDVETEGSIASNHYAMSEVSYPAMPSPTP
                     MYRGESLQKSTGSNGLLRTLSSSIPWAHAQDFQRPRGFSIVDHSHESDASESEAESML
                     "
     gene            complement(<351562..>354954)
                     /locus_tag="KLTH0A04180g"
                     /db_xref="GeneID:8290441"
     mRNA            complement(<351562..>354954)
                     /locus_tag="KLTH0A04180g"
                     /product="KLTH0A04180p"
                     /transcript_id="XM_002551592.1"
                     /db_xref="GeneID:8290441"
     CDS             complement(351562..354954)
                     /locus_tag="KLTH0A04180g"
                     /note="highly similar to uniprot|P40527 Saccharomyces
                     cerevisiae YIL048W NEO1 Protein involved in the retrograde
                     transport from the Golgi complex to the ER and the
                     endosomal membrane traffic putative aminophospholipid
                     translocase member of the highly conserved Drs2 family of
                     P-type ATPases"
                     /codon_start=1
                     /product="KLTH0A04180p"
                     /protein_id="XP_002551638.1"
                     /db_xref="GeneID:8290441"
                     /db_xref="GOA:C5DBN9"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR006539"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023299"
                     /db_xref="UniProtKB/TrEMBL:C5DBN9"
                     /translation="MSFTPPPGSNKEPAAPANRHNSFDLLDPQFEDSLDAALESLQIH
                     SEGAPTGEDFEMKSIASNDNHNAGLHSDTQPLINDGLGPNDSWSRGSRNSHSAEHRQP
                     FWSRITGIVRSSSTPRSSKYKSTGKSIQLTDQQLEREIHPGTTPIYDKYKYAANAVSN
                     AKYNPVTFIPVILYEQFKFFFNLYFLLVALSQAIPALRIGYLSSYIVPLAFVLIVTMS
                     KEALDDIQRRRRDSEANNELYEVLSKSQLVPSKDLKVGDLIKIGKGARAPADLILLQS
                     SEPSGEIFIKTDQLDGETDWKLRIASPLTQHLSQEDLLHKINITASVPEKSIHNFLGK
                     LTFNDSQSQPLSVDNTMWANTVFASTGTAVACVVYTGSDTRQAMNTTMSSVKTGLLEL
                     EINSLSKILCVCVFILSVALVAFAGFNNSDWYVDIMRYLILFSTIIPVSLRVNLDLGK
                     SVYAYQIEHDATIPDTIVRTSTIPEDLGRIEYLLTDKTGTLTQNDMELKKLHLGTVSY
                     TMDTMDIVTDYVRGMTSGADSTVLPSASKKDLPSRVRDLVLALALCHQVTPTFEDGEL
                     TYQAASPDEIAIVKFTESVGLTLFKRDRHSITLLHDQSGSYFDFDIVQVFPFNSDNKR
                     MGIIIFDKQKQEHWFFQKGADVVMSKIVQTNDWLEEETGNLAREGLRTLVIGRKKLSQ
                     KVFDNFTKEYKDASLTMLNREALMSNVVKKHLEHNLEILGLTGVEDKLQHDAKSSIEL
                     LRNAGIKIWMLTGDKVETARCVSISAKLVSRGQYVHTVTKIGKPEGALGQLELLKINQ
                     NSCLLIDGESLATYLEYYRQEFFEIVVHLPAVIACRCTPQQKADVATFIREATGKRVC
                     CIGDGGNDVSMIQAADVGVGIVGKEGKQASLAADFSITQFCHLSKLLLWHGRNSYKRS
                     AKLAQFVIHRGLLISVCQAVYSISSKFEPIALYQGWLMVGYATCYTMAPVFSLTLDHD
                     IDESLTKTYPELYKELTAGKSLSYKTFFVWVALSVFQGCVIQGFSQAFTSLDQLDFKR
                     LVALSFTVLIINELIMVAIEIYTWNKTMIICEILTFLVFVGSIPLLGDYFDLHFMTQP
                     NFYAKLALILGLSVVPVWTAKALHRKLNPPSYAKVQQFYFNA"
     gene            complement(<355181..>355970)
                     /locus_tag="KLTH0A04202g"
                     /db_xref="GeneID:8290442"
     mRNA            complement(join(<355181..355515,355934..>355970))
                     /locus_tag="KLTH0A04202g"
                     /product="60S ribosomal protein L34"
                     /transcript_id="XM_002551593.1"
                     /db_xref="GeneID:8290442"
     CDS             complement(join(355181..355515,355934..355970))
                     /locus_tag="KLTH0A04202g"
                     /note="highly similar to uniprot|P40525 Saccharomyces
                     cerevisiae YIL052C RPL34B Protein component of the large
                     (60S) ribosomal subunit, nearly identical to Rpl34Ap and
                     has similarity to rat L34 ribosomal protein"
                     /codon_start=1
                     /product="60S ribosomal protein L34"
                     /protein_id="XP_002551639.1"
                     /db_xref="GeneID:8290442"
                     /db_xref="GOA:C5DBP0"
                     /db_xref="InterPro:IPR008195"
                     /db_xref="InterPro:IPR018065"
                     /db_xref="UniProtKB/TrEMBL:C5DBP0"
                     /translation="MAQRVTFRRRNPYNTRSNKIKVVKTPGGVLRAQHTKKLATRPKC
                     GDTGVPLQGVSTMRPREYATVSKTHKTVSRAYGGVLCANAVKERIVRAFLIEEQKIVK
                     KVVKEQAESAKTTGKKKSRKN"
     gene            complement(<356660..>357085)
                     /locus_tag="KLTH0A04224g"
                     /db_xref="GeneID:8290443"
     mRNA            complement(<356660..>357085)
                     /locus_tag="KLTH0A04224g"
                     /product="KLTH0A04224p"
                     /transcript_id="XM_002551594.1"
                     /db_xref="GeneID:8290443"
     CDS             complement(356660..357085)
                     /locus_tag="KLTH0A04224g"
                     /note="highly similar to uniprot|P40185 Saccharomyces
                     cerevisiae YIL051C MMF1 Mitochondrial protein involved in
                     maintenance of the mitochondrial genome and similar to
                     YER057C uniprot|P40037 Saccharomyces cerevisiae YER057C
                     HMF1 Member of the p14.5 protein family with similarity to
                     Mmf1p, functionally complements Mmf1p function when
                     targeted to mitochondria; heat shock inducible;
                     high-dosage growth inhibitor; forms a homotrimer in vitro"
                     /codon_start=1
                     /product="KLTH0A04224p"
                     /protein_id="XP_002551640.1"
                     /db_xref="GeneID:8290443"
                     /db_xref="GOA:C5DBP1"
                     /db_xref="InterPro:IPR006056"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013813"
                     /db_xref="InterPro:IPR019897"
                     /db_xref="UniProtKB/TrEMBL:C5DBP1"
                     /translation="MFLRNAARQTFRTMSTLTPVRTQLSPPPAASYSQAMKVNNMVFV
                     SGQIPYTAENKRVEGTMTDKAEQVIQNVKNILEEANSALNKIVKVNIFLADINDFAEF
                     NGVYGKYFNEHKPARSCVAVKDLPLNVDLEMEVVAVEKE"
     gene            <357173..>357541
                     /locus_tag="KLTH0A04246g"
                     /db_xref="GeneID:8290444"
     mRNA            <357173..>357541
                     /locus_tag="KLTH0A04246g"
                     /product="KLTH0A04246p"
                     /transcript_id="XM_002551595.1"
                     /db_xref="GeneID:8290444"
     CDS             357173..357541
                     /locus_tag="KLTH0A04246g"
                     /note="similar to uniprot|Q02771 Saccharomyces cerevisiae
                     YER058W PET117 Protein required for assembly of cytochrome
                     c oxidase"
                     /codon_start=1
                     /product="KLTH0A04246p"
                     /protein_id="XP_002551641.1"
                     /db_xref="GeneID:8290444"
                     /db_xref="UniProtKB/TrEMBL:C5DBP2"
                     /translation="MKSQYIRRTNIFRHTMSTASKITLALSCAVTAATVVGVHYVQEL
                     ERETLHQGPIKDAKRMAERKAEQSAGAGAVSAESERKQHFNRSEHELQQELRKKYEAM
                     QPLSGEVLTKDGERAARDEK"
     gene            <358035..>359777
                     /locus_tag="KLTH0A04268g"
                     /db_xref="GeneID:8290445"
     mRNA            <358035..>359777
                     /locus_tag="KLTH0A04268g"
                     /product="KLTH0A04268p"
                     /transcript_id="XM_002551596.1"
                     /db_xref="GeneID:8290445"
     CDS             358035..359777
                     /locus_tag="KLTH0A04268g"
                     /note="similar to uniprot|P40186 Saccharomyces cerevisiae
                     YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms a
                     functional kinase complex with Pho85p which phosphorylates
                     Mmr1p and is regulated by Pho81p involved in glycogen
                     metabolism expression is cell-cycle regulated"
                     /codon_start=1
                     /product="KLTH0A04268p"
                     /protein_id="XP_002551642.1"
                     /db_xref="GeneID:8290445"
                     /db_xref="GOA:C5DBP3"
                     /db_xref="InterPro:IPR013922"
                     /db_xref="UniProtKB/TrEMBL:C5DBP3"
                     /translation="MYEEAPTQSAPNFTKGERAPAVTTSDFEAPKHPKTYRSVKYPYR
                     NITFLEEIPEFHTHTHTHMPPRPSFLEQVSENTPKTKARPMLIPRRVSTVHTEGPTSV
                     TEETISSSHSSESLMNGEDSPASRQTVGIAGGGVAVGPHGARLADSPAAGVASVRSDS
                     VASRMRPMLQRMGSSYSRGSFVGKNGSFISTSLSDDGGSGGGSNTGETPGLFEAVCDS
                     SDLERDHDHDYDHEHDHDHEHNDEHNHARAQSRGHGHCHDHDHTHGQTTPEDRETTLP
                     SSVPRGSAPIDISTAPMAKTLSSKYFQESVHDDDYLQNFTPFHNTPTSVSNSYSTNAT
                     GSDLMARRLAHPPAADPEPRLSDDPALVYIAEFPTDKLLSMLTALLDKIVRSNDQLSR
                     DRPFDEDQFLARAADATATASASADAPAAGCAGHDLAAEILSFRGKHVPAITLHQYFQ
                     RIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHRLIISAVTVSTKFFS
                     DFFYSNSRYARVGGISLKELNHLELQFLVLCDFELIISVEELQKYSNLLRDFWHREMG
                     DAPEAETAAPEHVL"
     gene            <361064..>362614
                     /locus_tag="KLTH0A04290g"
                     /db_xref="GeneID:8290446"
     mRNA            <361064..>362614
                     /locus_tag="KLTH0A04290g"
                     /product="KLTH0A04290p"
                     /transcript_id="XM_002551597.1"
                     /db_xref="GeneID:8290446"
     CDS             361064..362614
                     /locus_tag="KLTH0A04290g"
                     /note="similar to uniprot|P17064 Saccharomyces cerevisiae
                     YER056C FCY2 Purine-cytosine permease mediates purine
                     (adenine guanine and hypoxanthine) and cytosine
                     accumulation and similar to uniprot|P40039 Saccharomyces
                     cerevisiae YER060W FCY21 Putative purine-cytosine
                     permease"
                     /codon_start=1
                     /product="KLTH0A04290p"
                     /protein_id="XP_002551643.1"
                     /db_xref="GeneID:8290446"
                     /db_xref="GOA:C5DBP4"
                     /db_xref="InterPro:IPR001248"
                     /db_xref="InterPro:IPR012681"
                     /db_xref="InterPro:IPR026030"
                     /db_xref="UniProtKB/TrEMBL:C5DBP4"
                     /translation="MSTGKEEYEIQDVEKQSRSRLELSDDDSQPIVETSEHTRLSFVD
                     RMAAKLRAETKGIEPITDEEKDDNSILNAASMWFSANMVIAAFALGVLGPCIFGLNFF
                     GCLLAVLIFATLGILPVAFFSVFGAELGLRQMVLSRYLLGNATARIFALINVIACVGW
                     GAVNTIASAQLLHMVNPGGARCPPWAGCIIIVVSTIIVTFFGYRVIHAYEKFSWIPNF
                     AVFLVIIARLKIDGSFTVGPWVSGTAGAASVLSFGGVIFGFASGWTTYAADYTVYMPR
                     STNKPKVFFFVLVGLMFPLCFAILLGSACAMATFNNKSYASYYADEGTGGLIFAILVD
                     KSLHGFGQFCCVLLAMSTVANNIPNMYSIALGTQALWEPLAKIPRVFWTMAGNLVTLA
                     IAIPAYYKFESFMTNFMDAIAYYLAIYIGISITEHFVFRKGKFSNYNVDDWDSWARLP
                     LGIAGCCALFVGAVGVAVGMEQTYWTGEIARKIGTFGADIGLELGFGFSVIVYLALRP
                     LELKFIGR"
     gene            <362792..>363535
                     /locus_tag="KLTH0A04312g"
                     /db_xref="GeneID:8290447"
     mRNA            <362792..>363535
                     /locus_tag="KLTH0A04312g"
                     /product="KLTH0A04312p"
                     /transcript_id="XM_002551598.1"
                     /db_xref="GeneID:8290447"
     CDS             362792..363535
                     /locus_tag="KLTH0A04312g"
                     /note="similar to uniprot|P40526 Saccharomyces cerevisiae
                     YIL049W DFG10 Protein of unknown function involved in
                     filamentous growth"
                     /codon_start=1
                     /product="KLTH0A04312p"
                     /protein_id="XP_002551644.1"
                     /db_xref="GeneID:8290447"
                     /db_xref="GOA:C5DBP5"
                     /db_xref="InterPro:IPR001104"
                     /db_xref="UniProtKB/TrEMBL:C5DBP5"
                     /translation="MDLNPRSLFELAFYSSFLLAITSVLLAKWRLPTLLKYGKTLQGV
                     PSKGGILGSLQSLTVPKKWFGHFYVYSTALALLNVCFLRGFASLLVLTHSARRLYETR
                     CVSKFGKDSRIHLSHYLVGLWFYTAVNCAVFVDRTRTRSPLARLVAVIVFVLSSLDQY
                     RNHLHLSKLVKYTLPTYGLFQLVSSPHYFDEILIYLSLAIYTSSLKMFLCLVWVIVNL
                     STSALETRSWYAKKFPRAAPSFAIIPYLL"
     gene            complement(<363572..>364846)
                     /locus_tag="KLTH0A04334g"
                     /db_xref="GeneID:8290448"
     mRNA            complement(<363572..>364846)
                     /locus_tag="KLTH0A04334g"
                     /product="KLTH0A04334p"
                     /transcript_id="XM_002551599.1"
                     /db_xref="GeneID:8290448"
     CDS             complement(363572..364846)
                     /locus_tag="KLTH0A04334g"
                     /note="similar to uniprot|P39525 Saccharomyces cerevisiae
                     YER061C CEM1 homology with beta-keto-acyl synthases
                     Protein homologous to beta-keto-acyl synthase"
                     /codon_start=1
                     /product="KLTH0A04334p"
                     /protein_id="XP_002551645.1"
                     /db_xref="GeneID:8290448"
                     /db_xref="GOA:C5DBP6"
                     /db_xref="InterPro:IPR014030"
                     /db_xref="InterPro:IPR014031"
                     /db_xref="InterPro:IPR016038"
                     /db_xref="InterPro:IPR016039"
                     /db_xref="InterPro:IPR017568"
                     /db_xref="InterPro:IPR018201"
                     /db_xref="UniProtKB/TrEMBL:C5DBP6"
                     /translation="MSTRVVVTGLGALTPLGKTVAESWAALLAGKSGIRPIGELANAE
                     SYERHCPPSLAVADVKEFDPHAYGNLFTSQDLRRMSQFTQFAVVAAQEALRDANLIET
                     LQKGRNDRVGCVIGSGIASVHDMYDSIVEFDRGKRLSPSFVPKILSNMACGNVSIKFQ
                     LRGVSHCVSTACATGNNAIGDAYNFIRLGYNDVCLAGASEASVHPLALAGFLRAKSIT
                     PSGISRPFDKERNGFVLGEGAGLLVLESLKHAQDRGARIYAEVEGYGLTSDAHHITSP
                     SENGDGARRAMEMALNNQTRSQVDYVNAHATSTVLGDRAEAQAISNILSGDGKDAIKV
                     SSNKGAIGHLLGAAGAVESIFTIKSLQDGVVPHTLNLHSVGGASGDEAENFERLDLVR
                     GAPAKHDIRRALNNSFGFGGINSSIVFRRWEV"
     gene            complement(<365149..>365898)
                     /locus_tag="KLTH0A04356g"
                     /db_xref="GeneID:8290449"
     mRNA            complement(<365149..>365898)
                     /locus_tag="KLTH0A04356g"
                     /product="KLTH0A04356p"
                     /transcript_id="XM_002551600.1"
                     /db_xref="GeneID:8290449"
     CDS             complement(365149..365898)
                     /locus_tag="KLTH0A04356g"
                     /note="similar to uniprot|P40106 Saccharomyces cerevisiae
                     HOR2 and to YIL053W uniprot|P41277 Saccharomyces
                     cerevisiae RHR2, two redundant DL-glycerol-3-phosphatases"
                     /codon_start=1
                     /product="KLTH0A04356p"
                     /protein_id="XP_002551646.1"
                     /db_xref="GeneID:8290449"
                     /db_xref="GOA:C5DBP7"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DBP7"
                     /translation="MSSSKPISLKVNAALFDVDGTIIISQPATNAFWRDFAKDKPYFI
                     VDEVLKVSHGCRTFDTISRFAPDFADEAKIVEMETQIPAKYGEHSIEVPGAVNLCHAL
                     NTLPKEKWAVATSGTRGLAVQWFKLLGITMPTYFITANDVKQGKPHPEPYLKGRNGLG
                     YPVNEKEPSKSKAIVFEDAPAGIAAGKAAGCKVIGIATTFDLDYLKKHDCDIIVEDLS
                     TVRIGSYDAETDEVEFIFSDYLYAKDDVLTW"
     gene            complement(<366491..>367240)
                     /locus_tag="KLTH0A04378g"
                     /db_xref="GeneID:8290450"
     mRNA            complement(<366491..>367240)
                     /locus_tag="KLTH0A04378g"
                     /product="KLTH0A04378p"
                     /transcript_id="XM_002551601.1"
                     /db_xref="GeneID:8290450"
     CDS             complement(366491..367240)
                     /locus_tag="KLTH0A04378g"
                     /note="highly similar to uniprot|P40106 Saccharomyces
                     cerevisiae HOR2 and to YIL053W uniprot|P41277
                     Saccharomyces cerevisiae RHR2, two redundant
                     DL-glycerol-3- phosphatases"
                     /codon_start=1
                     /product="KLTH0A04378p"
                     /protein_id="XP_002551647.1"
                     /db_xref="GeneID:8290450"
                     /db_xref="GOA:C5DBP8"
                     /db_xref="InterPro:IPR006439"
                     /db_xref="InterPro:IPR023198"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DBP8"
                     /translation="MPLSKPLSFKVNAALFDVDGTIIISQPAIAAFWRDFGKDKPYFD
                     AEHVIHESHGWRTYDAIAKFAPDFADEDYATQLEAEIPEKYGEHSIEVPGAVKLCNDL
                     NALPKEKWAVATSGTRPMASKWFEHLGIAKPKYFITANDVKQGKPFPEPYIKGRDGLG
                     FPINEKDPSKSKVIVFEDAPAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHE
                     SIRVGGYDPKTDEVEFIFDDYLYAKDDLLQW"
     gene            <368443..>369036
                     /locus_tag="KLTH0A04400g"
                     /db_xref="GeneID:8290451"
     mRNA            <368443..>369036
                     /locus_tag="KLTH0A04400g"
                     /product="KLTH0A04400p"
                     /transcript_id="XM_002551602.1"
                     /db_xref="GeneID:8290451"
     CDS             368443..369036
                     /locus_tag="KLTH0A04400g"
                     /note="some similarities with uniprot|P40040 Saccharomyces
                     cerevisiae YER063W THO1 Suppressor of the Transcriptional
                     (T) defect of Hpr1 (H) by Overexpression (O); (putative)
                     involved in transcription"
                     /codon_start=1
                     /product="KLTH0A04400p"
                     /protein_id="XP_002551648.1"
                     /db_xref="GeneID:8290451"
                     /db_xref="GOA:C5DBP9"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="UniProtKB/TrEMBL:C5DBP9"
                     /translation="MAPMAAYAKRTVPELRKELESRQLSHDGNKPDLIARLEAHDAAQ
                     AAVEPPTAATAQEEPAPEPEAQPETQPEAQPAPESAPEPAPESAPAQPAQEHQASPAP
                     RKPSPEEAKALALADLELKLRRAKKFADDQSTIDSLQRQIARVHKFGVDPTTQLARDL
                     GLGSGPASAAPKSANRPRSRRRKANPQSKSTKHARSN"
     gene            <369616..>370812
                     /locus_tag="KLTH0A04422g"
                     /db_xref="GeneID:8290452"
     mRNA            <369616..>370812
                     /locus_tag="KLTH0A04422g"
                     /product="KLTH0A04422p"
                     /transcript_id="XM_002551603.1"
                     /db_xref="GeneID:8290452"
     CDS             369616..370812
                     /locus_tag="KLTH0A04422g"
                     /note="some similarities with uniprot|P40523 Saccharomyces
                     cerevisiae YIL055C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A04422p"
                     /protein_id="XP_002551649.1"
                     /db_xref="GeneID:8290452"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ0"
                     /translation="MEQPETRVAYIRIDNLPPGKTWRQVKYLVGGMIHHTSILQVKML
                     PPVQSIVPPFIPFQSSIVSLKRSDAQLSRLLMELNGYTWEYYPLVAYAVPPLHVPSNA
                     GYGEGLGLGFGLGSGSAGGSAGTGGSRSGSDVPGSPRAPGSAPVPPMMMPFQPMPAMY
                     FPPLAQEPYARHVQSHGKKMRQVFSEESFRKQMSARGMWQLLLEGFPPCLHWDVNGAD
                     GAGLQQSPLLGPPPAVHVKTAHPEHFGKLKWTVLKDFIKLKCHKLLEMDNMGATTNTR
                     EFYVGVYEDCEVRTDVEVPEQDAGQEPNGVEASDESPEESTSETATTASAKGSAENEL
                     EKATQSISRLSLGPSHRVVSATIYKAIVGFHSRELCDMCRESLQGQEYSLGYKLKVTE
                     LPLLEW"
     gene            complement(<371219..>373240)
                     /locus_tag="KLTH0A04444g"
                     /db_xref="GeneID:8290453"
     mRNA            complement(<371219..>373240)
                     /locus_tag="KLTH0A04444g"
                     /product="KLTH0A04444p"
                     /transcript_id="XM_002551604.1"
                     /db_xref="GeneID:8290453"
     CDS             complement(371219..373240)
                     /locus_tag="KLTH0A04444g"
                     /note="similar to uniprot|P40522 Saccharomyces cerevisiae
                     YIL056W Hypothetical ORF and to uniprot|P40041
                     Saccharomyces cerevisiae YER064C Non-essential nuclear
                     protein; null mutation has global effects on
                     transcription"
                     /codon_start=1
                     /product="KLTH0A04444p"
                     /protein_id="XP_002551650.1"
                     /db_xref="GeneID:8290453"
                     /db_xref="InterPro:IPR007147"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ1"
                     /translation="MIKPPRVQKPSSSGTTHKIRKQLNFTDERRWKQFSSRRLELIEK
                     FGLGERKASEQDKSIRQIATILRTEFGYPLSSSSEFEKLVTAAVQSVRRNRKRSSKSK
                     PSNPQAQESVLEPFPVMTTTRESSGTDNLFFDRDGDQFARADRYTSGSNSSSSPPESS
                     LTSFISHNQTLPTLFSHSGQRSGPTKNASTLGAVPHALPHLQPKPLSSSNKPVGDCEN
                     PGSSIVTAHTQNYDEVIKAVIADMVQNRVALHVQSRNDEVTPNLADFALSSNDGNLLN
                     IAFQSHVAPSNPHTTAYPKARNPSGNDSNESKIPFFLREKILLHVQRSRACLEVSTAQ
                     GSLELYTNLSILGETSVKASVAFVMERFFSNLSSSSMEYVTSKLCSDQELALISVRIF
                     GPATERHFDQLPHGAQLKLFYIVIGGIIKDFGFDPCIYPLSEIMHDVILRQFPLGHHP
                     KGDFKRAAVMSTVSMAPAAANKDVYRVVLLKFKDKEQRFTFHLLSNGPPTIAEIIANS
                     RSLFHIVSQTKSLYLIHNNRVINDDMELARVFNRFTSEEIVIELRDVKPEPLDGLAML
                     STVSASEFSDPGSQKALPNRQNGASTTPTAYYPAASPLGPDCHSKESGDSENMPSTST
                     IQSDRDKVASEGSGAKEQAENEQKTGSEVGQNPETSASAPPRRRFQPLL"
     gene            complement(<374411..>376081)
                     /locus_tag="KLTH0A04466g"
                     /db_xref="GeneID:8290454"
     mRNA            complement(<374411..>376081)
                     /locus_tag="KLTH0A04466g"
                     /product="KLTH0A04466p"
                     /transcript_id="XM_002551605.1"
                     /db_xref="GeneID:8290454"
     CDS             complement(374411..376081)
                     /locus_tag="KLTH0A04466g"
                     /note="highly similar to uniprot|P28240 Saccharomyces
                     cerevisiae YER065C ICL1 Isocitrate lyase catalyzes the
                     formation of succinate and glyoxylate from isocitrate a
                     key reaction of the glyoxylate cycle expression of ICL1 is
                     induced by growth on ethanol and repressed by growth on
                     glucose"
                     /codon_start=1
                     /product="KLTH0A04466p"
                     /protein_id="XP_002551651.1"
                     /db_xref="GeneID:8290454"
                     /db_xref="GOA:C5DBQ2"
                     /db_xref="InterPro:IPR006254"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="InterPro:IPR018523"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ2"
                     /translation="MTVPTTQNLDSFESLQRQLEQQTAEIEKWWSQPRWKHTKRIYSA
                     REIAARRGTMPMAPHASSTMAQKLYKLLEEHHENRTVARTFGALDPVHVTQMAKYLDT
                     VYVSGWQCSSTASTSNEPGPDLADYPMDTVPNKVDHLFKAQLFHDRKQWEDRSRCKSQ
                     AELDKLGPATDYLRPIVADADAGHGGVTAVFKLTKMFIEKGAAGIHMEDQTSTNKKCG
                     HMAGRCVIPVQEHISRLVTIRMCADIMHSDLVLVARTDSEEATLLSSTIDPRDHYFIV
                     GATNPDVEVSLAETLEAAIMKGVSAADLVATEERWCAKAGLKLFHEAFADEVRKHETS
                     NQEQIIKEFNETVGPLAGFSLREMQAVAKKLLGKPLHFDWDLPRAREGLYRYRGGTQS
                     SIMRARAFAPYADLVWMECNSPDYEQAKAFAEGVKAKFPDQWLAYNLSPSFNWTKTMD
                     AKQLRTFIDRLGDLGYIWQFITLAGLHTSALAVNAFSKDFAERGMQSYAETVQQKEID
                     QGVDILKHQKWSGAEYIDSLLKLAHGGTSATAAMGLGVTEDQFHENGV"
     gene            complement(376580..376661)
                     /locus_tag="KLTH0A04488r"
                     /db_xref="GeneID:8290455"
     tRNA            complement(376580..376661)
                     /locus_tag="KLTH0A04488r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (TGA) cove score=84.16"
                     /db_xref="GeneID:8290455"
     gene            <376970..>377461
                     /locus_tag="KLTH0A04510g"
                     /db_xref="GeneID:8290456"
     mRNA            <376970..>377461
                     /locus_tag="KLTH0A04510g"
                     /product="KLTH0A04510p"
                     /transcript_id="XM_002551606.1"
                     /db_xref="GeneID:8290456"
     CDS             376970..377461
                     /locus_tag="KLTH0A04510g"
                     /note="similar to uniprot|P40188 Saccharomyces cerevisiae
                     YIL057C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A04510p"
                     /protein_id="XP_002551652.1"
                     /db_xref="GeneID:8290456"
                     /db_xref="GOA:C5DBQ3"
                     /db_xref="InterPro:IPR022554"
                     /translation="MTKKDKKPKISTIVTKEGDTVKVFEDLDTFETFIKNETEDEEFD
                     HVNCHLKYYPPFVLHESHEDPEKIKETVNSHNRKFVRHLHQHVEKHLLKDIRERLQLP
                     QLKFNDKSKEETPDHIVWRYNQRANFHERDFDIHVTVECHHDSALVDVDYLTVPVPAV
                     AAA"
     gene            <378016..>379851
                     /locus_tag="KLTH0A04532g"
                     /db_xref="GeneID:8290457"
     mRNA            <378016..>379851
                     /locus_tag="KLTH0A04532g"
                     /product="KLTH0A04532p"
                     /transcript_id="XM_002551607.1"
                     /db_xref="GeneID:8290457"
     CDS             378016..379851
                     /locus_tag="KLTH0A04532g"
                     /note="similar to uniprot|P34909 Saccharomyces cerevisiae
                     YER068W MOT2 Component of the CCR4-NOT transcription
                     regulatory complex which represses transcription at least
                     in part by inhibiting functional TBP-DNA interactions and
                     also aids in transcription elongation interacts with
                     C-terminal region of Not1p"
                     /codon_start=1
                     /product="KLTH0A04532p"
                     /protein_id="XP_002551653.1"
                     /db_xref="GeneID:8290457"
                     /db_xref="GOA:C5DBQ4"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR000571"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ4"
                     /translation="MNKTTTAANMHAIQNALANYDTSFLSDDEEDYCPLCIETLDITD
                     KNFKPCPCGYQICQFCYNNIRQNPELNGRCPACRRKYDDESVEYIVLTPEEMKLEQAK
                     QVRKEKERKLRDKERKENEFANRKHLAGMRVIQKNLVYVVGLNPPVPYEDVAALLKSD
                     RYFGQYGKINKIVVNKKTAHNDHHSGPASGSHGHHTGYGIYVTFAKKDDAARCIAAVD
                     GTYLDGRIVKAAYGTTKYCSSYLRGQSCPNPNCMFLHEPGEEADSFNRRELTNKQHDH
                     SAFKQLGGSSSSLPSNKAAASAIVPPSASPAPSPLPIKTHLNSSHNQEEISSSSSTSA
                     AHTPVLTPALVPSGSNPWGVNSAAAPSFSSAAAKTTTSSAFPTLGEATLAQSMAALST
                     KDSGAGTAHSSTKSNKKNLEKKYIDPYDPLSSAVRFIDDTIKFLSEYRNCHFKLRSNV
                     IDEETYKSYPSLFSFENVPVSKTSDNTLSRKLVDMLAIKPVDHSASVLPYLQATPQAD
                     PLVLHQLQQQQQQQQLLLAKQQQQLQQQVQTHQQTQQPTPPGMTPQLLHAQLQQQRAV
                     NTPPPPGIFSPSNPPTSANQVPVTGSNSSDLLNQLINGKRISTSS"
     gene            <380152..>380988
                     /locus_tag="KLTH0A04554g"
                     /db_xref="GeneID:8290458"
     mRNA            <380152..>380988
                     /locus_tag="KLTH0A04554g"
                     /product="KLTH0A04554p"
                     /transcript_id="XM_002551608.1"
                     /db_xref="GeneID:8290458"
     CDS             380152..380988
                     /locus_tag="KLTH0A04554g"
                     /note="weakly similar to uniprot|Q00916 Saccharomyces
                     cerevisiae YIL061C SNP1 U1snRNP 70K protein homolog"
                     /codon_start=1
                     /product="KLTH0A04554p"
                     /protein_id="XP_002551654.1"
                     /db_xref="GeneID:8290458"
                     /db_xref="GOA:C5DBQ5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR022023"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ5"
                     /translation="MIKFPQNVSKLFRPGPPLQYKKPVDYPVEERKTANKIQSLSGYL
                     GALDTYRSEHPEGSENGHLDAYNAAENARQVEAKALNAKLAIWNPDEDPNIADSDPYR
                     TIFVGRLPFAVTEVELQKEFVRFGEIEKVRVVRDKTSNKSRGYGFIMFKDEISARSAC
                     REIGVHRGVQIGGRPVIVDIERGRTVKYFTPRRLGGGLGGRGYMKRDKLAKLASAVAK
                     DEPKTTPRGPPPSSFPSGPRSRFNAYSGAPARAAPPPERAPAYRSRQNRTSRFQGFRP
                     DY"
     gene            <381267..>383840
                     /locus_tag="KLTH0A04576g"
                     /db_xref="GeneID:8290459"
     mRNA            <381267..>383840
                     /locus_tag="KLTH0A04576g"
                     /product="KLTH0A04576p"
                     /transcript_id="XM_002551609.1"
                     /db_xref="GeneID:8290459"
     CDS             381267..383840
                     /locus_tag="KLTH0A04576g"
                     /note="highly similar to uniprot|Q01217 Saccharomyces
                     cerevisiae YER069W ARG5 6 Bifunctional enzyme with
                     acetylglutamate kinase and
                     N-acetyl-gamma-glutamyl-phosphate reductase activities
                     catalyzes the second and third steps in the biosynthesis
                     of the arginine precursor ornithine forms a complex with
                     Arg2p"
                     /codon_start=1
                     /product="KLTH0A04576p"
                     /protein_id="XP_002551655.1"
                     /db_xref="GeneID:8290459"
                     /db_xref="GOA:C5DBQ6"
                     /db_xref="InterPro:IPR000534"
                     /db_xref="InterPro:IPR000706"
                     /db_xref="InterPro:IPR001048"
                     /db_xref="InterPro:IPR004662"
                     /db_xref="InterPro:IPR006855"
                     /db_xref="InterPro:IPR011241"
                     /db_xref="InterPro:IPR012280"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR023013"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ6"
                     /translation="MSARLLVSTKSLKSGRLQGLASLLSKVNCAHSVPYAQKRVGYSK
                     RHVASVSGVGTTGTRSTVVQLLNNIGSKREVEQYLKYFTSVSQQQFAVIKVGGAIISD
                     NLQELASCLAFLYHVGLYPIILHGTGPQVNGRLEAQGVEPDYIDGIRITDERTMSVVR
                     QCFLEQNLKLVTALEQLGVRARPITSGVFTAEYLDKDKYKLVGDITGVCKDPIEASIK
                     AGALPILTSLAETPSGQTLNVNADIAAGELARIFEPLKIVYLNEKGGIVNGETQEKVS
                     VINLDEEYDELMKQSWVKYGTKLKIKEIKELLDYLPRSSSVAIINVQDLQKELFTDSG
                     AGTMIRRGYKLVKRSSLSEFPTPDALREALQRDPDIASGAQSSATYLRDLQSSEFTTY
                     SDEPLEVLAIVKKDTLVPKLDKFLCSKVGWLNNVTDNVFSSLKRDFPALQWVVREDDE
                     NIGWHFSKCDGSYLKNGKVLFWYGVKDLNTASQLIKDFVGTASAAPTGSTSGVFASGQ
                     ATRAFSTARSYSTRSEPKTEGTNTKKGRVALIGARGYTGQNLISLLDNHPYLELAHVS
                     SRELNGTKLKGYNKAEITYENLQLEDLKRLESKGNVDMWVMALPNGVCKPFVEAIESV
                     KGKSKIIDLGADYRFVPETEWAYGLPELNNREKIAAAKKIANPGCYATGAQVAIAPLT
                     EFITGLPTVFGVSGYSGAGTKPSPKNDPAFLNNNLIPYALTNHIHEREISTRLGLEVA
                     FVPHVAQWFQGISHTISIPIKKGSLTSQDIRSMYEKFYENERLVNVAKDIPLMKSISG
                     THGVLVGGFKVNDAQDRVVVCAAIDNLLKGAATQCLQNINLALGYGEYDGIPQDKIAQ
                     D"
     gene            <384126..>384587
                     /locus_tag="KLTH0A04598g"
                     /db_xref="GeneID:8290460"
     mRNA            <384126..>384587
                     /locus_tag="KLTH0A04598g"
                     /product="KLTH0A04598p"
                     /transcript_id="XM_002551610.1"
                     /db_xref="GeneID:8290460"
     CDS             384126..384587
                     /locus_tag="KLTH0A04598g"
                     /note="highly similar to uniprot|P40518 Saccharomyces
                     cerevisiae YIL062C ARC15 Subunit of the ARP2/3 complex
                     which is required for the motility and integrity of
                     cortical actin patches"
                     /codon_start=1
                     /product="KLTH0A04598p"
                     /protein_id="XP_002551656.1"
                     /db_xref="GeneID:8290460"
                     /db_xref="GOA:C5DBQ7"
                     /db_xref="InterPro:IPR006789"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ7"
                     /translation="MEDWRRIDIDAFDPDSGRLTAEDLKPPYASSVSLQELEPKISQL
                     RSAATSGDFLNALQILTTDPPYSADETTKNQYFHAVLGVLTQVRQADITNLVKQLSPK
                     QTDVLVKYLYKGMSVPEGQKQGGMLLSWFEKVTQLSGVGPVVRYLSDRNTV"
     gene            <384810..>385973
                     /locus_tag="KLTH0A04620g"
                     /db_xref="GeneID:8290461"
     mRNA            <384810..>385973
                     /locus_tag="KLTH0A04620g"
                     /product="KLTH0A04620p"
                     /transcript_id="XM_002551611.1"
                     /db_xref="GeneID:8290461"
     CDS             384810..385973
                     /locus_tag="KLTH0A04620g"
                     /note="some similarities with uniprot|P40517 Saccharomyces
                     cerevisiae YIL063C YRB2 Ran-GTPase-binding protein
                     involved in nuclear export nuclear protein interacts with
                     Gsp1p and Crm1p"
                     /codon_start=1
                     /product="KLTH0A04620p"
                     /protein_id="XP_002551657.1"
                     /db_xref="GeneID:8290461"
                     /db_xref="GOA:C5DBQ8"
                     /db_xref="InterPro:IPR000156"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ8"
                     /translation="MSEASDSSNLNQKELIKDTEANTSEPIGIKRSRSQEANNAEEPA
                     KRLKSEESEESKENLNEHTAQEKKDDGKRSEPATSEKGPANESGSNNKEAKSDEGHKQ
                     SSSDDDKKPGPAKECEADKDKKDVQKTTKEGEDNATEESQKASPKPSAKPKFAFGASS
                     GFSAGFGLAKTPTPKSNTPESIISPKEGSSESKAPTKPTAFGSGFAFGAGFYALNKDK
                     KSGSKVFASEEEKAKSASPVPGNPNTDDTKENTSSTDSEGVVKLQKQDVKSGEESEES
                     IFQVNAKLYQLTSLKEGWKERGVGALHVNKNPHNGKARIVMRSRGILKVILNVLLVKG
                     VVIHKGFPASLQGEKFIRIVTVDHDKAPLQYAVRMGKAEAADELYETIKKLIP"
     gene            complement(<386066..>386755)
                     /locus_tag="KLTH0A04642g"
                     /db_xref="GeneID:8290462"
     mRNA            complement(<386066..>386755)
                     /locus_tag="KLTH0A04642g"
                     /product="KLTH0A04642p"
                     /transcript_id="XM_002551612.1"
                     /db_xref="GeneID:8290462"
     CDS             complement(386066..386755)
                     /locus_tag="KLTH0A04642g"
                     /note="similar to uniprot|P40516 Saccharomyces cerevisiae
                     YIL064W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0A04642p"
                     /protein_id="XP_002551658.1"
                     /db_xref="GeneID:8290462"
                     /db_xref="GOA:C5DBQ9"
                     /db_xref="InterPro:IPR025714"
                     /db_xref="InterPro:IPR026635"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DBQ9"
                     /translation="MEDTSKLNTSKLGTKEYWDDFYALENSNFKENPGDTGECWFADN
                     DAEEKMIEFLMDNLDQQNIHRDCSMIDLGTGNGHLLFQLHEEGFNGPMMGVDYSEKSV
