GenomeNet

Database: RefSeq
Entry: NC_013078
LinkDB: NC_013078
Original site: NC_013078 
LOCUS       NC_013078             893706 bp    DNA     linear   CON 05-JUN-2017
DEFINITION  Lachancea thermotolerans CBS 6340 chromosome B complete sequence.
ACCESSION   NC_013078
VERSION     NC_013078.1
DBLINK      BioProject: PRJNA39575
            BioSample: SAMEA3138300
            Assembly: GCF_000142805.1
KEYWORDS    RefSeq; FUN; genomic DNA.
SOURCE      Lachancea thermotolerans CBS 6340 (Kluyveromyces thermotolerans CBS
            6340)
  ORGANISM  Lachancea thermotolerans CBS 6340
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Lachancea.
REFERENCE   1  (bases 1 to 893706)
  AUTHORS   Souciet,J.L., Dujon,B., Gaillardin,C., Johnston,M., Baret,P.V.,
            Cliften,P., Sherman,D.J., Weissenbach,J., Westhof,E., Wincker,P.,
            Jubin,C., Poulain,J., Barbe,V., Segurens,B., Artiguenave,F.,
            Anthouard,V., Vacherie,B., Val,M.E., Fulton,R.S., Minx,P.,
            Wilson,R., Durrens,P., Jean,G., Marck,C., Martin,T., Nikolski,M.,
            Rolland,T., Seret,M.L., Casaregola,S., Despons,L., Fairhead,C.,
            Fischer,G., Lafontaine,I., Leh,V., Lemaire,M., de Montigny,J.,
            Neuveglise,C., Thierry,A., Blanc-Lenfle,I., Bleykasten,C.,
            Diffels,J., Fritsch,E., Frangeul,L., Goeffon,A., Jauniaux,N.,
            Kachouri-Lafond,R., Payen,C., Potier,S., Pribylova,L., Ozanne,C.,
            Richard,G.F., Sacerdot,C., Straub,M.L. and Talla,E.
  CONSRTM   Genolevures Consortium
  TITLE     Comparative genomics of protoploid Saccharomycetaceae
  JOURNAL   Genome Res. 19 (10), 1696-1709 (2009)
   PUBMED   19525356
REFERENCE   2  (bases 1 to 893706)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUN-2017) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 893706)
  AUTHORS   Genoscope -,C.E.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2009) Genoscope - Centre National de Sequencage :
            BP 191 91006 EVRY cedex - FRANCE (E-mail : seqref@genoscope.cns.fr
            - Web : www.genoscope.cns.fr)
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CU928166.
            The Lachancea thermotolerans sequence is made of 8 chromosomes (A
            to H). The sequence was annotated by the Genolevures Consortium.
            For more information go to
            http://cbi.labri.fr/Genolevures.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..893706
                     /organism="Lachancea thermotolerans CBS 6340"
                     /mol_type="genomic DNA"
                     /strain="CBS 6340"
                     /type_material="culture from type material of
                     Zygosaccharomyces thermotolerans"
                     /db_xref="taxon:559295"
                     /chromosome="B"
     gene            complement(<1655..>3538)
                     /locus_tag="KLTH0B00110g"
                     /db_xref="GeneID:8290621"
     mRNA            complement(<1655..>3538)
                     /locus_tag="KLTH0B00110g"
                     /product="KLTH0B00110p"
                     /transcript_id="XM_002551758.1"
                     /db_xref="GeneID:8290621"
     CDS             complement(1655..3538)
                     /locus_tag="KLTH0B00110g"
                     /note="similar to uniprot|P25596 Saccharomyces cerevisiae
                     YCL073C and similar to uniprot|P36173 Saccharomyces
                     cerevisiae YKR106W"
                     /codon_start=1
                     /product="KLTH0B00110p"
                     /protein_id="XP_002551804.1"
                     /db_xref="GeneID:8290621"
                     /db_xref="GOA:C5DC55"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DC55"
                     /translation="MIRVASTIKILRSINTNHKMITGGIKAYELKEEKFDVTEHDIES
                     VADSNKSSKLGSGFLKVKEMEIMSSTCSGKSARAALLASAFLCGFGYYLDYITRSVYT
                     GYATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQ
                     CEARDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQFATSWPCIIICWIS
                     GDIVQSANPAKNWRFDIGMWAFLFPISALPFIIFLLYFTRQASKTAEWKEIQGDNKEP
                     SVRIVYWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGFV
                     SFMFFLAWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATISDYLYPVLLVSVN
                     ESSKSATRILWLPTFVACTGSIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYHYRGG
                     ASSHSGIIGASVVLGTGSAIFTQSLIVNLQTMTSHKNMASITGLYFMFAQIGSASGAS
                     ISGAIWTQTMYKQLYKRLEDSSLAATAFSSPYEFIELYPWGTPERTQMIYAYREVQKK
                     TMLVSLVLTGPLFLLILFTKDRKLGDNVTAETTQSDEDPMLTWILKRFNKIKAGWKQK
                     SQS"
     gene            <4664..>6370
                     /locus_tag="KLTH0B00132g"
                     /db_xref="GeneID:8290622"
     mRNA            <4664..>6370
                     /locus_tag="KLTH0B00132g"
                     /product="KLTH0B00132p"
                     /transcript_id="XM_002551759.1"
                     /db_xref="GeneID:8290622"
     CDS             4664..6370
                     /locus_tag="KLTH0B00132g"
                     /note="similar to uniprot|P36172 Saccharomyces cerevisiae
                     YKR105C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00132p"