                     QFAREISESQFPGYENIKFEAADIFDPNWECSAYDVVLDKGTLDAIALSGIKLDGDRS
                     VVDVYPKVVEKLLKKDSVFLITSCNFTQEELIRIVESDSLKVWKTIDYPVFEFGGVKG
                     TTICSIAFVKR"
     gene            <386899..>387363
                     /locus_tag="KLTH0A04664g"
                     /db_xref="GeneID:8290463"
     mRNA            <386899..>387363
                     /locus_tag="KLTH0A04664g"
                     /product="KLTH0A04664p"
                     /transcript_id="XM_002551613.1"
                     /db_xref="GeneID:8290463"
     CDS             386899..387363
                     /locus_tag="KLTH0A04664g"
                     /note="similar to uniprot|P40515 Saccharomyces cerevisiae
                     YIL065C FIS1 Mitochondrial outer membrane protein involved
                     in membrane fission required for localization of Dnm1p and
                     Mdv1p during mitochondrial division"
                     /codon_start=1
                     /product="KLTH0A04664p"
                     /protein_id="XP_002551659.1"
                     /db_xref="GeneID:8290463"
                     /db_xref="GOA:C5DBR0"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR016543"
                     /db_xref="InterPro:IPR028058"
                     /db_xref="InterPro:IPR028061"
                     /db_xref="UniProtKB/TrEMBL:C5DBR0"
                     /translation="MGKISFLPTLEDAYGSLSPDQLEILRQQVLSEGGELASIQSRFN
                     YAWGLIKSTEQDDQRLGVKLLTDIYKESSMRRRECLYYLTIGCYKLGEFSTAKRYSDA
                     LCSHEPDNKQARTLQSMVENKIQRESFKGIAIASGCVAVAATVAGMLFRKKR"
     gene            <388330..>390969
                     /locus_tag="KLTH0A04686g"
                     /db_xref="GeneID:8290464"
     mRNA            <388330..>390969
                     /locus_tag="KLTH0A04686g"
                     /product="KLTH0A04686p"
                     /transcript_id="XM_002551614.1"
                     /db_xref="GeneID:8290464"
     CDS             388330..390969
                     /locus_tag="KLTH0A04686g"
                     /note="highly similar to uniprot|P21524 Saccharomyces
                     cerevisiae YER070W RNR1 Ribonucleotide-diphosphate
                     reductase (RNR) and to YIL066C uniprot|P21672
                     Saccharomyces cerevisiae YIL066C RNR3 Ribonucleotide-
                     diphosphate reductase (RNR), large subunit; the RNR
                     complex catalyzes the rate-limiting step in dNTP synthesis
                     and is regulated by DNA replication and DNA damage
                     checkpoint pathways via localization of the small
                     subunits"
                     /codon_start=1
                     /product="KLTH0A04686p"
                     /protein_id="XP_002551660.1"
                     /db_xref="GeneID:8290464"
                     /db_xref="GOA:C5DBR1"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR005144"
                     /db_xref="InterPro:IPR008926"
                     /db_xref="InterPro:IPR013346"
                     /db_xref="InterPro:IPR013509"
                     /db_xref="UniProtKB/TrEMBL:C5DBR1"
                     /translation="MFVYKRDGRREPVKFDKITARVSRLCYGLDPNHVDAVKITQRII
                     SGVYEGVTTVELDNLAAETCAYMTTIHPDYATLAARIAISNLHKQTTKQFSQVVSDLF
                     HYVNPKNGIHSPMISQEVFDIIQKHKDELNSAIVYDRDFQYNYFGFKTLERSYLLRIN
                     GEVAERPQHLIMRVAVGIHGDNIPKVIETYNLMSLKYFTHASPTLFNAGTPHPQMSSC
                     FLVAMKDDSIEGIYDTLKECAMISKTAGGIGLHIHNIRSTGSYIAGTNGTSNGLIPMI
                     RVFNNTARYVDQGGNKRPGAFALYLEPWHSDIFDFVDIRKNHGKEEIRARDLFPALWV
                     PDLFMKRVQENGDWTLFSPSEAPGLSDVYGDEFEALYERYVQEGRGRKTIKAQKLWYA
                     ILEAQTETGTPFMLYKDACNRKSNQKNLGVIKSSNLCCEIVEYSAPDETAVCNLASLS
                     LPAFIETSEDGQTQWYNFDKLHEIAKVVTHNLNQVIDRNYYPVESARNSNMRHRPVAL
                     GVQGLADAFMILRIPFDSQEAKELNIQIFETIYHAALERSNELAVEHGPYETFEGSPA
                     SQGILQFDMWDKKPTDLWDWETLKAKIVKTGLRNSLLLAPMPTASTSQILGNNECFEP
                     YTSNMYSRRVLSGEFQIVNPYLLRDLVDLGIWNDAMKSHIISDNGSIQNLPNIPQKLK
                     DLYKTVWELSQKTIIEMAADRACYIDQSQSLNVHIRAPTMGKLTSMHFYGWKKGLKTG
                     MYYLRTQAASAAIQFTIDKSVASMAGDKEADLQNLHRPLYVPRKMNFSEGAAKDKGIE
                     ALRETRESSPSPSVDSSLANSVASLKIEEAKPVTPPATTTDVAAEAKSEATQPENEEF
                     DIYNSKVIACAIDNPGACEMCSG"
     gene            <391244..>393286
                     /locus_tag="KLTH0A04708g"
                     /db_xref="GeneID:8290465"
     mRNA            <391244..>393286
                     /locus_tag="KLTH0A04708g"
                     /product="KLTH0A04708p"
                     /transcript_id="XM_002551615.1"
                     /db_xref="GeneID:8290465"
     CDS             391244..393286
                     /locus_tag="KLTH0A04708g"
                     /note="similar to uniprot|P40514 Saccharomyces cerevisiae
                     YIL067C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A04708p"
                     /protein_id="XP_002551661.1"
                     /db_xref="GeneID:8290465"
                     /db_xref="InterPro:IPR004043"
                     /db_xref="UniProtKB/TrEMBL:C5DBR2"
                     /translation="MDRQGIGLTDSEEHTRQGNARECCPRDEILSSSGTAIDGSSADV
                     YEMHSMEDIDNQGHSKDSNEREEWVYLEDSNIVTRFFKRLWNGPRVAKDMRPTFPDRW
                     EFTRRIDSFPEAVFRKRFPRLSVRLCILVVYCCLWSAIIFAFMHYYFGSPPTYYRSNG
                     EKVPIKTISCSSTLFWKGKNNKCGLGAAACKPFDNEEVYVRCPALCDRGGWTYSAINV
                     GDRRVKHTGFEIGGGELHEGELLSYPYRADSFACGAAVHAGVVSPFVGGCARVSMEGA
                     QSSFESKKGRYGTDPSVKFDSFFPSSFSFRQLIEGYSSRCYDPRIPVLIINIVLGLPI
                     FYLYEGIYGYWIITIVGYWTLVLFLDPPIIVDPYSPETAFELLSVGFQRLLPLGFVLY
                     VLWKCSVKRTLTDGSPLVKVLCWFPTFWLGVMNVVTFDRLPVDRLIISDLKEQAGAMT
                     AVGSIITLIVVCAVIQAYSLWKSGRFRKYLVIYCLFISALATLGMLPGLSLRIHHYIL
                     GILLVPGCATRGASAYLFQGILIGLVLSGVSRWDFASIVETKVALLRGEAGGSWKPPT
                     MNYNEEHPTKISWQVENSTTQSFDVLDAYSLLINDIEQYVGQNTTIDLEKIIQEDGFL
                     SEYVNSTVSSKGSVKLYLRVARASLKAPRKSHGDYTNAAVLEWPQGIYHGPLPGVS"
     gene            <393425..>395821
                     /locus_tag="KLTH0A04730g"
                     /db_xref="GeneID:8290466"
     mRNA            <393425..>395821
                     /locus_tag="KLTH0A04730g"
                     /product="KLTH0A04730p"
                     /transcript_id="XM_002551616.1"
                     /db_xref="GeneID:8290466"
     CDS             393425..395821
                     /locus_tag="KLTH0A04730g"
                     /note="similar to uniprot|P32844 Saccharomyces cerevisiae
                     YIL068C SEC6 Essential 88kDa subunit of the exocyst
                     complex (Sec3p Sec5p Sec6p Sec8p Sec10p Sec15p Exo70p and
                     Exo84p) which has the essential function of mediating
                     polarized targeting of secretory vesicles to active sites
                     of exocytosis"
                     /codon_start=1
                     /product="KLTH0A04730p"
                     /protein_id="XP_002551662.1"
                     /db_xref="GeneID:8290466"
                     /db_xref="GOA:C5DBR3"
                     /db_xref="InterPro:IPR010326"
                     /db_xref="UniProtKB/TrEMBL:C5DBR3"
                     /translation="MADYALQRVSELIKDEPSIDRIRELVNQITKEKSTIDYQLNKDS
                     KKSLNDVTSSLDRMHLARKNVRMLKDRLREVSTLSQENQSSIERYEVINEATAIHELI
                     EKTTSMYNKIIGFNDLLTRLSEMMDNELAQDALQSGIPNLLQIHYLLTMARDFHDQSL
                     ILAQTSTEDVQRTMQRVFQRLPELIQKFDRLLESLIFDIVEAVRTENQSLLIRLFKII
                     DLEDREDIKIEATRRIIESKEREQDARKIRKLPSTYGITGSRDEAPVTQYPSPAALAQ
                     EITNGTIQTRLQPRGYKKFLFDKIKSSIQDVFQEVRREYSGEKRFEVLNNLDWVFNEL
                     LVVKDHVSNLCPAHWQLFDKFYELYYHELNKLITELVNAEPETLIILDILDFDKTFQS
                     TLRKDFGFSKDQAKSVIGEKEKETLLSDYLNLIVTKSNEWFGNLESAEMKIFVERTTP
                     PHTDSEGLLFLDGTKTCFQMFSQQVEVAAGSGQAKILVGVVDKLCELLAARQKNWMDI
                     ISVEVKKSVEYNHKVEEDPESVTPEEESSGGLVEYLIAVANDQMKAADYAVAISQKYG
                     SIVSKVHEKSITNNIERTLDGFAEVAKCSSTGLIKLMFDDLRKPYTQVFGKNWYTGNQ
                     AQQIADTLYEYLGDIRAQMNPFVYSTLAESVIEETILKFVECLKYEHSFKSKHNKFLE
                     CMKRDFEVFYKLFVQFVPEEEREIIDDKFKLMEFFMDFSCGPVNGIIEVWTQCLEMYW
                     DCPASFLSAILKCRKDVDSSTLKSTVATAQRIASSPQRANQLRAVDLQPTFISRFKIA
                     "
     gene            complement(<395850..>396281)
                     /locus_tag="KLTH0A04752g"
                     /db_xref="GeneID:8290467"
     mRNA            complement(<395850..>396281)
                     /locus_tag="KLTH0A04752g"
                     /product="KLTH0A04752p"
                     /transcript_id="XM_002551617.1"
                     /db_xref="GeneID:8290467"
     CDS             complement(395850..396281)
                     /locus_tag="KLTH0A04752g"
                     /note="weakly similar to uniprot|P40045 Saccharomyces
                     cerevisiae YER071C Protein of unknown"
                     /codon_start=1
                     /product="KLTH0A04752p"
                     /protein_id="XP_002551663.1"
                     /db_xref="GeneID:8290467"
                     /db_xref="GOA:C5DBR4"
                     /translation="MLTTCSLKPLIQQSQLSPEQLKESFLSSFMPALEVNSVPSSSEF
                     PVAPEKLASIIETSARDASSDDLGACTESILVELSKASSAHKFVVSLTKVAFSDSEDF
                     NLSIDSSIGGSWNKTKDGGYSHSVETEAGARLLATVVWVSK"
     gene            <397090..>397461
                     /locus_tag="KLTH0A04774g"
                     /db_xref="GeneID:8290468"
     mRNA            <397090..>397461
                     /locus_tag="KLTH0A04774g"
                     /product="KLTH0A04774p"
                     /transcript_id="XM_002551618.1"
                     /db_xref="GeneID:8290468"
     CDS             397090..397461
                     /locus_tag="KLTH0A04774g"
                     /note="highly similar to uniprot|P40046 Saccharomyces
                     cerevisiae YER072W VTC1 Protein involved in vacuolar
                     maintenance"
                     /codon_start=1
                     /product="KLTH0A04774p"
                     /protein_id="XP_002551664.1"
                     /db_xref="GeneID:8290468"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="UniProtKB/TrEMBL:C5DBR5"
                     /translation="MSSAPLLQKAPGKKIALPTRVEPKVFFANERTFLSWLNFTVMLG
                     GLGIGLLNFGDKVGRISAGLFTLVAMATMVYALVTYHWRASAIRRRGSGPYDDRLGPT
                     LLCFFLLIAVVVNFLLRMKYQ"
     gene            <398632..>400185
                     /locus_tag="KLTH0A04796g"
                     /db_xref="GeneID:8290469"
     mRNA            <398632..>400185
                     /locus_tag="KLTH0A04796g"
                     /product="KLTH0A04796p"
                     /transcript_id="XM_002551619.1"
                     /db_xref="GeneID:8290469"
     CDS             398632..400185
                     /locus_tag="KLTH0A04796g"
                     /note="highly similar to uniprot|P40047 Saccharomyces
                     cerevisiae YER073W ALD5 Mitochondrial aldehyde
                     dehydrogenase that is activated by K and utilizes NADP as
                     the preferred coenzyme"
                     /codon_start=1
                     /product="KLTH0A04796p"
                     /protein_id="XP_002551665.1"
                     /db_xref="GeneID:8290469"
                     /db_xref="GOA:C5DBR6"
                     /db_xref="InterPro:IPR015590"
                     /db_xref="InterPro:IPR016160"
                     /db_xref="InterPro:IPR016161"
                     /db_xref="InterPro:IPR016162"
                     /db_xref="InterPro:IPR016163"
                     /db_xref="InterPro:IPR029510"
                     /db_xref="UniProtKB/TrEMBL:C5DBR6"
                     /translation="MLVSRTFSRSVASRLVLRSYSQLPLRVPITLPSGVTYDQPTGLF
                     INGEFVPSRQHKTFEVLNPSTEQEIAHVYEAREDDVDVAVAAAKAAFENKWGTADPEF
                     RSRCLYKLADLVDKHAEVLAGIESLDNGKSLLCSRGDVDLVAKYLRSCAGWADKIFGR
                     TIDTGSTHFSYTRREPLGVCAQIIPWNFPLLMWSWKLGPALATGNTVVLKPAEATPLS
                     ALYACQLVQEAGIPAGVVNILPGFGKLLGDRLCTHKDVKKIAFTGSTATGRHIMRSAA
                     NTIKKVTLELGGKSPNIVFGDADLDKAVRTIAFGIFYNSGEVCCAGSRVYVQDTVYEE
                     VLEKFKNYAESLKVGDPFQEGVFQGAQTSQMQIDKILDYVQIGTGEGARVVAGGERLG
                     DKGYFIKPTIFADVTEDMRIVKEEIFGPVVTVSKFSTVDEVIEMANDSEYGLAAGIHT
                     KDINKAMDVSNRVKAGTVWINTYNSFHQSVPFGGFGQSGIGREMGAEALDNYTQVKAV
                     RMAIDPAER"
     gene            <400870..>401682
                     /locus_tag="KLTH0A04818g"
                     /db_xref="GeneID:8290470"
     mRNA            join(<400870..400872,401278..>401682)
                     /locus_tag="KLTH0A04818g"
                     /product="40S ribosomal protein S24"
                     /transcript_id="XM_002551620.1"
                     /db_xref="GeneID:8290470"
     CDS             join(400870..400872,401278..401682)
                     /locus_tag="KLTH0A04818g"
                     /note="highly similar to uniprot|P26782 Saccharomyces
                     cerevisiae YIL069C RPS24B and highly similar to
                     uniprot|P26782 Saccharomyces cerevisiae YER074W RPS24A
                     proteins component of the small (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S24"
                     /protein_id="XP_002551666.1"
                     /db_xref="GeneID:8290470"
                     /db_xref="GOA:C5DBR7"
                     /db_xref="InterPro:IPR001976"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR012678"
                     /db_xref="InterPro:IPR018098"
                     /db_xref="UniProtKB/TrEMBL:C5DBR7"
                     /translation="MSDAITIRTRKVITNPLLARKQFVVDVLHPNRANVAKDELREKL
                     AEAYKAEKDAVSVFGFRTQFGGGKSVGFGLIYNSVADAKKFEPTYRLVRYGLAEKVEK
                     ASRQQRKQKKNRDKKVFGTGKRLAKKVARRNAD"
     gene            <402770..>403160
                     /locus_tag="KLTH0A04840g"
                     /db_xref="GeneID:8290471"
     mRNA            join(<402770..402860,402930..403037,403105..>403160)
                     /locus_tag="KLTH0A04840g"
                     /product="KLTH0A04840p"
                     /transcript_id="XM_002551621.1"
                     /db_xref="GeneID:8290471"
     CDS             join(402770..402860,402930..403037,403105..403160)
                     /locus_tag="KLTH0A04840g"
                     /note="highly similar to uniprot|Q3E834 Saccharomyces
                     cerevisiae YER074W-A YOS1 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A04840p"
                     /protein_id="XP_002551667.1"
                     /db_xref="GeneID:8290471"
                     /db_xref="InterPro:IPR013880"
                     /db_xref="UniProtKB/TrEMBL:C5DBR8"
                     /translation="MIFGLGRLFYVILLLINAVAVLSEERFLSRIGLGSSASQAPAFG
                     QQENSTRSKVVQLIGAIQTLLRIPLIGINILVIVYELLLG"
     gene            complement(<403388..>406003)
                     /locus_tag="KLTH0A04862g"
                     /db_xref="GeneID:8290472"
     mRNA            complement(<403388..>406003)
                     /locus_tag="KLTH0A04862g"
                     /product="KLTH0A04862p"
                     /transcript_id="XM_002551622.1"
                     /db_xref="GeneID:8290472"
     CDS             complement(403388..406003)
                     /locus_tag="KLTH0A04862g"
                     /note="some similarities with uniprot|P40048 Saccharomyces
                     cerevisiae YER075C PTP3 Phosphotyrosine-specific protein
                     phosphatase involved in the inactivation of
                     mitogen-activated protein kinase (MAPK) during osmolarity
                     sensing dephosporylates Hog1p MAPK and regulates its
                     localization localized to the cytoplasm"
                     /codon_start=1
                     /product="KLTH0A04862p"
                     /protein_id="XP_002551668.1"
                     /db_xref="GeneID:8290472"
                     /db_xref="GOA:C5DBR9"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DBR9"
                     /translation="MESRWSSDQAELEAGCAAVSDASSVVSSSSTLVGEPGSKVAAFP
                     PARPHRRAISALAIGRTMPGPAGALGPVGAIGSARPVGSPSSVNSAGSAGSQSPQTLP
                     FLMRSNSNPSLPSFKAKEMRLPLPEGAQSMAAVELVSLLDSEPAEKLLVLDVRPFVDF
                     CRATIQNALHVCLPSTLLRRKTFTLERLVDNLPEDVRQIVKPRVMDPEDCSDLKIVIF
                     DNTAQQIDSGFSVGCHGMASKFVQSPKWATVEARPSVYILESGFAGFKEFAPDCVKAP
                     VVTLSSPINSNSSPTDLSGAPNMMPKPKFSNHSVANGSPSSIPESPLSSSSPVSGLLK
                     FQLPASNGLPPPFKIARNEEVLNLESYLSAVDLGEKQRSLGGSISSLENLDLSSPPSN
                     TAFKFPTDPSSINQINLASGNGIVHADKLNFQKSFIQLHILYDRNMINSVVPRWFQDL
                     AHEPKLEMISQFQKIDLLEKKRLSHCLSNACQPSRAQTASYAAANSCDTADLEHSNGF
                     CPSRWLDEYDSDEEDQNICVSSGVELGTKNRYKDIFPYEHTRVVLKKTMPVYQHHYAN
                     EIFDTYINANYLTNPFVRLQTPPESDCLNVRYIATQAPLEATIHDFYTCILNNNVPLV
                     LSLTDEFENGVEKCYKFWAEGNYDGIRIKLLQEHDLELPDVGPGVGPVTLRRIQIIYN
                     ENQTFETLQIQIKDWPDLGVMVNPRQILEMICLKNIVICQMFERRAYSHDHFPTILVH
                     CSAGCGRTGTLCTLDTVLSNMSKFDSLKEEWIGRRDATEYNPWSPRSAACLNSKLFDP
                     VIITINKFRKQRISMVQNVNQYLFIYDCLLSFFDMRLKEKAFLAHTSNPFRKTGKGLE
                     IIESFLGSKTREAGL"
     gene            <406887..>407675
                     /locus_tag="KLTH0A04884g"
                     /db_xref="GeneID:8290473"
     mRNA            <406887..>407675
                     /locus_tag="KLTH0A04884g"
                     /product="KLTH0A04884p"
                     /transcript_id="XM_002551623.1"
                     /db_xref="GeneID:8290473"
     CDS             406887..407675
                     /locus_tag="KLTH0A04884g"
                     /note="similar to uniprot|P40513 Saccharomyces cerevisiae
                     YIL070C MAM33 Acidic protein of the mitochondrial matrix
                     involved in oxidative phosphorylation related to the human
                     complement receptor gC1q-R"
                     /codon_start=1
                     /product="KLTH0A04884p"
                     /protein_id="XP_002551669.1"
                     /db_xref="GeneID:8290473"
                     /db_xref="GOA:C5DBS0"
                     /db_xref="InterPro:IPR003428"
                     /db_xref="UniProtKB/TrEMBL:C5DBS0"
                     /translation="MFSRVLVRSAAVAARSARTARCAPMLRSVNLQAASLRPLHFSAV
                     RLNKQCQKVAQVLESEVALEVEEDVQDLPESLQSFFDKTGFSAVASPGKNMAEITSKT
                     ARGETVHVFFDVAQVSNLPLESAELDGEAAAPSEEEEFDGMADNFANVNVVVVKDSDQ
                     SAVSFELLMNLQEGTFFVDSATPYSSAKAALDETAESEVSRELVYHGPPFSNLDEELQ
                     ESLEAYLESRGINEELATFIGTYSEFKENKEYINWLKNMKTFFN"
     gene            complement(<407728..>409641)
                     /locus_tag="KLTH0A04906g"
                     /db_xref="GeneID:8290474"
     mRNA            complement(<407728..>409641)
                     /locus_tag="KLTH0A04906g"
                     /product="KLTH0A04906p"
                     /transcript_id="XM_002551624.1"
                     /db_xref="GeneID:8290474"
     CDS             complement(407728..409641)
                     /locus_tag="KLTH0A04906g"
                     /note="similar to uniprot|P40050 Saccharomyces cerevisiae
                     YER077C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A04906p"
                     /protein_id="XP_002551670.1"
                     /db_xref="GeneID:8290474"
                     /db_xref="InterPro:IPR002885"
                     /db_xref="UniProtKB/TrEMBL:C5DBS1"
                     /translation="MVRKATIVNLTTFLRGLHVQVPNCASQLRDRITHFERNHEVLRK
                     SRSQLKRIEERRRLDLKNLNKTPYSQQHARHVLKRKYEVPSEDLDSTKLGPTSESDLR
                     FLKLTHDKRLLYTILGVTGEQLRDSKLIAADVSKFLSRNQLEKAVFLARLAKSRGVVG
                     MNKVIEHFCQVKQDAGSAIDMYNWRKKWDIPPNEFTHTILFDGLANVKQPLSEKQSQR
                     VLKIAKLLLEREEMNIAGFNASLSALANSVNVEYAFELFDARKKQISPDAITYTILLR
                     ALSLTQDDKLCMARLDAVMASVPRKFLDGRVVYEYCHVLHNRKDSMLSKMAIKALANF
                     FDINIPLEKISFPAGVNLPSLQFWDVKQRFDSNKFVADLFFQNCERNKLYELAWETYK
                     AWNSENPRLLELPVHERMIRIVTAAFPTKCAEMATEVFKNVNLRHRSGKNGMLLVYRA
                     FERQAGKKFINDSESNVDKLLTQLFDFSIELEGKHWKELGTRVLNWKAWMFCWNVVNK
                     ANERRKISNERAKWILDQYLRTILTGQTNRAGIQHEDHAGLRHVGLESVRFLSSFADH
                     FKIKGESELNDFVSEHDRQFFLYRRLLLRFKDRILEQVKILEGRPGSAESVEESIKQT
                     AEKLLATKLPDQA"
     gene            <409825..>411081
                     /locus_tag="KLTH0A04928g"
                     /db_xref="GeneID:8290475"
     mRNA            <409825..>411081
                     /locus_tag="KLTH0A04928g"
                     /product="KLTH0A04928p"
                     /transcript_id="XM_002551625.1"
                     /db_xref="GeneID:8290475"
     CDS             409825..411081
                     /locus_tag="KLTH0A04928g"
                     /note="similar to uniprot|P40512 Saccharomyces cerevisiae
                     YIL071C PCI8 Possible shared subunit of Cop9 signalosome
                     (CSN) and eIF3 binds eIF3b subunit Prt1p has possible dual
                     functions in transcriptional and translational control
                     contains a PCI (Proteasome-COP9 signalosome (CSN)-eIF3)
                     domain"
                     /codon_start=1
                     /product="KLTH0A04928p"
                     /protein_id="XP_002551671.1"
                     /db_xref="GeneID:8290475"
                     /db_xref="UniProtKB/TrEMBL:C5DBS2"
                     /translation="MDLLNGFYGPVLVERAAFAAQDEFLSPEIKSVWCSAAFEYLGLL
                     QFNGSPHIGTISKFVEGNQGNLIPNASTAKVQVNYNVCRKVVAHEFSDAIALQEADSN
                     VPFLEKLYGIVRLLILGEKWKSLDEIDHRLDAYLKSKEGCLSEAEKHLTLAVRLLICG
                     ALYLQGRYFDCIKYFVTAIQKDGAIFDMLLLSDSEAFFTTEEIITMITLSVIVSVPLD
                     NYEEFAQLEELKPLFVIAPTLSSCLSLLIDTSYNSFLKLWNESFDQKCSSSYFLCGRW
                     KEVQATMRYKIYFFYLRISNRVEIRYLSETLGIDFETVRTEINSLIDDLTLNFSINDQ
                     LIYYRNRYEMSDIVKNLSSSKTILDERIEKLKNQNDLVRYQVQQSIIENNARLREQNR
                     DLDACNDESNENLQNFVSNSEPDLGD"
     gene            complement(<411162..>412727)
                     /locus_tag="KLTH0A04950g"
                     /db_xref="GeneID:8290476"
     mRNA            complement(<411162..>412727)
                     /locus_tag="KLTH0A04950g"
                     /product="KLTH0A04950p"
                     /transcript_id="XM_002551626.1"
                     /db_xref="GeneID:8290476"
     CDS             complement(411162..412727)
                     /locus_tag="KLTH0A04950g"
                     /note="similar to uniprot|P40051 Saccharomyces cerevisiae
                     YER078C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A04950p"
                     /protein_id="XP_002551672.1"
                     /db_xref="GeneID:8290476"
                     /db_xref="GOA:C5DBS3"
                     /db_xref="InterPro:IPR000994"
                     /db_xref="InterPro:IPR001131"
                     /db_xref="InterPro:IPR007865"
                     /db_xref="InterPro:IPR028980"
                     /db_xref="InterPro:IPR029149"
                     /db_xref="UniProtKB/TrEMBL:C5DBS3"
                     /translation="MFRASKLSSFQVLFIAKVPRRYISGSKPFSNNARYLNRQCPQFS
                     AGQPLFETRPNLLKPGEITPGITALEYFERRVKLATRLPAKSCAIIAGSQVKYASGPV
                     FYPFQQNNDLFYLTGWNEPDSVMILEKPTDDIDDVLFHLIVPPKDAFSEQWEGERTGT
                     EGACEVFNADESTDTRQLSIYISRIIKRNEFIYFDRPQDKIDSSAEAFFRSFFSVSHS
                     PVASDTITSVIKSSGKKHVRKLKRIIADMRSIKSPAEIRVMRRAGQISGRAYNQAYAQ
                     RFRNERTLHSFLDYKFVSGGCDKSAYIPVVAAGANSLCIHYTRNDDVMYNDEMVLVDA
                     AGSLGGYCSDISRTWPVSGKFSPAQRDLYEAVLSVQRRCIDLCKASNLYSLNDIHEKS
                     VSFFKEELANVGLSNLQNSSIAKIYPHYIGHNLGLDVHDVPEVSRHEPLQAGQVITIE
                     PGIYFPDDPSYPAYFKNIGIRIEDDIAIGLDSHINLTAEAAKEVVDIESIAQNGVTTK
                     IEEDVVAPLKYVD"
     gene            complement(<412916..>414785)
                     /locus_tag="KLTH0A04972g"
                     /db_xref="GeneID:8290477"
     mRNA            complement(join(<412916..414017,414073..>414785))
                     /locus_tag="KLTH0A04972g"
                     /product="KLTH0A04972p"
                     /transcript_id="XM_002551627.1"
                     /db_xref="GeneID:8290477"
     CDS             complement(join(412916..414017,414073..414785))
                     /locus_tag="KLTH0A04972g"
                     /note="similar to uniprot|P20050 Saccharomyces cerevisiae
                     YIL072W HOP1 Meiosis-specific DNA binding protein that
                     displays Red1p dependent localization to the unsynapsed
                     axial-lateral elements of the synaptonemal complex
                     required for homologous chromosome synapsis and chiasma
                     formation"
                     /codon_start=1
                     /product="KLTH0A04972p"
                     /protein_id="XP_002551673.1"
                     /db_xref="GeneID:8290477"
                     /db_xref="InterPro:IPR003511"
                     /db_xref="UniProtKB/TrEMBL:C5DBS4"
                     /translation="MSTAQQTKPKTVVSTTTGITCEQSQKLVQTMLTMSFGCLSFLRG
                     LFPDDNFIDQRFVPEKVIKNYNKDRNEAPANSIKIKTLVRGKTPEADLFLDWLEKGVF
                     QSIKVKYLKALSLGVFTHEEAPSDLLENYLFSFSYGDDGQVSMGVNGEEGEVSLLDSR
                     RVVQQLMRRFIIITQSLEPLPEKRFLTMRLLFNENAPPEYQPQYFRDATYDKPSIIKI
                     PKSADLDTYSVGSIDTKFHEVSLKVLSVVESTNDASPVPTRDIDPFSLVEPVDAIEET
                     NLSFSQVAFETPRRPLSQTTKYLKNYLTAPSAEVANTQHLNEHDTYDCQCAIPCPQST
                     SKSICCTQCKRKVHRICYGNYRRTSINKCISCLMKGKSFNCRTWSFKTFMMLRRIYRF
                     MIKKPDFPSTLSEFYEILAGTDTDPEIKRCINVSISILFYDEVFVLEKERRPQTSSKN
                     QFLKSSNYITIDQSGIVVKNLGELPLNTKPVWSFIFNSAKAQAAYTTALFETPEQVSA
                     SLESISAAIKKVEQLSRTHQCTNERAIGSSFDFNSLRIDDDTQDSLGPLKRKHPNLRD
                     FLDNGKNSQLDDTLDMHSYKPQKIRKISASKKTLKSVW"
     gene            <416070..>416657
                     /locus_tag="KLTH0A04994g"
                     /db_xref="GeneID:8290478"
     mRNA            <416070..>416657
                     /locus_tag="KLTH0A04994g"
                     /product="KLTH0A04994p"
                     /transcript_id="XM_002551628.1"
                     /db_xref="GeneID:8290478"
     CDS             416070..416657
                     /locus_tag="KLTH0A04994g"
                     /note="some similarities with uniprot|P40052 Saccharomyces
                     cerevisiae YER079W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A04994p"
                     /protein_id="XP_002551674.1"
                     /db_xref="GeneID:8290478"
                     /db_xref="UniProtKB/TrEMBL:C5DBS5"
                     /translation="MEDSSIFSQSSKDVSSAISLYNMPTGEDASIRGLLDYDPSEEAQ
                     SSGISRPLSRSSVTSSLSMVATKDGVEGRRVHRYGIPQYSLNLLDAMSQPPPLKGKVH
                     TRQNAQSHHLSPQENKEDSETQLYQDLMHSPPITLKEKMQLFRDNSESSHLDYSEESY
                     QEGSTSLSGKDQLHSLHSYKKDIASERDDSDDYSQ"
     gene            <417016..>418875
                     /locus_tag="KLTH0A05016g"
                     /db_xref="GeneID:8290479"
     mRNA            <417016..>418875
                     /locus_tag="KLTH0A05016g"
                     /product="KLTH0A05016p"
                     /transcript_id="XM_002551629.1"
                     /db_xref="GeneID:8290479"
     CDS             417016..418875
                     /locus_tag="KLTH0A05016g"
                     /note="similar to uniprot|P40053 Saccharomyces cerevisiae
                     YER080W FMP29 The authentic non-tagged protein was
                     localized to the mitochondria"
                     /codon_start=1
                     /product="KLTH0A05016p"
                     /protein_id="XP_002551675.1"
                     /db_xref="GeneID:8290479"
                     /db_xref="GOA:C5DBS6"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR011009"
                     /translation="MLRYNLRIPVQAKKAMGSLAPLRPMKSRFGLRCISDKPNEVFTK
                     LSDDNDPQRDAFFKYSWGSWLANDRQEKEKRTTKFSIEGLTDVINDLHAQSKEKAKSE
                     ASEGNIPPPSYNPNLTVSLSHNLSALTLGSLNPNETLRVTAMASIHEGKHHRIYKVDT
                     NADKSFILRIPYATNSEAAISYRLKSEVATMDFADLKLGLKVPKVYCFGANALNPIRQ
                     PFILEEHIEGRLLMRDWNPLEDDASDKKAHISKLNKVIDPLSQFQSKLLSVEFNQFGS
                     LYFAKDYPDSEGPAYEGEKNESLKNRWSVGPSVERCFWRQKSALPLDKLMQFVGPWSK
                     SKPMDIVKSLGLLEAENAKSRLALQQTDASPAPIEESILREQVRTFENLAEISSSLFN
                     TKSHVIPNIDSLLKPRLYHPDLDPMNVLLDEKDNSAPYLLDFENTSIKPFILQNSPQF
                     VAYDGPKIYNLEEDVEGYKDLSEAEKVQYQFMYKRTRNQHLWESALNKNFNKLISAVA
                     PPVKLLRSPYVACVERKNDMEYLLVDESLIQLREVWEVFAKNKLVSEKKFPLEYTEEQ
                     LQKHSTDLNAFHEQLIKSPFAATQGWIPQDMFENLVKAGILIKDKNGDYTIKQ"
     gene            <419566..>420978
                     /locus_tag="KLTH0A05038g"
                     /db_xref="GeneID:8290480"
     mRNA            <419566..>420978
                     /locus_tag="KLTH0A05038g"
                     /product="KLTH0A05038p"
                     /transcript_id="XM_002551630.1"
                     /db_xref="GeneID:8290480"
     CDS             419566..420978
                     /locus_tag="KLTH0A05038g"
                     /note="highly similar to uniprot|P40510 and to YER081W
                     uniprot|P40054 Saccharomyces cerevisiae SER3
                     3-phosphoglycerate dehydrogenase, catalyze the first step
                     in serine and glycine biosynthesis; isozyme of Ser33p"
                     /codon_start=1
                     /product="KLTH0A05038p"
                     /protein_id="XP_002551676.1"
                     /db_xref="GeneID:8290480"
                     /db_xref="GOA:C5DBS7"
                     /db_xref="InterPro:IPR002912"
                     /db_xref="InterPro:IPR006139"
                     /db_xref="InterPro:IPR006140"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR029015"
                     /db_xref="InterPro:IPR029752"
                     /db_xref="InterPro:IPR029753"
                     /db_xref="UniProtKB/TrEMBL:C5DBS7"
                     /translation="MASPQQINNLQNSFQSAVNLGGSPGIVSTSPTQSFMSSVPRRVS
                     ASRQTKALKPFSTGDIKILLLENVNQTAVEIFNGQGYQVEFHKSSLSEDELIEKIRDV
                     HAVGIRSKTRLTEKVLKHAKNLVVIGCFCIGTNQVDLDYAAKIGVAVFNSPFSNSRSV
                     AELIMAEVISLARQLGDRSIEMHTGTWNKVASKCWEVRGKTLGIIGYGHIGSQLSVLA
                     EAFGMQVLYYDIVTIMALGTAKQVSTLDKLLSESDFVTCHVPATEDTKNLLSAPQFAA
                     MKDGSYVLNASRGTVIDIPSLIQAIKAGKIAGTALDVYPHEPAKNGAGAFNDELNSWI
                     SELVSLPNVILTPHIGGSTEEAQSAIGIEVATNLSKYINEGASVGSVNFPEVSLRGLD
                     LDQENVVRVLYIHHNVPGVLKTVNNILSNHNIEKQFSDSSGDIAYLMADISSVNQSDI
                     KDIYDQLNATEYKISIRLLY"
     gene            <421308..>424139
                     /locus_tag="KLTH0A05060g"
                     /db_xref="GeneID:8290481"
     mRNA            <421308..>424139
                     /locus_tag="KLTH0A05060g"
                     /product="KLTH0A05060p"
                     /transcript_id="XM_002551631.1"
                     /db_xref="GeneID:8290481"
     CDS             421308..424139
                     /locus_tag="KLTH0A05060g"
                     /note="highly similar to uniprot|P32565 Saccharomyces
                     cerevisiae YIL075C RPN2 Subunit of the 26S proteasome
                     substrate of the N-acetyltransferase Nat1p"
                     /codon_start=1
                     /product="KLTH0A05060p"
                     /protein_id="XP_002551677.1"
                     /db_xref="GeneID:8290481"
                     /db_xref="GOA:C5DBS8"
                     /db_xref="InterPro:IPR002015"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016642"
                     /db_xref="UniProtKB/TrEMBL:C5DBS8"
                     /translation="MSVVTAAPLLALLNENDNVAKSYALEAINEVVDQLWSEISNEIT
                     QIEALYDDNSFQDRKLAALVASKVYYNLGEYESAVKFALAADNYFNLDEKSQFVETIV
                     SQSIDMYIKSSAKNYESSGSEVKIDPQLSSVFERMLEKCVECGDFKLALGIALESYRL
                     DVVERILKARVEQDSDANALKLITYVLTAASTTVTSTPFRTSILHSLFNILMSTKSPE
                     YFTVSKIIVNLNDLNLALGLFKKLAQEEAAEISYQIAYDLVSSATQGLLEGLHSSLAA
                     EGADEKLLDILSGIPTCDYNNTFLFRNKNIDMGLLNKSKSSMDGKFSLFHTAVSVANG
                     FMHAGTTDDSFIRSNLPWLGKAQNWAKFTATASLGVIHKGNLSDGKKIMEPYLPGSRA
                     ASRYIKGGSLYGLGLIYAGYGREIIDYMKSHVIENSSSVGDEDVDVLLHGASLGIGLA
                     GMGSANSELYEALKEVLYNDSANSGEASALGMGLIMLGSGDENAVQDMFTYAQETQHG
                     NITRGLAVGLAVINYGRKELADSLIEKMLLHENALLRYGGAYTIALAYAGTGDNKAIK
                     KLLHIAVSDSDDDVRRAAVIALGFVLIRDYTTVPRIVELLAESHNAHVRCGTAFALGI
                     SCVGRGLQAAVDVLMPLTKDPVDFVRQAAMIALSLILMQQTEKTNSKVKDINDLFLNV
                     VSNKHQEGLAKFGACVAQGIMNAGGRNVTIQLENVDMGTLDTKAVIGLAMFSQFWYWF
                     PLAHFLSLSFTPTSIIAVRGQDLSIPAFKFNCHTRPDVFEYPPMYEENTDKNVEKVAT
                     AVLSTTAKAKARAKKTKKDGKDTVEEKPRRESKSELKPETKEEEKKLEPDQKDDAPFK
                     IKYTNKPYQIENASRVVPQQLKYIAFSKEDRFVPVRKFKGSNGVIVVFDKTPDEPAEL
                     IKTTKQKKDVDAPLPTPFKVEDELEFSKL"
     gene            complement(<424327..>425985)
                     /locus_tag="KLTH0A05082g"
                     /db_xref="GeneID:8290482"
     mRNA            complement(<424327..>425985)
                     /locus_tag="KLTH0A05082g"
                     /product="KLTH0A05082p"
                     /transcript_id="XM_002551632.1"
                     /db_xref="GeneID:8290482"
     CDS             complement(424327..425985)
                     /locus_tag="KLTH0A05082g"
                     /note="highly similar to uniprot|P40055 Saccharomyces
                     cerevisiae YER082C"
                     /codon_start=1
                     /product="KLTH0A05082p"
                     /protein_id="XP_002551678.1"
                     /db_xref="GeneID:8290482"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012952"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="UniProtKB/TrEMBL:C5DBS9"
                     /translation="MAKSSKPATGSHGVRDNAGKFDRDASVSKRTNGYKTKDKKLRAG
                     LKRIDDQYKDAVSSAAATEYLLPESSGFLEAEDEMEKTFRVKQDEIKSAVDVTTANKA
                     LDLKLTNFGPYSVNYSRNGTHLLVCGKKGHVASMDWRKGELRAELNLNETCQSAIYLQ
                     NEQYFAVAQKKYTFVYDHEGVELHRLKQHIEVKHMEFLPYHYLLATAGQTGWLKYQDV
                     TTGQLQAELRTKLGPTSAMAQNPWNAIIHLGHSNGTVTLWAPNMPTPLARLLSARGPI
                     TSIAIDRQGYYMATTGADKSLKLWDIRNFRELHTIENLPTPGSNLAISDTGLLALSRG
                     PHVTLWKDAFRSNKSSRPCFGSSGLPDRNTPYMSSMFPGNKVNNMQFVPFEDLLGVGH
                     GTGVRNLIIPGAGEANYDALEVNPFETAKQRQEQEVRTLLNKLPADSIALDPTVIGTV
                     DKRASATRLNAKDLAEITNAKALESKTNKDIPQVMPSVKGKNSGLRSFLRKKTQNVID
                     ERKLRVNAQLEKEKAARQRKEMVKRGEIEEGHQDLVNEALSRFG"
     gene            <426808..>428127
                     /locus_tag="KLTH0A05104g"
                     /db_xref="GeneID:8290483"
     mRNA            <426808..>428127
                     /locus_tag="KLTH0A05104g"
                     /product="KLTH0A05104p"
                     /transcript_id="XM_002551633.1"
                     /db_xref="GeneID:8290483"
     CDS             426808..428127
                     /locus_tag="KLTH0A05104g"
                     /note="weakly similar to uniprot|P28272 Saccharomyces
                     cerevisiae YKL216W URA1 The enzyme catalyzes the
                     conversion of dihydroorotic acid to orotic acid"
                     /codon_start=1
                     /product="KLTH0A05104p"
                     /protein_id="XP_002551679.1"
                     /db_xref="GeneID:8290483"
                     /db_xref="GOA:C5DBT0"
                     /db_xref="InterPro:IPR001295"
                     /db_xref="InterPro:IPR005719"
                     /db_xref="InterPro:IPR012135"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="UniProtKB/TrEMBL:C5DBT0"
                     /translation="MFVRPTLRGLSKTPNYFLKNSKLPLKSGFNGGKFILYTAGAIGG
                     GFAGLYLLNSRSAIHEYLFCPLIRLVTPDAETGHQLGVFFLKWGLAPKLLFDKDDEVL
                     KVNVFGTILTNPVGCAAGLDKDGEAIDGILQSGFSYHEIGSITPLPQPGNPRSRFFRL
                     PQDEAVINRYGFNSTGKDSVQGTLVERASKYVKSYFKDADVGKMSLYKNKLLAINLGK
                     NKNGDEVQDYLKGVETFQSLADVLVINVSSPNTPGLRDLQNESKLADLLQKVVDKRNS
                     LVDAGNQLGAKAHKPPVLVKIAPDLTEPELLSIAEAAKKSKVDGIIVSNTTIQRPNSL
                     ITQDPEVKFQTGGLSGKPLKQYSLKALRTIYKYTKDSDLVLIGCGGISSAQDALEYAR
                     AGATFVQLYTSFAYKGPGVVSKIKDGLTEELKREGKTWMQIIGEDSK"
     gene            complement(<428186..>429157)
                     /locus_tag="KLTH0A05126g"
                     /db_xref="GeneID:8290484"
     mRNA            complement(<428186..>429157)
                     /locus_tag="KLTH0A05126g"
                     /product="KLTH0A05126p"
                     /transcript_id="XM_002551634.1"
                     /db_xref="GeneID:8290484"
     CDS             complement(428186..429157)
                     /locus_tag="KLTH0A05126g"
                     /note="similar to uniprot|P40056 Saccharomyces cerevisiae
                     YER083C RMD7 Required for Meiotic nuclear Division
                     functions in DNA replication and damage response Protein
                     involved in cell wall function"
                     /codon_start=1
                     /product="KLTH0A05126p"
                     /protein_id="XP_002551680.1"
                     /db_xref="GeneID:8290484"
                     /db_xref="GOA:C5DBT1"
                     /db_xref="InterPro:IPR014802"
                     /db_xref="InterPro:IPR028143"
                     /translation="MSPKLEVVSRNNTQNLAMSEISDAEKRRILREKRQQKFNKGGAS
                     SRLAKITGQTENSFLSTESPLDSRESTYPAQETKAPAGNEDSTKQMDELLAKATSKTT
                     SKASSPPGSAEQQNGNPELDLFAQIAKLQQNANNETVSTDPSGTPDIFAQLMASMQQD
                     EAKGGSPGATAQQPIDPAIVEAHNIAVNKLKSYTILVKWLFFLLPYLYYITHSARDPF
                     QHNAVNYVLDRSNFFTVFTTFEIVALSVYYQLLMSAEKSHNVNTLDNNSKILKLVSMV
                     PPGLVPIPNLRGKVAQALQYWDVVSMYLTDLCFAIVLAGLFQYYHSM"
     gene            complement(<429228..>430112)
                     /locus_tag="KLTH0A05148g"
                     /db_xref="GeneID:8290485"
     mRNA            complement(<429228..>430112)
                     /locus_tag="KLTH0A05148g"
                     /product="KLTH0A05148p"
                     /transcript_id="XM_002551635.1"
                     /db_xref="GeneID:8290485"
     CDS             complement(429228..430112)
                     /locus_tag="KLTH0A05148g"
                     /note="similar to uniprot|P40509 Saccharomyces cerevisiae
                     YIL076W SEC28 Part of a heptameric protein complex that
                     regulates retrograde Golgi-to-ER protein traffic in
                     eukaryotic cells coatomer forms the COP I vesicle coat
                     whose functions are essential epsilon-COP coatomer subunit
                     Sec28p"
                     /codon_start=1
                     /product="KLTH0A05148p"
                     /protein_id="XP_002551681.1"
                     /db_xref="GeneID:8290485"
                     /db_xref="GOA:C5DBT2"
                     /db_xref="InterPro:IPR006822"
                     /db_xref="UniProtKB/TrEMBL:C5DBT2"
                     /translation="MDLFTVKQQYYSGNYKQALQEIEKVASSDQDAVVFYRAKSLIAL
                     GEYEKESSQSGIATAFNTYADIVAGSGSLQDLESAVSSSKSAFSLNLLASAQAIQGQN
                     EDAVKTCLEGLDSNETQGLAELVLLAVQIAVSDSSNRSESTASSILQNFLAAHEEYAN
                     EDEIIINLAESCVNFVAGREITGSNFYFYEELCQTLPSWKSQLGLMSLHLQQSHLPEA
                     QAIVDLLESEYYQNQQESARLYTPQLLANKITLTAMQGGRVDELRSQLLELQPEHPLC
                     QNYKINNAKFDEVVAKYA"
     gene            <430306..>431283
                     /locus_tag="KLTH0A05170g"
                     /db_xref="GeneID:8290486"
     mRNA            <430306..>431283
                     /locus_tag="KLTH0A05170g"
                     /product="KLTH0A05170p"
                     /transcript_id="XM_002551636.1"
                     /db_xref="GeneID:8290486"
     CDS             430306..431283
                     /locus_tag="KLTH0A05170g"
                     /note="similar to uniprot|P40508 Saccharomyces cerevisiae
                     YIL077C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A05170p"
                     /protein_id="XP_002551682.1"
                     /db_xref="GeneID:8290486"
                     /db_xref="InterPro:IPR012470"
                     /db_xref="UniProtKB/TrEMBL:C5DBT3"
                     /translation="MDDNRKSDGQGERKTALMESPWFKEAYNSALKFYEKDSALDSKD
                     RLELSRTFVSIARAELWGGWAAFALVFGAPFGYRLYKTGAVRGVKVPRNFVLGLFAMF
                     TTTQACGRYAFNSKLAQLQNDGNFTPRGSFGDDDDQSRPETNQQRQYEMMKLVGYGMA
                     PKWGNYFYTTFHNPEKRLPNPKVKLQEMKEGKTSNISPILNQRDPLGLYTGPGSEKKR
                     GIPQGNGEQSGATSSTSDKDGVETGTTTGSSWDRLRQENGITTKSPGGRWSQIRKAPS
                     DGSDIFGSSQPSQSSQFSEQPTDDSQGAEGAQEDFDALLEKERRGEDTV"
     gene            complement(<431378..>433600)
                     /locus_tag="KLTH0A05192g"
                     /db_xref="GeneID:8290487"
     mRNA            complement(<431378..>433600)
                     /locus_tag="KLTH0A05192g"
                     /product="KLTH0A05192p"
                     /transcript_id="XM_002551637.1"
                     /db_xref="GeneID:8290487"
     CDS             complement(431378..433600)
                     /locus_tag="KLTH0A05192g"
                     /note="highly similar to uniprot|P04801 Saccharomyces
                     cerevisiae YIL078W THS1 Threonyl-tRNA synthetase
                     cytoplasmic"
                     /codon_start=1
                     /product="KLTH0A05192p"
                     /protein_id="XP_002551683.1"
                     /db_xref="GeneID:8290487"
                     /db_xref="GOA:C5DBT4"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="UniProtKB/TrEMBL:C5DBT4"
                     /translation="MSVKEAVNRVEEKVKDLVLDNKDNKSSEKGNGKSKNKQDSKQSS
                     LYLDPEPDFIDERNQLFDKLLKEYQEKVEQMPRVPIKVVLKDGSEKEATAWETTPMDI
                     AKQIAKSFPDKQCISKANGQLWDLERPLEGKEGDEVKLEFFDFDSDEGKRVFWHSSAH
                     VLGEACECNLGAHICLGPPTEDGFFYEFAVKNAPNAPADAPERTVSQNDFPALESVSK
                     NVIKEKQKFERLVMSKEDLLKMFHYSKFKTYLVSTKVPDGGSTTVYRCGKLIDLCVGP
                     HIPHTGRIKAFKLLKNSSCYFLGDSNNDSLQRIYGISFPDKKLMDAHLKFLAEASMRD
                     HRKIGREQELFYFNEMSPGSCFWLPHGTRIYNNLVDLMRAEYRKRGFDEVITPNMYNS
                     KLWETSGHWGNYKENMFTFEVEKETFGLKPMNCPGHCILFKSRERSYKELPWRVADFG
                     VIHRNEFSGALTGLTRVRRFQQDDAHIFCAQNQIEQEIENCFSFLQYVYGVFGFEFKM
                     ELSTRPEKFVGEIETWNNAEAKLESALRKWGGNWELNPGDGAFYGPKIDIKISDALRR
                     WHQCATIQLDFQLPNRFELEFKSKDNQENENYERPVMIHRAILGSVERMTAILTEHFA
                     GKWPFWLSPRQVLVVPVGVKYQEYAQEVRDKLCEQDFYADVDLTGNTLQKKVRNGQML
                     KYNFIFIVGEQEMTEKSVNIRNRDVIEQQGKNATIAFETVLQQLKKLKEEKRLDNVLN
                     "
     gene            <434058..>435248
                     /locus_tag="KLTH0A05214g"
                     /db_xref="GeneID:8290488"
     mRNA            <434058..>435248
                     /locus_tag="KLTH0A05214g"
                     /product="KLTH0A05214p"
                     /transcript_id="XM_002551638.1"
                     /db_xref="GeneID:8290488"
     CDS             434058..435248
                     /locus_tag="KLTH0A05214g"
                     /note="similar to uniprot|P40507 Saccharomyces cerevisiae
                     YIL079C AIR1 and similar to uniprot|Q12476 Saccharomyces
                     cerevisiae YDL175C AIR2"
                     /codon_start=1
                     /product="KLTH0A05214p"
                     /protein_id="XP_002551684.1"
                     /db_xref="GeneID:8290488"
                     /db_xref="GOA:C5DBT5"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="UniProtKB/TrEMBL:C5DBT5"
                     /translation="MSLKNPSSSQTHDNNRNAYQENRMASLLSEYESHDTLSFVKSTT
                     PTPGASEGILAPSIDEVDSNPEDLRYLRGKGRYFGVDDPSDPSLDAEPKCNNCSQRGH
                     LKRNCPHVICAYCGIMDDHYTQQCPKAIKCANCGEEGHYRSQCPRQARRIYCTECNSK
                     NHARERCPSIWRSYYLRERTFHRTLHIERVFCYNCGHQGHFGDDCSMRRSSKVPNEDG
                     SAFSGENLPQELKAEYSRNLKESRLRFTQEFTFDRRQRLAAPLGEGLVGKREDTASSR
                     RNSERKKRNKPDFGARPSQGFPKPARNVSEPFKRNPPGRRPQKSFRASSQGNRGGRGS
                     SPGASNSSWGDFEPLRGSRAHNKPSQRSSKFSQRSNKSSQRSAKPSSPRNAFPFKKRK
                     KGPG"
     gene            <435817..>436212
                     /locus_tag="KLTH0A05236g"
                     /db_xref="GeneID:8290489"
     mRNA            <435817..>436212
                     /locus_tag="KLTH0A05236g"
                     /product="KLTH0A05236p"
                     /transcript_id="XM_002551639.1"
                     /db_xref="GeneID:8290489"
     CDS             435817..436212
                     /locus_tag="KLTH0A05236g"
                     /note="similar to uniprot|Q07549 Saccharomyces cerevisiae
                     YDL123W SNA4 Protein of unknown function localized to the
                     vacuolar outer membrane"
                     /codon_start=1
                     /product="KLTH0A05236p"
                     /protein_id="XP_002551685.1"
                     /db_xref="GeneID:8290489"
                     /db_xref="GOA:C5DBT6"
                     /db_xref="InterPro:IPR000612"
                     /db_xref="UniProtKB/TrEMBL:C5DBT6"
                     /translation="MCFYCHCFTVSDLILYIVGFFIPPVAVLLRSGCCSSDLLLNILL
                     TMLGVVPGMLHAFYYITMTSPLRREENRYYYQSGWDDGRRSRHQGSPGASEREHVVRE
                     EPSAVTPLMPNTGVGKPASGAPPPYTESV"
     gene            <436670..>437155
                     /locus_tag="KLTH0A05258g"
                     /db_xref="GeneID:8290490"
     mRNA            <436670..>437155
                     /locus_tag="KLTH0A05258g"
                     /product="KLTH0A05258p"
                     /transcript_id="XM_002551640.1"
                     /db_xref="GeneID:8290490"
     CDS             436670..437155
                     /locus_tag="KLTH0A05258g"
                     /note="similar to uniprot|Q12257 Saccharomyces cerevisiae
                     YDL177C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A05258p"
                     /protein_id="XP_002551686.1"
                     /db_xref="GeneID:8290490"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020569"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:C5DBT7"
                     /translation="MSMSKTVFRRAFAAMRSWNESELVIDRKSKFQGRCVKINNQDEI
                     PGILQELVDTNKAVSKASHPHMYAWRTGEVAHEEVSTGKRGKKGVKTETTVRGLQQGF
                     HDGGEAGAGQRLLTLLERSGLVNILVIVTRWYGGTPLGSARFRMIAAAAAESLKAAEG
                     K"
     gene            complement(<437543..>439168)
                     /locus_tag="KLTH0A05280g"
                     /db_xref="GeneID:8290491"
     mRNA            complement(<437543..>439168)
                     /locus_tag="KLTH0A05280g"
                     /product="KLTH0A05280p"
                     /transcript_id="XM_002551641.1"
                     /db_xref="GeneID:8290491"
     CDS             complement(437543..439168)
                     /locus_tag="KLTH0A05280g"
                     /note="highly similar to uniprot|P46681 Saccharomyces
                     cerevisiae YDL178W DLD2 D-lactate dehydrogenase located in
                     the mitochondrial matrix"
                     /codon_start=1
                     /product="KLTH0A05280p"
                     /protein_id="XP_002551687.1"
                     /db_xref="GeneID:8290491"
                     /db_xref="GOA:C5DBT8"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:C5DBT8"
                     /translation="MLRSTVRKPLQLASRVKLSTASWSASRRAVPLQAGRVWWPKVQE
                     YSTKIQPKLTAESYPDVHRFSGFKKLADEDLSFFRSILSDSEILQAKADEDLALFNED
                     WMRKYKGQSQLVLRPKSVNQVSQILKYCNEQKLAVVPQGGNTGLVGGSVPVFDEIVLS
                     LTQLNKIRDFDPVSGILKCDAGVILENADSFLAEHGYIFPMDLGAKGSCHVGGIVATN
                     AGGLRLLRYGSLHGTVLGLEVVLPNGEILDSMNALRKDNTGYDLKQMFIGSEGTIGVI
                     TGVSILTPPRPKAFNVSFLGVESYEAVQKTFVQAKQELSEILSAFEFMDLNSQRLTKE
                     HLKDVPHPLEEEYPFYILIETSGSNKEHDDVKLETFLEKAMEDGTVLDGVVAQDETEL
                     RNLWQWREMIPESSQAGGGVYKYDVSLPLKDLYSLVEAANAKLTEKGLLSVEDTSKPV
                     ISAIGYGHVGDGNLHLNVAVREYSKDVEKALEPFVYEHVSSKNGSISAEHGLGFQKKN
                     YIGYSKNDQEIKMIKQLKNLYDPNAILNPYKYV"
     gene            <440041..>440568
                     /locus_tag="KLTH0A05302g"
                     /db_xref="GeneID:8290492"
     mRNA            join(<440041..440095,440159..>440568)
                     /locus_tag="KLTH0A05302g"
                     /product="KLTH0A05302p"
                     /transcript_id="XM_002551642.1"
                     /db_xref="GeneID:8290492"
     CDS             join(440041..440095,440159..440568)
                     /locus_tag="KLTH0A05302g"
                     /note="similar to uniprot|Q04344 Saccharomyces cerevisiae
                     YDL125C"
                     /codon_start=1
                     /product="KLTH0A05302p"
                     /protein_id="XP_002551688.1"
                     /db_xref="GeneID:8290492"
                     /db_xref="GOA:C5DBT9"
                     /db_xref="InterPro:IPR001310"
                     /db_xref="InterPro:IPR011146"
                     /db_xref="InterPro:IPR019808"
                     /db_xref="UniProtKB/TrEMBL:C5DBT9"
                     /translation="MSAPVAHDAACIFCKIIKATTGEIPSFKLIETKYSFSFLDIQPT
                     AEAHALVIPKFHGAKLHNVPDEYLADILPVTKKLAQATGLAIDSPEGVGYNVLQNNGR
                     IAHQIVDHVHFHLIPKRDEKTGLVVGWPSLETDFEKLGQLHKELLAKIEAHQ"
     gene            <442339..>444837
                     /locus_tag="KLTH0A05324g"
                     /db_xref="GeneID:8290493"
     mRNA            <442339..>444837
                     /locus_tag="KLTH0A05324g"
                     /product="KLTH0A05324p"
                     /transcript_id="XM_002551643.1"
                     /db_xref="GeneID:8290493"
     CDS             442339..444837
                     /locus_tag="KLTH0A05324g"
                     /note="highly similar to uniprot|P25694 Saccharomyces
                     cerevisiae YDL126C CDC48 ATPase in ER nuclear membrane and
                     cytosol with homology to mammalian p97 in a complex with
                     Npl4p and Ufd1p participates in retrotranslocation of
                     ubiquitinated proteins from the ER into the cytosol for
                     degradation by the proteasome"
                     /codon_start=1
                     /product="KLTH0A05324p"
                     /protein_id="XP_002551689.1"
                     /db_xref="GeneID:8290493"
                     /db_xref="GOA:C5DBU0"
                     /db_xref="InterPro:IPR003338"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR004201"
                     /db_xref="InterPro:IPR005938"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029067"
                     /db_xref="UniProtKB/TrEMBL:C5DBU0"
                     /translation="MADDKKSLLDASGVEKREEDATATAILRRKKKDNMLMVDDAVND
                     DNSVIAINSNTMDLLQLFRGDTVLVKGKKRKDTVLIVLIDDELENGVCRVNRVVRNNL
                     RIRLGDLVTIHACPDIKYASRISVLPIADTVEGLTGSLFDVYLKPYFVEAYRPVRKGD
                     HFVVRGGMRQVEFKVVDVEPEEYAVVAQDTVIHSEGEPINREDEENNINEVGYDDIGG
                     CRKQMAQIRELVELPLRHPQLFKAIGIKPPRGILMYGPPGTGKTLMARAVANETGAFF
                     FLINGPEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRV
                     VSQLLTLMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLR
                     IHTKNMKLADDVDLEVLAAETHGYVGADIASLCSEAAMQQIREKMDMIDLDEDEIDAE
                     VLDSLGVTMDNFKFALGNSNPSALRETVVESVNVTWDDIGGLDEIKEELKETVEYPVL
                     HPDQYTKFGLSPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESE
                     SNIRDIFDKARAAAPTVVFLDELDSIAKARGGSVGDAGGASDRVVNQLLTEMDGMNAK
                     KNVFVIGATNRPDQIDPAILRPGRLDQLIYVPLPDEMARLSILNAQLRNTPLEPGLEL
                     STIAKATQGFSGADLSYIVQRAAKFAIKDSIEAQRRALAEQQSRVKTEDVEMGDGAEA
                     AEPAAADEEIEDAVPYITKEHFSEAMKTAKRSVSDAELRRYEAYSQQMKASRGQYSNF
                     SFDDSPSANQPAGTNERSGAAFGEGAEEDDDLYS"
     gene            complement(<445174..>446079)
                     /locus_tag="KLTH0A05346g"
                     /db_xref="GeneID:8290494"
     mRNA            complement(<445174..>446079)
                     /locus_tag="KLTH0A05346g"
                     /product="KLTH0A05346p"
                     /transcript_id="XM_002551644.1"
                     /db_xref="GeneID:8290494"
     CDS             complement(445174..446079)
                     /locus_tag="KLTH0A05346g"
                     /note="similar to uniprot|P25693 Saccharomyces cerevisiae
                     YDL127W PCL2 G1 cyclin associates with Pho85p
                     cyclin-dependent kinase (Cdk) to contribute to entry into
                     the mitotic cell cycle essential for cell morphogenesis
                     localizes to sites of polarized cell growth"
                     /codon_start=1
                     /product="KLTH0A05346p"
                     /protein_id="XP_002551690.1"
                     /db_xref="GeneID:8290494"
                     /db_xref="GOA:C5DBU1"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR012104"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="UniProtKB/TrEMBL:C5DBU1"
                     /translation="MSDLEALLQFNKRRVSMEMIEFLASTSNSVIQVRTGESSAKVVS
                     LVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN
                     LNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTCLSPFLTPIK
                     DQLVSQKEDYLFFNSPVPSRSRLAAYHDSHSRSSSAMSIPSLVSSATMSTISTGGSRR
                     TPLLPHSNSSNIHRIDENSYTYQSTKPVPGYAAPSLAKRSPSRPEKSHLARPIIMKTG
                     LPGSTQSVSSQNKFGIKSNWASIFK"
     gene            complement(<446807..>448030)
                     /locus_tag="KLTH0A05368g"
                     /db_xref="GeneID:8290495"
     mRNA            complement(<446807..>448030)
                     /locus_tag="KLTH0A05368g"
                     /product="KLTH0A05368p"
                     /transcript_id="XM_002551645.1"
                     /db_xref="GeneID:8290495"
     CDS             complement(446807..448030)
                     /locus_tag="KLTH0A05368g"
                     /note="similar to uniprot|O13581 Saccharomyces cerevisiae
                     YDL128W"
                     /codon_start=1
                     /product="KLTH0A05368p"
                     /protein_id="XP_002551691.1"
                     /db_xref="GeneID:8290495"
                     /db_xref="GOA:C5DBU2"
                     /db_xref="InterPro:IPR004713"
                     /db_xref="InterPro:IPR004798"
                     /db_xref="InterPro:IPR004837"
                     /db_xref="UniProtKB/TrEMBL:C5DBU2"
                     /translation="MDTNTPLLPQSARTQKRSALQAVWRDIKIVFRSSPVNYLAVFVP
                     LGLFFGYSHFSDTWVFLLNFIAIIPLAAMLAYATEELADKAGSTLGGLLNATLGNAVE
                     LIVSIIALSKGQVTIVQASMLGSILSNLLLVVGFCFVAGGYNREFQRFNQTAAQTMSS
                     LLAISCASLLIPAAFRLSLPDNNKRQDLLINEKLLELSRGTSIVLLIVYVLFLWFQLK
                     THHHLFEQREVETDRTVDQHTKGSKLSIKSSLAFLAGTTVLVSLCADFLVGSIDNVVA
                     SSGLSKTFIGLIIIPIVGNAAEHVTAVIVARKDKMDLALGVAIGSSLQISLFVTPFMV
                     LVGWAIGVPMSLSFSPFETTTLFIAVFLSNYLLQDGESHWLEGAMSIVTYVLIAMAFY
                     YLPDENTMGSLIFST"
     gene            complement(<448483..>449877)
                     /locus_tag="KLTH0A05390g"
                     /db_xref="GeneID:8290496"
     mRNA            complement(<448483..>449877)
                     /locus_tag="KLTH0A05390g"
                     /product="KLTH0A05390p"
                     /transcript_id="XM_002551646.1"
                     /db_xref="GeneID:8290496"
     CDS             complement(448483..449877)
                     /locus_tag="KLTH0A05390g"
                     /note="weakly similar to uniprot|Q12301 Saccharomyces
                     cerevisiae YDL180W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A05390p"
                     /protein_id="XP_002551692.1"
                     /db_xref="GeneID:8290496"
                     /db_xref="UniProtKB/TrEMBL:C5DBU3"
                     /translation="MARISYVSPYFMPLVCSSKPWVSAIVFLNLVVLFVAAFSLSQLL
                     ISQYDDDAMFRPVGQDYFRTSLLGFFSPLALYFVRDFVLMVSPRFVLFNLFVDFPLND
                     WLYLLIIFCLAYPQAQETHARSSLDDTFWHIIPRQSCIFGISWALSEFMVCLVENFYS
                     YEEVPSPESAKRQLESKMMQDEQDLARSNITLSKCIDVKRRTSHISENVYCHENSQPP
                     QGAQSPNSAAAEGASADTVFVSFSDSSISLLRDPEQGPHPRSRNDRKRPGLYGGTVTY
                     FPEVVSIRKFLKDILVLNLLVADSILLAVGHALLISMYFIYVPGHNRLFTSAVIYFGS
                     RPFGFFVLSLVLPLSVFSFIASVFLFLWSDEDGEDYKNTRKLTSSDLHAHTSNPQSLQ
                     YITSNQLFVVNSIYTQDISGSEGDNELGILRFFRALMTTWRSLASHQSFPIAGITVWA
                     FAIFVGGIVATIEQ"
     gene            complement(<450284..>450985)
                     /locus_tag="KLTH0A05412g"
                     /db_xref="GeneID:8290497"
     mRNA            complement(<450284..>450985)
                     /locus_tag="KLTH0A05412g"
                     /product="KLTH0A05412p"
                     /transcript_id="XM_002551647.1"
                     /db_xref="GeneID:8290497"
     CDS             complement(450284..450985)
                     /locus_tag="KLTH0A05412g"
                     /note="weakly similar to uniprot|Q07555 Saccharomyces
                     cerevisiae YDL129W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A05412p"
                     /protein_id="XP_002551693.1"
                     /db_xref="GeneID:8290497"
                     /db_xref="UniProtKB/TrEMBL:C5DBU4"
                     /translation="MPGTAGATAERTAHQDKPTLQVLTPEEPRASKDSPGSLGLHGSS
                     PASRSPLESPSVQSTRELEVALAETIQELEAQAGDDRYAAGAALDIPRLLSVLNQSLT
                     AISHWSLQARLAQLENRSAWDSRLAVENSLIKKEVEFFRNRCLSESHRSPRLVHAPSA
                     PASPSRGAPARVSKPARSNPSKKALSQQQDTQQQAQQPLLRLVENHKPHPRMRRSSDN
                     PSASDFVRVFHLEKL"
     gene            complement(<451664..>452146)
                     /locus_tag="KLTH0A05434g"
                     /db_xref="GeneID:8290498"
     mRNA            complement(join(<451664..451870,452033..>452146))
                     /locus_tag="KLTH0A05434g"
                     /product="60S acidic ribosomal protein P1"
                     /transcript_id="XM_002551648.1"
                     /db_xref="GeneID:8290498"
     CDS             complement(join(451664..451870,452033..452146))
                     /locus_tag="KLTH0A05434g"
                     /note="highly similar to uniprot|P10622 Saccharomyces
                     cerevisiae YDL130W RPP1B Ribosomal protein P1 beta, a
                     component of the ribosomal stalk, which is involved in the
                     interaction between translational elongation factors and
                     the ribosome; accumulation of P1 in the cytoplasm is
                     regulated by phosphorylation and interaction with the P2
                     stalk component"
                     /codon_start=1
                     /product="60S acidic ribosomal protein P1"
                     /protein_id="XP_002551694.1"
                     /db_xref="GeneID:8290498"
                     /db_xref="GOA:C5DBU5"
                     /db_xref="InterPro:IPR001813"
                     /db_xref="InterPro:IPR001859"
                     /db_xref="InterPro:IPR027534"
                     /db_xref="UniProtKB/TrEMBL:C5DBU5"
                     /translation="MSDAVISYASLILADAGLDITADSLTTLTKAAGASIDNIWAETF
                     AKALEGKDLKEILSGFHAAGSAAPAAGSASAAAAGGDAAAEEAAPEEAAEESDDDMGF
                     GLFD"
     gene            <453736..>454107
                     /locus_tag="KLTH0A05456g"
                     /db_xref="GeneID:8290499"
     mRNA            <453736..>454107
                     /locus_tag="KLTH0A05456g"
                     /product="KLTH0A05456p"
                     /transcript_id="XM_002551649.1"
                     /db_xref="GeneID:8290499"
     CDS             453736..454107
                     /locus_tag="KLTH0A05456g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A05456p"
                     /protein_id="XP_002551695.1"
                     /db_xref="GeneID:8290499"
                     /db_xref="UniProtKB/TrEMBL:C5DBU6"
                     /translation="MSYNTQDFLEDGDVFSFSLAQGAPASLLPSTPLSGASDLISGDD
                     DLLLQSPFLDAMSRDDDEDHAGDELFALENEPQLLPSYDMTHITAKAPVPSAFECVPA
                     PDDDEFADAAQHNYRLWLAGV"
     gene            <454908..>458162
                     /locus_tag="KLTH0A05478g"
                     /db_xref="GeneID:8290500"
     mRNA            <454908..>458162
                     /locus_tag="KLTH0A05478g"
                     /product="KLTH0A05478p"
                     /transcript_id="XM_002551650.1"
                     /db_xref="GeneID:8290500"
     CDS             454908..458162
                     /locus_tag="KLTH0A05478g"
                     /note="similar to uniprot|Q04336 Saccharomyces cerevisiae
                     YMR196W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A05478p"
                     /protein_id="XP_002551696.1"
                     /db_xref="GeneID:8290500"
                     /db_xref="GOA:C5DBU7"
                     /db_xref="InterPro:IPR004888"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="UniProtKB/TrEMBL:C5DBU7"
                     /translation="MSQVYKSELKDEFVDATLEERRLHENKTRKKYWLKWGPYLSERA
                     WATVREDYSDSGDAWTHFPFEHAASRVFRWGEDGIFGVSDNRQLVCLNLAMWNGHDQI
                     IKERMFGVTGPQGNHGEDVKELYYYIDSTPTHSYMKALYKYPFAKAYPYEELVAKNGE
                     RGYQDREFEVYEIDGLYSSEEHGDTPYFDVVFEMAKGDDNPNDLNFRVTAYNRSDKRA
                     GELYLMPQVFFRNTWGWCRQTATKPELKKGGSNYIDVQCEKYGKRTAIFAPSPGGFDD
                     EDTETQDVEPQLLFTENESNLEKLFDSGPNPAPYAKDAFQEYVVEQNGEAVNPENKGT
                     KSCAVYHFPKIPPGEYVTIRYKFTDVQLAQYEDELVIDEEEFDSIFDRREEEADNFYW
                     KITPLHISDELRNVQRQAFAGLMWSKQFYHFIQDQWYNGDPNVKPRPPPNRANGRNKD
                     WKHMYTDDILSLPDKWEYPFFASWDTAFHCIPLSMVDPEFAKHQLDIMTREWYMHPNG
                     QMPAYEWNFSDVNPPVHAWAVYRVFKIERNMYKREDRVFLERVFQKLLLNFTWWVNRK
                     DSNGQNVFEGGFLGLDNIGVFNRSEPLPTGGTLEQADSTGWMAFFSLQMLNIALELAK
                     ENPVYEDIASKFFEHFILISDAMSFRYTKNTESEEFQEEIKESLWNEEDQFYYDAISW
                     GGPFKQQLPIRSLVGLIPLYACMTLEPQILDKFPSFKKRVDWFINNKSEIFDRNIASM
                     KYRGVGERLLLSLVNKDRLEAILRRMLDETEFLSDYGIRSLSKYHEEHPFVMDVNGNK
                     YEVKYLSGESDSGMFGGNSNWRGPIWFPVNFLLIESLQRFFLYYGPEFKVECPVGSGV
                     FLNLAEVAEELEHRLIHVFMPDENGNRACYEGDNSEMLSQDEYFRDLVPFYEYFDGDT
                     GRGLGASHQCGWTALVAKWIHDAGVSCIRLPRSSRGSRSASISSKASSPVRPVMPGRM
                     ARRKSAKSLVNLTGTLLDLTEEEKRIYQLGSVPHTQVRSTSNAGTAADKDERKGASQE
                     QSARYEADSDFKAPTSHSSEAKVIEDLKKKMDSFNLTDDANERADEEELLNENK"
     gene            complement(<458289..>458951)
                     /locus_tag="KLTH0A05500g"
                     /db_xref="GeneID:8290501"
     mRNA            complement(<458289..>458951)
                     /locus_tag="KLTH0A05500g"
                     /product="KLTH0A05500p"
                     /transcript_id="XM_002551651.1"
                     /db_xref="GeneID:8290501"
     CDS             complement(458289..458951)
                     /locus_tag="KLTH0A05500g"
                     /note="similar to uniprot|Q04338 Saccharomyces cerevisiae
                     YMR197C VTI1 Involved in cis-Golgi membrane traffic Vti1p
                     is a v-SNARE that interacts with two t-SNARES Sed5p and
                     Pep12p"
                     /codon_start=1
                     /product="KLTH0A05500p"
                     /protein_id="XP_002551697.1"
                     /db_xref="GeneID:8290501"
                     /db_xref="GOA:C5DBU8"
                     /db_xref="InterPro:IPR000727"
                     /db_xref="InterPro:IPR007705"
                     /db_xref="InterPro:IPR010989"
                     /db_xref="UniProtKB/TrEMBL:C5DBU8"
                     /translation="MASLLSNYEAEFKTTLEQAKTLLSVAPSQPVSQRNGTLKEVEQQ
                     QDELLDLVDQMEIEVNNGALDNAARSSFKAKLREYKKHVQSDVKSPLQQLMDSRNRDL
                     LFQGRAGEGEPGESDDQRQQLLSNHAILSRTGDKLRDATRIAVDTEGVGSQIMMDLRS
                     QRETLENARQTLFQADSYVDKSIRTLKTMSRRLVANKFISYAIIAVLILLILLVLFSK
                     FK"
     gene            <459409..>459897
                     /locus_tag="KLTH0A05522g"
                     /db_xref="GeneID:8290502"
     mRNA            <459409..>459897
                     /locus_tag="KLTH0A05522g"
                     /product="KLTH0A05522p"
                     /transcript_id="XM_002551652.1"
                     /db_xref="GeneID:8290502"
     CDS             459409..459897
                     /locus_tag="KLTH0A05522g"
                     /note="similar to uniprot|Q12184 Saccharomyces cerevisiae
                     YPL252C YAH1 Iron-sulfur protein of the mitochondrial
                     matrix homologous to human adrenodoxin involved in heme a
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0A05522p"
                     /protein_id="XP_002551698.1"
                     /db_xref="GeneID:8290502"
                     /db_xref="GOA:C5DBU9"
                     /db_xref="InterPro:IPR001041"
                     /db_xref="InterPro:IPR001055"
                     /db_xref="InterPro:IPR012675"
                     /db_xref="InterPro:IPR018298"
                     /db_xref="UniProtKB/TrEMBL:C5DBU9"
                     /translation="MFRIAGLSKSLLRGPLAVGRANIMVPKYAGFAQSALRFHGHVHK
                     PKPGEELHVTFILKDGSQRQYEVSAGDTLLDIAQANNLEMEGACGGSCACSTCHVIVD
                     PDYYDALEEPDDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPAMTRNVSNTD
                     FD"
     gene            <460303..>462198
                     /locus_tag="KLTH0A05544g"
                     /db_xref="GeneID:8290503"
     mRNA            <460303..>462198
                     /locus_tag="KLTH0A05544g"
                     /product="KLTH0A05544p"
                     /transcript_id="XM_002551653.1"
                     /db_xref="GeneID:8290503"
     CDS             460303..462198
                     /locus_tag="KLTH0A05544g"
                     /note="weakly similar to uniprot|Q01649 Saccharomyces
                     cerevisiae YMR198W CIK1 is important for proper
                     organiziation of microtubule arrays and establishment of a
                     spindle is essential for karyogamy and expression is
                     regulated by KAR4 and mating spindle pole body associated
                     protein and to uniprot|Q12045 YPL253C VIK1 Protein that
                     forms a complex with Kar3p at the spindle pole body,
                     possible regulator of Kar3p function in
                     microtubule-mediated processes; required for sister
                     chromatid cohesion"
                     /codon_start=1
                     /product="KLTH0A05544p"
                     /protein_id="XP_002551699.1"
                     /db_xref="GeneID:8290503"
                     /db_xref="UniProtKB/TrEMBL:C5DBV0"
                     /translation="MTHTKIPQMSQTRIPGHKRAMSSPPGSATKRLHILEDVTNTNSI
                     ARLPGTKMSVAVDSNTRLMNKYYYGDPKVIEAVKVRERKIARDIQHFRKSIAEIDAET
                     KLIQETNLPNLDYDMSKKNTLCNELRKELVQLTTSLDEKNGECELMESNWELTVKHLQ
                     LEHEVNLQKARNEIDQALCEARERWEEKLREMENFRPDSGIIEEIEELKEERLQEEKK
                     LNALEASNKRACTMRDQELDIEFQKFLLEKQKPSEELREKCQVQREKNKQLTEEILCF
                     ENQLEESTRDCARLYEAITRIEKLIKACLEEREELLERRTKVEASFRETELTTQKVQT
                     EASAVESKYNAQFDKMEKEQLRRRKMENSIDEMRAKVRCFAYIGDKVPPSCEIDYPAK
                     KISMIGTNSGQSSVFSRIIPRKLIPEKDLIGQECQAYLDMCTAKGLNCNIISLPTDRQ
                     QHLRECFLQYFVNSNTHKLSVQYVALSEKMPSSDLLVDPEDSKGDELQLTIKEDAIEM
                     SSRSVELESPQDITDAFSGLELHSRVGDISVMKLKVYNKSEDYFDAYFLEINDDQTIK
                     NISNLSNKNRFVKTPITIILQTLLLKTKSLILCNLFDGRTSDPCLVLESVHQIGRLDV
                     PRKLNER"
     gene            complement(<462287..>463582)
                     /locus_tag="KLTH0A05566g"
                     /db_xref="GeneID:8290504"
     mRNA            complement(<462287..>463582)
                     /locus_tag="KLTH0A05566g"
                     /product="KLTH0A05566p"
                     /transcript_id="XM_002551654.1"
                     /db_xref="GeneID:8290504"
     CDS             complement(462287..463582)
                     /locus_tag="KLTH0A05566g"
                     /note="similar to uniprot|Q12060 Saccharomyces cerevisiae
                     YPL254W HFI1 Adaptor protein required for structural
                     integrity of the SAGA complex a histone
                     acetyltransferase-coactivator complex that is involved in
                     global regulation of gene expression through acetylation
                     and transcription functions"
                     /codon_start=1
                     /product="KLTH0A05566p"
                     /protein_id="XP_002551700.1"
                     /db_xref="GeneID:8290504"
                     /db_xref="GOA:C5DBV1"
                     /db_xref="InterPro:IPR024738"
                     /db_xref="UniProtKB/TrEMBL:C5DBV1"
                     /translation="MSVVQPQNTPVSPGSVHKQTGVTVSAHGQKPGGALTGTPTGTTV
                     PGNQTNRLNIEKMVESLTAALGKESWSKYAQIISLFVLGKLSRKELVNELDLLFSPQQ
                     ENQGQLMQGSNMSHGTLIRMHNQLLLAILTNSVRGSPLGESTEGSWGFNNGTTHSSKK
                     RSNKHNSQIDTYKKIVMSLPAEDRSRLKTITKEAGKRGFVLCSVLQARLNNIPKIPIV
                     TNPETLKRIKASNLKTPLEWSQEIVNGFSAPLATESYSLPDNDSLYLRMISIAREHGL
                     VGAVDGRCVEIMTLALENYLKNVVESAIDTVRYREKYHSDYYDLNEEGFYQGVAGTDE
                     EVACEGNELTRDLRSITNEEMAQTLSVFPNLVAPTGAYLNLSMCGLLNDDELVTMAST
                     IDDLPEFQEDKPNFTPVDDKNVGSREELNWLIKDILTKE"
     gene            complement(<463948..>465078)
                     /locus_tag="KLTH0A05588g"
                     /db_xref="GeneID:8290505"
     mRNA            complement(<463948..>465078)
                     /locus_tag="KLTH0A05588g"
                     /product="KLTH0A05588p"
                     /transcript_id="XM_002551655.1"
                     /db_xref="GeneID:8290505"
     CDS             complement(463948..465078)
                     /locus_tag="KLTH0A05588g"
                     /note="weakly similar to uniprot|Q12365 Saccharomyces
                     cerevisiae YPL255W BBP1 Protein required for the spindle