                     /protein_id="XP_002551805.1"
                     /db_xref="GeneID:8290622"
                     /db_xref="GOA:C5DC56"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DC56"
                     /translation="MTEIETGQNSEYNRKISDETKDLSVKQSACIAPDASKRNRVKLF
                     LSLLSLGLSMFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRL
                     SAVLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQL
                     VNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFIFF
                     YNPEGADLLEKGSQTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAGWLLFLLA
                     LTFGGQTHPWKSGIVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLSWHLMSQR
                     AILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGV
                     IIKKTGHIKPLLVFGSAMGVLGSGLMILLNNTSTKHTQIGVLILPGVALGFVLPAALI
                     TCHVQLDRTSPSYGADMLETTSVNALLKSLGTTVGSILSTMVFSTSLHNKMKNSNILF
                     EVSGELDSIASYRLDHFDGPRSEMGCMLNDSIRNTFWMALGSSVVAFLCSLLVSRRKV
                     SM"
     gene            complement(<7385..>9055)
                     /locus_tag="KLTH0B00154g"
                     /db_xref="GeneID:8290623"
     mRNA            complement(<7385..>9055)
                     /locus_tag="KLTH0B00154g"
                     /product="KLTH0B00154p"
                     /transcript_id="XM_002551760.1"
                     /db_xref="GeneID:8290623"
     CDS             complement(7385..9055)
                     /locus_tag="KLTH0B00154g"
                     /note="weakly similar to uniprot|P38090 Saccharomyces
                     cerevisiae YBR132C High affinity polyamine permease,
                     preferentially uses spermidine over putrescine; expression
                     is down-regulated by osmotic stress; plasma membrane
                     carnitine transporter, also functions as a low-affinity
                     amino acid permease"
                     /codon_start=1
                     /product="KLTH0B00154p"
                     /protein_id="XP_002551806.1"
                     /db_xref="GeneID:8290623"
                     /db_xref="GOA:C5DC57"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DC57"
                     /translation="MSKKENFELAVTTLEEGETTTIHDVGAETIRSLEGQAPSLEERI
                     ARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMC
                     VMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDKI
                     PKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHK
                     VLGFKNWSNPGAFAEYISKGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKV
                     IPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLG
                     IGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKRGVPIYCCVA
                     VLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKT
                     LPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGH
                     KLYKKTRFVKPVEMDLFSGIAELAEEDAYWEENPPKMNLLDKAFGFIL"
     gene            <10791..>12137
                     /locus_tag="KLTH0B00176g"
                     /db_xref="GeneID:8290624"
     mRNA            <10791..>12137
                     /locus_tag="KLTH0B00176g"
                     /product="KLTH0B00176p"
                     /transcript_id="XM_002551761.1"
                     /db_xref="GeneID:8290624"
     CDS             10791..12137
                     /locus_tag="KLTH0B00176g"
                     /note="similar to uniprot|P10356 Saccharomyces cerevisiae
                     YER152C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00176p"
                     /protein_id="XP_002551807.1"
                     /db_xref="GeneID:8290624"
                     /db_xref="GOA:C5DC58"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DC58"
                     /translation="MKSIINLFKGYASHDLLPRKDIIEATSEVLQPEVREYDYNDEDR
                     HPLVYGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNILVQT
                     TLPHTGYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFEN
                     SANGEREQKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELAR
                     KYDILIISDDVYDLLRLDDDNGSGALIPSPPELRFPHLDRESISAANTFGNTISNCTF
                     SKIIAPGLRTGYQETANANLATQLASGGANVSGGTPCQLNSMIVATMIKNGAVERIVH
                     NFVSVLRERAMVLAESIKLYLPKGTQYSECKGGYFSWCTLPVGYDSSKIVEEVSHEGV
                     LLADGSHFEVSGDKRNWGERSVRLSISYVTAAEIQEAVKTWGQFCEKHRYLSSKGS"
     repeat_region   14631..15046
                     /rpt_type=long_terminal_repeat
     gene            complement(<17460..>18851)
                     /locus_tag="KLTH0B00220g"
                     /db_xref="GeneID:8290626"
     mRNA            complement(<17460..>18851)
                     /locus_tag="KLTH0B00220g"
                     /product="KLTH0B00220p"
                     /transcript_id="XM_002551762.1"
                     /db_xref="GeneID:8290626"
     CDS             complement(17460..18851)
                     /locus_tag="KLTH0B00220g"
                     /note="highly similar to uniprot|P07991 Saccharomyces
                     cerevisiae YLR438W CAR2 L-ornithine transaminase (OTAse)