                     pole body (SPB) duplication localized at the central
                     plaque periphery forms a complex with a nuclear envelope
                     protein Mps2p and SPB components Spc29p and Kar1p required
                     for mitotic functions of Cdc5p"
                     /codon_start=1
                     /product="KLTH0A05588p"
                     /protein_id="XP_002551701.1"
                     /db_xref="GeneID:8290505"
                     /db_xref="GOA:C5DBV2"
                     /db_xref="InterPro:IPR029328"
                     /db_xref="InterPro:IPR029330"
                     /translation="MIWNNDDTEHSTGGLYRWTMDALFGRQISPSRKFKEVSQDDTNY
                     NMKSHKDKQWDGHGFQPRTRSSSASFDRSFLQRYELLQDEEEQDIMRPVRSPARPYLS
                     AGHAAGQDAALANDESTDTFSNKRQRFKGKFSGPKYHDESLKFRAPAKNDPFISKLFQ
                     RESPEHPSNLPGKFPSPFKQALGLPAGVQVQLDPEEQIPQKMFTDEYLQLLAELDQNG
                     QKLKQLQQGLHQKQQDHILQETSYREKYHVMRQELITELKQSKKLYDNYYRLYEKHKK
                     MRALDTDASRLRQRISDLEAQVVDASIEKAEEVRKLNETIFQLEFREQETQSKHERER
                     IRYQSRIAELESIVESRLSISNGVQNPPLRERIKPVNSSARI"
     gene            <465309..>466430
                     /locus_tag="KLTH0A05610g"
                     /db_xref="GeneID:8290506"
     mRNA            <465309..>466430
                     /locus_tag="KLTH0A05610g"
                     /product="KLTH0A05610p"
                     /transcript_id="XM_002551656.1"
                     /db_xref="GeneID:8290506"
     CDS             465309..466430
                     /locus_tag="KLTH0A05610g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A05610p"
                     /protein_id="XP_002551702.1"
                     /db_xref="GeneID:8290506"
                     /db_xref="UniProtKB/TrEMBL:C5DBV3"
                     /translation="MGILYDHEEWAVYAEGKQLLIWREGTLVNEWTVQGIQDYQFYTA
                     EDELVIIGNWGQGLTRLRIKEGTEELSEESALRTSFHIAQFQILPSSGVILAYDKVAG
                     VLHLFNSREERYQGFIKAHPAQTSFSSHGPSEFQVFVRDFDPASLVIKTYLNRYRLRG
                     SNASLINTIPMEGLFIKRWVVRSACGAFFAVISTSECEQACQLKFFLQDASIPFHTET
                     LEGHAVSAAFVSPLKLFLILRLAQGNALCLLNLESSHTHQLLSLEAEFIRSSHEIDEA
                     GNFTQPSSVPAITHLDSNLKLVNSSSNSIFFVMNSAPNILFCWSFTKNIDSHLDTWAF
                     PAKVVSLGELNSATVAAVCLTENPTSLSKIEISQPFSGP"
     gene            <467019..>468533
                     /locus_tag="KLTH0A05632g"
                     /db_xref="GeneID:8290507"
     mRNA            <467019..>468533
                     /locus_tag="KLTH0A05632g"
                     /product="KLTH0A05632p"
                     /transcript_id="XM_002551657.1"
                     /db_xref="GeneID:8290507"
     CDS             467019..468533
                     /locus_tag="KLTH0A05632g"
                     /note="similar to uniprot|P20437 Saccharomyces cerevisiae
                     YMR199W CLN1 role in cell cycle START; G(sub)1 cyclin"
                     /codon_start=1
                     /product="KLTH0A05632p"
                     /protein_id="XP_002551703.1"
                     /db_xref="GeneID:8290507"
                     /db_xref="InterPro:IPR006671"
                     /db_xref="InterPro:IPR013763"
                     /db_xref="InterPro:IPR014399"
                     /db_xref="UniProtKB/TrEMBL:C5DBV4"
                     /translation="MGVSNGIPQGLIVTAKQTYYPIELSNAELLAHYEMIQDYHQEIS
                     ANVISQSCKFKPDPKLIDQQPEMNPQQTRQQVMAVLFELSVKTRVTNGIFFHAARLYD
                     RYCSKRVVLREQAKLVIATCLWLAAKTWGGCNHIINNVSVPTGGRFYGPNPRARIPRL
                     SELVHYCGGADVFDESMFMQMERHILDTLSWDIFEPMVNDYVLNVDENCLLQYELYKR
                     QLEHNKEWFHRASQSSDSDATEADEEEDEDLVDKIQLINIKKFLIDLATWQYDLLKFE
                     MFEVAHGIFAIINKFTGQDQGPLLLSPLPTSTNQSLLLRIFINAVVKAPKQLLQFYEN
                     SQGVNQFVAAVRDFHASRQKKVQIASGMDLSGRPTVCYEVPSMPSPPHPNVNYTPMRN
                     TSAPSDVSIFSAAESQPSPVTPVMYSFANNKTNSGSACGSVLSVNSLSNKRSRADDYD
                     CMDEDKENQPHNPTFAPPPRAKFVGNSIFASGGTSATNSNRSSLVSLAISNNIV"
     gene            <468827..>469576
                     /locus_tag="KLTH0A05654g"
                     /db_xref="GeneID:8290508"
     mRNA            <468827..>469576
                     /locus_tag="KLTH0A05654g"
                     /product="KLTH0A05654p"
                     /transcript_id="XM_002551658.1"
                     /db_xref="GeneID:8290508"
     CDS             468827..469576
                     /locus_tag="KLTH0A05654g"
                     /note="similar to uniprot|Q03691 Saccharomyces cerevisiae
                     YMR200W ROT1 Protein that may be involved in cell wall
                     function mutations in rot1 cause cell wall defects
                     suppress tor2 mutations and are synthetically lethal with
                     rot2 mutations"
                     /codon_start=1
                     /product="KLTH0A05654p"
                     /protein_id="XP_002551704.1"
                     /db_xref="GeneID:8290508"
                     /db_xref="InterPro:IPR019623"
                     /db_xref="UniProtKB/TrEMBL:C5DBV5"
                     /translation="MLGALSLISLLAFTATVMGDSDSDALYGTWTSKSNQVFTGPGFF
                     DPVDELLIEPSLPGYSLSFTKDGYFEEAAYRVSGNPQDPHCPTAVLIYQHGTYEVQSN
                     GSLTLTPFEVDGRQLLSSPCTDNGTSVYSRYNQTETFKSFLVQLNNYHGVKELQLYEF
                     DGTAMMPLYLAYQPPVMLPTITLNPTASATSTETGSHNKRSLRGLVKRGLENRYKTSA
                     VKRNREPVNAAAYWWTSVGLIAFGSAVFFVF"
     gene            <469968..>471845
                     /locus_tag="KLTH0A05676g"
                     /db_xref="GeneID:8290509"
     mRNA            <469968..>471845
                     /locus_tag="KLTH0A05676g"
                     /product="KLTH0A05676p"
                     /transcript_id="XM_002551659.1"
                     /db_xref="GeneID:8290509"
     CDS             469968..471845
                     /locus_tag="KLTH0A05676g"
                     /note="similar to uniprot|P40343 Saccharomyces cerevisiae
                     YNR006W VPS27 hydrophilic protein has cysteine rich
                     putative zinc finger esential for function"
                     /codon_start=1
                     /product="KLTH0A05676p"
                     /protein_id="XP_002551705.1"
                     /db_xref="GeneID:8290509"
                     /db_xref="GOA:C5DBV6"
                     /db_xref="InterPro:IPR000306"
                     /db_xref="InterPro:IPR002014"
                     /db_xref="InterPro:IPR003903"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011011"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017073"
                     /db_xref="InterPro:IPR017455"
                     /db_xref="InterPro:IPR018205"
                     /db_xref="UniProtKB/TrEMBL:C5DBV6"
                     /translation="MSAAVSTPSQLDSLIQRATSESIPNGEIDLSLALEVSDVIRSRR
                     VPPKECMRCIKKRIMSSRSNPNRSLSAWRLTEVCLKNGGVPFIKEVCSREFMDSLEHA
                     ILQEESNDELEILCKGMLQDLYVAFRNDSQLNYVSKVYQRLEAKGVDFPSNPSRHSEL
                     AAAMFDSKTPADWIDSDTCMICSNKFSLLNRRHHCRSCGGIFCQEHSSRFIPLPDLGI
                     YDNVRVCDNCFDDYETKKQSDKKRKKKKKGHGKSSSVRDQEEEELKKAIELSLRDARS
                     EDTFVPVVPVQKAPSPQAIDEEEDEDLKAAIAASLRESEEAKRRQQERQQTPVAEGYS
                     VPDVPPPLPSNELTTSEEDDIQLFASLVERMKYQPPTAILEDTQLQQLYRKVMGTVPK
                     LNIALSETSHKYNTLMNMNGKISDIMNIYDSLLEKQLQSINLNQQYFMPQLPSDPYAY
                     YNVGQQNSPHVNPAALPQQNQHIQVSSPALNRQHVSESKVPSMPASELRPLEGHASPN
                     HIEQLKSIAIEQEAPQKQSLSSPRPYPDETQEEQNPCLSDPYPNGISKNGPAQAPSDP
                     PYPNDDEEKEESLRQAHPKLDKITNFDFPTVPVQQPPVEEHVKEEPEEANEQEQLLIE
                     L"
     gene            complement(<472128..>473270)
                     /locus_tag="KLTH0A05698g"
                     /db_xref="GeneID:8290510"
     mRNA            complement(join(<472128..473150,473244..>473270))
                     /locus_tag="KLTH0A05698g"
                     /product="KLTH0A05698p"
                     /transcript_id="XM_002551660.1"
                     /db_xref="GeneID:8290510"
     CDS             complement(join(472128..473150,473244..473270))
                     /locus_tag="KLTH0A05698g"
                     /note="similar to uniprot|P28519 Saccharomyces cerevisiae
                     YMR201C RAD14 Protein that recognizes and binds damaged
                     DNA during nucleotide excision repair subunit of
                     Nucleotide Excision Repair Factor 1 (NEF1) contains zinc
                     finger motif homolog of human XPA protein"
                     /codon_start=1
                     /product="KLTH0A05698p"
                     /protein_id="XP_002551706.1"
                     /db_xref="GeneID:8290510"
                     /db_xref="GOA:C5DBV7"
                     /db_xref="InterPro:IPR000465"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="InterPro:IPR022656"
                     /db_xref="InterPro:IPR022658"
                     /db_xref="UniProtKB/TrEMBL:C5DBV7"
                     /translation="MNAEQKARIEANRQRALEKLKKRGIIRSEQAEKIESRNEPRPKP
                     AAPELAQSVAENKAKALERYKHHQQNLRDASSNINQSVELDKSSGRKRPLDRIRPTVR
                     KQDYIEYDLATMKNSYGGFINAEEDFSEGPENKKQQSLEEWQKAQKERKALYENAPPP
                     DHPSLAPRCIECHINTELDPLLHDVFKLQICKACAKAIPEKYSLLTKTECKEDYFLTD
                     PELNDQELFHRFEKPNPHSGTFARMQLFVRCEVEEFAYKKWGGEEGLDNEWQRREEGK
                     AQRREKKYQAKMKEMRVKTRAQEYTKKLLERKHGKEHVHEFSTAIDGGLNEEGIKLSK
                     RRCIGCGLEVNEIAL"
     gene            complement(<473454..>474338)
                     /locus_tag="KLTH0A05720g"
                     /db_xref="GeneID:8290511"
     mRNA            complement(<473454..>474338)
                     /locus_tag="KLTH0A05720g"
                     /product="KLTH0A05720p"
                     /transcript_id="XM_002551661.1"
                     /db_xref="GeneID:8290511"
     CDS             complement(473454..474338)
                     /locus_tag="KLTH0A05720g"
                     /note="similar to uniprot|P40344 Saccharomyces cerevisiae
                     YNR007C ATG3 Protein involved in autophagy E2-like enzyme
                     that plays a role in formation of
                     Atg8p-phosphatidylethanolamine conjugates which are
                     involved in membrane dynamics during autophagy"
                     /codon_start=1
                     /product="KLTH0A05720p"
                     /protein_id="XP_002551707.1"
                     /db_xref="GeneID:8290511"
                     /db_xref="GOA:C5DBV8"
                     /db_xref="InterPro:IPR007134"
                     /db_xref="InterPro:IPR007135"
                     /db_xref="InterPro:IPR019461"
                     /db_xref="UniProtKB/TrEMBL:C5DBV8"
                     /translation="MIRSKLASWREYLTPVTHTSTFQSSGQITPEEFTQAGDYLCHMF
                     PTWEWNSTSKDVSYRDFLPKEKQFLVTRKVPCSARAEQLTTVEGAEEGDNADGWVVEG
                     QVKTRSTEEHANADIEDMLEGMDLEEVEQDDDDMVAIAPNDRRFYDLYITYSTSYRVP
                     KIYLVGFNGDGSPLTPEQMFEDISPDYRTKTATIERLPFQHTHVTSVSIHPCKHANVM
                     RVLMERIREVKQRKNASLANTTNPSSGRGKEGDEDWEDIQNDVEGGLRVDQYLIVFLK
                     FVSSVTPGIEHDYTMEGW"
     gene            <474516..>476417
                     /locus_tag="KLTH0A05742g"
                     /db_xref="GeneID:8290512"
     mRNA            <474516..>476417
                     /locus_tag="KLTH0A05742g"
                     /product="KLTH0A05742p"
                     /transcript_id="XM_002551662.1"
                     /db_xref="GeneID:8290512"
     CDS             474516..476417
                     /locus_tag="KLTH0A05742g"
                     /note="similar to uniprot|P40345 Saccharomyces cerevisiae
                     YNR008W LRO1 Acyltransferase that catalyzes diacylglycerol
                     esterification one of several acyltransferases that
                     contribute to triglyceride synthesis putative homolog of
                     human lecithin cholesterol acyltransferase"
                     /codon_start=1
                     /product="KLTH0A05742p"
                     /protein_id="XP_002551708.1"
                     /db_xref="GeneID:8290512"
                     /db_xref="GOA:C5DBV9"
                     /db_xref="InterPro:IPR003386"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DBV9"
                     /translation="MGVKNRRKRQESSPESVTDKGQEKRHGAAASHRHVHKKSKKSSQ
                     ESKKTWRESRRIVFSLGAILGLLIAVYAGAYGGKTNNTLFDNFVNFDSLQDYVDDWKE
                     ILPQGLMSLISDAQRTTSPKDLTESFAVGKQLHKDMNLTDKHPVIMVPGVISTGIESW
                     GLYGDEECSSEAHFRKRLWGSFYMLKTMVLDKVCWLRHVMLDPETGLDPANFTLRAAQ
                     GFEAADFFMAGYWIWNKVLQNLGAIGYDPNKMATAAYDWRLAYLDLERRDSYFSKLKQ
                     KIEMDYKLTGEKTVLVGHSMGSQVVFYFLKWVEAEGPLYGNGGVGWVEKYVDSFVNVA
                     GTLLGAPKTVPALISGEMKDTIQLNALAMYGLEKFFSRKERVDMIQTWGGVPSMLPKG
                     GSMIWGTNEVSVEDNTHNNSHSFGEFIRFERESQSVFSQRSFSMDDSIDLLLRLSPTW
                     LQKRIKDQYSFGVATSEKQMRENELHHTYWSNPLEVPLPDAPSLKIYCIYGVGNPTER
                     AYVYKEDPEHPDLNITIDYESSNPVSFTDGDGTVPVVTHAMCQKWAQGRSPYNPSNAS
                     VKIIEIKHQPERFDIRGGAKSAEHVDILGSAELNEYVLKIAGGKGDSIEPRELTNLSQ
                     WVRDMPFPM"
     gene            <476615..>477211
                     /locus_tag="KLTH0A05764g"
                     /db_xref="GeneID:8290513"
     mRNA            <476615..>477211
                     /locus_tag="KLTH0A05764g"
                     /product="KLTH0A05764p"
                     /transcript_id="XM_002551663.1"
                     /db_xref="GeneID:8290513"
     CDS             476615..477211
                     /locus_tag="KLTH0A05764g"
                     /note="weakly similar to uniprot|P53718 Saccharomyces
                     cerevisiae YNR009W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A05764p"
                     /protein_id="XP_002551709.1"
                     /db_xref="GeneID:8290513"
                     /db_xref="UniProtKB/TrEMBL:C5DBW0"
                     /translation="MPAELERKPLGAVSQSRINQLKGRTHGKVGKPAATTKLPSIMSI
                     IHQETSADTHAPETNTRGSELARPSKSAPECDFDLISEKLRIRMQLAHYKFKTKQGHL
                     KFRQLQPAVPAVTLSAPAEGPRDASSGTTSPLSSSQRRSKPSRRLVGSQGALRTPVKP
                     RTLSSHALAPRAAAESGQNTPMSVEAARSLIDLFTSQH"
     gene            <477538..>478206
                     /locus_tag="KLTH0A05786g"
                     /db_xref="GeneID:8290514"
     mRNA            <477538..>478206
                     /locus_tag="KLTH0A05786g"
                     /product="KLTH0A05786p"
                     /transcript_id="XM_002551664.1"
                     /db_xref="GeneID:8290514"
     CDS             477538..478206
                     /locus_tag="KLTH0A05786g"
                     /note="similar to uniprot|P32352 Saccharomyces cerevisiae
                     YMR202W ERG2 C-8 sterol isomerase catalyzes the
                     isomerization of the delta-8 double bond to the delta-7
                     position at an intermediate step in ergosterol
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0A05786p"
                     /protein_id="XP_002551710.1"
                     /db_xref="GeneID:8290514"
                     /db_xref="InterPro:IPR006716"
                     /db_xref="UniProtKB/TrEMBL:C5DBW1"
                     /translation="MKLLYVVGVLLSTYYIMDKLLYTWLPTNCVFDPDRLVLIANKVI
                     ATHNQMGNSTTEQLLMDVREELAKEYGDKWINPYEKDKWVFNNAGGAMGQMLILHASF
                     SEYLILFGSATGNEGHSGVHFADDWFTILKGTQLASLPENPSPEVYNAGDVHLMRKGY
                     AKQYSMARESYALEYARGWIPFMLPFGFLDTFTSTLDFYTLGKTVWITGRDMLRHLFV
                     NGKF"
     gene            <478459..>478818
                     /locus_tag="KLTH0A05808g"
                     /db_xref="GeneID:8290515"
     mRNA            <478459..>478818
                     /locus_tag="KLTH0A05808g"
                     /product="KLTH0A05808p"
                     /transcript_id="XM_002551665.1"
                     /db_xref="GeneID:8290515"
     CDS             478459..478818
                     /locus_tag="KLTH0A05808g"
                     /note="some similarities with uniprot|P33308 Saccharomyces
                     cerevisiae YNR010W CSE2 Component of the Med9/10 module
                     which is a subcomplex within the RNA polymerase II
                     Mediator complex required for regulation of RNA polymerase
                     II activity"
                     /codon_start=1
                     /product="KLTH0A05808p"
                     /protein_id="XP_002551711.1"
                     /db_xref="GeneID:8290515"
                     /db_xref="GOA:C5DBW2"
                     /db_xref="InterPro:IPR011425"
                     /db_xref="UniProtKB/TrEMBL:C5DBW2"
                     /translation="MASSSLSNASLAQIEALLVPNAQSSGQSSEFIPQLYYALHQVKK
                     DPNSSVNSLETATSSIRHRLKQCKSHIAESEECRALLSKTPEEWEAALRQRQKDLAVK
                     QQVFARLERQIRDLGDH"
     gene            <479011..>480180
                     /locus_tag="KLTH0A05830g"
                     /db_xref="GeneID:8290516"
     mRNA            <479011..>480180
                     /locus_tag="KLTH0A05830g"
                     /product="KLTH0A05830p"
                     /transcript_id="XM_002551666.1"
                     /db_xref="GeneID:8290516"
     CDS             479011..480180
                     /locus_tag="KLTH0A05830g"
                     /note="highly similar to uniprot|P23644 Saccharomyces
                     cerevisiae YMR203W TOM40 Essential component of the
                     preprotein translocase of the mitochondrial outer membrane
                     (TOM complex) in which it constitutes the core element of
                     the protein conducting pore"
                     /codon_start=1
                     /product="KLTH0A05830p"
                     /protein_id="XP_002551712.1"
                     /db_xref="GeneID:8290516"
                     /db_xref="GOA:C5DBW3"
                     /db_xref="InterPro:IPR023614"
                     /db_xref="InterPro:IPR027246"
                     /db_xref="UniProtKB/TrEMBL:C5DBW3"
                     /translation="MSASAPLPLGDFSKIPAIPGVSPMTDSQKRESFWSSNPIFSYLN
                     SVYNNIHAHRQSLALVNPGTIENLNKEVSRDVLVGQYFFTGLRADLNKAFSLNPAFQT
                     SHTLSVGSANLPSYAFSALFANDNMFIQGNVDNELSVSGRLNYGWDKNNITKVTLQFS
                     QGQPSMCQLEQDYQGSDFSLNFKSLNPSVNSKGIFTGVAVGSILQSITPQFALGLEAI
                     FSRGQAGMPADAAVSYVTRYVSPKQDWIFSGQLQANGALVASFWRKVAENVEAGLETS
                     LQASMVPIADPVIGTPIGIQPAIEGSTTLGCKYEYRQSVFRGAIDVNGKVGCFLERKI
                     LPTLSVLFSGEIDHFKQESKLGCGLQFETAGSEELLMLQQGLDPNGNPLQAPVQV"
     gene            complement(<480862..>482028)
                     /locus_tag="KLTH0A05852g"
                     /db_xref="GeneID:8290517"
     mRNA            complement(<480862..>482028)
                     /locus_tag="KLTH0A05852g"
                     /product="KLTH0A05852p"
                     /transcript_id="XM_002551667.1"
                     /db_xref="GeneID:8290517"
     CDS             complement(480862..482028)
                     /locus_tag="KLTH0A05852g"
                     /note="weakly similar to uniprot|Q03694 Saccharomyces
                     cerevisiae YMR204C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A05852p"
                     /protein_id="XP_002551713.1"
                     /db_xref="GeneID:8290517"
                     /db_xref="GOA:C5DBW4"
                     /db_xref="InterPro:IPR024758"
                     /db_xref="UniProtKB/TrEMBL:C5DBW4"
                     /translation="MSGLKASGSTAGEALIRAQQKDPANGAKPSKKKQQSPFKSIKNT
                     LLLRSHKHKKSGANAELVSLNPPKLRRDIVGKSASREKADQKCQQRFSAQRVTLFKYE
                     HVKVMNCNASSQRSNSDSSASTVTSQSTVLRRSSSRDNPSSGSFKRETCLMSNGVLEI
                     YQIITYNVKSPPQKMTYLCLGRKGNIIHPILPRLQVTRLDSPEFKISILLFNPERFWE
                     IEFLPSGELAKLNDQIIFEFEGIISTICSYKSEKSLALDEALPPQQTPGTPDSNESDL
                     EYLLEDSDESFDENVSITGSTCNKDDLIHDAFQKAMKNIAYLDASEKGRGIENKRFSS
                     YPTSSIPSRLQYRSPIVRSTSFPLRLHSNNNDIVNFNILRGSWMDISLDDLRDK"
     gene            complement(<482307..>485327)
                     /locus_tag="KLTH0A05874g"
                     /db_xref="GeneID:8290518"
     mRNA            complement(<482307..>485327)
                     /locus_tag="KLTH0A05874g"
                     /product="KLTH0A05874p"
                     /transcript_id="XM_002551668.1"
                     /db_xref="GeneID:8290518"
     CDS             complement(482307..485327)
                     /locus_tag="KLTH0A05874g"
                     /note="highly similar to uniprot|P16862 Saccharomyces
                     cerevisiae YMR205C PFK2 Beta subunit of heterooctameric
                     phosphofructokinase involved in glycolysis indispensable
                     for anaerobic growth activated by fructose-2
                     6-bisphosphate and AMP mutation inhibits glucose induction
                     of cell cycle-related genes"
                     /codon_start=1
                     /product="KLTH0A05874p"
                     /protein_id="XP_002551714.1"
                     /db_xref="GeneID:8290518"
                     /db_xref="GOA:C5DBW5"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:C5DBW5"
                     /translation="MRNSVSITSSFYDFIKDKLREVRPKRANLAQRRSKSNFSTSESI
                     FLSIEMTVDIPLVNGTSECTVTAYSKDTYQSAVDFYAQFLQLEQESAAGTSTFLRNSN
                     VALEVVLVEDSKKHAASEERLQKLTSSLETADWRSLVSDSLVFKAVDVAQCKANLEEQ
                     KASYQAYPTDLFPMELYAVDPVGNVVGVTKTKNAVSAMPTAPPASKGSFTSTAPSSAQ
                     STIDLTSAGSMSISDSLTAEPKGSEQKAIAVMTSGGDAPGMNANVRAIVRTAISKGCR
                     AYVVMEGYEGLVRGGPEYIKQFNWEDVRGWSSEGGTNIGTARCMEFRERAGRLLGALH
                     LIEAGVDALIVCGGDGSLTGADLFRSEWPSLLEELRDTGKITSEQYTRYKHLNICGTV
                     GSIDNDMSTTDATIGAYSSLDRICRAIDYIEATANSHSRAFVVEVMGRNCGWLALMAG
                     IATTADYILIPEKPASSREWQDQMCDIVSKHRSRGKRTTIVVVAEGAIANDLTPISPN
                     DVHKVLVDRLGLDTRVTTLGHVQRGGTAVAYDRILATLQGVEAVNAVLESSPDTPSPL
                     IAINENKITRKSLVDSVRLTKSVAEAIHAKDFKKAMSLRDTEFVEHLNNFMAVNSADH
                     NPPKLPQEKRLKIAIVNVGAPAGGINSAVYSMATYCMSQGHRPYAIYNGWSGLARHES
                     VRSLDWKSMLGWQSRGGSEIGTNRVTPEEADIGMIAYYFQKYQFDGLMIVGGFEAFVS
                     LHQLERARENYPAFRIPMVLIPATLSNNVPGTEYSLGTDTALNALMDYCDVIKQSAAS
                     TRGTAFVVDVQGGNSGFLATNASLAVGAQVSYVPEEGISLEQLSEDIETLRESFETAQ
                     GRNRFGKLILKSKNASKVFTPEVLAEVMTSEAKGSFSAKSAIPGHVQQGGLPSPIDRT
                     RATRLAIKAVGYIEQQQEVIAKARADDEEFDPDNKEISATAAVLGIKGSHVVFSSIRQ
                     IYDFETEVVKRMPKVIHWESTRAIADSLVGRKKV"
     gene            complement(<486445..>487485)
                     /locus_tag="KLTH0A05896g"
                     /db_xref="GeneID:8290519"
     mRNA            complement(<486445..>487485)
                     /locus_tag="KLTH0A05896g"
                     /product="KLTH0A05896p"
                     /transcript_id="XM_002551669.1"
                     /db_xref="GeneID:8290519"
     CDS             complement(486445..487485)
                     /locus_tag="KLTH0A05896g"
                     /note="highly similar to uniprot|P50107 Saccharomyces
                     cerevisiae YML004C GLO1 Monomeric glyoxalase I catalyzes
                     the detoxification of methylglyoxal (a by-product of
                     glycolysis) via condensation with glutathione to produce
                     S-D-lactoylglutathione expression regulated by
                     methylglyoxal levels and osmotic stress"
                     /codon_start=1
                     /product="KLTH0A05896p"
                     /protein_id="XP_002551715.1"
                     /db_xref="GeneID:8290519"
                     /db_xref="GOA:C5DBW6"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="InterPro:IPR004361"
                     /db_xref="InterPro:IPR018146"
                     /db_xref="InterPro:IPR025870"
                     /db_xref="InterPro:IPR029068"
                     /db_xref="UniProtKB/TrEMBL:C5DBW6"
                     /translation="MHSVARYLGRLTNVYRLPAIRKMSSEAKFYPIKIEAAQNDASLK
                     LNHTCVRVKDPQRSVEFYKSKFGMELVGHKKFPDAKFDLYFLSFPKSNLQHNSRGEID
                     VFRENGMLELTHNYGTESDPTFKVNNGNEEPYRGFGHICFSVADIEKTCKDLEEKGVA
                     FKKKLTDGRQKNIAFALDPDGYWIELVSYGRSDSGEPVKDEGYKFNHTMVRVKDAQKS
                     LEFYQNVLGMKILDISKHENAKFTLYFLSYDGAKPRWMQESVLELTHNWGTESDPDFQ
                     YHNGNSEPQGYGHICISLEDPETLCKEIESQYGDKVQWGVKFNQGKMKNLAFIKDPDG
                     YSIEVVPYGLCT"
     gene            complement(<487673..>490363)
                     /locus_tag="KLTH0A05918g"
                     /db_xref="GeneID:8290520"
     mRNA            complement(<487673..>490363)
                     /locus_tag="KLTH0A05918g"
                     /product="KLTH0A05918p"
                     /transcript_id="XM_002551670.1"
                     /db_xref="GeneID:8290520"
     CDS             complement(487673..490363)
                     /locus_tag="KLTH0A05918g"
                     /note="similar to uniprot|P20095 Saccharomyces cerevisiae
                     YNR011C PRP2 RNA-dependent ATPase in the DEAH-box family
                     required for activation of the spliceosome before the
                     first transesterification step in RNA splicing"
                     /codon_start=1
                     /product="KLTH0A05918p"
                     /protein_id="XP_002551716.1"
                     /db_xref="GeneID:8290520"
                     /db_xref="GOA:C5DBW7"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBW7"
                     /translation="MSGTISGTGKRRLKSHDVVDDAPIKKPKAHEEGASQNDGLQAQQ
                     KSTDLNTGEVDHNIDEMRILARRQYLASREQLKLQVLQQELVFLEKDVEKYGWEQLTQ
                     KERDEITLKRELVALVQQREDAGKHGFKFQDDYIDENGSIDLNRKQQLLKRKPAQNGE
                     KESRQKLWEDQQMKNAVRAASGAEEIYVEGSQGYDFVFDDEAMIEFTEDSNEDVLPEE
                     HSEYDNKLLTELERENKRLLTIQETRKSLPVYHFRQELLTSIKENQILIVVGETGSGK
                     TTQLPQYLVEDGYTQRGRYQIACTQPRRVAATSVAARVADEMNVVLGKQVGYSIRFED
                     KTTPDTTILKYMTDGMLLREFMTDPELSKYACIMIDEAHERTLATDVLLGLLKDILPH
                     RKDLKLIISSATMNATKFSSFFYDAPIFNVPGRRFPVDIHYTLQPEANYLNAAVTTIF
                     QIHTTQALPGDILVFLTGQEEIEAAQQSLEDIAHALGDKIKDMVIAPIYANLPQEQQS
                     KIFQKTPQDCRKIVLATNIAETSLTIDGIKYVVDPGFVKENSYVPSTGMSQLLTVPCS
                     RASVDQRAGRAGRVGPGKCFRIFTKWSYFHELEPLPKPEILRTNLSQVVLLLLSLGVT
                     DLINFPLLDKPSIPALSKALENLYILGALNSKGVITRLGRMMCEFPCEPDFGKVIHTA
                     ATHESCKGALEEVVTIVAMLHETASIFVHARAERDQNKTAVVGKVSSDHMLYLRTFNS
                     WRDMDYSKSWCFDHKVQYKTMVRVRNIRDQLWRCCDKLGLAALNEKAMKSLNVDENLE
                     PRIIKSFIAGFPTNVARLSPTGYRTLGKSQGGVNVSIHPTSTVFQAARQDMKKPSKLI
                     LYQRLVLTSKEFMRDCMPVPREDWLQEMVPHYFNGDNTQD"
     gene            <490562..>492037
                     /locus_tag="KLTH0A05940g"
                     /db_xref="GeneID:8290521"
     mRNA            <490562..>492037
                     /locus_tag="KLTH0A05940g"
                     /product="KLTH0A05940p"
                     /transcript_id="XM_002551671.1"
                     /db_xref="GeneID:8290521"
     CDS             490562..492037
                     /locus_tag="KLTH0A05940g"
                     /note="similar to uniprot|P27515 Saccharomyces cerevisiae
                     YNR012W URK1 converts ATP and uridine to ADP and UMP
                     Uridine kinase"
                     /codon_start=1
                     /product="KLTH0A05940p"
                     /protein_id="XP_002551717.1"
                     /db_xref="GeneID:8290521"
                     /db_xref="GOA:C5DBW8"
                     /db_xref="InterPro:IPR000764"
                     /db_xref="InterPro:IPR006083"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DBW8"
                     /translation="MGGLESNSNSNLSLFIGPEDGSQELRRTGDPADHGPRYIPPWTT
                     PYVIGVGGSSGSGKTSVAAKIISSINTPWTVLISLDNFYKPLTQEQREQAFQNNFDFD
                     EPDSIDLDLAYECIRSLKEGKKTSIPLYSFVHHNRVPGKSVTIYGSSVIVVEGIYALH
                     DKRLLDLMDLKVFVDVDLDVCLARRLSRDIISRGRELDGCIQQWEKFVKPNAEKYVNP
                     SMKNADVIIPSMGNNAVATQTVINHIKSRLQVKSRKHLQELRNLGHTKELKPLSEMGN
                     VHQLEHTSQVVALKTILLDKYTPRDDFVFYFDRIASILISRALDDMPLHPQKQITTPT
                     GIKVTAPSVHFDKVASINIVRSGDCFMRSLKKAVPGMAMGKLLIQSDSNTGEPQLHCE
                     FLPPGLENYEQVLLADAQIISGAAVIMAIQVLLDHGVPLSKIKVLVYLATEIGIRRIV
                     NAFSGSVTIHAGEIVATEALGTHHCKWARKRFVDSQYFGCD"
     gene            complement(<492119..>494842)
                     /locus_tag="KLTH0A05962g"
                     /db_xref="GeneID:8290522"
     mRNA            complement(<492119..>494842)
                     /locus_tag="KLTH0A05962g"
                     /product="KLTH0A05962p"
                     /transcript_id="XM_002551672.1"
                     /db_xref="GeneID:8290522"
     CDS             complement(492119..494842)
                     /locus_tag="KLTH0A05962g"
                     /note="similar to uniprot|P27514 Saccharomyces cerevisiae
                     YNR013C PHO91 Low-affinity phosphate transporter deletion
                     of pho84 pho87 pho89 pho90 and pho91 causes synthetic
                     lethality transcription independent of Pi and Pho4p
                     activity overexpression results in vigorous growth"
                     /codon_start=1
                     /product="KLTH0A05962p"
                     /protein_id="XP_002551718.1"
                     /db_xref="GeneID:8290522"
                     /db_xref="GOA:C5DBW9"
                     /db_xref="InterPro:IPR001898"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="UniProtKB/TrEMBL:C5DBW9"
                     /translation="MTASLYTSNLRHVAEVSRTCLRSRACPGGYSPVGDLPVHRQIAS
                     LIKVPRASHRSLALLPHRPMKFSHSLQFNAVPEWSSRYIAYSQLKRLIYTLQKEKLYQ
                     SSVSDPELVPLHDSYEHKFLEALDKELHKIDAFFAQQETRIFASYHELKDDVAEFYAQ
                     QPLHEFLSRRSSASGASAVSEGLRPALRHAASLSDDDDDDDDDDDDDDDDDGHNNRAG
                     NGGHANSTNNSGFRRRGNSASEMVPLVSRSTHYAGLLDPLMEDRINLKKRLVVAYTQL
                     SELKSFIELNQTGFSKICKKFDKSLDTNVKPGYIASLSSRAHVFSPAALADIDASIGD
                     AISMYARLLGLSTDPNQDPAAIEEAERELSLHLREHVVWERNTVWKDMMNLERQAQNF
                     KTAAHAKRKATQKSLDDEVRMSPSPDELPNATLTDALHMTPAHYFRVLLRSPGILRFT
                     GITAIFLLILEFVPIRDTLQKNCLSIVIYASMLWATETIPLFVTSLLVPLLIVVLPVL
                     KDSEGNVMTSQQSSQYILSTMWSSVIMLLLGGFTLAAALSKYNVAKVVSTHVLASAGT
                     NPKIILLTNMCVALFVSMWVSNVAAPVLCYSIIQPLLRTLPKNSSFAKSLILGIALAS
                     NIGGMASPIASPQNIFSIGMMDPQPTWGQWFIVALPVCAICTLGIWVMLLISFPVDRS
                     LKLLQLHPIKDPFTVQQWYVTLVTIVTIVLWCMAKQLSGIFGEMGIISIIPILLLFGT
                     GMLSSSDFNNFMWTIVVLAMGGTTLGKAVTSSGLLASIANTIKDHVQDKPIFLIVLIF
                     GIVILVMATFVSHTVAAMIIVPLMSEIGKNLPNGDHSRLLIMIAALLCSAAMGLPTSG
                     FPNVTAISMIDELGDRYLTVGNFITRGVPASIWSYFVITTVGYGLMKLIGY"
     gene            <495293..>495949
                     /locus_tag="KLTH0A05984g"
                     /db_xref="GeneID:8290523"
     mRNA            <495293..>495949
                     /locus_tag="KLTH0A05984g"
                     /product="KLTH0A05984p"
                     /transcript_id="XM_002551673.1"
                     /db_xref="GeneID:8290523"
     CDS             495293..495949
                     /locus_tag="KLTH0A05984g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A05984p"
                     /protein_id="XP_002551719.1"
                     /db_xref="GeneID:8290523"
                     /db_xref="UniProtKB/TrEMBL:C5DBX0"
                     /translation="MESSENRPVDAHLVVRYAVAEDNGETGAGSAEGAAWEHGSRRGS
                     VQGTSICVVEPWRGPGQGSTPEAAPTRRLSASMRVSDLYQCVHSRETSMSGPGALWGA
                     GGEEVSPGTSPGTSPRTSVAQQGAGGVETRVPTAAAAPPPSRNSSLLSSSSQQSPRSR
                     TGSQDSEALGACPGHECASHDAHGDCWIDASTPCDRHHHRRKSTAIKFRKALYEDPGT
                     "
     gene            complement(<496157..>500506)
                     /locus_tag="KLTH0A06006g"
                     /db_xref="GeneID:8290524"
     mRNA            complement(<496157..>500506)
                     /locus_tag="KLTH0A06006g"
                     /product="KLTH0A06006p"
                     /transcript_id="XM_002551674.1"
                     /db_xref="GeneID:8290524"
     CDS             complement(496157..500506)
                     /locus_tag="KLTH0A06006g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A06006p"
                     /protein_id="XP_002551720.1"
                     /db_xref="GeneID:8290524"
                     /db_xref="InterPro:IPR012965"
                     /db_xref="UniProtKB/TrEMBL:C5DBX1"
                     /translation="MIKIRAFTKKLSGGFDSPKAHKKRSVSEYDKKHESSRSARSSMR
                     RRAISSTQNIKTELPPLPTQEYTLSTASTASQDDTLGSPARASRSGKHYIYDQEAYKK
                     ASSALAKPDPNYSILNKKNGINPTSAKDVMHYLVLHFKHTLIQQTTGESDKKMDSIKA
                     AMEIFRPNLSHYVSHEVGETIHILESFFPLDGCSLTGDALKKEINEQIGTSKHKLILA
                     LRIIWSKLPLGVVPWESYLKFCTVESKQNFSKMCFENFLPQVLPDNDYKCCAFDFMDV
                     LVSIISMVDLVVDKAAQMDLLFTAGQVCFVKTPELLNYIDHKDSENADCITLAKLYRA
                     RGEALYRLFVSYLNSLAEEGKIKNFYLIDNFRIDEYPPKPYRPVTQRALTLTIPQLWD
                     PEENNFNELIRVAAKTQIRTYSSNHPFSKLENSFLDKFEENPYKIVSTLFSRSSKRYL
                     YKFDPHFDAEYFKPLSKKYGTPSTLGPGDQQAVATWINSCKERGFNDFLSVLDDNNHG
                     EGTLALGFSFPKVSQEESESLPPVRVSKVEISECFISSWKYETFLAKVHNTLVIKLTK
                     RIGDCEWLVIAMDERVGNFGYVAPSKPNESAKERDWSTLSTPPLPSKNPASYHSASDS
                     MSSVKTRPPPPSLLGEPSSSPLLDSATGVFSDRSSVRLSSRPTSDLTSVYSNVRHHTK
                     NNSSFDQRKFSAFDVHESPLQHSSPRLSSQSEHVTKVGSHSSKVSSRVISVSSPLSEV
                     RDDEETQPLRTEKKEATETPSVQHKSHSNKNDANESQLQQPKTGAEAAAKPEISRGLE
                     SPLKLDRVPASQGTAKVENSARVEEPLKSEQTEKVGQHAEAEKCAEAKTPVNAENPVK
                     VEEPLKAEESLKFEKPEETEEPEKTEKPEKTGEALKANKPLKTEEPLKAEEPVKAKEV
                     VENEEPVKATGDEKFVKAEEPSKLEKPYEVGRSAEINESVKTEEQPKIEEHAKAEEPV
                     RGEELLKAKEFSKVKQLAQLDDEPKVETTIKSNDINENTVPLCGQSPTEKEETVQSSS
                     PDENVEAKNALAESAANRTLHAEENYSLSKNGKNLTQLRLSKGSTDSDSSGETSSDQE
                     ISSLESAVEVPEVHGQKPGFGHSSETLTIGDNLAKNERKQKGLSESTQTTIDWAQQSE
                     PSDSAKKPESESKADSKAEVTLQSPLAIKLKYEDSSLSVSTPVNALPPNGLPQLPMKV
                     QNPSVASFADATVKPDSAESTMDTSETTQVQEEPKAKAKAATKNPEPYSGSIQKRNSR
                     VVEELRKSKILSNDVLTEDLLSDLLENYDTLSTEPINSENGPTVFERVRVYFERQAAN
                     AEEAFSGSTDGDSPATRESHTESLNSKNGTWFSCNVTPPNRSGKRVKNPKNLQLHGTE
                     RAAGGPDGSGALSRTPSVAGRGLEKNGVWLELEDHPSSPAEMSSPTQAMFRHMMMKTK
                     RSLRSLKKSSDAA"
     gene            <502053..>503246
                     /locus_tag="KLTH0A06028g"
                     /db_xref="GeneID:8290525"
     mRNA            <502053..>503246
                     /locus_tag="KLTH0A06028g"
                     /product="KLTH0A06028p"
                     /transcript_id="XM_002551675.1"
                     /db_xref="GeneID:8290525"
     CDS             502053..503246
                     /locus_tag="KLTH0A06028g"
                     /note="similar to uniprot|P53720 Saccharomyces cerevisiae
                     YNR015W SMM1 Dihydrouridine synthase"
                     /codon_start=1
                     /product="KLTH0A06028p"
                     /protein_id="XP_002551721.1"
                     /db_xref="GeneID:8290525"