                     catalyzes the second step of arginine degradation
                     expression is dually-regulated by allophanate induction
                     and a specific arginine induction process not nitrogen
                     catabolite repression sensitive"
                     /codon_start=1
                     /product="KLTH0B00220p"
                     /protein_id="XP_002551808.1"
                     /db_xref="GeneID:8290626"
                     /db_xref="GOA:C5DC59"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR010164"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DC59"
                     /translation="MILARGKVAGLRRVFHHGGAFLASSQAFKMSTLNTDLSSETTVQ
                     YEKAYSAHNYHPLPVVFQKAKGAKVWDPEGKQYLDFLSAYSAVNQGHCHPDIIAALVD
                     QASKLTLSSRAFSNNVFSAFAKFITEYFRYESVLPMNTGAEAVETGLKLARRWGYMKK
                     GIPENEAIILGAKDNFHGRTLGALSLSTDEEARKFFGPFLESITAKIPGTDGQYLRYG
                     NIEDVELAFKNAGDRIAAILLEPIQGEAGIVVPPVEYLQKVQELCRKYNVLLICDEIQ
                     TGIARTGKMLCYEHSPNVKPDVILLGKAISGGILPVSCVLSSKEIMGCFEPGSHGSTY
                     GGNPLSSRVAIAALEVVKKENLVERAKTLGEFFQSELKKLQQEAGGIISDVRGRGLLT
                     AIVIDPSKSNGRTAWDLCLLMKDQGVLAKPTHDHIIRLAPPLVISKEDLMKGVEAIRA
                     SLKLLPNAAKSNH"
     gene            <23546..>24871
                     /locus_tag="KLTH0B00264g"
                     /db_xref="GeneID:8290628"
     mRNA            <23546..>24871
                     /locus_tag="KLTH0B00264g"
                     /product="KLTH0B00264p"
                     /transcript_id="XM_002551763.1"
                     /db_xref="GeneID:8290628"
     CDS             23546..24871
                     /locus_tag="KLTH0B00264g"
                     /note="highly similar to uniprot|P40896 Saccharomyces
                     cerevisiae YJL213W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00264p"
                     /protein_id="XP_002551809.1"
                     /db_xref="GeneID:8290628"
                     /db_xref="GOA:C5DC60"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011059"
                     /db_xref="UniProtKB/TrEMBL:C5DC60"
                     /translation="MQLTAIDVNERNNKSLEDLVTPWKIPPLKDYYIKNANLVDVREG
                     ITKPGAHIFTSGGFITNICFSDHEADKCTSDKFEIIDATGKFVMPGLFDNHVHVTSVP
                     GETDLSKTLNMPKTRALMRVRHKLEGALARGFTTLRGCGGAESYIKAAVIEGSVIGPR
                     LLTCGHAISQTGGHGDMRPADLPGEAFDSCSCHMNDLGVVADGAAECYKVAREELRRG
                     ADFIKIMAGGGVASPTDKITNLQFCDDEVTALVKVAKTYNTYVTAHAYTPEAIKACVS
                     YGVKGIEHGNLLDEETAQLMAKAGCYLTPTLVTYKIMASDQFSTFLSGSNREKNTQVL
                     YRGIEALRIAKKNGVKICYGSDLLGSLGGYQTQEFFIRGRYLSTHEVLLSATITPAEM
                     NGLQDQIGEIKPGFIADMLLMNSNPLENITVLDEPESNLVFVMKEGRVY"
     gene            <25467..>26243
                     /locus_tag="KLTH0B00286g"
                     /db_xref="GeneID:8290629"
     mRNA            <25467..>26243
                     /locus_tag="KLTH0B00286g"
                     /product="KLTH0B00286p"
                     /transcript_id="XM_002551764.1"
                     /db_xref="GeneID:8290629"
     CDS             25467..26243
                     /locus_tag="KLTH0B00286g"
                     /note="similar to uniprot|Q12288 Saccharomyces cerevisiae
                     YLR126C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00286p"
                     /protein_id="XP_002551810.1"
                     /db_xref="GeneID:8290629"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DC61"
                     /translation="MSKIAILNANPPQEALKRWGSFADMAIEMFEATKASFLNSTVEY
                     EVYNVYEKDFPTVLELCNGDYLGLHITGSTSDAYAIDIEWVNILRKLLQNLLKNGAHP
                     PISGICFGHQILASALGSEVRRNPKGYEGGITRLEITKEALKLGLFQNSTSPLPSCEF
                     YASESHSDFVKNVPHGYINTLTSKKCDVQGLYKRNVALTFQCHPDFISEVCIKCNEGT
                     YSRGEINADELAHMKESGRQRNNDGRFFATYIWMLFTNVL"
     gene            complement(<26947..>28719)
                     /locus_tag="KLTH0B00308g"
                     /db_xref="GeneID:8290630"
     mRNA            complement(<26947..>28719)
                     /locus_tag="KLTH0B00308g"
                     /product="KLTH0B00308p"
                     /transcript_id="XM_002551765.1"
                     /db_xref="GeneID:8290630"
     CDS             complement(26947..28719)
                     /locus_tag="KLTH0B00308g"
                     /note="highly similar to uniprot|P53051 Saccharomyces
                     cerevisiae YGR287C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00308p"
                     /protein_id="XP_002551811.1"
                     /db_xref="GeneID:8290630"
                     /db_xref="GOA:C5DC62"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /db_xref="InterPro:IPR013780"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR015902"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DC62"
                     /translation="MVSMPNHPETEPKWWKEATVYQIYPASFKDSDNDGWGDMKGIYS
                     KLDYIKELGADAIWISPFYDSPQDDMGYDIANYEKVWPTYGTNEDCFKVIEKTHKLGM
                     KFITDLVINHCSSEHEWFKESRSSKTNPKRDWFFWRPPKGYDKNGAPIPPNNWKSYFG
                     GSAWTFDEKTQEFYLRLFASTQPDLNWESEECRKAIYESSVGFWLDHGVDGFRIDVGS