                     /db_xref="GOA:C5DBX2"
                     /db_xref="InterPro:IPR001269"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR018517"
                     /db_xref="UniProtKB/TrEMBL:C5DBX2"
                     /translation="MVTYTGKLVLAPMVRAGELPTRLLALKYGADLVWSPEIIDKKLI
                     QCKRQVNDKLKTIDFVAPSSNDNKPPCVVFRTFPDAERGRLIFQMGTSTPSLAVEAAM
                     VVIKDVDGIDVNAGCPKHFSIHSGMGAALLKTPETLCSILSSLVEKVGRPHEKPISVK
                     IRILDSEELTLNLVKKLCGTGISNLTVHCRTTPMRNRQAPIRNYVPSIYKICQANNVS
                     LIMNGAIQSLEHFRQLRKQMDLPETIGGMMADCAEANPTVFSEAPLSWPDTARAYLDL
                     ASKFDHSVNNVKYMLSRIIPGKSKFYQYFTRCKTMEEVMYVSQQMGSDGEVLSDPTDY
                     LAKRREHERILKQKAGDMKAKAKQKQDQTTANKDSAEAELTNSEKRREGGLEVGMGKK
                     RAKIE"
     gene            complement(<504244..>510936)
                     /locus_tag="KLTH0A06050g"
                     /db_xref="GeneID:8290526"
     mRNA            complement(<504244..>510936)
                     /locus_tag="KLTH0A06050g"
                     /product="KLTH0A06050p"
                     /transcript_id="XM_002551676.1"
                     /db_xref="GeneID:8290526"
     CDS             complement(504244..510936)
                     /locus_tag="KLTH0A06050g"
                     /note="highly similar to uniprot|Q00955 Saccharomyces
                     cerevisiae YNR016C ACC1 Acetyl-CoA carboxylase biotin
                     containing enzyme that catalyzes the carboxylation of
                     acetyl-CoA to form malonyl-CoA required for de novo
                     biosynthesis of long-chain fatty acids or YMR207C
                     uniprot|P32874 Saccharomyces cerevisiae YMR207C HFA1
                     Mitochondrial acetyl-coenzyme A carboxylase, catalyzes the
                     production of malonyl-CoA in mitochondrial fatty acid
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0A06050p"
                     /protein_id="XP_002551722.1"
                     /db_xref="GeneID:8290526"
                     /db_xref="GOA:C5DBX3"
                     /db_xref="InterPro:IPR000022"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR001882"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR005481"
                     /db_xref="InterPro:IPR005482"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="InterPro:IPR011054"
                     /db_xref="InterPro:IPR011761"
                     /db_xref="InterPro:IPR011762"
                     /db_xref="InterPro:IPR011763"
                     /db_xref="InterPro:IPR011764"
                     /db_xref="InterPro:IPR013537"
                     /db_xref="InterPro:IPR013815"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR016185"
                     /db_xref="InterPro:IPR029045"
                     /db_xref="UniProtKB/TrEMBL:C5DBX3"
                     /translation="MSEESLSEVGVSQKDQYEVTDYTSKHASLAPHFLGLNTVEKAED
                     SPLKEFVKCHGGHTVISKVLIANNGIAAVKEIRSVRKWAYETFGNERAVQFVAMATPE
                     DLEANAEYLRMADQYVEVPGGTNNNNYANVDLIVEIAERADVDAVWAGWGHASENPLL
                     PERLAKSPRKVIFIGPPGNAMRSLGDKISSTIVAQHASVPCIPWSGTGVDQVHLDKEN
                     GLVSVTDDVYQKGCCDSPEDGLAKAKQIGFPVMVKASEGGGGKGIRKVEREEDFIPLY
                     KQAANEIPGSPIFIMKLAGKARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAP
                     VTIAKPDTFSEMERSAVRLGKLVGYVSAGTVEYLYSHDDDKFYFLELNPRLQVEHPTT
                     EMVTGVNLPAAQLQIAMGIPMHRVKDIRLLYGVDPHTATEIDFDFSSKDSKQIQRKPT
                     PKGHCTACRITSEDPNEGFKPSGGSLHELNFRSSSNVWGYFSVSSSGGIHSFSDSQFG
                     HIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEGNSITTGWLDDL
                     ISQKMTAEKPDPTLAVICGAATKVFIASENGRKEFITSLQKGQVPNKSLLQTMYPVEF
                     IHDGKRYKFTVAKSADDRYTLFINGSKCEVGVRKLSDGGLLIAVGGRSHTIYWKEEVS
                     ATRLSVDSMTTLLEVENDPTQLRTPSPGKLVKFLVENGDHVNAGQPYAEVEVMKMQMP
                     LVSQESGIVQLLKQPGSTVSAGDILAILALDDPTKVKHAMPFEGMLPDMGAPIVEGTK
                     PAYKFRSLVSTLENILNGYDNQVIMNASLQQLIEVLRNPQLPYSEWKMQSSALHSRLP
                     IKLDEQLEQLVNRSLSRNAHFPARQLGKMLEAAQKESDDPLFGTVIEPLLDISTRYAD
                     GLEAHEHSVFAKFLQNYYQVEKLFSGTNVREEDVILKLRDENAENLDRVALTVLSHSR
                     VSAKNNLILAILKHYQPLCKMSSEVSSRISEPLKQIVELESKATAKVALQAREILIQA
                     ALPSVRERTDQIEHILRSSVVQTAYGAFDNKRTDPDLEILKDLIDSNYVVFDVLTQFL
                     THRDPSVAAAAAEVYIRRAYRAYTIGDLKHYNHANNAVVEWKFQLPSAAFASVPQMKS
                     KLGMHRAISVSDLTYVSEGDNQPLRTGILIASTHLDDVDEGLSKGLQLVPHHTSSSGP
                     VPDRSGSNATLSNVANVSVSSTDGFESEEEVLRRLREILDMNKQQLVEASIRRITFIF
                     GYEDGTYPKYFTFRGPSYAEDETIRHIEPALAFQLELGRMSNFNIKQLFTENRNIHVY
                     EATGKNSAVDKRFFTRGIIRTGRISDDITIQEYLTSEANRLMSNILDNLEVIDTSNSD
                     LNHIFIHFSAVFDVSPEDVEAAFGGFLERFGKRLLRLRVAAAEIRIIIKDPQTGAPVP
                     LRALINNVSGYVVKTELYTEVKNAQGEWVFKSLDKPGSMHLRPIATPYPAKESLQPKR
                     YKAHLMGTTYVYDFPELFRQATVSQWKKISPKTKLSDEFFIANELIEEEDGELTEIDR
                     EAGANTIGMVAFKVTVKTPEYPRGRQFVIVANDITFKIGSFGPQEDAFFNKVTEYARK
                     RGIPRIYLSANSGARIGVAEELIPLFNVSWNDPENPAKGFQYLYLSSEGMAELKKQAK
                     DASVVTERVVEDGEERFVIKSIIGADDGLGVECLKGSGLIAGATSRAYKDIFTITLVT
                     CRSVGIGAYLVRLGQRAIQIEGQPIILTGAPAINKLLGREVYSSNLQLGGTQIMYNNG
                     VSHLTAEDDLAGVQKIMEWLSYVPARRDLPVPILETEDKWDREVDFTPSTSEPYDVRW
                     MIEGRNTPEGFEYGLFDKGSFQETLSGWAKGVVVGRARLGGIPLGVIGVETRMVENMI
                     PADPANPVSTESLIQEAGQVWYPNSAFKTAQAINDFNYGEQLPLMIMANWRGFSGGQR
                     DMYNEVLKYGSFIVDALVGYKQPIFTYIPPTGELRGGSWVVVDPTINAEQMEMYADVN
                     SRAGVLEPEGMVGIKYRREKLLATMARLDETYKNLKTQMSDPGLSVEKHQEIATKLAA
                     REKMLMPIYHQITVQFADLHDRSGRMVAKGVISKELDWPEARRFFFWRLRRRLNEEYL
                     MKRLNTELPNAPRLEKIARLSSWYPASVDREDDRIVANWIEENYSVLEEHLKALKVES
                     FAQNLAKSIRSDHENAISGLSEVLKLLSAEDKAKILNSLK"
     gene            <512774..>513424
                     /locus_tag="KLTH0A06072g"
                     /db_xref="GeneID:8290527"
     mRNA            <512774..>513424
                     /locus_tag="KLTH0A06072g"
                     /product="KLTH0A06072p"
                     /transcript_id="XM_002551677.1"
                     /db_xref="GeneID:8290527"
     CDS             512774..513424
                     /locus_tag="KLTH0A06072g"
                     /note="similar to uniprot|P32897 Saccharomyces cerevisiae
                     YNR017W MAS6 Essential protein of the mitochondrial inner
                     membrane component of the mitochondrial import system"
                     /codon_start=1
                     /product="KLTH0A06072p"
                     /protein_id="XP_002551723.1"
                     /db_xref="GeneID:8290527"
                     /db_xref="GOA:C5DBX4"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="InterPro:IPR005681"
                     /db_xref="UniProtKB/TrEMBL:C5DBX4"
                     /translation="MSWLFGGSNKETEGSQKTAQDESKLQSTLGFDPSQVTNVSSIIS
                     TPGALDPARLHPLAGLERGVEYLDLEEEQLSTMEGSRSLIPSRGWTDDLCYGTGAVYL
                     IGLGLGGSYGFFEGLRNIPPNSPGKLQLNTVLNHITRRGPFLGNNAGVLTLTYNLVNS
                     TIDGLRGKHESANSVAAGALTGAIFKSSKGLKPMGYASGMMAVAAAGWCGLKSVLL"
     gene            complement(<513667..>515157)
                     /locus_tag="KLTH0A06094g"
                     /db_xref="GeneID:8290528"
     mRNA            complement(<513667..>515157)
                     /locus_tag="KLTH0A06094g"
                     /product="KLTH0A06094p"
                     /transcript_id="XM_002551678.1"
                     /db_xref="GeneID:8290528"
     CDS             complement(513667..515157)
                     /locus_tag="KLTH0A06094g"
                     /note="similar to uniprot|P25381 Saccharomyces cerevisiae
                     YCR045C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A06094p"
                     /protein_id="XP_002551724.1"
                     /db_xref="GeneID:8290528"
                     /db_xref="GOA:C5DBX5"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR015500"
                     /db_xref="InterPro:IPR022398"
                     /db_xref="InterPro:IPR023827"
                     /db_xref="InterPro:IPR023828"
                     /db_xref="UniProtKB/TrEMBL:C5DBX5"
                     /translation="MRTSLIGALVATSASLAQAEEFLVRLKAPRTLAKAVESRISDGI
                     LDVFSEGKILRTFSFGKFEGLTVDFPLSLVSKLRGNPLIAEIVPNVEFNVFDAVEGLE
                     GWGDDEDEDGDYDDDNEEGEDEGDDDVLSIVAQKKAPRHLARISRRTALPYDPENISV
                     PATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQLEGRAKFGADLVGEGPGDFNGHGTH
                     VAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSVISAIEFTVNHCRKSRRGCVANLS
                     LGSFRNTVLNQAVEAALEAGVVIVVAAGNSNANACWSSPASSLSAITVGAFDDRTDTI
                     ARFSNWGNCVDIFAPGVKIESLSNVPPFKPVAFSGTSMASPIVSGMVANLLDSGIHPF
                     DIKTELIDLATDSVFHKRTLLFKPGTPNRVAFTGIDKTDDVYEDAVYPSVDIDRLVKD
                     LQSYNSDGHVAEDDATLPLGEIKIKKRSQIVTTLAPPHLSPHSQLA"
     gene            <517260..>517925
                     /locus_tag="KLTH0A06138g"
                     /db_xref="GeneID:8290530"
     mRNA            <517260..>517925
                     /locus_tag="KLTH0A06138g"
                     /product="KLTH0A06138p"
                     /transcript_id="XM_002551679.1"
                     /db_xref="GeneID:8290530"
     CDS             517260..517925
                     /locus_tag="KLTH0A06138g"
                     /note="similar to uniprot|P53721 Saccharomyces cerevisiae
                     YNR018W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A06138p"
                     /protein_id="XP_002551725.1"
                     /db_xref="GeneID:8290530"
                     /db_xref="GOA:C5DBX6"
                     /db_xref="InterPro:IPR007667"
                     /db_xref="UniProtKB/TrEMBL:C5DBX6"
                     /translation="MKILTEEEIEAHHYHTLSGGVKGTVAGLVISGLLFRYAPVKFPK
                     FQPKRMPWSLKTAMFITPPTLLASIGAEEASTSFDNMMYGSGSASRDAIEEHRRWKSL
                     PLSEKLTEGASNHKYKIIVAAWAASMWGSWKFVDRDPIMTKTQKAVQARMYAQGLTVM
                     LLLGSIGLSMYEEKLHPDAKKLDRSKRWERLLERAEEEEARAQKEAGFRSNEDRVKAK
                     IFK"
     gene            complement(<518116..>518625)
                     /locus_tag="KLTH0A06160g"
                     /db_xref="GeneID:8290531"
     mRNA            complement(<518116..>518625)
                     /locus_tag="KLTH0A06160g"
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /transcript_id="XM_002551680.1"
                     /db_xref="GeneID:8290531"
     CDS             complement(518116..518625)
                     /locus_tag="KLTH0A06160g"
                     /note="similar to uniprot|P25626 Saccharomyces cerevisiae
                     YCR046C IMG1 Mitochondrial ribosomal protein of the small
                     subunit required for respiration and for maintenance of
                     the mitochondrial genome"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG1"
                     /protein_id="XP_002551726.1"
                     /db_xref="GeneID:8290531"
                     /db_xref="GOA:C5DBX7"
                     /db_xref="InterPro:IPR001857"
                     /db_xref="InterPro:IPR008991"
                     /db_xref="UniProtKB/TrEMBL:C5DBX7"
                     /translation="MLGFRGFSKTFSRGYQVKSTTFKTIPVYPAVQSPSNHNLLSSLS
                     KQELDKKLDPEGWRRSLISSHNKERLRAGDVVRVAYNQQKCKYDNLMGYVLSVDRKAL
                     EQDASILLRNQYSKTFVEVRVPIFSPLVERIDLIRRADGRRQRSKHYYIRGTKLDVGD
                     LEAGMRKRR"
     gene            complement(<518948..>519754)
                     /locus_tag="KLTH0A06182g"
                     /db_xref="GeneID:8290532"
     mRNA            complement(<518948..>519754)
                     /locus_tag="KLTH0A06182g"
                     /product="KLTH0A06182p"
                     /transcript_id="XM_002551681.1"
                     /db_xref="GeneID:8290532"
     CDS             complement(518948..519754)
                     /locus_tag="KLTH0A06182g"
                     /note="highly similar to uniprot|P25627 Saccharomyces
                     cerevisiae YCR047C BUD23 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="KLTH0A06182p"
                     /protein_id="XP_002551727.1"
                     /db_xref="GeneID:8290532"
                     /db_xref="GOA:C5DBX8"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR022238"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DBX8"
                     /translation="MSRPEDLAPPEVFYNDSESQKYTSSTRVQHIQAKMSLRALELLN
                     LSHMSFVLDIGCGSGLSGEILTEEGHVWCGVDISPSMLATGLTRELEGDLMLHDMGQG
                     LPFRAGTFDAAISISAIQWLCNADTSYNDPKQRLMRFFNTLFACLKKGGKFVAQFYPK
                     NDDQTEQILGAAKVAGFSGGLVVDDPESKKNKKYYLVLSAGASQEEEQVNLQGVTMNA
                     EELAKTKRDRRKEVESNKVYINRKKELMRKRGRKVAKDSKFTGRKRRPRF"
     gene            <521514..>523202
                     /locus_tag="KLTH0A06204g"
                     /db_xref="GeneID:8290533"
     mRNA            <521514..>523202
                     /locus_tag="KLTH0A06204g"
                     /product="KLTH0A06204p"
                     /transcript_id="XM_002551682.1"
                     /db_xref="GeneID:8290533"
     CDS             521514..523202
                     /locus_tag="KLTH0A06204g"
                     /note="similar to uniprot|P53629 Saccharomyces cerevisiae
                     YNR019W ARE2 Acyl-CoA:sterol acyltransferase isozyme of
                     Are1p endoplasmic reticulum enzyme that contributes the
                     major sterol esterification activity in the presence of
                     oxygen"
                     /codon_start=1
                     /product="KLTH0A06204p"
                     /protein_id="XP_002551728.1"
                     /db_xref="GeneID:8290533"
                     /db_xref="GOA:C5DBX9"
                     /db_xref="InterPro:IPR004299"
                     /db_xref="InterPro:IPR014371"
                     /db_xref="UniProtKB/TrEMBL:C5DBX9"
                     /translation="MTKDPKRPKKVLTQEFEKIQEISKNTESRRPLPGVETGMEEYGS
                     ENVPKKQDEEPLYKSYAAVLHNKEKHRFHWQTGEMRSLFGDVGFDRRNTIMDNLVESS
                     LTETSFKGAGWGKLQREKEIEAVPAGADPERVFFNFSGFYVLFWMIVAFIVLRVGVDY
                     YISHNGDLSQSEILRFMTTDLISVAMIDLVMYLCTYFVVFVQLACKHKWITWNNLGWY
                     LTSAFEVTFVLVFLYVAENVMKFHWVAKIFLFLHSLVLLMKMHSFAFYNGYLWNITAE
                     LDFSKKTLAKYKDYTLEKGFKEALEKSVEFCEFELSLQSPNLKFPDNLTLKGYFTYSM
                     FPTVVYQIEYPRTEKIRWMYVFEKLCAIFGVIFVMMIVAQFFMYPIAMRAMAVRDAGM
                     PIFWERIREWLYLLLKLVPSFIMMYLLVWYLIWDAILNCIAELTRFGDRYFYGDWWNC
                     VSWDEFSRQWNVPVHQFLLRHVYHSSISFLQLNKTQATLMTFFLSSVVHELAMYVLFQ
                     KLRFYLFFLQMAQIPLVQLGNSRFLKDKKILGNAIFWIGICTGPSLMCTLYLTF"
     gene            complement(<523293..>524024)
                     /locus_tag="KLTH0A06226g"
                     /db_xref="GeneID:8290534"
     mRNA            complement(<523293..>524024)
                     /locus_tag="KLTH0A06226g"
                     /product="KLTH0A06226p"
                     /transcript_id="XM_002551683.1"
                     /db_xref="GeneID:8290534"
     CDS             complement(523293..524024)
                     /locus_tag="KLTH0A06226g"
                     /note="similar to uniprot|P53722 Saccharomyces cerevisiae
                     YNR020C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A06226p"
                     /protein_id="XP_002551729.1"
                     /db_xref="GeneID:8290534"
                     /db_xref="GOA:C5DBY0"
                     /db_xref="InterPro:IPR019165"
                     /db_xref="UniProtKB/TrEMBL:C5DBY0"
                     /translation="MGDVIPPNEEIKRPKPPLDESSVRGFNWWRRTFQYKTGLGLTTV
                     EKDRYENDYQFIIQRDQCNKCYEYRDWLLKYSPTVIFMAQQIAKLNKKDTNALKFDES
                     KIICDICPEWRSGGFHPELGILLCQNRIRDKWHLEDTMAHEMVHYFDNLKWQVDWLNL
                     KHHACSEIRASSLSGECRFMQEFSRRGFGFKVSGGHQECVRRRATLSVMGNPNCKDQK
                     HAEKIVNEVWDSCFGDTRPFEEIYR"
     gene            <524183..>524791
                     /locus_tag="KLTH0A06248g"
                     /db_xref="GeneID:8290535"
     mRNA            <524183..>524791
                     /locus_tag="KLTH0A06248g"
                     /product="KLTH0A06248p"
                     /transcript_id="XM_002551684.1"
                     /db_xref="GeneID:8290535"
     CDS             524183..524791
                     /locus_tag="KLTH0A06248g"
                     /note="similar to uniprot|P25631 Saccharomyces cerevisiae
                     YCR051W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A06248p"
                     /protein_id="XP_002551730.1"
                     /db_xref="GeneID:8290535"
                     /db_xref="InterPro:IPR002110"
                     /db_xref="InterPro:IPR020683"
                     /db_xref="UniProtKB/TrEMBL:C5DBY1"
                     /translation="MNIWIAASDGRAELVEKFLSEGFTAESKDPNGYTPIHAAASYGH
                     IDLLRELCSAPYSGSVNVRDNDGDTPLHHCEDANTARVILEELGGDAKLTNNEGKTAL
                     AVCEEDGEFTDLIQYLRGVSGQQEEPLGIDSEQLAQFKDNLRYTLENDPETDDPQSIE
                     RRQKLEQILNGGNPEQDLENYIRDLVRSQLLADDEPSKRRKD"
     gene            <525035..>526264
                     /locus_tag="KLTH0A06270g"
                     /db_xref="GeneID:8290536"
     mRNA            <525035..>526264
                     /locus_tag="KLTH0A06270g"
                     /product="KLTH0A06270p"
                     /transcript_id="XM_002551685.1"
                     /db_xref="GeneID:8290536"
     CDS             525035..526264
                     /locus_tag="KLTH0A06270g"
                     /note="similar to uniprot|P53723 Saccharomyces cerevisiae
                     YNR021W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A06270p"
                     /protein_id="XP_002551731.1"
                     /db_xref="GeneID:8290536"
                     /db_xref="InterPro:IPR012879"
                     /db_xref="UniProtKB/TrEMBL:C5DBY2"
                     /translation="MSILEPFLKLSNYANKLNEKYAAMPIGELRALTLAERIRFYNWT
                     FEIWALALLAAVYGAYVIGTRLNSRRATQLFDSLTDGFQKLAFAKVGFSTKAGEKKQY
                     VAEQNNTWYTTFATGRSSIESITARAHMTARYNPLTLLMERVVGLFFPSLFEKDLGEF
                     LEVSIVPNGIYVTSPNADLPKEDAVTAILSRFKFIASIVNKSVMTKARETNYFLSLTH
                     TSESEKLPVEYVFMSESNQLNGFFEHYAGPEFKDLLAKCSRFLSFVSFTDLPEEKPIT
                     DKLWNLKQKPRCVIHCEFVTGTKDLNLLNQLIAEIVKIFDAVTQDYAQNPTKAFLTND
                     MLKKASNLRSQELQKIVKVMKQVERELAQEKKQDVEREKRRQMRSKLSGQEQDKIDQK
                     MREKRERRMRNRQKVRM"
     gene            complement(<526397..>526825)
                     /locus_tag="KLTH0A06292g"
                     /db_xref="GeneID:8290537"
     mRNA            complement(<526397..>526825)
                     /locus_tag="KLTH0A06292g"
                     /product="KLTH0A06292p"
                     /transcript_id="XM_002551686.1"
                     /db_xref="GeneID:8290537"
     CDS             complement(526397..526825)
                     /locus_tag="KLTH0A06292g"
                     /note="similar to uniprot|P53724 Saccharomyces cerevisiae
                     YNR022C MRPL50 Mitochondrial ribosomal protein of the
                     large subunit not essential for mitochondrial translation"
                     /codon_start=1
                     /product="KLTH0A06292p"
                     /protein_id="XP_002551732.1"
                     /db_xref="GeneID:8290537"
                     /db_xref="UniProtKB/TrEMBL:C5DBY3"
                     /translation="MFKAPALRAYSALSKRSKKVKVQLLKDFPQFQLYKGQVTQVSPS
                     LMRNYLHLSNGARYILHEEEIDEGLRAESIAAAAARATSVQKAVKRQIEAAAEKIKGN
                     DAKESEKTKESEKPDAEKQAPRVFNSGVTINDVKIPGLDI"
     gene            <527454..>528776
                     /locus_tag="KLTH0A06314g"
                     /db_xref="GeneID:8290538"
     mRNA            <527454..>528776
                     /locus_tag="KLTH0A06314g"
                     /product="KLTH0A06314p"
                     /transcript_id="XM_002551687.1"
                     /db_xref="GeneID:8290538"
     CDS             527454..528776
                     /locus_tag="KLTH0A06314g"
                     /note="some similarities with uniprot|P53628 Saccharomyces
                     cerevisiae YNR023W SNF12 73 kDa subunit of the SWI/SNF
                     transcription activation complex homolog of Rsc6p subunit
                     of the RSC chromatin remodeling complex"
                     /codon_start=1
                     /product="KLTH0A06314p"
                     /protein_id="XP_002551733.1"
                     /db_xref="GeneID:8290538"
                     /db_xref="InterPro:IPR003121"
                     /db_xref="UniProtKB/TrEMBL:C5DBY4"
                     /translation="MSKPRKQSIQPQANQRTTPLPITQPTDAYIPPFLVEQVPELKSY
                     KQLLEAESKIDIYISRKKIDLYQSVSQWNSLKQEAQEKQYLRIFVSNIAENQAWQTND
                     ANAQPSWTLRIEGRLLNDLDVNDPQRPKFSSFLQGIAVDFTRPQNADAGAQDQQQPQP
                     LVPSIVEWHADPSALAEFDGLDVKRDGAENVKCRIAIQPRGVTGEWIQFSPELSSIIG
                     MSRGTLHEAVYSLYKYILINDLLTSEDDVQAPGNPSSNSTNGERTITKIDKYLAALFP
                     DERKTMRLAEIPSLVNRHISPLPPIRIDYTIRVDKASTYGETVIDIEVPAVSEDEVAR
                     EGMSLLTELNQLSTTLEPQMQALNQELNILQLQLNASANKYQFFSKLSKDPVPMLQEY
                     MDSSSRALKVLSGDDGFNEDTVRRAQFYKDNEAMLFENLSVLLSNGRM"
     gene            <528991..>530520
                     /locus_tag="KLTH0A06336g"
                     /db_xref="GeneID:8290539"
     mRNA            <528991..>530520
                     /locus_tag="KLTH0A06336g"
                     /product="KLTH0A06336p"
                     /transcript_id="XM_002551688.1"
                     /db_xref="GeneID:8290539"
     CDS             528991..530520
                     /locus_tag="KLTH0A06336g"
                     /note="highly similar to uniprot|P16120 Saccharomyces
                     cerevisiae YCR053W THR4 threonine synthase"
                     /codon_start=1
                     /product="KLTH0A06336p"
                     /protein_id="XP_002551734.1"
                     /db_xref="GeneID:8290539"
                     /db_xref="GOA:C5DBY5"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR004450"
                     /db_xref="InterPro:IPR029144"
                     /db_xref="UniProtKB/TrEMBL:C5DBY5"
                     /translation="MSKTYRSTRSSSKDTKSFEETIIQGLASDGGLFIPSEIPQVSEE
                     TLKQWSQLSFQGLALEIMKLYISSEEIPEADLKVLIERSYSTFRSKDVTPLAKDVTGK
                     NEHLHILELFHGPTYAFKDVALQFVGNLFEYFLQRANKDLPQEQRKRITVVGATSGDT
                     GSAAIYGMRGKKDVSVFILYPTGRISPIQEEQMTTVPDQNVQTLSVKGTFDNCQDIVK
                     AIFGDVEFNKKHNVGAVNSINWARILAQMTYYFYAYFQATNGSPSKVKFVVPSGNFGD
                     ILAGYYAKKMGLPVERLIIATNENDILDRFLKSGVYERSDDVAATLSPAMDILISSNF
                     ERLLWYLARDVLASNDDQKAGEILNQWFTQLKTKGKFEVDSAVVKHALVDFDSERVSN
                     AETTSTIKETYANSQNPQHYILDPHTAVGVCATKRQMAKDNDKSIQYISLSTAHPAKF
                     AEAVNEALSSFEGYSFEKDVLPDELKVLSTLEKKLKFVEKADVELVKSAIEEELAKMG
                     L"
     gene            complement(<532367..>535114)
                     /locus_tag="KLTH0A06380g"
                     /db_xref="GeneID:8290541"
     mRNA            complement(<532367..>535114)
                     /locus_tag="KLTH0A06380g"
                     /product="KLTH0A06380p"
                     /transcript_id="XM_002551689.1"
                     /db_xref="GeneID:8290541"
     CDS             complement(532367..535114)
                     /locus_tag="KLTH0A06380g"
                     /note="highly similar to uniprot|P25636 Saccharomyces
                     cerevisiae YCR057C PWP2 part of small (ribosomal) subunit
                     (SSU) processosome (contains U3 snoRNA) Eight WD-repeats
                     with homology with G protein beta subunits flanked by
                     nonhomologous N-terminal and C-terminal extensions
                     regulatory protein"
                     /codon_start=1
                     /product="KLTH0A06380p"
                     /protein_id="XP_002551735.1"
                     /db_xref="GeneID:8290541"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007148"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="InterPro:IPR027145"
                     /db_xref="UniProtKB/TrEMBL:C5DBY6"
                     /translation="MKSDFRFSNLLGTVYRQGNILFSEDGTQLISPVGNRVSVFDLVH
                     NKSFTFEYEHRKNISCVALNPQGTLLLSVDEDGRAILVNFRAKTVLHHLNFKEKVRDL
                     KFSPDGKLFALACGRFVQVWKTPEVAEDRQFAPFVRYRVHAGHFSDIISLTWSQDSRF
                     LVSTSKDLTARIWSLDSEEKDLASVTFAGHRDYVMGAFFSSDQERIYTVSKDGAVFQW
                     EYTIRPGYEALGEEPETEIDPSLYSWRITKKNYFYASQARVKCVTFHAKSNMLIVGFN
                     NGEFRLYELPGFTLLQQLSMGQNAVNAVSVNNTGEWLAFGSSKLGQLLVYEWQSESYI
                     LKQQGHFDATNAVTYSPDGSRVVTASEDGKIKIWDVVSGFCLVTFQEHTSAVTGLAFA
                     KKGQVLFSASLDGTVRAWDLVRYRNFRTFTAAERIQFNCLAADPSGEVVCAGSVDSFA
                     IHVWSVQTGQLVETLDGHEGPVSCLSFSRENSVLASASWDKTIRVWSIFGRSQQVEPL
                     EVYADVLSIAVRPDGNEVAASTLDGQVLFFDINEGKQVGAIDGKKDIVSGRHLEDRFT
                     AKSSARSKYFTTIDYSFDGLSIVAGGNNNSICLYDIPNSVLLKRFIVSRNMSLNGTQQ
                     FLNSKKMTEAGSLDLIDRDAENSDLEDRIDNSLPGSSRGGDLSTRRVRPAIRITGLKF
                     SPTSNAFAAASTEGILIYSVDDSLIFDPFDLDIDITPQAVIETLQEKEYLHSLVMAFR
                     LNEEYLINRVYEAVPLKDIELVSSGLPVVYLARMLKFIGDFAMESQHLEFNLIWIKAL
                     LSAHGHYISSHKNEFGSCLRSVQRFIGRIAKDVVAASKDNKYAYFFLTSTDGSVEGGV
                     SDGEDHKHVNNSDSEDEADGSEDEVLTGASDDEEGWIGVTDTKNKLPLQLEEDSDEDL
                     I"
     gene            <535357..>535836
                     /locus_tag="KLTH0A06402g"
                     /db_xref="GeneID:8290542"
     mRNA            <535357..>535836
                     /locus_tag="KLTH0A06402g"
                     /product="KLTH0A06402p"
                     /transcript_id="XM_002551690.1"
                     /db_xref="GeneID:8290542"
     CDS             535357..535836
                     /locus_tag="KLTH0A06402g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A06402p"
                     /protein_id="XP_002551736.1"
                     /db_xref="GeneID:8290542"
                     /db_xref="UniProtKB/TrEMBL:C5DBY7"
                     /translation="MSKEVSGKLSSRVMNMKFMKQADQAEEIEQEKQKVQHHVDTSEW
                     ALSGGEEFKSRLRPQLRTAGTTEIMEQTQSAPVVGRRKFGSQAKTEPEGTTEPGLDEL
                     WENQKGKKRKAGEAAGEKDEKETDQSEDEEEEAPAKRFKSQQEKTDKRERKSSKRKN"
     gene            complement(<535960..>536772)
                     /locus_tag="KLTH0A06424g"
                     /db_xref="GeneID:8290543"
     mRNA            complement(<535960..>536772)
                     /locus_tag="KLTH0A06424g"
                     /product="KLTH0A06424p"
                     /transcript_id="XM_002551691.1"
                     /db_xref="GeneID:8290543"
     CDS             complement(535960..536772)
                     /locus_tag="KLTH0A06424g"
                     /note="similar to uniprot|P25637 Saccharomyces cerevisiae
                     YCR059C YIH1 piecemeal microautophagy of the nucleus
                     (PMN)"
                     /codon_start=1
                     /product="KLTH0A06424p"
                     /protein_id="XP_002551737.1"
                     /db_xref="GeneID:8290543"
                     /db_xref="InterPro:IPR001498"
                     /db_xref="InterPro:IPR006575"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR023582"
                     /db_xref="UniProtKB/TrEMBL:C5DBY8"
                     /translation="MSQEELQQELEAIDAIYPDFMERLSETQCVIKIPEHEAISVHLS
                     FPTGYPTQSAPQVLQVNGAHDPKALRDQFEGVMEDIWKQDVCIFDFLTEVAEACSQVS
                     DQDLLLSESDVQADAALQQQLESLQLEVSAAALDVTWFQSDPVVDRGSTFIAFAAHAS
                     SEEDACLKLDQLRMDPKVSKCQHVMTAWRIRGEGSVTYQDCEDDGETAAGGRLLHLLT
                     LMDAWDVVVGVARWFTGTHIGPDRFKHINSTAREAVLRGSFADASKAGKKKK"
     gene            <538144..>539985
                     /locus_tag="KLTH0A06446g"
                     /db_xref="GeneID:8290544"
     mRNA            <538144..>539985
                     /locus_tag="KLTH0A06446g"
                     /product="KLTH0A06446p"
                     /transcript_id="XM_002551692.1"
                     /db_xref="GeneID:8290544"
     CDS             538144..539985
                     /locus_tag="KLTH0A06446g"
                     /note="similar to uniprot|P25639 Saccharomyces cerevisiae
                     YCR061W Protein of unknown function green fluorescent
                     protein (GFP)-fusion protein localizes to the cytoplasm in
                     a punctate pattern"
                     /codon_start=1
                     /product="KLTH0A06446p"
                     /protein_id="XP_002551738.1"
                     /db_xref="GeneID:8290544"
                     /db_xref="InterPro:IPR018825"
                     /db_xref="InterPro:IPR018827"
                     /db_xref="UniProtKB/TrEMBL:C5DBY9"
                     /translation="MRRSLIMAGAAAALGVAVRGDMDMDMEMGMDAGDSAEIMPMGGG
                     SAASKTEAGAGGSAAASAPSAVLSAVPHEPKHVHGLPILQTQLTAAERLYWENYNTTT
                     FFNLPEGTRGAGLARYHAAAVALATAAVYPASLVLYGARQCSARCARLYVAVVVANGA
                     LLFSAMAALLALRGHNPVPYPGNAYAKTCYVVAVLCAVQTLAAVARFWTHDRHVTSVA
                     GDGGLAPADAERFELVAADRHHSHSSDGSELSAALSHQHKPEPESEPTLEFDAERALD
                     LEAHRRALSFHTDADSRLARVAGLVQSLTTWPLLYMLMIHCVIGLAVGNLFGEGLRVF
                     NLLAHWIKGGVFVLLGMLSLARYSGYGAGRGWAWNRSIVRVHPTSAVNNLRRMILPYG
                     SVITMEYIESFLIFFYGSTNVFLEHLSNTDGQWHAKDLQHVSIAFMYIGCGLCGLITE
                     YKLSDWRRKHATSDPGECQTSDSNVTGTPGYTPNPFPAFTIFWTGILMSQHAQASAVS
                     TAIHVQWGLLLSYGSFFRLLTFFMLIWKPNTDSKPSRPFTELVTSFCLLCGGLIFMES
                     TDQVVEALEYRGLTSMFTFNLSVGFTTLFMAWEMILFMWGDWLHQRA"
     gene            <540882..>541502
                     /locus_tag="KLTH0A06468g"
                     /db_xref="GeneID:8290545"
     mRNA            <540882..>541502
                     /locus_tag="KLTH0A06468g"
                     /product="KLTH0A06468p"
                     /transcript_id="XM_002551693.1"
                     /db_xref="GeneID:8290545"
     CDS             540882..541502
                     /locus_tag="KLTH0A06468g"
                     /note="similar to uniprot|Q07923 Saccharomyces cerevisiae
                     YLR011W LOT6 Putative NADPH-dependent FMN reductase with
                     strong ferricyanide reductase activity in vitro gene
                     expression increases in cultures shifted to a lower
                     temperature"
                     /codon_start=1
                     /product="KLTH0A06468p"
                     /protein_id="XP_002551739.1"
                     /db_xref="GeneID:8290545"
                     /db_xref="GOA:C5DBZ0"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="InterPro:IPR029039"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ0"
                     /translation="MLIGVIIGSTRSPRVCPQIAQFILDTIERSKSYQELSEKPLLKI
                     IDIADWNLPLYDESNVPSQIKRSEDYDHEHTKLWSLEIQKYNGFIFVTPQYNWGYPAA
                     LKNAIDYLFNEWKGKSAAIVTYGGHGGTKCNEQLAVVLEGLRMIPTQSRVLLSFPDRD
                     TLYAAASGKDLGLSSNPSGDLWTTEKTQIEATFNELFESIVKTQDL"
     gene            541900..541994
                     /locus_tag="KLTH0A06490r"
                     /db_xref="GeneID:8290546"
     tRNA            join(541900..541936,541950..541994)
                     /locus_tag="KLTH0A06490r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (CGA) cove"
                     /db_xref="GeneID:8290546"
     gene            <542323..>542790
                     /locus_tag="KLTH0A06512g"
                     /db_xref="GeneID:8290547"
     mRNA            <542323..>542790
                     /locus_tag="KLTH0A06512g"
                     /product="KLTH0A06512p"
                     /transcript_id="XM_002551694.1"
                     /db_xref="GeneID:8290547"
     CDS             542323..542790
                     /locus_tag="KLTH0A06512g"
                     /note="highly similar to uniprot|P25337 Saccharomyces
                     cerevisiae YCR063W BUD31 Protein involved in bud-site
                     selection diploid mutants display a random budding pattern
                     instead of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="KLTH0A06512p"
                     /protein_id="XP_002551740.1"
                     /db_xref="GeneID:8290547"
                     /db_xref="GOA:C5DBZ1"
                     /db_xref="InterPro:IPR001748"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ1"
                     /translation="MPRIKTKNTKATPAGFDKIKPTLIDFDIQLKELQDDKASRLAAN
                     ADQGAWKVFQLSHERTRYVYDLYYKRKAISKELYEWLLREKYADKMLIAKWKKKGYEK
                     LCCLRCIQTSETAQGNTCICRVPRATLEKNSKDGVVTFTRCVHCGCSGCASTD"
     gene            <543130..>544806
                     /locus_tag="KLTH0A06534g"
                     /db_xref="GeneID:8290548"
     mRNA            <543130..>544806
                     /locus_tag="KLTH0A06534g"
                     /product="KLTH0A06534p"
                     /transcript_id="XM_002551695.1"
                     /db_xref="GeneID:8290548"
     CDS             543130..544806
                     /locus_tag="KLTH0A06534g"
                     /note="weakly similar to uniprot|P25364 Saccharomyces
                     cerevisiae YCR065W HCM1 Forkhead transcription factor
                     involved in cell cycle specific transcription of SPC110
                     encoding a spindle pole body (SPB) calmodulin binding
                     protein dosage-dependent suppressor of calmodulin mutants
                     with specific defects in SPB assembly"
                     /codon_start=1
                     /product="KLTH0A06534p"
                     /protein_id="XP_002551741.1"
                     /db_xref="GeneID:8290548"
                     /db_xref="GOA:C5DBZ2"
                     /db_xref="InterPro:IPR001766"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR018122"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ2"
                     /translation="MEASAGTAVVGVEHSKRRRDSADAAEPPTLTPPHSTLRKAGTPV
                     KRGKNQHPLSPELSSPIRPHKTRKSKSDTPLITTRSSNSQTLEELIEAFTDRKRLLLL
                     QDPNKKPPFSYAMLIGLAILQSTEVRLTLSQIYQWITYHFPYYKLGDYGWQNSIRHNL
                     SLNEAFVKGEKAPDGKGHYWQVKSGCEGKFFKSGQTDDEVRTKLRKLCSDVLAVTSNP
                     RSPEPELLGKSLYDEGTTTEVERRRLGGRKLDDVYALDISSDEDESFQEQSINNLSRV
                     ASSPVGLREALLPFEQASANKEAINQDAFIGELSPAIPYSENDAGASETKNETAFPSL
                     RKSYSADCPQQELWSAPSLTLSPKKDAKKYTCSFNANFEASPHTRTPKTGPLLEGFGS
                     PGSELEGVDFTGPLDLLKTPQLKHANNHEFSYTPRGNTSMKKWRTPTVLFQDFSRSPV
                     LMNSAGPPMMVIDDCVSEEVSCRKPDPFQLGKFCSLPLCESQTHSHKFFENIRYSSGL
                     FGVDVCSVWKRAVEGSRETADRSGKETLLDTPFQGTSRRASTSKEDRVYE"
     gene            <545636..>547018
                     /locus_tag="KLTH0A06556g"
                     /db_xref="GeneID:8290549"
     mRNA            <545636..>547018
                     /locus_tag="KLTH0A06556g"
                     /product="KLTH0A06556p"
                     /transcript_id="XM_002551696.1"
                     /db_xref="GeneID:8290549"
     CDS             545636..547018
                     /locus_tag="KLTH0A06556g"
                     /note="similar to uniprot|P10862 Saccharomyces cerevisiae
                     YCR066W RAD18 Protein involved in postreplication repair
                     binds single-stranded DNA and has single-stranded DNA
                     dependent ATPase activity forms heterodimer with Rad6p
                     contains RING-finger motif"
                     /codon_start=1
                     /product="KLTH0A06556p"
                     /protein_id="XP_002551742.1"
                     /db_xref="GeneID:8290549"
                     /db_xref="GOA:C5DBZ3"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003034"
                     /db_xref="InterPro:IPR004580"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR017907"
                     /db_xref="InterPro:IPR018957"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ3"
                     /translation="MSRLPKLSEQIQDVSDPRDFLRTKLPELVDLDTLLRCHICKGFI
                     KTPVLTPCGHTFCSLCIREYLNRELKCPLCLAELRESMLRSEFLVNEIIASYVGLRSK
                     LLEIARSGPDGTVPHSDTSLIEIAPGDEGAHELSGDDDLQIIETRRNRPAKRNAEIVL
                     MPSKKSRRDSEKPGISSMISKSKSPALPEDSAECPICQKHFPLEYLQRTHLDECLTMG
                     SLGAAAKPTSPPKIGKASNETTVSVQPAAERISEPSVSANTTHSNRYLESGQKQGVAR
                     LAKLNFSSMSMQQLKSKLTSLKLSTIGSRQQLINRYNHYEMLWNSNFMDSIEPLEEKE
                     LRRRLASWEATHNSSEGTLRKGNISKLLNKNSTTRIKDFKTDRFDRKGWILAHQQEFN
                     ELLEEARHNLAKANKMKYSASNQDEVEDAEQAESHPNSISCEKGEIPSNQLVVKTEEI
                     STSSQGTTGV"
     gene            complement(<547101..>550316)
                     /locus_tag="KLTH0A06578g"
                     /db_xref="GeneID:8290550"
     mRNA            complement(<547101..>550316)
                     /locus_tag="KLTH0A06578g"
                     /product="KLTH0A06578p"
                     /transcript_id="XM_002551697.1"
                     /db_xref="GeneID:8290550"
     CDS             complement(547101..550316)
                     /locus_tag="KLTH0A06578g"
                     /note="similar to uniprot|P11655 Saccharomyces cerevisiae
                     YNR026C SEC12 Guanine nucleotide exchange factor (GEF)
                     glycosylated integral membrane protein of the endoplasmic
                     reticulum important for the initiation of transport
                     vesicle budding from the endoplasmic reticulum through
                     activation of the GTPase Sar1p"
                     /codon_start=1
                     /product="KLTH0A06578p"
                     /protein_id="XP_002551743.1"
                     /db_xref="GeneID:8290550"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ4"
                     /translation="MSHKRTMKFQQAVYNIGYPAYGARFLNDNVLLVAGGGGEGNNGI
                     PNKLTALQVSFDKRKVIKRFRELTLNENDDSPTTLDAANNIILMGCNENSEKIKATGE
                     NLHLRKYVFENEHLKFVASIDMDHSSKFEDYTKLTYMSQDGSVAAIASSKVPTVIRIM
                     NPNLLTETYEIETGNDVKDLHFSPDGKVLSYITSSTLEVISIVTGRFIVRKTDFDKSW
                     ALSKIKFIGEDTVLIAAALKKGTGIVLSKVSLKSGTTSVLKTRLVTTKLRGVTSMDVD
                     PTGQLAALSGNDNSIVLVRLKNLTVAKFFKQVHSFAITKVAFSPNGKILASVSAANTI
                     HVILVPDKLATSVPILERIVKLFINFVLIVVVAAAVQISYKYDLHTKAYRYGVAKWNA
                     RRDSFIMNDVFRQTTLVGDVVSIETHTNFAPTESSSVNTPIYETTVPELSTTSPYSSS
                     WSSPVPEDPLLTSDASTVEEPEYFPSSLEEISAENESANSEASSSMTVSASMTASISG
                     VQESAVSASEEKPTQATQKSSSESEALLSDSNDISTENGLNKSKAQQQFYEVDKTLEQ
                     QPTPTSVQSSDVHSGISLTAGNSKGEEASPSHKISSASSGASSNISLGEPVSKLPSAS
                     KASPMDTPIEESSPETRVAVSEESSKSASTVPELTPKIARDVSNEKPVEKSANAIPEA
                     STQALSPALAEAPVKTHSSFSNQEATSLTTTPAFSATGRVASADSPKKANSEFGELQD
                     TERERDFDLKASAGASDAISSEEPVTENKTYDASSPSSFISDTTNTQIASSPIANSVS
                     STIANSSLSSESKKAKEINTSSPSRSQEPARSEIITTTASTAVEDKSAAPTTLSQAIS
                     QDESDGSKAKTESNVIPTQASATGIVSPVQLMASTESSNLNKVPKSSNSAQSETEVAE
                     AKVHLSTPEELQSTEKTDEIKTSSPHISSWGKNPSSNTNAPTNSIALPDDFENRFTPE
                     DETYSEEKRSPIEDEELEADAQIYSEQVYPSQIEVADPLPQSTPEPSVSREPKDTESY
                     SEPVGSQSGDSTAGSSSVSASGSVEETSATSMQTEVTHDEL"
     gene            <550407..>551324
                     /locus_tag="KLTH0A06600g"
                     /db_xref="GeneID:8290551"
     mRNA            <550407..>551324
                     /locus_tag="KLTH0A06600g"
                     /product="KLTH0A06600p"
                     /transcript_id="XM_002551698.1"
                     /db_xref="GeneID:8290551"
     CDS             550407..551324
                     /locus_tag="KLTH0A06600g"
                     /note="similar to uniprot|P53727 Saccharomyces cerevisiae
                     YNR027W BUD17 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="KLTH0A06600p"
                     /protein_id="XP_002551744.1"
                     /db_xref="GeneID:8290551"
                     /db_xref="GOA:C5DBZ5"
                     /db_xref="InterPro:IPR004625"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="InterPro:IPR029056"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ5"
                     /translation="MARKVLSIQSHVVHGYVGNKAATFPLQYRGWDVDALNTVQFSNH
                     PGYGHFKGFRSEASDLQGIIEKGLLGGLDIQYDAVLTGYLPDIEGLRAIGKTLIKLCE
                     KDHRVKWVLDPVLGDNGKLYVPEEAIPVYRDILTHGAVYLATPNQFEMEVLTGVQICD
                     LASLKQSIQQFHELYPRVQNVVVTSVSFHSAGDSISELICACSEQESRRAHYFKVPKI
                     DAQFSGSGDLCSALLLDSFLTQNPAARDLCAALNQVLSLVDSILLNTFELYKASIAAP
                     PLKINDLRLIESRELLKQTTAPKYVPIKL"
     gene            <551457..>553004
                     /locus_tag="KLTH0A06622g"
                     /db_xref="GeneID:8290552"
     mRNA            <551457..>553004
                     /locus_tag="KLTH0A06622g"
                     /product="KLTH0A06622p"
                     /transcript_id="XM_002551699.1"
                     /db_xref="GeneID:8290552"
     CDS             551457..553004
                     /locus_tag="KLTH0A06622g"
                     /note="similar to uniprot|P25641 Saccharomyces cerevisiae
                     YCR068W ATG15 Lipase required for intravacuolar lysis of
                     autophagic bodies located in the endoplasmic reticulum
                     membrane and targeted to intravacuolar vesicles during
                     autophagy via the multivesicular body (MVB) pathway"
                     /codon_start=1
                     /product="KLTH0A06622p"
                     /protein_id="XP_002551745.1"
                     /db_xref="GeneID:8290552"
                     /db_xref="GOA:C5DBZ6"
                     /db_xref="InterPro:IPR002921"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ6"
                     /translation="MDDTKSLKRRTRFRIFKSHLGLASFVLATICAVLLWYKKHEYTS
                     VSIRDRGSSQSSFRLTRTYRHGISQDPYMQVLDIDEQVLQAGQERFMEHVSMLSDEEA
                     QDDDMWTSKPEYSTSNPLDFEFRLASEPLRMKRMLHRDPQFVESYLDFSHENPHMAAK
                     VNLEWIDKTVLVPNVSDKQTVISLALMSSDAYVRLPHTGDWRNLTEPWNHTHNSGHGW
                     ENDGLRGHLFVNSEQDIVVMAVKGTSARGLAGSGEDETTVNDQINDNLLFSCCCARIS
                     YLWTTVCDCYMKSYTCDETCLEQELSRKDRYYKAVLNFYKDVVAEYPNSTIWVTGHSL
                     GGALASLLGRTYGLPVVAFEAPGELLATRRLHLPMPPGYPDYLEGIWHFGNTADPIFM
                     GTCNGASSSCSIAGYAMETSCHTGKVCVYDVVKDKGWHVSMLNHRIHKVIDGVIDSYE
                     GPARCIPPGPCHDCYNWKYVQKGHSSSVSQTRSPKTTSTSTVPPEPTITSSCVGRNWI
                     GICTEYE"
     gene            complement(<553084..>555270)
                     /locus_tag="KLTH0A06644g"
                     /db_xref="GeneID:8290553"
     mRNA            complement(<553084..>555270)
                     /locus_tag="KLTH0A06644g"
                     /product="KLTH0A06644p"
                     /transcript_id="XM_002551700.1"
                     /db_xref="GeneID:8290553"
     CDS             complement(553084..555270)
                     /locus_tag="KLTH0A06644g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A06644p"
                     /protein_id="XP_002551746.1"
                     /db_xref="GeneID:8290553"
                     /db_xref="GOA:C5DBZ7"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ7"
                     /translation="MAEKSSSKVSKPRKLKKNGQRALKACDSCRRMKTRCIPSPLPEE
                     VQCLRCDTFNLRCSFQDLLSDDEGAETLALLKEQKSSSGTGSATYESAELTKRLLKSG
                     YSPEDFAVHAKLLQNVNKNVTKILELLANQAPPAAPESSSHPAAPGNPSSRAVSALTE
                     AVQMMTSSSGHTLVPSGLVGPESREVSPELDDISAKRTEQRHLTPYLTCPFTMVSQMV
                     SRENLPLPICKIQDHEMLPQGLVDDVVGLNLLTLEEVVLLTQDFRDGYGKWCSFPESM
                     STEKLVEVLRSRNASLLLSAICVLALRYTLSYHDLKTRIYKNLLYKLKSDLELSLRHN
                     PHGIEFIQALVVLSMYASSYSSDIMSVDAWYLSGIGLQQFLTLNIPDALFNRENDYAE
                     PTDFFSLGLSSPLDSAPSHLLSPESQFQKLQTSRLWNHLCLAHITNCVFSGRMCIVDG
                     VRIDLCRRILDFPNSTNFDGRMVAEISMQLILYNFVQHCNVHPPKSPNSTTAFDKVHE
                     ELQVWIEEWRYLFSQPIHPNTQYAEFAYNYSRTIVLYTWYHRCYRARKMHLAKRARVN
                     PSRPTDLNIMNKTSIGNYLSQEYPVEDVINSIPKDKRLDMLKHAHRSLETMINDNPEN
                     FRYLSDQLFFQCVHCSLVCLIIAHSLYHFSDGLLGEDHLEQILSDVKKYSLRLQKIRE
                     GELKSFWVEEVDLKIPSVILQYHRAIETCLQDKFPEYEIHVDDGYP"
     gene            <556052..>556993
                     /locus_tag="KLTH0A06666g"
                     /db_xref="GeneID:8290554"
     mRNA            <556052..>556993
                     /locus_tag="KLTH0A06666g"
                     /product="KLTH0A06666p"
                     /transcript_id="XM_002551701.1"
                     /db_xref="GeneID:8290554"
     CDS             556052..556993
                     /locus_tag="KLTH0A06666g"
                     /note="similar to uniprot|P25334 Saccharomyces cerevisiae
                     YCR069W CPR4 Peptidyl-prolyl cis-trans isomerase
                     (cyclophilin) catalyzes the cis-trans isomerization of
                     peptide bonds N-terminal to proline residues has a
                     potential role in the secretory pathway"
                     /codon_start=1
                     /product="KLTH0A06666p"
                     /protein_id="XP_002551747.1"
                     /db_xref="GeneID:8290554"
                     /db_xref="GOA:C5DBZ8"
                     /db_xref="InterPro:IPR002130"
                     /db_xref="InterPro:IPR020892"
                     /db_xref="InterPro:IPR029000"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ8"
                     /translation="MLVNYVLWVLSALMCFAKAATIDDAKLYAPNPPVTHRAFFTIEY
                     FNNATQQVEETDVTIELYGTVVPKTVDNFVKLAKGVTAVMKGKDEKKDRFTLGYKNTL
                     FHRIINDFMIQGGDVLPDVGPFNTFGGMFFDDENFDLKHDRPGRLSMANINKPDTNAS
                     QFFIVTSTRALDELDGKHVVFGQVVAGLEGLLEKVQFVETTKDEYKPKHDVKLKYSLV
                     EDLQISNKEQLHEKYLQDLLAFQNGDRSKGLTMSTTIKQGAKEEKIMRELRYEDLHHP
                     LVKVVLGMVLISAIYVVSKNRKRIFSKTTKIVSMRHE"
     gene            complement(<557036..>558268)
                     /locus_tag="KLTH0A06688g"
                     /db_xref="GeneID:8290555"
     mRNA            complement(<557036..>558268)
                     /locus_tag="KLTH0A06688g"
                     /product="KLTH0A06688p"
                     /transcript_id="XM_002551702.1"
                     /db_xref="GeneID:8290555"
     CDS             complement(557036..558268)
                     /locus_tag="KLTH0A06688g"
                     /note="similar to uniprot|P53729 Saccharomyces cerevisiae
                     YNR029C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A06688p"
                     /protein_id="XP_002551748.1"
                     /db_xref="GeneID:8290555"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR011629"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DBZ9"
                     /translation="MSALKDFSYKEDEDGDIPSLIEGNEENLSDILNSIKSDGGGTIV
                     SDKKIELANTQIEEAGSSEAPRVPVTIITGYLGSGKSTLLEKIALKGSDKKIAVILNE
                     FGDSSEIEKSMTIRNGENSYEEWLDLGNGCLCCSLQDVGVKAIESLIARCPGKIDYII
                     LETSGIADPRPIAKMFWQDDGLYSNVYLDGIVTVLDAENILTCLDDVSPATHWHGEKV
                     VTDDNITIAHLQVALADCILINKIDRLGAAANQDAVREIENRVRQINAAASLHHTSFG
                     EVSLDKVLDLHAFESVKFEGSSDSTMHDPRIRTVTLTFRALKDEDEFQRFLDGFLRTV
                     HWKGFGHDLEGDWEIQRTKGLIIVGDNCKVVQGVRETFDVLPGKRLDSAVSCKMVFIG
                     KGISREALLQILKTVIEV"
     gene            <558390..>560036
                     /locus_tag="KLTH0A06710g"
                     /db_xref="GeneID:8290556"
     mRNA            <558390..>560036
                     /locus_tag="KLTH0A06710g"
                     /product="KLTH0A06710p"
                     /transcript_id="XM_002551703.1"
                     /db_xref="GeneID:8290556"
     CDS             558390..560036
                     /locus_tag="KLTH0A06710g"
                     /note="similar to uniprot|P53730 Saccharomyces cerevisiae
                     YNR030W ECM39 Alpha-1 6-mannosyltransferase localized to
                     the ER responsible for the addition of the alpha-1 6
                     mannose to dolichol-linked Man7GlcNAc2 acts in the
                     dolichol pathway for N-glycosylation"
                     /codon_start=1
                     /product="KLTH0A06710p"
                     /protein_id="XP_002551749.1"
                     /db_xref="GeneID:8290556"
                     /db_xref="GOA:C5DC00"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:C5DC00"
                     /translation="MKLDVWDVALLAVIFLHLWYSPFTKVEESFTIQAIHDILKYGIR
                     DISKYDHLQFPGVVPRTFIGPLIIAFLAKPLVAGSELLFGSDSGPSSGLRTQLLVRGV
                     IGFTNGLSLVFLKHQVQALFDRRNDVAQTKKEQDVSETPTNSYVGTLFALFSTTQFHL
                     MFYSSRPLPNFVIALPVANCAFALIMAHRFGSAIALLGFASVVFRLEMTALTAGIALS
                     VLWFKKASLVRVIEFGALGVMSGAALSIFVDSHFWRYSTFPEADSFLFNVVAGKSVEW
                     GSTPFYSYVTSSLPSLFLPPTALLLNFIGLRAAPQEVKIVAQAAYFHILILSFQPHKE
                     WRFIIYAVPAITLVASCGASRIFQMKGFKEANLLKAVILISSVVSLVISVAFSFISSM
                     NYPGGEALQQFNEYASRRNVSNTVVHLDVPVCMTGATLFGQLEDAHNITYDKTEDLGS
                     LRKNWDSYDFLITSIPDPFDFPVESNDQWELLHSTKAFSGINILQLSIVLESELRDNF
                     PTLKMLVYTRSLAPVVDAIKGAITTDTIFTYKRSGSKFNT"
     gene            complement(<560106..>560624)
                     /locus_tag="KLTH0A06732g"
                     /db_xref="GeneID:8290557"
     mRNA            complement(<560106..>560624)
                     /locus_tag="KLTH0A06732g"
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /transcript_id="XM_002551704.1"
                     /db_xref="GeneID:8290557"
     CDS             complement(560106..560624)
                     /locus_tag="KLTH0A06732g"
                     /note="similar to uniprot|P25642 Saccharomyces cerevisiae
                     YCR071C IMG2 Mitochondrial ribosomal protein of the small
                     subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein IMG2"
                     /protein_id="XP_002551750.1"
                     /db_xref="GeneID:8290557"
                     /db_xref="GOA:C5DC01"
                     /db_xref="InterPro:IPR007740"
                     /db_xref="UniProtKB/TrEMBL:C5DC01"
                     /translation="MLVRFGLRTARHQGGLVCSGLQTIRPAMRLASSSLDINSGKLDD
                     GRELSALTEQEINDLSTAFEEQTFSVFPRLQDVKPEELVGFAKFGVQSYFIERSATGN
                     LPVYTDFKRGGKVVTEIRKIHGDPVQLRNDLQARLSHLPKDSFKVMMQAKKIIIEGDV
                     VRQVKEALSSKF"
     gene            complement(<560921..>562465)
                     /locus_tag="KLTH0A06754g"
                     /db_xref="GeneID:8290558"
     mRNA            complement(<560921..>562465)
                     /locus_tag="KLTH0A06754g"
                     /product="KLTH0A06754p"
                     /transcript_id="XM_002551705.1"
                     /db_xref="GeneID:8290558"
     CDS             complement(560921..562465)
                     /locus_tag="KLTH0A06754g"
                     /note="highly similar to uniprot|P25382 Saccharomyces
                     cerevisiae YCR072C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0A06754p"
                     /protein_id="XP_002551751.1"
                     /db_xref="GeneID:8290558"
                     /db_xref="GOA:C5DC02"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012972"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DC02"
                     /translation="MATLVPPPSKKQKRQAQQPRQVDLIPEDLPHVLVKFQAFDTGES
                     VGGSVRVPGAMTEQQLEQLLNQLHGETDEPVPYTFSCMVDAEKGKPEQLVDIKDNIYN
                     SILKPGYKTTEDFITIVYTPRAVFKVRPVTRSSSAIAGHGSTILCSAFAPHTSSRMVT
                     GAGDNTARIWDCNTNTPMQTLKGHFNWVLCVAWSPDGELIATGSMDNTIRLWQSEKGE
                     NFGDALRGHSKWITSLSWEPIHLVKPGDKPRLASASKDGTIKIWDTARRVCLFTLSGH
                     TNSVSCVKWGGRGVLYSGSHDKTIRAWDMNAGGKCINILKSHAHWINHLSLSTDYALR
                     VGAFDHTGKKPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTK
                     PITRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGTFIATFRGHVASVYQVA
                     WSSDCRLLVSCSKDTTLKVWDVRTKKLSVDLPGHKDEVYTVDWSVDGKRVCSAGKDKM
                     VRIWTH"
     gene            complement(<562932..>567503)
                     /locus_tag="KLTH0A06776g"
                     /db_xref="GeneID:8290559"
     mRNA            complement(<562932..>567503)
                     /locus_tag="KLTH0A06776g"
                     /product="KLTH0A06776p"
                     /transcript_id="XM_002551706.1"
                     /db_xref="GeneID:8290559"
     CDS             complement(562932..567503)
                     /locus_tag="KLTH0A06776g"
                     /note="similar to uniprot|P53599 Saccharomyces cerevisiae
                     YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
                     kinase kinase kinase activator of Pbs2p"
                     /codon_start=1
                     /product="KLTH0A06776p"
                     /protein_id="XP_002551752.1"
                     /db_xref="GeneID:8290559"
                     /db_xref="GOA:C5DC03"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017240"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DC03"
                     /translation="MAEKDYFSFKQGYTLEDRGAPSGRHKARTRLRSGGPGTGPSRSF
                     SPSRQGPRSPGYYTANSLRSPPAAAGSSPLSTMKLSASAKHTMGTAMANAMGSSMGMA
                     GPPGGRKSRNPSVSGPSSNTAGGGGGSMSASSSMSVTSPGRQHRANSLSLSSTRMSST
                     QSAESSASVTPTLVLPPNLASLNSQSTSNMSLQGGAGHSTSSSSTSLKPMQKQYVLNE
                     ELYLNRMKNSNLDDYYTRGIAASANDEEDETDTDAEDTDADESAFGTNFFTTTEKGGA
                     LKFDDELITISPKFLLARMDWLRNADPDSPDVKGLLGPQQRLPSGPSAGRTLFAAAAP
                     PTAEGNSYGYLQRLAKNSHVLERLEWQAMLANVLKGDIVKSEKSKIAYQGGSLNTSSQ
                     YADELWLELKAWMNCRTIEEEKTTLEYLRNSTDSVFQEIMDMNFADDVPVETAVNTIK
                     PLIDRYHQVTSYWRTEQHMHYDKPVTGREEFIHRVAAMNTFLTLKQAFECEIEALKKW
                     TGNDSLDVKFTNTFYDIEGVYKNDRPFAEQILKERDIESIFQKKLFYRHAPWILKAKV
                     SIFTLSQTVKEMNLPLLHNELEILLMFPFKLVKEIILIRIEYAKKLQNPTMMMIDQMI
                     DDFSSYIRLSVQIKHTVIVYCSDWEFTTKIDADFDDAVNEAIVYLFKLLHLKLIDSAR
                     KSFKTFREPEELLKYWDQLKNVGCFIPGAGHVVAEGFSHLTLRLLNRLHSYILREQNH
                     PPAFEKESDVEKWLVQAMENCGTVKRKINRFSNVLTKAFQNSVNYRVNDNKELLKRLK
                     ESGHFLVYTGGELEGNGVYLFCSSELLGCSDDEILKILHNVEIGSDLIPNVEINNSLS
                     VYNALESGWDQNATLFQEYCANGVAYYHVQSEQQNKSSGGRVRRAAAAHANPFEDFKS
                     EEDELFELEMKLKSLGYIIAYCPKEPILWEGEMLNLSEDKVLTMQDFDIKLPADSLVL
                     LNQGSTYAMEYQSDKFQHYVGESVSFSERRCSMNAIEYTLQKINRAYFRITYSVLANM
                     QKVTNAIQKEFRGNETLNNLFLFCRDFARNFLRLNVATYEKKSIIIMLLMRISINWIK
                     FLVDDCDPTDLHTFRWCVPAMEFAMQMTTGWNILGLDEDQFSVLQEKISGCMSLLISH
                     FDIMGARTLEAEKNNHPQVRSYIGTCEDDTDSILAVNSKVRVEAINELEKRLKGNPRH
                     IGKVLDESDKDNQYLQSLASSLSNVSIRWQKRHFIGGGAFGTVFSAVNLDTGEILAVK
                     EIKIQDRNTMKQVFPAIKEEMSVLEMLNHPNVVQYYGVEVHRDKVNLFMEYCEGGSLA
                     QLLEHGRIEDEMVTQVYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGA
                     ARSLAANGTKVANNGSEGKTDGVNSMMGTPMYMSPESVTGAKKGKFGSSDIWSLGCVI
                     LEMATGRRPWFNLDNEWAIMYHVAAGHVPQLPSRDEISPQGTDFLLKCLKQDPDKRAT
                     AMELLVHPWMIEIRKLAFGDGEEAESSQA"
     gene            <567632..>568699
                     /locus_tag="KLTH0A06798g"
                     /db_xref="GeneID:8290560"
     mRNA            <567632..>568699
                     /locus_tag="KLTH0A06798g"
                     /product="KLTH0A06798p"
                     /transcript_id="XM_002551707.1"
                     /db_xref="GeneID:8290560"
     CDS             567632..568699
                     /locus_tag="KLTH0A06798g"
                     /note="highly similar to uniprot|P32838 Saccharomyces
                     cerevisiae YNR032W PPG1 Putative serine/threonine protein
                     phosphatase required for glycogen accumulation interacts
                     with Tap42p which binds to and regulates other protein
                     phosphatases"
                     /codon_start=1
                     /product="KLTH0A06798p"
                     /protein_id="XP_002551753.1"
                     /db_xref="GeneID:8290560"
                     /db_xref="GOA:C5DC04"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006186"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DC04"
                     /translation="MELDRCLERLYAGELLPEATIRALCFKLKEKLVRESNVVHISTP
                     VTVVGDIHGQFHDLLEIFHIGGAAPDTNYLFLGDYVDRGLYSVETWTLLMVLKLRWPS
                     RIQLLRGNHESRQITQSYGFYTECVNKYGGSSDVWRQFTDVFDYLALCCVVDDELFCV
                     HGGLSPNVQTVDQIRVIDRFREIPHDGAMADLVWSDPEETGGQDARDGRTTGLESSSP
                     HFQVSPRGAGYTFGRSVVEKFLQLNGMSKIYRAHQLCNEGYQVYFGGLVTTVWSAPNY
                     CYRCGNKASILELYDKDNGYFNVFEEAPENKLLHHASTSGQITNNNAFLNEFFDERGG
                     DVFSDEYQAASASRRHVEYFL"
     gene            complement(<569895..>570116)
                     /locus_tag="KLTH0A06820g"
                     /db_xref="GeneID:8290561"
     mRNA            complement(<569895..>570116)
                     /locus_tag="KLTH0A06820g"
                     /product="KLTH0A06820p"
                     /transcript_id="XM_002551708.1"
                     /db_xref="GeneID:8290561"
     CDS             complement(569895..570116)
                     /locus_tag="KLTH0A06820g"
                     /note="similar to uniprot|Q6Q546 Saccharomyces cerevisiae
                     YNR032C-A HUB1"
                     /codon_start=1
                     /product="KLTH0A06820p"
                     /protein_id="XP_002551754.1"
                     /db_xref="GeneID:8290561"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR029071"
                     /db_xref="UniProtKB/TrEMBL:C5DC05"
                     /translation="MIEVEVNDRLGKKIRVKCEGEDTVGDFKKVLALQLGISWTKIVL
                     QKGGAVLKDHITLDDYEVHDQTYLELYYL"
     gene            <570282..>572528
                     /locus_tag="KLTH0A06842g"
                     /db_xref="GeneID:8290562"
     mRNA            <570282..>572528
                     /locus_tag="KLTH0A06842g"
                     /product="KLTH0A06842p"
                     /transcript_id="XM_002551709.1"
                     /db_xref="GeneID:8290562"
     CDS             570282..572528
                     /locus_tag="KLTH0A06842g"
                     /note="similar to uniprot|Q6B1Q1 Saccharomyces cerevisiae
                     YNR033W"
                     /codon_start=1
                     /product="KLTH0A06842p"
                     /protein_id="XP_002551755.1"
                     /db_xref="GeneID:8290562"
                     /db_xref="GOA:C5DC06"
                     /db_xref="InterPro:IPR005801"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR006805"
                     /db_xref="InterPro:IPR010117"
                     /db_xref="InterPro:IPR015890"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DC06"
                     /translation="MVLNVLFVDFYDSFTYNLVSLIRDQGQHVTIIHFDSYGEDIERF
                     WKDLQCFDCIVLGPGPGNPENGFPDVGFMEQLFVRQVDLPVLGVCLGFQLMCKSVGCT
                     IEQLPSIKHGQVYDVKLSSGAETAGSLFEGYPSSFKSVRYHSLHVNCKNSDVSRIVPL
                     AFTDDEGGTVLMSVQVANKPWFGVQYHPESCCSELGGKLIENFLKITERHKQARVRAS
                     ESSDLSTAQGVIRNLDQTIDKSSIYQKQDLQAQNIQIEEIPIEPCTLLALQICNLLTE
                     PFFLMSSSTIHENRGEFSIIALPNERSTVYTHYDQVHRTLVHQWRDQRITLEGFASAA
                     ETGLSCDGVDIINQSKHEFWKTLGTFMQPKMMANNPDIPFIGGLVGVLGYEMGQFTVH
                     DREGKLVPDAKMVYVENSVVVDYQKGVLMLISLNNKFPENARSAVMKIVQGSKPGTRL
                     PQLPDGVEYDITMPTKESYVRAYNKSQSYLNKGDSYEVCLTTQTRVVPSKRIEPWRIF
                     QTLICRNPAPFSSFFEFTDIKPGHSDLCLLSTSPERFLKWDADTCELRPIKGTVKKDG
                     NTTRELATKILKTPKEFGENLMILDLIRNDLYELLDVVTVDELMSVEEYATVYQLVSV
                     VKGHGLRQAPYSGIDLLQHSLPPGSMTGAPKRKTVELLHDEIEKELNSHISPTSARGV
                     YSGVTGYMSCNDRGDWSVNIRCMFSYDNARTWRLGAGGAVTVLSTLEGEWQEMLTKLE
                     SALQVFQN"
     gene            <573655..>574686
                     /locus_tag="KLTH0A06864g"
                     /db_xref="GeneID:8290563"
     mRNA            <573655..>574686
                     /locus_tag="KLTH0A06864g"
                     /product="KLTH0A06864p"
                     /transcript_id="XM_002551710.1"
                     /db_xref="GeneID:8290563"
     CDS             573655..574686
                     /locus_tag="KLTH0A06864g"
                     /note="similar to uniprot|P50278 Saccharomyces cerevisiae
                     YNR034W"
                     /codon_start=1
                     /product="KLTH0A06864p"
                     /protein_id="XP_002551756.1"
                     /db_xref="GeneID:8290563"
                     /db_xref="GOA:C5DC07"
                     /db_xref="InterPro:IPR005900"
                     /db_xref="InterPro:IPR006148"
                     /db_xref="UniProtKB/TrEMBL:C5DC07"
                     /translation="MTTTVPRVFAFHEFAGVAEAVADHVVHAQNLALSKEPYALKNTG
                     GSNSTPANSSSLNVPGSNGAGNAPVSRQSSSRSIGHSHSAAGSGLRGPSSSKLKKIKE
                     KRFKIALSGGSLIQVLHEGLLKRQDVLWGKWDIYFADERLVPFESSESNFGNTKRKIL
                     DLIDTCTYGTPRVYHINESLINDPQECADDYEKELIKGFAGRDSVKLPMFDLFLLGCA
                     PDGHIASLFPNFSENLRENLAWVVPVTNAPSGPSNRISLTIPVICHSHQVTFVVEGAT
                     KAPVVKTIMERPEKGLPSSIVNEGAAGRVAWFVDDDALTDVQVTKKKYKFLVNTDASQ
                     ISPSPPVPE"
     gene            complement(<574848..>575597)
                     /locus_tag="KLTH0A06886g"
                     /db_xref="GeneID:8290564"
     mRNA            complement(<574848..>575597)
                     /locus_tag="KLTH0A06886g"
                     /product="KLTH0A06886p"
                     /transcript_id="XM_002551711.1"
                     /db_xref="GeneID:8290564"
     CDS             complement(574848..575597)
                     /locus_tag="KLTH0A06886g"
                     /note="similar to uniprot|P17261 Saccharomyces cerevisiae
                     YCR075C"
                     /codon_start=1
                     /product="KLTH0A06886p"
                     /protein_id="XP_002551757.1"
                     /db_xref="GeneID:8290564"
                     /db_xref="InterPro:IPR005282"
                     /db_xref="InterPro:IPR006603"
                     /db_xref="UniProtKB/TrEMBL:C5DC08"
                     /translation="MNLESALGYGYVIPWSVSIYPVVWHNWRHRSASAMSIDFVIINV
                     FGYLYLLLSLWLQLFCWQTGQEHEDSTRPKITAFDFYYCLHGVVMNMVVVSQVLWGNR
                     VWNFKSGGSPRMKPVYRKLLIGSMIVASLSAGQFLTHNFQMGWNNDNTLAFSNTLYAL
                     KISMSLIKYLPQVKHNYERKTLRGFPIQSVVCDVMGSLCSLAQLVVQVTRDRTPLTTA
                     VLSANFGRIGIAAVTLFFNFIYISQWLVYGQ"
     gene            complement(<575902..>577665)
                     /locus_tag="KLTH0A06908g"
                     /db_xref="GeneID:8290565"
     mRNA            complement(<575902..>577665)
                     /locus_tag="KLTH0A06908g"
                     /product="KLTH0A06908p"
                     /transcript_id="XM_002551712.1"
                     /db_xref="GeneID:8290565"
     CDS             complement(575902..577665)
                     /locus_tag="KLTH0A06908g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A06908p"
                     /protein_id="XP_002551758.1"
                     /db_xref="GeneID:8290565"
                     /db_xref="GOA:C5DC09"
                     /db_xref="InterPro:IPR006876"
                     /db_xref="UniProtKB/TrEMBL:C5DC09"
                     /translation="MFWLILLVAAGLTAVCSFLSVNRYLSFKLHKNTLPFTLATLLVN
                     MWILLAITYLLPLDVFYAARASRDDSNAGLNGTAVAQPTPHLLARGLKSVRELEGDTS
                     EGNESYAPDFSALWYGIYWLEFFICWFVLPVLISYLDLKYLFPTQLYVSQRKTIFQRV
                     KKAVTVNIKFYALCALGLLGGVLYLVFGTNRGIVDLKPLIISFSHLYSLSYTLILLSM
                     GLILLPKALLTNRTDENKLFVDLSKSNDESNDAKMAMTDYAGKILSIREVNNGDVALA
                     QAINECKLEVQSLVNETQISLPHLPNGDQHINLDKINKYYNGFKKEYYNYLYYQAKSD
                     RVIHDLAQSQVKTISATKSVVRMVFGICCLLLSILVVFLEFTPSKFAHSKLFQGTSWF
                     NFLLEISILVYNTFASLYAMTCFKWQNLHLIPNGQSSPKNALYYSLYSSRLLLPLCFN
                     FMALISHDPGAPECSFEKVLYKDLKLIPLVDILNRYLPVFFIIAVPVGYFLDLKNRVL
                     VRVLGKEYCYELFGILTDPAPQSDSSAQPSHEASQAIDRSRLDEDYEYSLQDGRYLFQ
                     RATSNYNLREDSADSDRRAYV"
     gene            <578040..>578300
                     /locus_tag="KLTH0A06930g"
                     /db_xref="GeneID:8290566"
     mRNA            <578040..>578300
                     /locus_tag="KLTH0A06930g"
                     /product="KLTH0A06930p"
                     /transcript_id="XM_002551713.1"
                     /db_xref="GeneID:8290566"
     CDS             578040..578300
                     /locus_tag="KLTH0A06930g"
                     /note="similar to uniprot|Q3E830 Saccharomyces cerevisiae
                     YCR075W-A Identified by homology to Ashbya gossypii"
                     /codon_start=1
                     /product="KLTH0A06930p"
                     /protein_id="XP_002551759.1"
                     /db_xref="GeneID:8290566"
                     /db_xref="InterPro:IPR021591"
                     /db_xref="UniProtKB/TrEMBL:C5DC10"
                     /translation="MSSQSTTKARLAQLVPNAIGLLAFDGNCNVIEASGVAKNRLEDI
                     VQINQAKVDSEGFALLRDGDIQVMVYKHDGETLAVYTQENSL"
     gene            complement(<578369..>579304)
                     /locus_tag="KLTH0A06952g"
                     /db_xref="GeneID:8290567"
     mRNA            complement(<578369..>579304)
                     /locus_tag="KLTH0A06952g"
                     /product="KLTH0A06952p"
                     /transcript_id="XM_002551714.1"
                     /db_xref="GeneID:8290567"
     CDS             complement(578369..579304)
                     /locus_tag="KLTH0A06952g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A06952p"
                     /protein_id="XP_002551760.1"
                     /db_xref="GeneID:8290567"
                     /db_xref="InterPro:IPR013886"
                     /db_xref="UniProtKB/TrEMBL:C5DC11"
                     /translation="MAQQTDHKKVENKLDLVAHLFLIYLSHSSLLADNVNVQVKDIGK
                     KNIEFHINVDAESAIAKLNLESCNGPLEVIVMDMSGGEKCMISLCYQEQALKQGIFNY
                     SRELVPDADKIVFPLEKSQVVDYYTELVDWNLDVKFRLKDQPSQKPSHLRENEGNSSP
                     SAVHEKLEHLKFGNPPVPSSHSHSRNPYTDIPGFEDEYEIQQQPGIPVTGAFGVPGLA
                     APGPSAGYGDQDLYPGGQKYPNLQDPSSRFPAAQRQPGQGGMVFDPFRTGQGDPRSNP
                     LRGEGPTGPTPPFPGARFDDPFGRTSQQGGGGGFI"
     gene            complement(<579496..>582102)
                     /locus_tag="KLTH0A06974g"
                     /db_xref="GeneID:8290568"
     mRNA            complement(<579496..>582102)
                     /locus_tag="KLTH0A06974g"
                     /product="KLTH0A06974p"
                     /transcript_id="XM_002551715.1"
                     /db_xref="GeneID:8290568"
     CDS             complement(579496..582102)
                     /locus_tag="KLTH0A06974g"
                     /note="similar to uniprot|P25644 Saccharomyces cerevisiae
                     YCR077C PAT1 Topoisomerase II-associated
                     deadenylation-dependent mRNA-decapping factor also
                     required for faithful chromosome transmission maintenance
                     of rDNA locus stability and protection of mRNA 3'-UTRs
                     from trimming functionally linked to Pab1p"
                     /codon_start=1
                     /product="KLTH0A06974p"
                     /protein_id="XP_002551761.1"
                     /db_xref="GeneID:8290568"
                     /db_xref="InterPro:IPR019167"
                     /db_xref="UniProtKB/TrEMBL:C5DC12"
                     /translation="MSFFGFDSSLPNQGKGGGREKRTATPDKPLDFDETYQGLGEYQN
                     EEDDYLNNETFGNATDLGTDFDFGYGKGELSSNSAPSAAQVDHGRSYASAATTGPVVT
                     NPGYVAAAPHSMDEGMDFTPMESLWTNQPMMMQHPQQPQHPQVLSMEELERQQQQQQI
                     GVPHGQQQGYMGMPPMPPMGYGYAPQAFMPQAQVMPGAAYPSAPQGMPPQGLPLPPQG
                     MPPQSMPPPGMVPPQYQQHAMAMQQQPGAHQQAVQQVPSVVSPLAQQELQQSPHLVPK
                     AALPASAGVVSDFATPSPPHLAASKSASGQARLASPSQMAPSSQDSRESTPRGTRRGS
                     MRKHQEPLSQDDFKRLQVRQAKVDKILRHSGVMTPRDKDFITRYQLSQIVTDDPYNED
                     FYFQVYKIIQRGGIVGESNKGLIARAYLEHSGHRLGGRYKRADVALQRMQSQVEKAVT
                     VAKERPQKNRENFDGAKEGVLGKISSAKNSKAPRRQLQIPQQRDEDEDLGTSAIEDVV
                     ESLNGVDISSSSRARRRSSYAFRSVDQRAVLSRSGGRKFVLSLIETVYAEVLDLEALL
                     RSGKETDSTHLWESLHIADDAYEVSPFISILSFDKGVKIMPRIFNFLNKEQKLKLLYC
                     FFSELSHLNIIVTSSYKTNPDPSDSQLKKIELFQSVFLKIIVSFLSSSAEFLEVLGLL
                     LALVKNNNVSFISTSKIGLNLVTVLISRAALIKQDVSRGSVLSSVEASSWNEIYDKLF
                     TALETKLAAVFPPEEYTSKVVATSSNGTPTSATVGQSSGHQFYDQSYIWQFLASLALS
                     GKLNHQRVIIDEIREEIFGTISRAEQLVKNVPVEEQQIALYQRDKLYQDLNLFLNVMG
                     LVARDGEISELK"
     gene            complement(<582435..>583391)
                     /locus_tag="KLTH0A06996g"
                     /db_xref="GeneID:8290569"
     mRNA            complement(<582435..>583391)
                     /locus_tag="KLTH0A06996g"
                     /product="KLTH0A06996p"
                     /transcript_id="XM_002551716.1"
                     /db_xref="GeneID:8290569"
     CDS             complement(582435..583391)
                     /locus_tag="KLTH0A06996g"
                     /note="similar to uniprot|P53731 Saccharomyces cerevisiae
                     YNR035C ARC35 Subunit of the ARP2/3 complex which is
                     required for the motility and integrity of cortical actin
                     patches required for cortical localization of calmodulin"
                     /codon_start=1
                     /product="KLTH0A06996p"
                     /protein_id="XP_002551762.1"
                     /db_xref="GeneID:8290569"
                     /db_xref="GOA:C5DC13"
                     /db_xref="InterPro:IPR007188"
                     /db_xref="UniProtKB/TrEMBL:C5DC13"
                     /translation="MLHLRPENLLVQKTLTEAWNASKAGSPLTLDRVISDFDYTTLHV
                     SNSPDDKSILWLSIRTKAWQSVVKCGGDFAGYLKSKYNGFHAVSECSPEQGYDFTVQV
                     KLDELDADAIVQLSLMKIHIMSYPFQLAFDEFARLSQLPEGSNASDTVHQIQYRDDEN
                     IFIKPSSDRITVIFETFFQDETDKVFGKVFLQEFVDARKRNRNIQSAPQVLFSHEPPL
                     EAASLMAARSADKNRRFITFVLFPRHFQTPELQFSSVCHLSLFRNYFHYHIKCSKAYM
                     HSRMRYRVDTFIKVLNRAKVDDEEEAGEQTTRRTITGRKLVY"
     gene            complement(<583576..>584091)
                     /locus_tag="KLTH0A07018g"
                     /db_xref="GeneID:8290570"