                     LYSKVPGLPDAPIVDKDSEWQSSDPLTLNGPRIHEFHQEMNKFMRDRVKDGREIMTVG
                     EMQHAPNEVKKMYTSASRHELGELFNFSHTDVGTSPLFRYNLVPAVLKDFKVSLAELF
                     EYINGTDCWSTVYLENHDQPRSITRFGDDSPKYRVVSGKMLSVLLTALTGTLYIYQGQ
                     ELGQINFKNWPVEKYEDVEIRNNFRVIKEEHGENSVQMKKFLEAVALISRDHARTPMQ
                     WSGEEPNAGFSGPDAKPWFYLNESFREGINVETEEKDPDSVLNFWKKALKFRKEHKDI
                     AVYGYDFEFVDLENKKLFSFTKKYGKKTMFTTLNFSSDEVDFEFPNDVSYSLAFGNYD
                     EGQVDASSKTLKPWEGRIYINESA"
     gene            <29891..>31591
                     /locus_tag="KLTH0B00330g"
                     /db_xref="GeneID:8290631"
     mRNA            <29891..>31591
                     /locus_tag="KLTH0B00330g"
                     /product="KLTH0B00330p"
                     /transcript_id="XM_002551766.1"
                     /db_xref="GeneID:8290631"
     CDS             29891..31591
                     /locus_tag="KLTH0B00330g"
                     /note="highly similar to uniprot|P54862 Saccharomyces
                     cerevisiae YOL156W HXT11 Putative hexose transporter that
                     is nearly identical to Hxt9p, has similarity to major
                     facilitator superfamily (MFS) transporters and is involved
                     in pleiotropic drug resistance"
                     /codon_start=1
                     /product="KLTH0B00330p"
                     /protein_id="XP_002551812.1"
                     /db_xref="GeneID:8290631"
                     /db_xref="GOA:C5DC63"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DC63"
                     /translation="MSEPGVKLDRVSSNPVEGSTKPGSISSHEKLDIEREKDLHNFPP
                     HENDIELPKQPLSHYFSISILCLMIAFGGFIFGWDTGTISGFVNLSDFVRRFGSRNSK
                     GVYYLSKVRMGLIISIFNIGCAIGGIVLSKIGDVYGRRIGLISVTIVYVIGIIIQISS
                     TDKWYQYFIGRIISGLGVGGIAVLSPMLLSEVSPKHIRGMLVNLYQLLGTMGIFLGYC
                     TNYGTKKYTDSTQWRVGLGLCFAWAMLMISGMLFVPESPRYLVEAGKLEEAKRSLSRS
                     NKVLIDDPAIAAELDAISAGVESERLAGDATWGELLSTKTKVIQRVIMGIMIQSLQQL
                     TGDNYFFYYGTTIFKSIGLEDSFETSIIIGAVNFFSSFIAIYTIERFGRRTCLLWGAA
                     SMFCCFIVFASVGVTKLWPEGPDHPGISSKGAGNCMIVFTMFFIFSFATTWAGCCYVI
                     VSETFPLRVKSKGMALSTAANWMWGFLISFFTPFITGAINFYYGYVFMGCLIFAYFYV
                     FFFVPETKGLTLEEVDIMWLESVPAWNSSSWVPPTRRSADYVVDTSSKNFFSKFFSKN
                     "
     gene            complement(<31952..>34756)
                     /locus_tag="KLTH0B00352g"
                     /db_xref="GeneID:8290632"
     mRNA            complement(<31952..>34756)
                     /locus_tag="KLTH0B00352g"
                     /product="KLTH0B00352p"
                     /transcript_id="XM_002551767.1"
                     /db_xref="GeneID:8290632"
     CDS             complement(31952..34756)
                     /locus_tag="KLTH0B00352g"
                     /note="weakly similar to uniprot|P25611 Saccharomyces
                     cerevisiae YCR106W RDS1 Regulator of drug sensitivity
                     transcriptional regulator"
                     /codon_start=1
                     /product="KLTH0B00352p"
                     /protein_id="XP_002551813.1"
                     /db_xref="GeneID:8290632"
                     /db_xref="GOA:C5DC64"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR002409"
                     /db_xref="UniProtKB/TrEMBL:C5DC64"
                     /translation="MEHQHPIKIQKRNRPSFVCQECRRRKIKCDKKRPRCSRCVDTGL
                     PCTYLASGSRSAADWHISGDETSIWTGESVTTTESRTPGESGAATSEAHSEALGDEQL
                     ALPQASTRCRCSCGSCCGYGTTFAYADGSGRRAPTSASAHEIYVNFGNPEDTMVAHEQ
                     MRYLHKPFSALAMMQRDHFLRAFAGSVTGVILTGMHSAPANGNPESFTYDGKLNSRQD
                     SNNEGRGTQEIPVNVFMEEIKKTNMLMNRRRAGNDLIKLVFFQNPWSFDDNVGSTSAY
                     PAELVSLVTNIQDILPDVAALRFLLDCFYEAVYPLHPFLDVPSFEKVLSEVLKARSDG
                     SQRYNIMLGTSALHNKLENLAILLVVLKISQAALNMQQDPLKSATAKKLDIFGHNNIK
                     DDVIILAQKCLNALNFLRLPNENTFCCLLFLWIYQSYDLDDVNFSLPPHVALVLGTLS
                     HLSVILGLHNDPSMYPRLVESSQFHSSFLNYRRKLWMGVVSVRTNELLLNGNSLESTH
                     ALMSSFLKRGREDKESYMSSVIQDEGQENSFDTRLHEFAHKEYELRRIWTKLNSACNS
                     LDKPILLSEIEIIISRAEITLSQLFPLTDITEISSFSCPEKGTVKCAESKAEIDYNAI
                     RACKTYANNLRGRIIILNISMALTVHFENLCRNEPDRYLEYYRKYLKLTFRRSLEIVK
                     LLKKLPDNMEKNSLFSRYKYALTRITLDSVLRTLIPMCSILFKLSFAERQLKMSVKSE
                     RVLYEKDDHSDSSHSLQMIVNVKESLAQALRSLISLQSTNWGLGFLSCYRLVCMAKYV
                     LHLVDIDMLPEVTNRFWEYEKNYKQVPESIANRIFLKWGLKFKESKAIKDDLFNPNVL
                     GAMDSDLLESFKTILESLELWKLTENTPEVNDVSSLSDRNEQLSEEVAEDAQGFSLDI
                     LDYFKVFEDEYSGESFPSIF"
     gene            complement(<36075..>37979)
                     /locus_tag="KLTH0B00374g"
                     /db_xref="GeneID:8290633"
     mRNA            complement(<36075..>37979)
                     /locus_tag="KLTH0B00374g"
                     /product="KLTH0B00374p"
                     /transcript_id="XM_002551768.1"
                     /db_xref="GeneID:8290633"
     CDS             complement(36075..37979)
                     /locus_tag="KLTH0B00374g"
                     /note="similar to uniprot|Q08989 Saccharomyces cerevisiae