     mRNA            complement(<583576..>584091)
                     /locus_tag="KLTH0A07018g"
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /transcript_id="XM_002551717.1"
                     /db_xref="GeneID:8290570"
     CDS             complement(583576..584091)
                     /locus_tag="KLTH0A07018g"
                     /note="similar to uniprot|P53732 Saccharomyces cerevisiae
                     YNR036C"
                     /codon_start=1
                     /product="putative mitochondrial 37S ribosomal protein
                     MRPS12"
                     /protein_id="XP_002551763.1"
                     /db_xref="GeneID:8290570"
                     /db_xref="GOA:C5DC14"
                     /db_xref="InterPro:IPR005679"
                     /db_xref="InterPro:IPR006032"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5DC14"
                     /translation="MLFPSLTSRFVLGLSRASMIPRAPARSSAMAIFSPLRAFSICRP
                     NWATLNQIKRGVEPPKRKKATVSPDLYQSPLRKGVVLRVMVLKPKKPNSAQRKACRVR
                     LTNGKVISAYIPGEGHNAQEHSIVYVRGGRCQDLPGVKYRVIRGTGDLSGVVNRITSR
                     SKYGVKKPQKA"
     gene            <585536..>586978
                     /locus_tag="KLTH0A07040g"
                     /db_xref="GeneID:8290571"
     mRNA            <585536..>586978
                     /locus_tag="KLTH0A07040g"
                     /product="KLTH0A07040p"
                     /transcript_id="XM_002551718.1"
                     /db_xref="GeneID:8290571"
     CDS             585536..586978
                     /locus_tag="KLTH0A07040g"
                     /note="similar to uniprot|P25646 Saccharomyces cerevisiae
                     YCR079W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A07040p"
                     /protein_id="XP_002551764.1"
                     /db_xref="GeneID:8290571"
                     /db_xref="GOA:C5DC15"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR015655"
                     /db_xref="UniProtKB/TrEMBL:C5DC15"
                     /translation="MGKSQPFVLLKPSNLVLKSSGMHHAGSVASTMATRESSSPMLRV
                     NLRKFPGFIGHCSSRINRLTNEDSYSINMLKMPTVGSEMNCLWNKGIKDKEVHWATKL
                     PLNKSILNLSVFDGHGGDQISKLLASELHNELAATFPSREAFFELLKQYNDVIGGKYW
                     GKIYDRKEQYFKKFIATCNTKQEQVLFDDKSGSRMIFDQWGNIIDKTSLLTENERLRI
                     FLSYMRFDLKRCCAPASTEGAQRDENVITGGSTASSIFLTPYDEPNSIGDTFFINSEG
                     LLKLVVTQVGDTKIVLCDKNGIAHSLTKMHHPSSSRESRRLRTSFQTDSFGETRFLNN
                     FANTRSFGDFVGKQEGLSCEPDIYSYLIGNTQYLPHSERSKLQFGGDECFVCLITDGV
                     SDLMSDQELVDLITSTVNMRGLKVASPQYVSEEVIRFIAAIGGKHSDNATCLVLRLPN
                     WGNWPTVDRTGAIREEKLMSGSSGSERSNV"
     gene            complement(<587250..>587525)
                     /locus_tag="KLTH0A07062g"
                     /db_xref="GeneID:8290572"
     mRNA            complement(<587250..>587525)
                     /locus_tag="KLTH0A07062g"
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /transcript_id="XM_002551719.1"
                     /db_xref="GeneID:8290572"
     CDS             complement(587250..587525)
                     /locus_tag="KLTH0A07062g"
                     /note="highly similar to uniprot|P53733 Saccharomyces
                     cerevisiae YNR037C"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein RSM19"
                     /protein_id="XP_002551765.1"
                     /db_xref="GeneID:8290572"
                     /db_xref="GOA:C5DC16"
                     /db_xref="InterPro:IPR002222"
                     /db_xref="InterPro:IPR020934"
                     /db_xref="InterPro:IPR023575"
                     /db_xref="UniProtKB/TrEMBL:C5DC16"
                     /translation="MQFTLSLLSRSVWKGPNIVPLPVKEALAKGAPIRTNARSATILP
                     QFVGLKFQVHNGKEYVAFEVSEDMVGSKLGEFAPTRKRFSYTHTKNK"
     gene            <587692..>589578
                     /locus_tag="KLTH0A07084g"
                     /db_xref="GeneID:8290573"
     mRNA            <587692..>589578
                     /locus_tag="KLTH0A07084g"
                     /product="KLTH0A07084p"
                     /transcript_id="XM_002551720.1"
                     /db_xref="GeneID:8290573"
     CDS             587692..589578
                     /locus_tag="KLTH0A07084g"
                     /note="similar to uniprot|P53734 Saccharomyces cerevisiae
                     YNR038W DBP6 Essential protein involved in ribosome
                     biogenesis putative ATP-dependent RNA helicase of the
                     DEAD-box protein family"
                     /codon_start=1
                     /product="KLTH0A07084p"
                     /protein_id="XP_002551766.1"
                     /db_xref="GeneID:8290573"
                     /db_xref="GOA:C5DC17"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DC17"
                     /translation="MFAARFDPTAVQSVAVDQEEKVRASKPVVPQKRRAESEEDSEED
                     EDEEKDEVDENENVRENHIPEENPSDEEDHKSDVEMDLATNDEVTSSKYSGVYSRFQK
                     TLQIQDKLAPYDLVNTEDENDNSDTEQHELVPIPQPEIVRNTHLTTEVVNLKGKSAAW
                     LHTARVQYDSSMVKPFSAYKDILNDKLISNVTSKFSENAFPVQTVILDTVVPKMNFAQ
                     SVNKKSFPRRVGDILVNASTGSGKTLAYSIPVVQCLSKRTVNRLRCLIVVPTKILIHQ
                     VFETLVKLSQGTSLITGISKLENSLREEHRKFQAQEPDILVITPGRLVDHLQLNTFSL
                     KNLKFLILDEADRLLNQSFQNWCSVIMERLKTDKEEMHPVSVIKMVFSATLTTNTEKL
                     HGLQLNRPSLFMMDSVKLYHLPKQLQEFNIKIPTAKSFAKPLFALQLIAALSPTDPRI
                     LVFVRSNEASIRLATLLEILVNNKVLPIEFRTQIASINSNNTKGLNSKLIKQFASSSP
                     EKVTKILVATDLMSRGIDINNVSHVINYDLPISSQQYVHRCGRTARAQASGEAFNLLV
                     GKGEQTFWSDNIDSDLSRDLDGCRPKPYEEEQALENILEITKDAEENYKDSLEQLKNN
                     VTSK"
     gene            <589774..>593877
                     /locus_tag="KLTH0A07106g"
                     /db_xref="GeneID:8290574"
     mRNA            <589774..>593877
                     /locus_tag="KLTH0A07106g"
                     /product="KLTH0A07106p"
                     /transcript_id="XM_002551721.1"
                     /db_xref="GeneID:8290574"
     CDS             589774..593877
                     /locus_tag="KLTH0A07106g"
                     /note="similar to uniprot|P25648 Saccharomyces cerevisiae
                     YCR081W SRB8 RNA polymerase II mediator complex subunit"
                     /codon_start=1
                     /product="KLTH0A07106p"
                     /protein_id="XP_002551767.1"
                     /db_xref="GeneID:8290574"
                     /db_xref="GOA:C5DC18"
                     /db_xref="InterPro:IPR019035"
                     /db_xref="UniProtKB/TrEMBL:C5DC18"
                     /translation="MPSKYLLTPPEGLHSLTSGNTKKIYPDFDPWSHTPLDDKIFLNF
                     VSKGYYNSAKVNFESISSRSSLQESLPAVSGLLADQLSDVVRIREEKINRITANSTSS
                     AKKSGMPSDLSGPGFSLPKRVTLTDHRRELWLQEMSSPQSSLSETSKTIPHGLKRRQL
                     LEQCYLKQIPIPRAIWLIKCCFSLEWKTLANKQGATQIEDGIDKLLKEWSETMVHLLE
                     RLVFEMTQYYNEPVKLSNWRQKIKYYLSLLGNCYSLNLMDSNFFHHWLVDFIAKIENF
                     EYLPMALHILTVFWGGIFEACRHSEDPQQLFLVNKMTEALLYKYYMVTSSRSMINDEQ
                     YLINDVKKNNKVNKTILAKLKGLIEKIFQGQSMEAFVFPNNNWDIYKKCLYEILQVDK
                     IREDDGSSSEASKKLELIVYRNDSLKFNTILHDADTESLGSGNETPNNLENIFVPDTV
                     LKLKRIDYKLTKALDENCPGDDWATFADQKLRRVEQIIQMMLWAVHPSRSHHYEASQL
                     VAKLLLLKLNSRNGNLEYSLEDKIWALVFVFAKTKSEDLKFMVSLTRLHQLLNVFIGY
                     GIVKVPTYIRKLISSGVLYLTHSSDKLFHCNLLINLKISPLMKIQYNMVLRNVHESNP
                     EFYDNYNYDRLMEMLEGAKESLSSGNYEFVKEVPYSIKLMASEWYLNVICSPIDGSLR
                     TVRKLDVIEKLKVFCVNLKVYHQFYKWVEFIVYHQLLNDLEALECLVDILMYYDKLFP
                     LLINDHTLLMKTILHLHSLKLAPQNTASQNLLLFNDFWLFFMKRFPLALEIDTDLQTK
                     LIEAYESEKAQIERLAKPHSRNDGTSPLKADNDSIQSVKKESQNFPSVFQPNLKCLLT
                     SGEEESLRNARKNMRVLMIINLTEYNKFMSIFLKRRSASDEELARLISLKVLSLSLIK
                     KVLGGPAVVNLLDTRYCDCGMAFELQKKTFTKQNLRLVMNALCEDLPGSYQKLLNVIG
                     EFSTTKNGQEQISNIVNKVQVKGGKDTFSFITDLLNLGVNNSEWGNFEPLPESARHDL
                     FEDDGEVTEEETDVLDLFSRLNFTNLWIFQILTSLYLQSMNCLSPAKPHFALDIIELT
                     GCDVAASKLFDKISNVEVLEKTLQTLEVDFFQRKSIKDPEVSYYYVIIETIVNISRRL
                     NKVSTSSIPMGEESFRLMKECCHEFISKDPTDLAKLEYRLDAFLKILIVHQKFILKEG
                     LEKPQPAFEGYSEFLRMLCQLFHKIDFSLKLKLLLYDVLASMKSFVIYSSTGRNHQLS
                     IKKNLKVPKELLDLPPFKISSFMPGDIPSGEANKVEPGIKDRNPSDEPRKPVFFLYNK
                     SSNTFEEKLSLRPFHLLDNFQEEGPEFNNTPLNLCLFNASYYRKNPT"
     gene            complement(<594164..>595864)
                     /locus_tag="KLTH0A07128g"
                     /db_xref="GeneID:8290575"
     mRNA            complement(<594164..>595864)
                     /locus_tag="KLTH0A07128g"
                     /product="KLTH0A07128p"
                     /transcript_id="XM_002551722.1"
                     /db_xref="GeneID:8290575"
     CDS             complement(594164..595864)
                     /locus_tag="KLTH0A07128g"
                     /note="similar to uniprot|P53735 Saccharomyces cerevisiae
                     YNR039C ZRG17 Endoplasmic reticulum protein of unknown
                     function transcription is induced under conditions of zinc
                     deficiency mutant phenotype suggests a role in uptake of
                     zinc"
                     /codon_start=1
                     /product="KLTH0A07128p"
                     /protein_id="XP_002551768.1"
                     /db_xref="GeneID:8290575"
                     /db_xref="GOA:C5DC19"
                     /db_xref="InterPro:IPR002524"
                     /db_xref="UniProtKB/TrEMBL:C5DC19"
                     /translation="MGSPNLSTKEDFGSSFSFGGLPSTPQHMNCIVEEDHAKDGLAEE
                     MEREPSKTPQRPLSFYSNADGNNSSNSLIMNPAFSFGASATQENKRHSMKYVPTPKLP
                     PSSSSRTKSPARGNRSPSPDRGKRRGSLVLDKPFNFSSSTLQPPASAGSATRASFRKG
                     HRYKHSSVSMNFFQEPEVQVPLNIAKAMPIPDFADLKSNIPWPHGYAQLAIAALQIIA
                     CLVTFRLGHVKSWNNFITLSHFVLYDVIGSLAIILVENLSQFQVWNTGTITFPFGLNR
                     MDVLLSFALAISLCFMGLDLFFHILEETIVLFVESTNDSNQHNDIAPKIPHSHHSSAF
                     LHTASETQIWYWTLLPNLALSLLSLFKTYHSNAHTKFKTKNPVITCTYILYLSLYPLI
                     QKVVSSSDYIATSLLSIFIMSYGWTIAKWTSTILLMGFSTASLNGLILDDDPSLSDDR
                     PTKALLVRSKSTLPIAVANNNSSKPNKNNSKICDSTHVKSKIMESVQELPLFRANCKL
                     ANEDLVIVKVNFDQYIVLIRLRMAGGSNDDELNLRLAIDKCIRKILKTVDTTIDIDRL
                     "
     gene            <596361..>597467
                     /locus_tag="KLTH0A07150g"
                     /db_xref="GeneID:8290576"
     mRNA            <596361..>597467
                     /locus_tag="KLTH0A07150g"
                     /product="KLTH0A07150p"
                     /transcript_id="XM_002551723.1"
                     /db_xref="GeneID:8290576"
     CDS             596361..597467
                     /locus_tag="KLTH0A07150g"
                     /note="similar to uniprot|P32378 Saccharomyces cerevisiae
                     YNR041C COQ2 Para hydroxybenzoate: polyprenyl transferase
                     catalyzes the second step in ubiquinone (coenzyme Q)
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0A07150p"
                     /protein_id="XP_002551769.1"
                     /db_xref="GeneID:8290576"
                     /db_xref="GOA:C5DC20"
                     /db_xref="InterPro:IPR000537"
                     /db_xref="InterPro:IPR006370"
                     /db_xref="UniProtKB/TrEMBL:C5DC20"
                     /translation="MITARGVTLGVYRGWRTQLIAQAKSAGRNGVFFVRYSSQLRKEV
                     RKPVFTPEELEKARETRLRGLEPYVSKLPAKWIPYAELMRLEKPVGTWLLYIPCTWAI
                     SMAAMETMAPISSAMWMLSLFGVGSLVMRGAGCTINDLLDRNLDDKVIRSVERPIASG
                     RVSPKQAVAFLGAQTAGGMGILTQLPAECWWLGLASLPLVFTYPLFKRFTYYPQAALS
                     ACFTWGALLGFPAMGVMDWPTMIPLYTSSFLWCMTYDTIYAHQDKSFDVKAGIKSTAL
                     AWGPKTRKICTAMSVAQMGLLGLAGLNSGLLLGPGFLGGLAIFGYRVFSMVRNVDLDN
                     PADCWKHFTSNIRSGLYFSAALLLDYFLRILGFL"
     gene            complement(<597528..>598358)
                     /locus_tag="KLTH0A07172g"
                     /db_xref="GeneID:8290577"
     mRNA            complement(<597528..>598358)
                     /locus_tag="KLTH0A07172g"
                     /product="KLTH0A07172p"
                     /transcript_id="XM_002551724.1"
                     /db_xref="GeneID:8290577"
     CDS             complement(597528..598358)
                     /locus_tag="KLTH0A07172g"
                     /note="weakly similar to uniprot|P53736 Saccharomyces
                     cerevisiae YNR040W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A07172p"
                     /protein_id="XP_002551770.1"
                     /db_xref="GeneID:8290577"
                     /db_xref="UniProtKB/TrEMBL:C5DC21"
                     /translation="MFRPAALRFVPRTTWRGAAHSTAGLPFSSKLAALIAKTSPEQIY
                     TYSVPRLVKFGSWTLSGVFLVYGVSFADWSLTSSLELYGEEVQQPPSSWWKHPKLLLA
                     ARVAGSALLTLIPLTLSCVAIYAPSRIVTAVSYVPHGACKLTRGALLTGKPVSRVADL
                     SHVARNQKAKVYTGVGPQGTDDRASFAFLLTDSHRPAWDRFYIVNRSGRFWAQDGRIF
                     DALFGGESARSLECPSATQTTGPPPATSPVQRMIEVEQTRSKIHDHASRVKSIVMKPK
                     "
     gene            complement(<598542..>598940)
                     /locus_tag="KLTH0A07194g"
                     /db_xref="GeneID:8290578"
     mRNA            complement(<598542..>598940)
                     /locus_tag="KLTH0A07194g"
                     /product="KLTH0A07194p"
                     /transcript_id="XM_002551725.1"
                     /db_xref="GeneID:8290578"
     CDS             complement(598542..598940)
                     /locus_tag="KLTH0A07194g"
                     /note="some similarities with uniprot|P25372 Saccharomyces
                     cerevisiae YCR083W TRX3 mitochondrial thioredoxin"
                     /codon_start=1
                     /product="KLTH0A07194p"
                     /protein_id="XP_002551771.1"
                     /db_xref="GeneID:8290578"
                     /db_xref="GOA:C5DC22"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C5DC22"
                     /translation="MFKTSVFRCSQALPRNGTLLRPIARTQSTVAQLQTLQQFQQAVA
                     RKNLSVIDFYATWCAPCRAVAPHFDKLSEKHTDVAFYRVDVDSAPDIAGFCGVSAMPT
                     FLFARESKTVGKVVGANLRALSEEIESLQK"
     gene            complement(<599149..>599559)
                     /locus_tag="KLTH0A07216g"
                     /db_xref="GeneID:8290579"
     mRNA            complement(<599149..>599559)
                     /locus_tag="KLTH0A07216g"
                     /product="KLTH0A07216p"
                     /transcript_id="XM_002551726.1"
                     /db_xref="GeneID:8290579"
     CDS             complement(599149..599559)
                     /locus_tag="KLTH0A07216g"
                     /note="weakly similar to uniprot|P25649 Saccharomyces
                     cerevisiae YCR082W AHC2 component of the yeast ADA
                     acetyltransferase complex"
                     /codon_start=1
                     /product="KLTH0A07216p"
                     /protein_id="XP_002551772.1"
                     /db_xref="GeneID:8290579"
                     /db_xref="UniProtKB/TrEMBL:C5DC23"
                     /translation="MPSDPPAPAAYELVRQFQEQALSENADYALLQHSRAHLHNKLMQ
                     KKFFLKQLRLLYTQLDKTHNYQELVDALVGHRALLREIFAMERGARRGRRAHAPPAIA
                     WQKYGVDVEQYLLAQDDAASRALVHESGWVFHDV"
     gene            <600411..>601712
                     /locus_tag="KLTH0A07238g"
                     /db_xref="GeneID:8290580"
     mRNA            join(<600411..600455,600564..>601712)
                     /locus_tag="KLTH0A07238g"
                     /product="KLTH0A07238p"
                     /transcript_id="XM_002551727.1"
                     /db_xref="GeneID:8290580"
     CDS             join(600411..600455,600564..601712)
                     /locus_tag="KLTH0A07238g"
                     /note="similar to uniprot|P32377 Saccharomyces cerevisiae
                     YNR043W MVD1 Mevalonate pyrophosphate decarboxylase
                     essential enzyme involved in the biosynthesis of
                     isoprenoids and sterols including ergosterol acts as a
                     homodimer"
                     /codon_start=1
                     /product="KLTH0A07238p"
                     /protein_id="XP_002551773.1"
                     /db_xref="GeneID:8290580"
                     /db_xref="GOA:C5DC24"
                     /db_xref="InterPro:IPR005935"
                     /db_xref="InterPro:IPR006204"
                     /db_xref="InterPro:IPR013750"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR029765"
                     /db_xref="UniProtKB/TrEMBL:C5DC24"
                     /translation="MSIYTASTTAPVNIATLKYWGKRDKTLNLPTNSSISVTLAQEDL
                     RTLTSVATSESFTEDQLWLNGQPESLQGERTQHCLQDLRNLRSRIEAQDSSLPRMSQW
                     KLHIVSENNFPTAAGLASSAAGFAALVMAIAKLYQLPDSHSEISKIARKGSGSACRSL
                     FGGYVAWEMGSEPDGSDSKAVEVAPQSHWPEMKAAILVVSADRKDTPSTSGMQHTVAT
                     SDLFQERIRNVVPKRFEEMKQAIQDRDFTRFAELTMRDSNSFHATCLDSFPPIFYMND
                     TSRKIVKLCHQINAFYDETIVAYTFDAGPNAVLYYLQENEAKLMAFVHHVFQKNSGWD
                     TKFSQNDLEKFSEVFKTRVAPEVAFEFDEELYKGVSRVILTQVGPGPQDTTECLINKS
                     TGYPN"
     gene            <602127..>604328
                     /locus_tag="KLTH0A07260g"
                     /db_xref="GeneID:8290581"
     mRNA            <602127..>604328
                     /locus_tag="KLTH0A07260g"
                     /product="KLTH0A07260p"
                     /transcript_id="XM_002551728.1"
                     /db_xref="GeneID:8290581"
     CDS             602127..604328
                     /locus_tag="KLTH0A07260g"
                     /note="weakly similar to uniprot|P35995 Saccharomyces
                     cerevisiae YKL222c"
                     /codon_start=1
                     /product="KLTH0A07260p"
                     /protein_id="XP_002551774.1"
                     /db_xref="GeneID:8290581"
                     /db_xref="GOA:C5DC25"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="UniProtKB/TrEMBL:C5DC25"
                     /translation="MSSEDHVEDEGGFEPNEDQFEVDGRSKKRRKAIKQCLFCRKRKL
                     KCDKKKPMCTTCVTRGLGECIYVEQFGRDVSARELLNSAPNVDLLNKIKALEKELDSY
                     KHTSLTKGEGFNPLRDVQILIKKDERTIYHGCTSFRAALSESRFKFSTYHAFFWARVK
                     DDRRRWKALNGYTTLKEITVIEKERDNGLSVLGAVCKALPPFEQIEAIVKKFFTSILL
                     EGYKVLDMKKTLQNLHMSFIRGPQNPITGMHPVIHLWPSFKKNYYCIGIILEIMCLMS
                     YSSVIPEAIDVFNKYLTSFVTKKAFYIERVQYLFLRYLYKSLNYGGGDDSNLVFLAQA
                     MSASAICVGLHRNIRDLLKGDNVDRGDAVYFENLWLWILQADLETSFNVGTPPKIAES
                     FVNYQMIEDPNYGSCELLKNLIRPMRNIMTVIYLENRIPDMEAIVGKIKRLLETHFKP
                     LKLYREKENLKQIPFVEIDLYTWLLGMIGVFSNFRRVYFKDHSPSAINSALQFTILPL
                     AMSMSTIEAFFELDKEAAAKTQAPLQGGLPFHLAIANSLVQKHFPRSLSEIYTLMGSL
                     GSFPDFGTARFQYPLSPVFDIPLDSLECVGDHYVSFKQASEVIENLLSKWEEEKNRDM
                     VKLLKRYSYAFVVSYAIQKSHKDLFDQCFKRRELQFTRGEEQSNPDMEQKAALPSPSN
                     SFGGQEFIPDETLKELADEFWKNYDIEVDDFFSDAFDQTSIWFDSSAQPQQ"
     gene            complement(<604949..>607126)
                     /locus_tag="KLTH0A07282g"
                     /db_xref="GeneID:8290582"
     mRNA            complement(<604949..>607126)
                     /locus_tag="KLTH0A07282g"
                     /product="KLTH0A07282p"
                     /transcript_id="XM_002551729.1"
                     /db_xref="GeneID:8290582"
     CDS             complement(604949..607126)
                     /locus_tag="KLTH0A07282g"
                     /note="some similarities with uniprot|P18323 Saccharomyces
                     cerevisiae YCR084C"
                     /codon_start=1
                     /product="KLTH0A07282p"
                     /protein_id="XP_002551775.1"
                     /db_xref="GeneID:8290582"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR013890"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DC26"
                     /translation="MASSAVSASQNKLNELLEAIRQEFGQISQEANTYRLQNQKDYDF
                     KINQQLAEMQQIRNTVYELELTHRKMKDAYEEEIGRLKLELDQRDRQVATLAAAAQQQ
                     QHQQQHQQQQQQHQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ
                     PTGPILASSNAATPGIQNPVLGSQAVQSPALSAAGPAAPAQAPRLAALEPSQTAPTIT
                     AQAPHMKKLASEHQINSPPVQGAGIPTGPAVLAAPAAPGTPGTPAAALAAAAAPTPPS
                     ASGGPLAAPTNQGAVAPPAPMAPMAPIAAPVSENKSQEYYLVPPHQRASHAKPIPPFL
                     LDLDSQLVPQHLKKQTNDYYILYNPALSRELDVDLHVSLDHSSVVCCVRFSNDGEYLA
                     TGCNKTTQVYKVSTGELVARLSEDAASAPSGNSGDGASGAENAEQTPAVSTSASSDLY
                     IRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSG
                     SGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFL
                     VERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANT
                     AASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVIS
                     VAVANDHPLGPEYGVFATGSGDCKARIWKYTKKSEPKLREVKE"
     gene            <607568..>608095
                     /locus_tag="KLTH0A07304g"
                     /db_xref="GeneID:8290583"
     mRNA            <607568..>608095
                     /locus_tag="KLTH0A07304g"
                     /product="KLTH0A07304p"
                     /transcript_id="XM_002551730.1"
                     /db_xref="GeneID:8290583"
     CDS             607568..608095
                     /locus_tag="KLTH0A07304g"
                     /note="similar to uniprot|P25651 Saccharomyces cerevisiae
                     YCR086W CSM1 Protein that forms a complex with Lrs4p
                     located in the nucleolus Lrs4p-Csm1p heterodimer binds to
                     Mam1p at kinetochores during meiosis I to mediate accurate
                     chromosome segregation may be involved in premeiotic DNA
                     replication"
                     /codon_start=1
                     /product="KLTH0A07304p"
                     /protein_id="XP_002551776.1"
                     /db_xref="GeneID:8290583"
                     /db_xref="InterPro:IPR020981"
                     /db_xref="UniProtKB/TrEMBL:C5DC27"
                     /translation="MDPISQYKAAVQSRLDNADILVSKLVHENRMLAQDVENKDQEIE
                     SLKRQLAAAEARSKECEERTGAAEEETDIVKDLFEHLCGVRVHKSYEDESGLWFDTSQ
                     GGKAGVMDYKLGFVKGEPSGTEVVYVPLLKQRSAEELQQLQKQLPGYLFDTLSFPLRS
                     LQQFYSKMAKCLSRG"
     gene            complement(<608380..>608883)
                     /locus_tag="KLTH0A07326g"
                     /db_xref="GeneID:8290584"
     mRNA            complement(<608380..>608883)
                     /locus_tag="KLTH0A07326g"
                     /product="KLTH0A07326p"
                     /transcript_id="XM_002551731.1"
                     /db_xref="GeneID:8290584"
     CDS             complement(608380..608883)
                     /locus_tag="KLTH0A07326g"
                     /note="similar to uniprot|P37263 Saccharomyces cerevisiae
                     YCR087C-A Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A07326p"
                     /protein_id="XP_002551777.1"
                     /db_xref="GeneID:8290584"
                     /db_xref="InterPro:IPR014898"
                     /db_xref="UniProtKB/TrEMBL:C5DC28"
                     /translation="MVTFNCEVCNDTVPKKNTEKHYYRCPQAYYTCIDCNVTFDDGTG
                     YKKHTQCISEDEKYQKALYKGKKKPQEKKPQQQKPEESKPKQEKQQEQETRKDKNTKL
                     EKAKLQKGKVQKPEEQKPLKQKSVLSEKKGASLYKILKSIDDKEEKKNLLKSLVVNEN
                     GQLEVKA"
     gene            <610049..>611929
                     /locus_tag="KLTH0A07348g"
                     /db_xref="GeneID:8290585"
     mRNA            <610049..>611929
                     /locus_tag="KLTH0A07348g"
                     /product="KLTH0A07348p"
                     /transcript_id="XM_002551732.1"
                     /db_xref="GeneID:8290585"
     CDS             610049..611929
                     /locus_tag="KLTH0A07348g"
                     /note="similar to uniprot|P15891 Saccharomyces cerevisiae
                     YCR088W ABP1 Actin-binding protein of the cortical actin
                     cytoskeleton important for activation of the Arp2/3
                     complex that plays a key role actin in cytoskeleton
                     organization"
                     /codon_start=1
                     /product="KLTH0A07348p"
                     /protein_id="XP_002551778.1"
                     /db_xref="GeneID:8290585"
                     /db_xref="GOA:C5DC29"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR002108"
                     /db_xref="InterPro:IPR029006"
                     /db_xref="UniProtKB/TrEMBL:C5DC29"
                     /translation="MALEPIDYTTHCREIEEVFQKVVRGSDAEIEWLVLSPNSKKEYT
                     AESVGSGFSEFLGTFEDTKVQFGLARVSPPGSDVQKLILIGWCPDSAPLKTRASFASN
                     FGVVANQVLKSYHVQVTARDEDDLDENELLMKISNAAGARYSIQQEPTRTSSAPKPRP
                     AATPKATPSSNNVSTAPKPSADFTPKPSTTASVPKAAPASAPKPAAQFSTPVSGRDAG
                     RSNSSGEDDDWDEPEIEERDFDSKPLKPNKSSWQPVGKVDLQKLIAEENAKQDPRLVN
                     MVKSDTPVKLNPQDDIQKLKQESRAQRDAELNKFMGTKPPTGSVPKKDDDKVIRGFQN
                     EKSPAQLWAEKHQQKVTSPQKASAATEAAEGKKEDEDDEEEEAPEVSNVKAKFEKMAV
                     NEPTIIKPGQPKTPAPVESDSAPAPPKASLGRPLPGMHTELDDDQDANSSNAQDDDDD
                     WDDQSDEEVKPPAPAPRPSLPARTSTATSSSPAPAPGPRPQSNLTQEVPTKTQVDEKP
                     AAAAAPSLPTRTSESSYVPPPPPRRNVPVTEEPEEPEEPETVEGSQKNAAEDELQLEE
                     KLPSAIAEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQL
                     IK"
     gene            <612403..>616227
                     /locus_tag="KLTH0A07370g"
                     /db_xref="GeneID:8290586"
     mRNA            <612403..>616227
                     /locus_tag="KLTH0A07370g"
                     /product="KLTH0A07370p"
                     /transcript_id="XM_002551733.1"
                     /db_xref="GeneID:8290586"
     CDS             612403..616227
                     /locus_tag="KLTH0A07370g"
                     /note="some similarities with uniprot|P25653 Saccharomyces
                     cerevisiae YCR089W FIG2 Cell wall adhesin expressed
                     specifically during mating may be involved in maintenance
                     of cell wall integrity during mating"
                     /codon_start=1
                     /product="KLTH0A07370p"
                     /protein_id="XP_002551779.1"
                     /db_xref="GeneID:8290586"
                     /db_xref="InterPro:IPR025928"
                     /db_xref="UniProtKB/TrEMBL:C5DC30"
                     /translation="MKLAFVLTSCSTALASTYPRVYYANTSTVKQSATSYRELTSLVL
                     SSTHSDGLVSTFVSEAFVSLTTLTTNDVVTVVTTWCPLGSEVVNSQLSSYSEESRASS
                     SNLNAPTTTSPTSVFIDMSGTTETIQKSQIHTKEITTCPTCSVRPTSASTVPESTDIA
                     SSSVASSISHSKDLVSQAGSSLSSSAKSSSARMPSITTSGEIGTSAVDTGNLSPSSSS
                     NSYQSGSSSTETHATTSQNTLSSVSGLSKSAYSPGLSSFDVRPVLTTETVDGKTTVYT
                     TWCPLTSHSISSLYSVVTSDNPSSPSSVRIASSESQVSDENEHESDFSTQASSLQEHG
                     YSSYSMVTITSTSLRTVVYSTELCSSRRCSPSLTSVLESIVFTTSVHPTGLGSSSERS
                     RNTYSNSKTDSILKGQLCSLTSCQETSTSDTSGTGSSSKPTSVSQSATSEAAESSKSL
                     SEGYQSSVSSKSFATSQSCVSCASQRNYYTTESETYLSEKASLTSAESSQKLSLSSFS
                     SVPDSSVSSSLLSTYSIVTTTSNGVVTVYTTWCPLSNLKSSSNNGLVSSSLALKIVST
                     EQSGTKKLSSTQQYRSLSKTASSFMTLGSGALTFSTPSVTNSKPISGSTLASSTQRPS
                     VETHNFIQRSSFSASHFSSLVATSHGISGSIDTVQSGSSTSLSTSSAISTEHLSNTRY
                     SSISEGSNSQLQKTSTGSLISVLSSSSRSVPVVSTANSKNEETSCTQCQTSSHTSFST
                     EISSIVSLSVPSQSQDLKTSARSSTSLKSSVTYTSKVITTTSSGIRTVYTTYCPWTSS
                     ASQESQNSEKQKSSAASSSASSPASSPASSSASSQQELSSSVASTSESQKHQTSSSLD
                     SEPQRSSKATIQSVGSQASSSKTWTSKVVTTTEGGVTTIYTTWCPQEDLQSSGTVAAV
                     SPSTSQQKSSSLVTTTSESQTHETPSSLDSESQRSSKATIQSVGSQASSSKTWTSKVV
                     TTTEGGVTTIYTTWCPLEDLHSGTVAAASLPSKFTDSTYISSTSSPSGLSSVPSINEG
                     KTASSALKSSEIAKTLSDSSAKELTLYGTSSSMKASEAGSSDSMSSTIVPRMSTAESS
                     AIIQSTQDASKKSSKGTVTTGRPSTSNVERSPSTTLGTTESLVSSSHTFSSTKTPAVS
                     PHSSAIISSKATTYSSSFTISVTTVLPFTKTSTGDNGQLFTVVSSQPSTIPTVTTVLV
                     KTRVPVTTYSQVSITESASQQATRKSSTEDTTSSWAIASTVSTYEGSAASTRRFDRIL
                     KVATALLLTFIM"
     gene            complement(<616307..>616864)
                     /locus_tag="KLTH0A07392g"
                     /db_xref="GeneID:8290587"
     mRNA            complement(<616307..>616864)
                     /locus_tag="KLTH0A07392g"
                     /product="KLTH0A07392p"
                     /transcript_id="XM_002551734.1"
                     /db_xref="GeneID:8290587"
     CDS             complement(616307..616864)
                     /locus_tag="KLTH0A07392g"
                     /note="similar to uniprot|P25654 Saccharomyces cerevisiae
                     YCR090C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A07392p"
                     /protein_id="XP_002551780.1"
                     /db_xref="GeneID:8290587"
                     /db_xref="InterPro:IPR008584"
                     /db_xref="UniProtKB/TrEMBL:C5DC31"
                     /translation="MLYVVLSASVSENIGRLKVKDLDTDPADYAFELVCTNCREKHDS
                     KVTINRLEKHTMSGSRGEASFVMKCKFCGKDCSINLERTQEELYNLEEESNRELVEKT
                     RVYRKKIGIKNVDSSKAILLALDCRGCEALNLDFSNLTFEACLVSGKVMEATFEEENE
                     WYDYDDDAGEEVSITGLQFDIIKGK"
     gene            <617043..>618317
                     /locus_tag="KLTH0A07414g"
                     /db_xref="GeneID:8290588"
     mRNA            <617043..>618317
                     /locus_tag="KLTH0A07414g"
                     /product="KLTH0A07414p"
                     /transcript_id="XM_002551735.1"
                     /db_xref="GeneID:8290588"
     CDS             617043..618317
                     /locus_tag="KLTH0A07414g"
                     /note="weakly similar to uniprot|P07390 Saccharomyces
                     cerevisiae YNR045W PET494 Specific translational activator
                     for the COX3 mRNA that acts together with Pet54p and
                     Pet122p located in the mitochondrial inner membrane"
                     /codon_start=1
                     /product="KLTH0A07414p"
                     /protein_id="XP_002551781.1"
                     /db_xref="GeneID:8290588"
                     /db_xref="UniProtKB/TrEMBL:C5DC32"
                     /translation="MYCFRQYFTRGFPFTWPKRHSRGIKLSQRYYGRSPRCKGRLTLR
                     PMGTGMTLWRYFNAPGNVMFVTTNVVTLLGIMSYTTIQNMAREQAMQEYLEHKSFGDD
                     TVDIELTQGSPRKRYRKENIKLSKNQPPSNCYAQHAKMSLFHLLYSFYICRDVASENE
                     VRGSSEWKEELDDLQDEVPERHSSHISTRMFYHLWRSEFGQIFDNLSRSQQFHMPNWK
                     HYPGSLQVVCQSLYDSELRTVADFIKFYKGVKQGTLKELLRAWFYDNMQLFQSTSDND
                     NEYFYRYLVQACENDEPLFNQYASIMLNPSNPRRRAFFNRRNQYSSASLETFVEVLKG
                     NLRAAAGAVEKSYYHESILNLVSMLRTSCFLAQNSNGSHEVRILLPGNMNVCDSLPYP
                     HTSSADRFACYKLVSENAEVMAVLGAISKLPS"
     gene            <618523..>618924
                     /locus_tag="KLTH0A07436g"
                     /db_xref="GeneID:8290589"
     mRNA            <618523..>618924
                     /locus_tag="KLTH0A07436g"
                     /product="KLTH0A07436p"
                     /transcript_id="XM_002551736.1"
                     /db_xref="GeneID:8290589"
     CDS             618523..618924
                     /locus_tag="KLTH0A07436g"
                     /note="highly similar to uniprot|P53738 YNR046W
                     Saccharomyces cerevisiae TRM112 Protein required for cell
                     viability"
                     /codon_start=1
                     /product="KLTH0A07436p"
                     /protein_id="XP_002551782.1"
                     /db_xref="GeneID:8290589"
                     /db_xref="InterPro:IPR005651"
                     /db_xref="UniProtKB/TrEMBL:C5DC33"
                     /translation="MKFLTSNFLKCSVRECDRSNENFPLKYNGEKCQLEQDESLEFNP
                     EFLLRIIDRVDWSAVVSVAIDLGNSSLPSSKPEFTSEDLSDEDMIILKDLHTLLIKTN
                     IVEGEMSCRNCGHIYYIKNSIPNLLLPPHLA"
     gene            <620459..>623080
                     /locus_tag="KLTH0A07458g"
                     /db_xref="GeneID:8290590"
     mRNA            <620459..>623080
                     /locus_tag="KLTH0A07458g"
                     /product="KLTH0A07458p"
                     /transcript_id="XM_002551737.1"
                     /db_xref="GeneID:8290590"
     CDS             620459..623080
                     /locus_tag="KLTH0A07458g"
                     /note="similar to uniprot|P53739 Saccharomyces cerevisiae
                     YNR047W Putative protein kinase that when overexpressed
                     interferes with pheromone-induced growth arrest localizes
                     to the cytoplasm potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0A07458p"
                     /protein_id="XP_002551783.1"
                     /db_xref="GeneID:8290590"
                     /db_xref="GOA:C5DC34"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/TrEMBL:C5DC34"
                     /translation="MDNLQVLSQPPATVSEGEQRSRSVSLSKLIPRSFRKASGTPTNE
                     SSAGSVNSLENGKPTPSATNRGAEDMELRETPESPSRAHFRTASNTENSSSATPQPEG
                     SEETKPHQQIQTGGKLSARLKKIFLPASKLPEPPQPAAEISTAGSAPLQSPDRKSLEN
                     PDLPEPPTSSHTHEPLHTASIQGVAGPNRRTRSPSTPIMPSHVPTPDATGKSDNRHNG
                     INQGSSNANNSGVDRRSTRADTVRSSNPYFAFQGLPPHALSSQDFEGGNISASTRNND
                     SSVLMTPPPTSSTATTSYFYSEFSATSNKSLNDINENEEMEDFKAANSKGNSNSPSGK
                     FFSPGPAYKSSPSPQHLPSDLTPNPIVIVEPDFEENSLSPLPPPALKDITQDDPSSPV
                     KPGLRRVASEPNAIKVANGQGSGTVKKALGGNQPKVSSANASPGDAYLNEEPRRSRRL
                     RNKSFSNKFKEVIVGPQSFEKIKLLGQGDVGKVYLVKEKKTNRLYALKIFSKEEMIKR
                     KKIKRILAEQEILATSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCI
                     EEDDARFYSSEVVAAIEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDTKN
                     PVVKGSAQASLLDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVDWWTLGILIYE
                     MLFGFTPFKADTTNKTFSNVLKNEVTFPNNNEVSRNCKDLIKKLLIKSETKRLGSKFG
                     ASDIKKHPFFKRVQWSLLRNQEPPLIPVLTENGYDFTRLSNNVNKGNIKQDAVDNDKE
                     KADPIAEQEKIMFEEKVERDDIVADDDPFHDFNSMSLMKQDNNSLIYGDNNSYGKISY
                     TPNQNRSRSNSHRFFKR"
     gene            complement(<623145..>626252)
                     /locus_tag="KLTH0A07480g"
                     /db_xref="GeneID:8290591"
     mRNA            complement(<623145..>626252)
                     /locus_tag="KLTH0A07480g"
                     /product="KLTH0A07480p"
                     /transcript_id="XM_002551738.1"
                     /db_xref="GeneID:8290591"
     CDS             complement(623145..626252)
                     /locus_tag="KLTH0A07480g"
                     /note="similar to uniprot|P25336 Saccharomyces cerevisiae
                     YCR092C MSH3 Mismatch repair protein forms dimers with
                     Msh2p that mediate repair of insertion or deletion
                     mutations and removal of nonhomologous DNA ends contains a
                     PCNA (Pol30p) binding motif required for genome stability"
                     /codon_start=1