                     YPL277C Hypothetical ORFs"
                     /codon_start=1
                     /product="KLTH0B00374p"
                     /protein_id="XP_002551814.1"
                     /db_xref="GeneID:8290633"
                     /db_xref="UniProtKB/TrEMBL:C5DC65"
                     /translation="MQTRRLSFLVAAGGILVLLVFSSSRLFQTNDILSSLTSPAKTSE
                     ETSTAVSLIRWDNYLDYTRKLDFENSTALFNSVRAALRQSSSDIHPVGVSYFPAVIPQ
                     GTLMYHAGSKVPTTFEWLAMDHEFSYSFGLRSPSYGRKSLQKRRGGPGRGPGGDKKPG
                     GSNTSVNTPDKPSRGPGLTSSQKMLTYRATRDLNKFLYLDGASAAKTETGEMDTQELL
                     SNVAEKKLNLSGDGENGGMQERIFAARICEWGKPFGLDGIIRVEVGFEVVLCNFSSSA
                     VELVSALELVNPSEHLGLPPPSVISKENGWPLDDDGNLIEEDLTDEQKALLDKEDSWQ
                     QVLENFYGVKSFNWLRAGAVHDKGERRIQLDYRHLVTGINRTVINPDPNNRRLLNDGT
                     SWENQLKIVEDLEQVLSIGFDASQSTDWQIVFDEVVDKFAPILRMLSGILQRDDSSSE
                     NIAINATAITLNFSLRFKAKDDVKNQYGNDREFAVYQYVRPLKDLRTNSDFLVWSASV
                     NVVRKVVDAIYDVNELLLPIVRSHMGKESGASIEAAQAVTRAQQEIDDLIEDLGWIEL
                     HYRCEKVCKWDEICYTPSWGPSPMGMTVPGSPNAGTGTHYDADRQRLVIDSALRCLSL
                     NELLGNRGHF"
     gene            complement(<38234..>42757)
                     /locus_tag="KLTH0B00396g"
                     /db_xref="GeneID:8290634"
     mRNA            complement(<38234..>42757)
                     /locus_tag="KLTH0B00396g"
                     /product="KLTH0B00396p"
                     /transcript_id="XM_002551769.1"
                     /db_xref="GeneID:8290634"
     CDS             complement(38234..42757)
                     /locus_tag="KLTH0B00396g"
                     /note="similar to uniprot|P32386 Saccharomyces cerevisiae
                     YLL048C"
                     /codon_start=1
                     /product="KLTH0B00396p"
                     /protein_id="XP_002551815.1"
                     /db_xref="GeneID:8290634"
                     /db_xref="GOA:C5DC66"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DC66"
                     /translation="MMQFATETEKLRSTVAFLYSFLVPLSGGSFVLLGWDLLRLYWAS
                     QRNACGYEAPEADASTSLISRKPEHQITEHASSYPQLEWRVLCESSQQDCEQVVKKVF
                     GKELLKSYAELLTIILCIVLELSLQRAVNRTQEEAPWILSSQIFWFSLLVSSLCRIVS
                     LHRGGKSFITFQKLRALNFLLFGFIFCVKVLHFTLVFLRSQVKSLEGKYVTGGTFLAG
                     VLSILALSSQQSFGLTDPPLNQNDAPPAPEGSSSIFHSLTFSWLDGLIFRRSQKQLRF
                     QDIFDLQPKYRTLPVIKRYSDRSHGCTSLIKRLTAFCWKSIIMQCTWSLAGAIASFMP
                     TLQMKKILEYIENPSGSNIRVAWVCVFVMIVSKIIAALCESQAVYLGARVCFQLKSII
                     TAEISRKALKQSLFSSESKTRCGATNGEVINLVAIDSTAVSELCGSLHYLVQAGIMTT
                     VAISLLYQMLGWSAFVGVSVIIILLPFNVKIATLMQTYQSEALAMTDKKTNAISAMLG
                     SIKNVKFLCWENHFQELIMGFRSSECSFLTKKLFCWATLHLVWFLTPTLVTAATFGAS
                     IYLQKQKITVASAYTALTLFALLRNPLTQLATMLGTIIQTTVSIQRIEKFLNRSNTKK
                     HEILKDSFTEMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLA
                     LLGELDLIEGSIRVPRGYMHDDRCSFAFCSQTPWITNATVKENIVFSSQFNTKRYQEV
                     LHACGLEEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAV
                     DPGMAVWIFQKCIMGPLMKGKTCILATHNIALVQKHADMIILLDNGRVSKIGKARDFN
                     FDSEFDYSKPSKLEKAEMKPNKKPKKEMILQPDTGFSREEHKEDGSIKIEVYNWLVKH
                     LGGWRTITAFTMLLCLTHGIEMTQNLWIKIWCSSGDGANEHYKSSIYYLSTYAAIGLF
                     HASVTTLIMLKFLCIGLEASSKVFAEILNRVLHAKMTFFDFTPAGRILNRITRDFEIL
                     EQELMVLLLQLLFAITSLGAILLLISVIATKFLIFAFLLGIIYAVMITSYIPAFRDLK
                     RYEGITRSPIFEQFSELLSGFVTIRGFGKEKSCMGQLFRKLDLNNRPAYYVSVVQLWL
                     CLRVEVLGSLVLGATATLSLLNAKELGAGLAGLALTYAMPFSQSALWTATVSSNVEIK
                     MTSVERIKEYTEIDCEDTKAGALINTQWSGGAEISFDHVYVRYAPHLPDVLKNVSFTL
                     LPNSKVAIVGRTGSGKSTVMMSLFRLIELTNGTIRIGGIDIASLNLQTLRRELTVIPQ
                     DPSLFSGTIKSNIDPFGRYSDQELTHFARRIGLFSGTDDVRTFNSLGSLVSEGGENMS
                     QGQRQLLCLARALLQKSKILILDEATASIDHETDATIQQVVRDFSSGGIVITVAHRMS
                     TIIDYDQVIVLDSGIVKENNHPYLLLKQNGAFHQMCKESGEYERLEDAAKKAYQKGLS
                     QARSAPRNSESKC"
     gene            complement(<44522..>46297)
                     /locus_tag="KLTH0B00418g"
                     /db_xref="GeneID:8290635"
     mRNA            complement(<44522..>46297)
                     /locus_tag="KLTH0B00418g"
                     /product="KLTH0B00418p"
                     /transcript_id="XM_002551770.1"
                     /db_xref="GeneID:8290635"
     CDS             complement(44522..46297)
                     /locus_tag="KLTH0B00418g"
                     /note="highly similar to uniprot|P43550 Saccharomyces
                     cerevisiae YFL053W DAK2 Dihydroxyacetone kinase required
                     for detoxification of dihydroxyacetone (DHA) involved in
                     stress adaptation"
                     /codon_start=1
                     /product="KLTH0B00418p"
                     /protein_id="XP_002551816.1"
                     /db_xref="GeneID:8290635"
                     /db_xref="GOA:C5DC67"
                     /db_xref="InterPro:IPR004006"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="InterPro:IPR012734"
                     /db_xref="UniProtKB/TrEMBL:C5DC67"
                     /translation="MSQKQFKSDGNIVAPYLLGLARSNPGLTVIEHDRVVFRAASAPS
                     AKNKPKVTLVSGGGSGHEPTHAGFVGDGALDAIAAGAIFASPSTKQIFSALKAVESPK
                     GTLLIVKNYTGDIIHFGLAAERAKAAGMNVELVAVGDDVSVGKKKGSLVGRRGLGATV
                     LVHKIAGAAASHGLELSEVAKIARAVVENSATIAGSLDHCTVPGHKPENNLGPDEYEI
                     GMGIHNESGTERRSPLPSIPQLVTELLPLVLGEKEDNTFVEFSPEEDVVLMINNMGGM
                     SNLELGYATEVVSEQLIKKFSIVPKRTMSGTFITALNGPGFGITLLNASKAGPDIMRY
                     FDYPTNASGWNQNYHSAQEWKVLAGGKVPTAPPLETVKNEKPSGVTANYETFSKILQS
                     GIAKVKEVEPKVTWYDTIAGDGDCGTTLVSGGRALEEAIQKHTLRLTDAAHGIEDIAY
                     IVEDSMGGTSGGLYSIYLSALAKGISDSGDKTLTVDTFREASKTALDALYKYTRARPG
                     YRTLIDALQPFVEALNSGQDPRTAVDAAFKGAEKTRKMDALVGRASYVAKEELSKLDD
                     EGGLPDPGAVGLAALLDGLVSAAGY"
     gene            <46950..>48908
                     /locus_tag="KLTH0B00440g"
                     /db_xref="GeneID:8290636"
     mRNA            <46950..>48908
                     /locus_tag="KLTH0B00440g"
                     /product="KLTH0B00440p"
                     /transcript_id="XM_002551771.1"
                     /db_xref="GeneID:8290636"
     CDS             46950..48908
                     /locus_tag="KLTH0B00440g"
                     /note="similar to uniprot|P43549 Saccharomyces cerevisiae
                     YFL054C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00440p"
                     /protein_id="XP_002551817.1"
                     /db_xref="GeneID:8290636"
                     /db_xref="GOA:C5DC68"
                     /db_xref="InterPro:IPR000425"
                     /db_xref="InterPro:IPR022357"
                     /db_xref="InterPro:IPR023271"
                     /db_xref="UniProtKB/TrEMBL:C5DC68"
                     /translation="MVGESIMPSSSSSSSISSSSSDVPRATREQRGREGETEQVKWSG
                     NLKDSSQKTKRGDRTSVDVGVARGVSSGRKATHTEGTKNVLSRLTPLNKPAAEDAQPR
                     HQKRHPVGTAFSSPNLKSLNTPLSREQARLMEYYLSTAVPRSNNNYVDPLYRHLNPSV
                     GSTKSRPVWSLNQPLPHVLDHSLAEKMLKKNTDVKSRASSRPESREMSRAGSLASMND
                     WKKLIGRSGSWRKLNDVEAQIPGATKNSGLTRNRKHSQSQIEFANNQRRAHHAASFQL
                     GDESCTPSLRGEDVPAQIQNQKQAGTAPTAEELLEKRFRSSLDGATPLDGGRLGTGDS
                     ESEQLAFTNYWAKIRYRLREPFAEFLGTLILVIFGVGGNLQATVTNGSGGSYESLSFA
                     WGFGCMLGVYVAGGVSGGHINPAVTISMAIFRKFPWKKVPVYIFAQIVGAFFGGAMAY
                     GYFWSSITEFEGGTHIRTAASGACLFTNPKSYVTWRNAFFDEFIGASMLVGCLMALLD
                     DSNSPPTNGMTALIVGFLVAAIGMALGYQTSFTINPARDLGPRIFASMIGYGPHAFHL
                     THWWWTWGAWGGPIAGGIAGALVYDIFIFTGCESPVNYPDNGYIEHRVSKILHAEFHP
                     HDSPKSSEVVVEEGSNSKDGSTKSNSAH"
     gene            complement(<49413..>51011)
                     /locus_tag="KLTH0B00462g"
                     /db_xref="GeneID:8290637"
     mRNA            complement(<49413..>51011)
                     /locus_tag="KLTH0B00462g"
                     /product="KLTH0B00462p"
                     /transcript_id="XM_002551772.1"
                     /db_xref="GeneID:8290637"
     CDS             complement(49413..51011)
                     /locus_tag="KLTH0B00462g"
                     /note="weakly similar to uniprot|P38866 Saccharomyces
                     cerevisiae YHR176W FMO1 Flavin-containing monooxygenase,
                     localized to the cytoplasmic face of the ER membrane;
                     catalyzes oxidation of biological thiols to maintain the
                     ER redox buffer ratio for correct folding of disulfide-
                     bonded proteins"
                     /codon_start=1
                     /product="KLTH0B00462p"
                     /protein_id="XP_002551818.1"
                     /db_xref="GeneID:8290637"
                     /db_xref="GOA:C5DC69"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:C5DC69"
                     /translation="MTKDARKEIKSVAIIGAGVAGLTSLFELLNTRKDGTTNLAYSSD
                     GKFDEANTNENKNPAFQKIVGFELKSSIGGIWSPNFDTPDFIEQKDLDSERYDDPLFL
                     RPPTEAPSELYNRGYTFSEPLITERPDTPSPKTWAASGIYQHLYSNVPQRYLRNSFIP
                     YSENQEKQNSNIAPLITNYSITESLLDFAKTHRLEKHIRVNSEVVKIKKVSNGSWRLT
                     VKENPKNSSLTRWYEEDFDAVLVSNGHYSIPYIPRIEGLSKWVARYRDSVLHSKSFRE
                     FDKFKNKRCLFVGTGLSGIDILQYVFPVAKEVIVSRTPDKEEIYPWLTKAATSEGLIK
                     KPRIKELRPSENRKVIFQDGSIVEGVDHIIFSTGYHWHYPFLNEGVSGLSVIKSGQKV
                     LKDSASMVDGLFLDTFSIDDPSLAFVGVTVTPLKWPSFELTASAIAGVWANASSLPSK
                     DSQLSAISQRKKEMGENLLFHYFPPMHIKELMARLEHFLPKGRKAADIIDLKHLSDFE
                     KAAEVAERLFYLLKNEEIELSETL"
     gene            complement(<51712..>53412)
                     /locus_tag="KLTH0B00484g"
                     /db_xref="GeneID:8290638"
     mRNA            complement(<51712..>53412)
                     /locus_tag="KLTH0B00484g"
                     /product="KLTH0B00484p"
                     /transcript_id="XM_002551773.1"
                     /db_xref="GeneID:8290638"
     CDS             complement(51712..53412)
                     /locus_tag="KLTH0B00484g"