                     /product="KLTH0A07480p"
                     /protein_id="XP_002551784.1"
                     /db_xref="GeneID:8290591"
                     /db_xref="GOA:C5DC35"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007861"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DC35"
                     /translation="MSYQPAISKFFKSNSKNSAKRSASGNGNTGSPSPQPVTGSRSQS
                     SGFWKDTARKSGDGTAEKHEANAADPARAVSKVAKAALSEYSFTRAKSTEDAPSRRGI
                     QESDDFSEKVQSALRKRASGTLDREADQDSSTDAAAIEPASKKSRKSDKLTPLDQQVK
                     DLKLQHMDKILAVRVGYKYKFFAMDAVIVSKILQIMLISGKLTLDDSHPCDRSYKQLA
                     YCSIPDNRLQVHLQRLLRHNLKVGVVEQAETQAIKRAHGTSSGVFRRKVDKVFTKATF
                     SINETFNRAEANSTGELSTIWALKAAEDEHFFHFWLLSVQLSSGEVIHDKFSDRKKMS
                     AIELDKRISYLSPIEVVSRGPLPEVIVSFIKKRQSEVQFYDLSTSEPEAPQGSHLGGI
                     KLPEELLELRATLRHYLENYDTHKILDILHNYKPFDTKTNMILSPNTLESLEIFENQT
                     DLTTRGSLMWILDHTRTPYGYRLLREWISRPLTDKNEINKRLDAIECARKEITSIFME
                     ALSNMLKDTPDFLKNLNRISYGQTSRQEVYVFLKHLDKIAKHFISHHYYLQEQVFDTG
                     GRVHQRSTLLTSVLQQLDDALRKINVTHLLNMINVEGALDKNKEKSCNEFFDLNNYDN
                     AEVIISKLRDIDSVKEELQRELERIRRVLRRPRFFFKDEIEYLIEVRNTQLNGLPTDW
                     VKVASTKTLSRFRTPETTKLVNQLEYHKNLLTYVCDEEFKKFLVRISADYAQLRDIIN
                     KLATFDCILSISAASFNRNYVRPKFSENSRQINIKNGRNPIIESLDVNYVANDVHMKE
                     DANKLMIITGPNMGGKSSFIRQVALIGILAQIGSFVPADSAEIPIFNNVFTRIGAHDN
                     LIKGDSTFKVEMLEMLDILKNCNENSLLLLDEVGRGTGTTDGVSISYAIIKHFTSMET
                     KCPFILFITHYPILGSITSPLLDNYHMSFIEERRPGERWPTAVFLYKLTRGLASDSYG
                     LNVARLANIPTDIINKAFEISEQAKFEMEGDKHLRFISAVKAALLDKGSSYKEKLLRL
                     LEIEE"
     gene            <627176..>633685
                     /locus_tag="KLTH0A07502g"
                     /db_xref="GeneID:8290592"
     mRNA            <627176..>633685
                     /locus_tag="KLTH0A07502g"
                     /product="KLTH0A07502p"
                     /transcript_id="XM_002551739.1"
                     /db_xref="GeneID:8290592"
     CDS             627176..633685
                     /locus_tag="KLTH0A07502g"
                     /note="some similarities with uniprot|P25655 YCR093W
                     Saccharomyces cerevisiae CDC39 Component of the CCR4-NOT
                     complex regulating mRNA levels"
                     /codon_start=1
                     /product="KLTH0A07502p"
                     /protein_id="XP_002551785.1"
                     /db_xref="GeneID:8290592"
                     /db_xref="InterPro:IPR007196"
                     /db_xref="InterPro:IPR024557"
                     /db_xref="UniProtKB/TrEMBL:C5DC36"
                     /translation="MHTSPELQQSQRSKEVKEVAQITLTQISILITSLDESNCKKIEN
                     EILSLLERSPFVVYLKYWKKLLPLASDFIKQHRRLNTSSEPLHRLLYSLIQDLEFKNR
                     EVIEILTKEVFQNAEFQAQTSLNFTDLLALLDPEEDKRIIEQIDPEAAIKRLKKLRNL
                     KMNAAQSLQDFLASETPDTLEQNLSSLLCSLKGESLNDSVALILAEILSPGSQNIQLP
                     STAWFTPNAISEASQRGTQISNAFTKLGPSAINWNRVFNLMSTKYFLNRPISISLASL
                     NSLLAALNRGRLIDQFLSCDWNMQFKLSVCLLFHKWNLQQGCIDLLSMPDIKKVTNNI
                     QNSSPKNTLLYLKSVARLDVEIFLLREELAGNPLLPAFQECFFEDYDLAPEYLALVVM
                     SDNKHFTMLVDNKSIIDDLLITLLVKVFENSPAALTDLLKQLPFEKVVDMGSIIIRKD
                     SSPLLNLVQVLSEVNILPEFIKTLPLHEALKVTPSAKKLGWIGFEDYMKSQLSAETVP
                     LILDHLELQSKMDESSTTFYSSKVYDLSALHYLISLLNSFPLSGKERENLENVQFSLI
                     IAFPRLINFGHGHDKAIIANGDSVPIPMDVEKEMQNYLQKMYSGELAIKDVIEVLRKL
                     RDSDDPHDQDLFACMTHAVIAESNFFKDYPLEALATTSVLFGSMILFQLLRGFVLDVA
                     FRVILNFAQDGTESKMFKFSVQALYAFRMRLKEFPQYCKHLIEAVPALQSQPQIYQTL
                     SQAAAQSPERSNNGATKVQKPPEMIALKYFAISEVPPKVLQESPPKETTEKILFIVNN
                     ITQDNFEDKIEALKLNLKDKYFGWFSNYLVNQRAKTEPNYHSLYARLINSIGSTLLHD
                     YVLNATFKQLYLLLSTKELQFNEKNFLKNLGAWLGSITVALNKPIRYNNIAFRELLLD
                     AHRAERLEIIVPFVCRVLQQASSSKVFLPPNPWTLGILKVLLELNQKANWKLNLTFEV
                     EVLFKSLKLKLTDVEPTNYLDNADSIAFISGDLFRLTAEQQQAEQQQIVTVMQQYQQQ
                     AVLLHNRQQRKAQQPQPPQSQQPQQSQTQQRASSTGFSGLPSGLDQPVSTGDSQANEN
                     PFNTLLGNTLFVTHPDLKRVFQMAIAKSVREILVPAVDKSSSIAVITTVNVVLKDFAT
                     EVDEMKLKTAAITMVRHLAQSLARATSIELLKDTIRSTTQSLAPNLMNVPNSPIEELN
                     VAINDNISIALALIEKATMDKATQYVGEQLMQAVAIRRYHKERRSGQLFLAQNANSFS
                     LNLPEPLGLKPTGVTPQQFRIYEEFGKNNIFDTVSSASGGGFSAEGGPVSQQQILGQQ
                     LLQQQQRQQQQQQQEQHQQQRQQLLEHEQQKQQQQQQLQLQQQQQLQQQQLQQQQQLQ
                     QQQQQQQQQQQQQQQQQLLLQQLQQPHAQSQPGTPQAQTQPSVQVELEQSHRVLVLLM
                     DSLVAQIKENADKALDSLGQENGIKDILFQILTLISRSNQKDQLALKVSQAVVNSMFA
                     TSESPLCREVLSLLLEKLCSLSIVARKDVVWWLVYALDSRKFNVPVIRSLLEVNLIQS
                     SKLDTVLVVAIKNNMEGALQFAVNLLRDVILSEKPLFMRSDFVQTLTYLRTVDCDITN
                     SFFQDFEKANILPVNEVRSATNKERMLLVFTEWVKLLQRVPSDDVKVAVFISQMIEKG
                     VLSETNNVIEFTKAALELSVGSFKESDPTSEVFTATDAFSKLIVNLLVLQDFSEVDRS
                     SYFKLIFSVITFVFSEDQGKTENTFNERPYFRLFSSLLCDWEDISSHNFVKVEDQRCR
                     AQLVEFNKEFYRVIASFLHAYQPIAFPGFSFAWITLISHRMFLPKMLKLPEKAGWSQL
                     VLLFTDLLKFMAQYTKKQDVPDAVSVVYKGALRVFLAVANDAPEFLVENHYELLNNLP
                     HVYMQLRNVVLSAFPKHVSIPNPYNPKLSIDTVKICDQPPNVFYDPVHDLKTLKKPVD
                     NYLRIPSASLSRTISSNVFRSEYEKDNGIGFDTVSVDVKLINAIVLHVGIEAALEKQR
                     TTANAVFNVKSSYYTLLADLLNDGTTEVRFHVVQAIANQLRYPNAHTQWFNYVLKNFF
                     NSEEWGENKTEIQEIIVRTLLERIVTNKPHCWGIIVTFTDLLKSTECSLMDLPFVKDV
                     PEVELIIKHLSKYIVKTEETTNEQQNERAPAEVASRA"
     gene            <634227..>635408
                     /locus_tag="KLTH0A07524g"
                     /db_xref="GeneID:8290593"
     mRNA            <634227..>635408
                     /locus_tag="KLTH0A07524g"
                     /product="KLTH0A07524p"
                     /transcript_id="XM_002551740.1"
                     /db_xref="GeneID:8290593"
     CDS             634227..635408
                     /locus_tag="KLTH0A07524g"
                     /note="similar to uniprot|P25656 Saccharomyces cerevisiae
                     YCR094W CDC50 Endosomal protein that regulates cell
                     polarity"
                     /codon_start=1
                     /product="KLTH0A07524p"
                     /protein_id="XP_002551786.1"
                     /db_xref="GeneID:8290593"
                     /db_xref="GOA:C5DC37"
                     /db_xref="InterPro:IPR005045"
                     /db_xref="UniProtKB/TrEMBL:C5DC37"
                     /translation="MLWFRKRAAKDSRSSESLTTKSRKPPNTAFRQQRLKAWQPILSP
                     QSVLPLLILISAIFAPIGVALIITANNVQNLSIDYSYCENLANSEAFTTIPTKYTKFH
                     FKRKASVQPTWKLSEDSEGELTCQLQFEVPVNLKKSIYIYYRLTNFFQNHRKYVQSFD
                     IDQLKGKAVDEDSLNDDCNPLKSEGDKVIYPCGLIANSLFNDTFAGVLKGVNDTDTDY
                     QLSNKNIAWHADRKRYKKTTYNASDIVPPPNWAKAFPSGYTDDNIPDLSQWEELQVWM
                     RTAGLPKFYKLALKNESTTLPKGTYRMDIGLNYPVRMFGGSKSFVLTTNSIIGGRNMS
                     LGVVYLIVAGISILFGIIFLVKLIIQPRKLGDHSFLNFDDATESESRPNTSDIPLREI
                     L"
     gene            <635570..>636217
                     /locus_tag="KLTH0A07546g"
                     /db_xref="GeneID:8290594"
     mRNA            <635570..>636217
                     /locus_tag="KLTH0A07546g"
                     /product="KLTH0A07546p"
                     /transcript_id="XM_002551741.1"
                     /db_xref="GeneID:8290594"
     CDS             635570..636217
                     /locus_tag="KLTH0A07546g"
                     /note="highly similar to uniprot|P21734 Saccharomyces
                     cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme that
                     mediates selective degradation of short-lived and abnormal
                     proteins plays a role in vesicle biogenesis and
                     ER-associated protein degradation (ERAD) component of the
                     cellular stress response"
                     /codon_start=1
                     /product="KLTH0A07546p"
                     /protein_id="XP_002551787.1"
                     /db_xref="GeneID:8290594"
                     /db_xref="GOA:C5DC38"
                     /db_xref="InterPro:IPR000608"
                     /db_xref="InterPro:IPR009060"
                     /db_xref="InterPro:IPR015368"
                     /db_xref="InterPro:IPR016135"
                     /db_xref="InterPro:IPR023313"
                     /db_xref="UniProtKB/TrEMBL:C5DC38"
                     /translation="MSRAKRVMKELQAIKDDPEAKVDLQLVNENDIHLLKGSFLGPPG
                     TPYENGKFIVDIEVPMEYPFKPPKMKFDTKVYHPNVSSVTGAICLDILKNAWSPVITL
                     KSALISLQALLQSPEPNDPQDAEVAQHFLRDKASFDKTAAFWTKTYAPLESAKAEAPV
                     DQAALYGIDRSLVDQFAAQGFDEEKVVEVLRRLGLKSMSTNDNETANKILEELLR"
     gene            complement(<638520..>639071)
                     /locus_tag="KLTH0A07568g"
                     /db_xref="GeneID:8290595"
     mRNA            complement(<638520..>639071)
                     /locus_tag="KLTH0A07568g"
                     /product="KLTH0A07568p"
                     /transcript_id="XM_002551742.1"
                     /db_xref="GeneID:8290595"
     CDS             complement(638520..639071)
                     /locus_tag="KLTH0A07568g"
                     /note="weakly similar to uniprot|P53604 Saccharomyces
                     cerevisiae YNR049C MSO1 Probable component of the
                     secretory vesicle docking complex acts at a late step in
                     secretion shows genetic and physical interactions with
                     Sec1p and is enriched in microsomal membrane fractions
                     required for sporulation"
                     /codon_start=1
                     /product="KLTH0A07568p"
                     /protein_id="XP_002551788.1"
                     /db_xref="GeneID:8290595"
                     /db_xref="InterPro:IPR028095"
                     /db_xref="UniProtKB/TrEMBL:C5DC39"
                     /translation="MHQESPAAYQKSGKFWSKVKSSTKSFSSSFSQLSLKQERDGDTP
                     TSTVVHKALVKFYSTQEPFQGFPDWLGHKEDLPDEQKVLRKQKHHSPTHSTKPSEPAL
                     HLPSTCSNSAAVTPTPRTAGTDFRGIYKSSSESRATSVDYMGSRPLPRQSQDASRQEN
                     TAQLPPPTQRTSSMLMRERLKRK"
     gene            complement(<639228..>640568)
                     /locus_tag="KLTH0A07590g"
                     /db_xref="GeneID:8290596"
     mRNA            complement(<639228..>640568)
                     /locus_tag="KLTH0A07590g"
                     /product="KLTH0A07590p"
                     /transcript_id="XM_002551743.1"
                     /db_xref="GeneID:8290596"
     CDS             complement(639228..640568)
                     /locus_tag="KLTH0A07590g"
                     /note="highly similar to uniprot|P38999 YNR050C
                     Saccharomyces cerevisiae LYS9 Saccharopine dehydrogenase
                     (NADP L- glutamate-forming)"
                     /codon_start=1
                     /product="KLTH0A07590p"
                     /protein_id="XP_002551789.1"
                     /db_xref="GeneID:8290596"
                     /db_xref="GOA:C5DC40"
                     /db_xref="InterPro:IPR005097"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DC40"
                     /translation="MVKNVLLLGSGFVAQPVVDVLAGTEGINVTVGCRTLAKAQELAA
                     SSKSAAISVDVTKDDDLDAALAKHDLVISLIPYIYHAAVVKSAIRLKKDVVTTSYVSP
                     ALRELEPQIKEAGITVMNEIGLDPGLDHLYAVKTIDEVHRAGGKIKSFLSYCGGLPAP
                     EDSDNPLGYKFSWSSRGVLLALRNSAKYWKDGKIEEVSSEDLMASAKPYFIFPGYALV
                     CYPNRDSTPFKEFYKMPEADTVIRGTLRFQGFPEFVKVLVDVGMLKDDENEIFQKPIS
                     WKEALHQYWGSKSSSKDDLIAAIDSKTQWVTDEDRERILNGFSWLGLFSDNKINPKGN
                     ALDTLCATLEELMQFEEGERDMIILQHKFGIEWADGTPETRTSTLVAYGQPGGYSAMA
                     ATVGLPCAIATKLVLDGKIKGPGLVVPYSPEINDPIMKELKEKYNIFLKEKTIS"
     gene            complement(<641201..>642262)
                     /locus_tag="KLTH0A07612g"
                     /db_xref="GeneID:8290597"
     mRNA            complement(join(<641201..642153,642217..>642262))
                     /locus_tag="KLTH0A07612g"
                     /product="KLTH0A07612p"
                     /transcript_id="XM_002551744.1"
                     /db_xref="GeneID:8290597"
     CDS             complement(join(641201..642153,642217..642262))
                     /locus_tag="KLTH0A07612g"
                     /note="similar to uniprot|P25366 Saccharomyces cerevisiae
                     YCR095C Cytoplasmic protein required for replication of
                     Brome mosaic virus in S. cerevisiae which is a model
                     system for studying replication of positive-strand RNA
                     viruses in their natural hosts"
                     /codon_start=1
                     /product="KLTH0A07612p"
                     /protein_id="XP_002551790.1"
                     /db_xref="GeneID:8290597"
                     /db_xref="InterPro:IPR004861"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DC41"
                     /translation="MLVPPANFGIAEEGIYRCSKIETLNLSFLETLNLKTVVFVGGQQ
                     PSKFFQEFFERSCIQWYVVKTADVSSSLAPVNVSTSKPAVDEKLTPLGSSDNETQYKL
                     SDNDDLMILKSYSLKRTFELLLNTINHNTILVDKTSIVVGVLRKMQKWNIASIINEYR
                     LFSGKNCNYFAETLLEMISVQIIQEEGITGSKDNDQGLINNIDDFDEAHSCHEWEVIK
                     ESDLSLPPSIPAHLLQILQDVQEDSQETVGETAASTPLMRTQSDMGIFGNRYRLAFNK
                     KERADYEFYKGAEQNVLTINIPKESQLPKWFIRQRDTWENDNAQEQHNFYRESIFV"
     gene            complement(<642477..>643940)
                     /locus_tag="KLTH0A07634g"
                     /db_xref="GeneID:8290598"
     mRNA            complement(<642477..>643940)
                     /locus_tag="KLTH0A07634g"
                     /product="KLTH0A07634p"
                     /transcript_id="XM_002551745.1"
                     /db_xref="GeneID:8290598"
     CDS             complement(642477..643940)
                     /locus_tag="KLTH0A07634g"
                     /note="similar to uniprot|P53741 YNR051C Saccharomyces
                     cerevisiae BRE5 Ubiquitin protease cofactor"
                     /codon_start=1
                     /product="KLTH0A07634p"
                     /protein_id="XP_002551791.1"
                     /db_xref="GeneID:8290598"
                     /db_xref="GOA:C5DC42"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR002075"
                     /db_xref="InterPro:IPR018222"
                     /db_xref="UniProtKB/TrEMBL:C5DC42"
                     /translation="MTDIDNIQEVGYAFLKTYYQRMHQDPFKVHHLYSTTAELTHVNY
                     QMDFDYTADTLPTTKLTGKENISKFYTRHSKKVKSIQIKIDACDFQFTGSNNSSILIL
                     ALGELCWANTPSYRFCQNFVLAPVPSNPKIYDVTNDVLRFIPYFPTLIRDGKTSSSNP
                     GAVKDVRKDDYLKEPFCQHIDSEQNIAQKREDNMNNENNREIAEQQHFTDKPKLAEHE
                     QKHDTEKPFQANDMGIVQEAEAGDIQKAEDFDGSEESPVALESNIIDEGVLPEKTNAR
                     SDLKKEAYTAEDAPVPSSAQFPSELNHNETTKVKSPEADKPALEPAKKMNWASKLAAS
                     ESKDVPNATTKYIRAELAPVQPKKAPERKSVSPSGQLKDVKNYKKKQFYYVNKDGFYP
                     VYVRGTGGVSDEQLVRALESEFGTVRKISSQETFAVIDFEDQRCQTEAIERGVLRINN
                     VEVHMEPKTVRKANASTSSTSPSGQRFSKKHTSKRKA"
     gene            complement(<644272..>645540)
                     /locus_tag="KLTH0A07656g"
                     /db_xref="GeneID:8290599"
     mRNA            complement(<644272..>645540)
                     /locus_tag="KLTH0A07656g"
                     /product="KLTH0A07656p"
                     /transcript_id="XM_002551746.1"
                     /db_xref="GeneID:8290599"
     CDS             complement(644272..645540)
                     /locus_tag="KLTH0A07656g"
                     /note="weakly similar to uniprot|P39008 Saccharomyces
                     cerevisiae YNR052C POP2 RNase of the DEDD superfamily
                     subunit of the Ccr4-Not complex that mediates 3' to 5'
                     mRNA deadenylation"
                     /codon_start=1
                     /product="KLTH0A07656p"
                     /protein_id="XP_002551792.1"
                     /db_xref="GeneID:8290599"
                     /db_xref="GOA:C5DC43"
                     /db_xref="InterPro:IPR006941"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:C5DC43"
                     /translation="MQSVNRQIHELPIGEQFFPQQTQQHQHPPGIGPQIFSPQLLQAR
                     LQQQQGGLVQDVHGIEKNQNLQNVYLLKQKLEAANAAFGQQQVPQRQSQTQQMLNNGS
                     QNATSAALGSLAGLPPGVGMVQHGTSGMGPPSGAIHPQLAMGSFSLPPPTYFVVREVW
                     SNNLHAEFMSIRKLVDQYNYVSISTEFVGTIARPMGNFRSKNDYHYQTMRANVDLLNP
                     VQIGISLSDANGNKPENKHSTWQFNFHFDVTKEMVSAESLELLKKSGINFERHQNFGV
                     LAFEFAQLLIDSGLISDNVTWVSYHAAYDFGFLVNMLMNNSMPNNKEDYVWWVQQFVP
                     NFYDLNLINKFSQQHPSQLQQQHQPQFTLETMADELGIPRFSLFSSTAGQSLLALLTF
                     TTLLNLPLPQPQLGPDLTRYKNMIYGITNE"
     gene            complement(<645874..>647803)
                     /locus_tag="KLTH0A07678g"
                     /db_xref="GeneID:8290600"
     mRNA            complement(join(<645874..646572,646994..>647803))
                     /locus_tag="KLTH0A07678g"
                     /product="KLTH0A07678p"
                     /transcript_id="XM_002551747.1"
                     /db_xref="GeneID:8290600"
     CDS             complement(join(645874..646572,646994..647803))
                     /locus_tag="KLTH0A07678g"
                     /note="some similarities with uniprot|P53742 Saccharomyces
                     cerevisiae YNR053C NOG2 Putative GTPase that associates
                     with pre-60S ribosomal subunits in the nucleolus and is
                     required for their nuclear export and maturation"
                     /codon_start=1
                     /product="KLTH0A07678p"
                     /protein_id="XP_002551793.1"
                     /db_xref="GeneID:8290600"
                     /db_xref="GOA:C5DC44"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR012971"
                     /db_xref="InterPro:IPR023179"
                     /db_xref="InterPro:IPR024929"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DC44"
                     /translation="MGTGKKEKQRRVRQNDTRDGNLRVKGENFYRDAKKVQFLNMYTD
                     GKSIRNKKGDLIRAAPLQGVEVPTARVQPDRRWFGNTRVISQDALTHFREALGDTEKN
                     NYQVLLRRNKLPLSLLDEKDVQESPTAKILETESFEQTFGPKSQRKKPRVAASSLEEL
                     AENAVKHNEQFEEKRELDSTLGLMAQNEQNEDGWTQTAKEAIFSKGQSKRIWNELYKV
                     IDSSDVVIHVLDARDPLGTRCKSVEEYMRKETPHKHLIFVLNKCDLVPTWVAAAWVKH
                     LSSERPTLAFHASITNSFGKGSLIQLLRQFSLLHKDRKQISVGFIGYPNTGKSSIINT
                     LRKKKVCQVAPIPGETKVWQYITLMKKIFLIDCPGIVPPSAKDTEEDVLFRGVVRVEH
                     VSHPEQYIPGVLRRCQRKHLERTYEISGWKDSVDFIEMLARKQGRLLKGGEPDESGVS
                     KQVLNDFNRGKIPWFMPPPEKVERSAEQDSSQKKRSAQDQSSSDQHAKKIKS"
     gene            complement(<647969..>648877)
                     /locus_tag="KLTH0A07700g"
                     /db_xref="GeneID:8290601"
     mRNA            complement(<647969..>648877)
                     /locus_tag="KLTH0A07700g"
                     /product="KLTH0A07700p"
                     /transcript_id="XM_002551748.1"
                     /db_xref="GeneID:8290601"
     CDS             complement(647969..648877)
                     /locus_tag="KLTH0A07700g"
                     /note="similar to uniprot|P53743 YNR054C Saccharomyces
                     cerevisiae ESF2 Essential nucleolar protein involved in
                     pre-18S rRNA processing"
                     /codon_start=1
                     /product="KLTH0A07700p"
                     /protein_id="XP_002551794.1"
                     /db_xref="GeneID:8290601"
                     /db_xref="GOA:C5DC45"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DC45"
                     /translation="MASESSDSEGYISEDDHDVLLVDKRKFQGKDVFDDQIDSEEEDS
                     EVDTAGQVSKSRKKASAHELEENPKPVSSEDIKQEKLERLKKLRASKKSKHKTGVVYL
                     SKIPPYMKPAKMRQILSRFGEVDRLFLKREDEQRHKNRVKGGGNKKVMFEEGWAEFVR
                     KKDAKLCASTLNGNILGGKKGSFYHDDVMNVKYLSGFKWADLTEQIARENDVRQAKLQ
                     LEVSQANKMNAEFIRNIEKSKMLNNIRSKKRSNVSEATSNENSDSQPAPAHFKQRKVT
                     TNRASGPEHLKKASSGRLEGVIKNLL"
     gene            <650427..>651605
                     /locus_tag="KLTH0A07722g"
                     /db_xref="GeneID:8290602"
     mRNA            <650427..>651605
                     /locus_tag="KLTH0A07722g"
                     /product="KLTH0A07722p"
                     /transcript_id="XM_002551749.1"
                     /db_xref="GeneID:8290602"
     CDS             650427..651605
                     /locus_tag="KLTH0A07722g"
                     /note="similar to uniprot|P32804 Saccharomyces cerevisiae
                     YGL255W ZRT1 High-affinity zinc transporter of the plasma
                     membrane responsible for the majority of zinc uptake
                     transcription is induced under low-zinc conditions by the
                     Zap1p transcription factor"
                     /codon_start=1
                     /product="KLTH0A07722p"
                     /protein_id="XP_002551795.1"
                     /db_xref="GeneID:8290602"
                     /db_xref="GOA:C5DC46"
                     /db_xref="InterPro:IPR003689"
                     /db_xref="InterPro:IPR004698"
                     /db_xref="UniProtKB/TrEMBL:C5DC46"
                     /translation="MFTQRHSHSHAGSHDEASLAEASSSAAWWAQWDPNTVTIWDDTV
                     PTSWKKCALDGVYFGGSEYQGSLNARISSIFVILFVSTSFTLLPVIFTKVKGIKVPKA
                     CYLFARYFGTGVIIATAFIHLMEHSYMSIGSNSCVGSSGRWADYSWCSGIVLTTVFVV
                     FLVDLLSEVYIERKFGISCSHGDLVEGAISDNNPRLKENDAETGSPVISNKDDVSYDV
                     VSGVNSEIAVKPFESQIGAFLVMEFGIIFHSVMIGLELGTTGEEFSILYPVIVFHQSF
                     EGLGIGARLISIAFPEGKKWWPYALCILYGATTPIAIAIGLGVRMSYNAHSFKMSIIS
                     GVLDAIAAGILIYTGLVELLARDFMFDPNRTKNLKKLTFMIICTFSGAGLMALLGRWA
                     "
     gene            <652578..>653339
                     /locus_tag="KLTH0A07744g"
                     /db_xref="GeneID:8290603"
     mRNA            <652578..>653339
                     /locus_tag="KLTH0A07744g"
                     /product="KLTH0A07744p"
                     /transcript_id="XM_002551750.1"
                     /db_xref="GeneID:8290603"
     CDS             652578..653339
                     /locus_tag="KLTH0A07744g"
                     /note="similar to uniprot|P39721 Saccharomyces cerevisiae
                     YAL049C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A07744p"
                     /protein_id="XP_002551796.1"
                     /db_xref="GeneID:8290603"
                     /db_xref="GOA:C5DC47"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DC47"
                     /translation="MPLFQIIKKDKMSGKCCFTGNLHTGEPLGKFEEVFGLKTYVTGS
                     PSNEKVLVILTDVFGNELNNTKLIADQLAGEDFKVYVPDILFGDNVKSLDGSVDFHEW
                     AHNHRPEITRPIVDQFMKSLQATFSPKFVGVVGHCFGAKYALHQIDVKQSTANAIAVA
                     HPSFCEQEEFRAIGKHPILISAAQTDSIFTVESRHETEKTLNDIGAVYQIDLFSQVTH
                     GFAVRGDVSDPCVLYAKEKVTLDQIHWFKHFSKDA"
     gene            <654163..>655980
                     /locus_tag="KLTH0A07766g"
                     /db_xref="GeneID:8290604"
     mRNA            <654163..>655980
                     /locus_tag="KLTH0A07766g"
                     /product="KLTH0A07766p"
                     /transcript_id="XM_002551751.1"
                     /db_xref="GeneID:8290604"
     CDS             654163..655980
                     /locus_tag="KLTH0A07766g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A07766p"
                     /protein_id="XP_002551797.1"
                     /db_xref="GeneID:8290604"
                     /db_xref="GOA:C5DC48"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR021858"
                     /db_xref="UniProtKB/TrEMBL:C5DC48"
                     /translation="MRVTSKRSRGGCRNCKRSKIKCDERKPKCGHCIRKGKDDCTYSL
                     ALRWGNNPSRSLKTRKGDSKTTLLRDAINVTSSRDPHSSSATVNFPSLVPAEAGIEQL
                     LWPTGHELLSSPGVSYRPQSFKESFLQAPLSPFSFDSPFSGHSERPINSGLAEPGTLE
                     LSHPSPSILSNSPYFSELFGFFLRETSRLLVPVPSYAYRSNPFHTLIPQMAMQSPALM
                     GLILAFGANHRNKMTAYQEQCSFPSLDEKSSAKNIDGLLADELLSSTISQLLVKLMNA
                     EERRSDTTLATILMLAGFDIFFCDTRNKWRAHILGAKKLLMDRLNSKSGTKTMIFKIP
                     SANNVLDTETFLVHWFSYLNIIASLSSASPKNSTEASRGVGYEFCYEDNSAHTHELRL
                     QLRDIDYFTGVDTKILSLLAGVSCLIEEKKVIEQPFGIHNLVLKALELDHEIRSYLEA
                     SEAARDRVESQLLGEDASSDTKLRFQTYKTMRATNLIFGLTGVLQLKRRVIGIPHNSK
                     ILKDLLAEVTALIDKEIPHNSSAASCITFCLFCCGCELIDDNLACHRETYTEHIEALL
                     RKGVTSALQAQSIMKECWREKKCWWEILEEKNLDLAFAI"
     gene            complement(656853..656955)
                     /locus_tag="KLTH0A07788r"
                     /db_xref="GeneID:8290605"
     tRNA            complement(join(656853..656896,656919..656955))
                     /locus_tag="KLTH0A07788r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAG) cove"
                     /db_xref="GeneID:8290605"
     gene            complement(<657742..>659067)
                     /locus_tag="KLTH0A07810g"
                     /db_xref="GeneID:8290606"
     mRNA            complement(<657742..>659067)
                     /locus_tag="KLTH0A07810g"
                     /product="KLTH0A07810p"
                     /transcript_id="XM_002551752.1"
                     /db_xref="GeneID:8290606"
     CDS             complement(657742..659067)
                     /locus_tag="KLTH0A07810g"
                     /note="highly similar to uniprot|P40896 Saccharomyces
                     cerevisiae YJL213W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A07810p"
                     /protein_id="XP_002551798.1"
                     /db_xref="GeneID:8290606"
                     /db_xref="GOA:C5DC49"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:C5DC49"
                     /translation="MSSCAIDVNERNNKKLEDLAVPWRFKPLQKYCIKNSNLVDVVEG
                     TTFPEAYIFVENGKISKVEFGSGQPVDVDTNEYQIIDGTGKYVTPGLFDNHVHMASVT
                     GELDLGKLMTMPKTVSLLRVRYTMEASLARGFTTVRDCGGAESYIKAAVNDGSVIGPR
                     MITCGHAISQTGGHGDLRPGNLPASAFESCSCHYGQVGVVADGVGECYRAAREEFRRG
                     ADFIKMMAGGGVASPTDKVTNVQFCHDEIRALVDVANTYHTYVTAHAYTAEAIQNCIK
                     LGVRGIEHGNLLDEETAELMAKLGCYLTPTLVTYKIMASDQFGSFLGPVNSQKNAEVL
                     SQGIDALKIAQSKGVKICYGSDLLGPLAGYQTQEFFIRGKVQTAQEVLLSATVTPAEM
                     NGLGDKLGQIKPGFIADLLLMNANPLDDISILDEPETNLFLVMKEGRIY"
     gene            complement(<660003..>661517)
                     /locus_tag="KLTH0A07832g"
                     /db_xref="GeneID:8290607"
     mRNA            complement(<660003..>661517)
                     /locus_tag="KLTH0A07832g"
                     /product="KLTH0A07832p"
                     /transcript_id="XM_002551753.1"
                     /db_xref="GeneID:8290607"
     CDS             complement(660003..661517)
                     /locus_tag="KLTH0A07832g"
                     /note="weakly similar to uniprot|P15365 Saccharomyces
                     cerevisiae YJR152W DAL5 Allantoin permease;
                     ureidosuccinate permease; expression is constitutive but
                     sensitive to nitrogen catabolite repression"
                     /codon_start=1
                     /product="KLTH0A07832p"
                     /protein_id="XP_002551799.1"
                     /db_xref="GeneID:8290607"
                     /db_xref="GOA:C5DC50"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DC50"
                     /translation="MSEEEKPVQRGTIEEAEISSRSSSLIEKPDKITNEDALNDEYLE
                     TVTFTAEEEKALVRKIDLYILPLMCFVFLSQYLDKQSLSYATIFGLTKDLKMGQHDIS
                     WCSTIFSIGQLGANFVFTYLMTIVPRAPMTGACVVIWSVCCMCLAAPTTKEGFWVGRL
                     FLGIFEAVVQPACVLITSYWYRKREQPLRTACWISMNAIAQIVGSFLMYGIGKTNKSS
                     VADWKLMFIACGVISLVAGIAFYLLIPVSPRTAWFLTKREKEIAVKRLFDESDRTATN
                     KFKKDQLFECFKFDWLFLSSLAFGFLVTVTSGTIIFQSLMLFSFGYDKFEVMKYGSPA
                     GAVQLLFIWVAVVAVKLFPRERAMISLALVCVPLAGSIMVLSLKQSSGWWIIVGSWLG
                     SVISCIMSILLSLISSNVRGNTKKSVCSNAFFAGYCLAAIIYPQWWVGTYKGGLIVNI
                     IMWIIMDIYLIFYRFKAIFENKKRDKLQEEGFTLETHLVDDLTDKQNIHHRYVY"
     repeat_region   662041..662457
                     /rpt_type=long_terminal_repeat
     repeat_region   complement(663681..663866)
                     /rpt_type=long_terminal_repeat
     gene            664228..664299
                     /locus_tag="KLTH0A07898r"
                     /db_xref="GeneID:8290610"
     tRNA            664228..664299
                     /locus_tag="KLTH0A07898r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (TCC) cove score=66.72"
                     /db_xref="GeneID:8290610"
     repeat_region   complement(665204..665617)
                     /rpt_type=long_terminal_repeat
     gene            complement(<670591..>672450)
                     /locus_tag="KLTH0A07964g"
                     /db_xref="GeneID:8290613"
     mRNA            complement(<670591..>672450)
                     /locus_tag="KLTH0A07964g"
                     /product="KLTH0A07964p"
                     /transcript_id="XM_002551754.1"
                     /db_xref="GeneID:8290613"
     CDS             complement(670591..672450)
                     /locus_tag="KLTH0A07964g"
                     /note="similar to uniprot|P38724 Saccharomyces cerevisiae
                     YHL047C ARN2 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to the
                     siderophore triacetylfusarinine C"
                     /codon_start=1
                     /product="KLTH0A07964p"
                     /protein_id="XP_002551800.1"
                     /db_xref="GeneID:8290613"
                     /db_xref="GOA:C5DC51"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DC51"
                     /translation="MVDNHGEDPVSGVIHASNEVDGKNIVVEKLFSKNADMEQESPDT
                     FEVTESIVIRKAELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYE
                     THSLLSTVNVISMVISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQSQAYDVQR
                     YAAGSVFYNVGLVGAMFQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNVVHVAN
                     PLENWSWGIAMWAFIFPVSCIPFIACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQT
                     FVQLFWRLDVVGVILLSVFTGCICVPLTVAGGVSTEWRSGKVIAPFVLGFSLIPAFVY
                     WESRLARFPLAPFLMLKDRGIWAPLWIYFLIAFIYEMAAEYLYTILLVAANESDLSAI
                     RITSLYSFVAAIFSPIVGLLVARSSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKGV
                     IGAMVVWGITSCLYDYPISVSIQTVTSHENLANVSALSSTIFRIGGAVGAAVSGAIWT
                     QTLYPKLLKALGDAGMAEAAFNSPLDFITDYDWGTPVREATVEAFQYVQKYEVLVGLI
                     FVVPMFVMTFFLRDPPLNEEFGQNLNGEEYVKENDDPINDWIAERLSRFKKQD"
     gene            complement(<678392..>679639)
                     /locus_tag="KLTH0A07986g"
                     /db_xref="GeneID:8290614"
     mRNA            complement(<678392..>679639)
                     /locus_tag="KLTH0A07986g"
                     /product="KLTH0A07986p"
                     /transcript_id="XM_002551755.1"
                     /db_xref="GeneID:8290614"
     CDS             complement(678392..679639)
                     /locus_tag="KLTH0A07986g"
                     /note="similar to uniprot|P53095 Saccharomyces cerevisiae
                     YGL196W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0A07986p"
                     /protein_id="XP_002551801.1"
                     /db_xref="GeneID:8290614"
                     /db_xref="InterPro:IPR001608"
                     /db_xref="InterPro:IPR026956"
                     /db_xref="InterPro:IPR029066"
                     /db_xref="UniProtKB/TrEMBL:C5DC52"
                     /translation="MRYPYQYTALSKKAELLEAFKGKKLSELPTPSFIVDRGKFKENC
                     EKMLANVDRLNVDFRAHVKTHKTVEGTLLQLGSENIKTKKIVVSTLMEAWGLLPLIEK
                     GLIIDVLFSLPVVKSRLPELADLGARIPNLRLMVDNGEQFEVLAEFSKKHKIQKKWSL
                     FIKVNMGSDRAGFDESSTLDEALFDLLQSPAKDYLSLYGFYCHAGHSYASSTEEQARH
                     FLLNEIDSGNNACKKALNIDPSLKLQISVGATPTAHASQSLDISSIGELYGKLELHAG
                     NYPFCDLQQVSTHCVGLDQVSCRVLAEVLSSYPQRGSRGPGEQLINAGVIALAREFGS
                     LPGYGKIVSPKGYENWIVGRLSQEHGILTCLQDTETKMIPLGTKIGIVPQHSCITAAS
                     YPWYFVVEHGDIVVDIWVPWRGW"
     gene            <681796..>682542
                     /locus_tag="KLTH0A08008g"
                     /db_xref="GeneID:8290615"
     mRNA            <681796..>682542
                     /locus_tag="KLTH0A08008g"
                     /product="KLTH0A08008p"
                     /transcript_id="XM_002551756.1"
                     /db_xref="GeneID:8290615"
     CDS             681796..682542
                     /locus_tag="KLTH0A08008g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0A08008p"
                     /protein_id="XP_002551802.1"
                     /db_xref="GeneID:8290615"
                     /db_xref="GOA:C5DC53"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DC53"
                     /translation="MSLVGKVALITGGTKNLGRLTAIELASKHKANLFLHYNSTQGDE
                     KKLANELSSKYNVKVELYQGNLGSARNVEKLFEAAKAKFGSIDIAINNVGKVLKKPMV
                     EVTEEEFDEMDLVNNKIAFFFIAQATKHVSSGGSIISLVTSLLAAYTPFYAVYQGTKS
                     AVEFYTKSASKELIGKRVSVNCIAPGPMDTPFFYAQEQPEAVEFYKSVSFDNRLTKIE
                     DIAPIVGFLATSGSWMTGQTLYASGGMTAR"
     repeat_region   complement(683907..684323)
                     /rpt_type=long_terminal_repeat
     gene            complement(<685177..>686193)
                     /locus_tag="KLTH0A08052g"
                     /db_xref="GeneID:8290617"
     mRNA            complement(<685177..>686193)
                     /locus_tag="KLTH0A08052g"
                     /product="KLTH0A08052p"
                     /transcript_id="XM_002551757.1"
                     /db_xref="GeneID:8290617"
     CDS             complement(685177..686193)
                     /locus_tag="KLTH0A08052g"
                     /note="highly similar to uniprot|Q02895 Saccharomyces
                     cerevisiae YPL088W Putative aryl alcohol dehydrogenase
                     transcription is activated by paralogous transcription
                     factors Yrm1p and Yrr1p along with genes involved in
                     multidrug resistance"
                     /codon_start=1
                     /product="KLTH0A08052p"
                     /protein_id="XP_002551803.1"
                     /db_xref="GeneID:8290617"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="UniProtKB/TrEMBL:C5DC54"
                     /translation="MPIVQQVRLGSSGLKISPIIVGCMSFGSKSWAPWLLDDKEEIFK
                     ILKYCYDNGLRTFDTADIYSNGLSERLIGEFLRNYNINRETVVILSKVNFPVDESLDL
                     SVKSIFNVDEVTALTLTNQRGLSRKHIIDGVAKSVERLGTYIDVLQIHRFDSETTMEE
                     TMRALNDVVESGHARYIGASSMLATEFSDLQFTVERNGWFKFISSQSQYNLLYREDER
                     ELIPYAKRHGIGLIPWSPNARGLLTRPVGVATERSSSDPRFQKLTNAGMEIINRVEEV
                     ANRRNVSMVVASNAWVLHKGCHPIVGMSSTARVDEAVQALTFKLTDEEVKYIEEPYRP
                     KSYE"
     repeat_region   686725..687141
                     /rpt_type=long_terminal_repeat
CONTIG      join(CU928165.1:1..687718)
//
DBGET integrated database retrieval system