                     /note="weakly similar to uniprot|Q12300 Saccharomyces
                     cerevisiae YDL138W RGT2 Plasma membrane glucose receptor"
                     /codon_start=1
                     /product="KLTH0B00484p"
                     /protein_id="XP_002551819.1"
                     /db_xref="GeneID:8290638"
                     /db_xref="GOA:C5DC70"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DC70"
                     /translation="MTVEEKLNGEVTEVGDVASSDQSIKVAAVFKEYEPEKEVLSEVD
                     QIIREYELEDHRELLTRGALWANNPGILETESYSDEDRRVAKQAQERPLSSLSKHMLL
                     AALCTSCAAINFGMDESAIGGAVLQYQKQFNITDPNIQGLTVAAPYLAAACLGSPLTI
                     YLDNYVGRKWIVFLSCFIGFAGSLIQGFSNGLGCLLFARLFLGIGMGLNSSTVPIYTA
                     ECSPAISRGAILMLWQTFIALGVCLGSVFNRAFVNISGSLSWRLMIGSSAVAPFVTGI
                     LIFFPPESPRWLIAHGKTRESLYSLMKLRPHELSGARDFYILHQSLKFESELENQLSS
                     WQQFLSLFTNRRNRFALIVSLIGILGQQYGGVNILVSYTTTILTNAGVDSVTAIAGSI
                     GIGGGCFLATFLSTQLIDRFGRRKMLLFTLPMEALCLFWLGGVLNVNDAQSRLGAGLA
                     SMYVYVLFYGAGIGPVSFTLVAETSSITVRMAHSATCMFVNWILDFCLSMTWPKMESS
                     MTASGGLYFYGAFNIVVWILTFLCIPETMRFTLEQLDEIFKVGVSAHIKKSLHRIVRN
                     "
     gene            complement(<53662..>54858)
                     /locus_tag="KLTH0B00506g"
                     /db_xref="GeneID:8290639"
     mRNA            complement(<53662..>54858)
                     /locus_tag="KLTH0B00506g"
                     /product="KLTH0B00506p"
                     /transcript_id="XM_002551774.1"
                     /db_xref="GeneID:8290639"
     CDS             complement(53662..54858)
                     /locus_tag="KLTH0B00506g"
                     /note="weakly similar to uniprot|P53912 Saccharomyces
                     cerevisiae YNL134C"
                     /codon_start=1
                     /product="KLTH0B00506p"
                     /protein_id="XP_002551820.1"
                     /db_xref="GeneID:8290639"
                     /db_xref="GOA:C5DC71"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DC71"
                     /translation="MYKRKLESVDVGSILVSQMQERHLKRISIRSGPLIGVEAPLPLF
                     QQAAVVKSFEEEIIVSDQIPVPQRLEDHEILIRNKYTGLNHVDWKSKKYRFNIHSFPW
                     INGRESSGIVVRRGAKVDRDRFPIGAEVFLASTCYRELKTSTFQEFTVFDSRLVWRLP
                     REILPDGTTRKRFGLDFAAGVGVPLVTAGSALSSFVDFNEIGKADQGRSLVVWGGSSS
                     VGIFTIQLARNLGIFKNIIAVSSLRYEDYLKELGATAVIDRTLPSEELVQKFQELCPT
                     GVDYGVDVISKKTAELVLEILKDGKGTKKSLVCLSGAPGEDVRAKYPDIKVEAVGIKR
                     FHEDLVFGETFVKFTSDLFEKGQLNPVRSVKVFKGFEKFGVGLRNGLKELEERGSSAE
                     KFVVRL"
     gene            <55345..>56889
                     /locus_tag="KLTH0B00528g"
                     /db_xref="GeneID:8290640"
     mRNA            <55345..>56889
                     /locus_tag="KLTH0B00528g"
                     /product="KLTH0B00528p"
                     /transcript_id="XM_002551775.1"
                     /db_xref="GeneID:8290640"
     CDS             55345..56889
                     /locus_tag="KLTH0B00528g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B00528p"
                     /protein_id="XP_002551821.1"
                     /db_xref="GeneID:8290640"
                     /db_xref="GOA:C5DC72"
                     /db_xref="InterPro:IPR011251"
                     /db_xref="InterPro:IPR016215"
                     /db_xref="UniProtKB/TrEMBL:C5DC72"
                     /translation="MTIDHTAKRSSELEVGNAKRAQLTSPKRKNLIVNAFIMGSAGNQ
                     SVGIWKHPQDKSAELYQSPEYWINLAKLLERGKFNAVFLADVLGPYDVYKGPANVGPV
                     AKAGSQWPISDPSYFIPLMAAVTTKLAFGMTISTISEQPYHLARRLGTLDLLTNGRVG
                     WNIVTSYLDSASRNLLDGKNLPPNEERYARAGEYVDVIYKLFLSSWRDESFKADKKTG
                     VFTDPEGLRHINHVGKYFNVPGPAITHPSQQKLPVIIQAGTSAKGKDLSAKNAEVVFL
                     ASLTPEALGASIKEIKQIATTKYHRNPSKIKFIGLVTVILGDTHEEAENKYNEYKANY
                     SDEEGAKAMFSGWTGVDIDKFEDDEVLSNVDHIAIASAVKKWQTAYPRVEKWTKRAII
                     DEIKVGGSGPVLIGTPQEVASEIQNWVDISDIDGFNFAYTVLPQSFEEIIDKLLPELE
                     KLGLFWHDYPNASDSSKYLTFREQLFGEPSLDKTHPASDLRWKADETREAYEARIGEA
                     LKKLVL"
     gene            complement(<57160..>59163)
                     /locus_tag="KLTH0B00550g"
                     /db_xref="GeneID:8290641"
     mRNA            complement(<57160..>59163)
                     /locus_tag="KLTH0B00550g"
                     /product="KLTH0B00550p"
                     /transcript_id="XM_002551776.1"
                     /db_xref="GeneID:8290641"
     CDS             complement(57160..59163)
                     /locus_tag="KLTH0B00550g"
                     /note="similar to uniprot|P33413 Saccharomyces cerevisiae
                     YHL016C DUR3 Plasma membrane urea transporter expression
                     is highly sensitive to nitrogen catabolite repression and
                     induced by allophanate the last intermediate of the
                     allantoin degradative pathway"
                     /codon_start=1
                     /product="KLTH0B00550p"
                     /protein_id="XP_002551822.1"
                     /db_xref="GeneID:8290641"
                     /db_xref="GOA:C5DC73"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="InterPro:IPR019900"
                     /db_xref="UniProtKB/TrEMBL:C5DC73"
                     /translation="MSEFVLNQGYGYGIVLGLGALFSVLMIALSWAIAKFLNQKQDSE
                     RFTTASRNVKQGLISSAVVSSWTWPATLLTSNLWTYSYGIVGAYWYSVTGCFQILVFT
                     LVAIEIKLKCPGIHTIAEVAKVRFGKWGHFCYLFYSLGTNVIVSGMILLGGSQGIAYT
                     TGMNIIAACFLLPVSVCIYTLFGGLQATFLSDWSHTIVIYIMVIVSIVTVYCTSDLIG
                     SPDKMYDLLKDMGESFPLESSANGSYLTFANKDIILTAWNALLGGAATVFMDPSYSQK
                     AIAAGSKEVMRGYMLGGICWQIIPLGLGTSMGLASLALTKNPAFFTYPNKLTDLEAGR
                     GLSLVYAMTAIFGKSGAACAVVMVFMSATSAMSAELISCSSILTYDFYKTYVNPKASG
                     KQLVYVSHLNVIGFSLCMGALAVVFNYIGVTLGWLFSFVGIALGPAFFGLLGMLFYKK
                     MNTMALVVGVPSATLCGIVGWVASATRYSSDGRVDKASLSLSEPLAFGNFISVFSSGI
                     FVWILSQVKSQSWNFNEMNETYFETQIADDADSDEIEFSQVSKESVKDLRKHIFITKI
                     LVFCQFIIFLIIIPLSMYGTKYIFSRKLFRGYVCIIIIWAFLAAMWIIFYPLYESKSN
                     LIFVFKKLIGKASTDSSADLSQTDTSSIEREKLDKTSINVAAI"
     gene            complement(<60243..>61859)
                     /locus_tag="KLTH0B00572g"
                     /db_xref="GeneID:8290642"
     mRNA            complement(<60243..>61859)
                     /locus_tag="KLTH0B00572g"
                     /product="KLTH0B00572p"
                     /transcript_id="XM_002551777.1"
                     /db_xref="GeneID:8290642"
     CDS             complement(60243..61859)
                     /locus_tag="KLTH0B00572g"
                     /note="similar to uniprot|Q12235 Saccharomyces cerevisiae
                     YLL055W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00572p"
                     /protein_id="XP_002551823.1"
                     /db_xref="GeneID:8290642"
                     /db_xref="GOA:C5DC74"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DC74"
                     /translation="MLATESDRSSGSLSLENADKILVNIVENEIGQSEDQIEDKVTTS
                     RDADVTLGFLLDNNVLVPAVSYEEERRLARKVLWTIVPLCALIDFVLYADKATASYTS
                     IFGMWKDTNLDQNKYSNSTTLFYVGFIIGQVNLLFLQKFPVGRVVAALSFFWSLIIYL
                     HTVTTSYQGIYALRFFLGFVEAIAVPALNVTMGQFLTAEEKSWTAPLFYTTCLGNEIV
                     VGFIAFGILHAKPAFAIWKLFMIVIATISLLVTILVLFLYPNNPTDARFLNLKEKIWV
                     IRRVQRTTGSSIEQKVIKKQQIIEALKDPVSWLFCAFFFCNQLSNNLVYQEKLLFKEI
                     GISTLGSTLVSVAYGSFSVTCAVIASSIIRKKKNSTAYSVVFWTLFPLVGSIAMVTLP
                     WDRTYALLAMICICAPKGIAWILMFSWTSTSTSGHTKKITRNALIMFWYGVANIIAPQ
                     LWRANDGPRYYPAWIVQIVFAFFLAPISALAIRYILARRNEERKSSLDGGTPLGLIKS
                     TDIESASTIKGNIALLDLTDLENDHFIYPL"
     gene            <64332..>66188
                     /locus_tag="KLTH0B00594g"
                     /db_xref="GeneID:8290643"
     mRNA            <64332..>66188
                     /locus_tag="KLTH0B00594g"
                     /product="KLTH0B00594p"
                     /transcript_id="XM_002551778.1"
                     /db_xref="GeneID:8290643"
     CDS             64332..66188
                     /locus_tag="KLTH0B00594g"
                     /note="similar to uniprot|P36172 Saccharomyces cerevisiae
                     YKR105C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00594p"
                     /protein_id="XP_002551824.1"
                     /db_xref="GeneID:8290643"
                     /db_xref="GOA:C5DC75"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DC75"
                     /translation="MSVCLDNQTTASLSDREVVEGTKEDIHEKVTGGILEKADSANSG
                     ANSVAKDSENGQAAPSEPETAISPLTGLRFYVCFASLALSLFLAALDILIVGTIMETV
                     AAKFNGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAA
                     TSMTMLIGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAVASVAGPFL
                     GGAFATHVTWRWCFYINLPIGGLAFFFFLFSYNPNGENTFENFKILLGRIKRISYSQL
                     LTVSFYRRLFRTLVFKFDFFEFALSSAGFTLVLLALTFGGNRYDWNSGTIIAYFVVGI
                     LLIIASFVYDFVVFDRVKPQTDRIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNMQV
                     VYIVQYFQLVWGDSAWKASIHLIAPVISTVITVLFCGIITRKTGHVKILLVVGGIVIP
                     VASGILTLLGPKSSSSAKIGLLILPGISFGSVMNGSLLSSQLQIQKNHPLFRFDFIAV
                     TTFNAFVKMLGMAFGGIMSNMIFTTSVRNELSKIKPPLPHSQSVDGLISWWYKNYAGR
                     DSAEVHVFMNGIKDVFWAALGLAAIAAVACFCSSNKKVDIEKPEGDEEKNGK"
     gene            complement(<66965..>67327)
                     /locus_tag="KLTH0B00616g"
                     /db_xref="GeneID:8290644"
     mRNA            complement(<66965..>67327)
                     /locus_tag="KLTH0B00616g"
                     /product="KLTH0B00616p"
                     /transcript_id="XM_002551779.1"
                     /db_xref="GeneID:8290644"
     CDS             complement(66965..67327)
                     /locus_tag="KLTH0B00616g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B00616p"
                     /protein_id="XP_002551825.1"
                     /db_xref="GeneID:8290644"
                     /db_xref="UniProtKB/TrEMBL:C5DC76"
                     /translation="MDSTAEQSQTIVPCGYVYNLTVTSNTSAMEGWCCGTAARTGSDP
                     RDDRLLNGTSAITCNNGNTYLQVFNGTTYEDGYLCGLGLPGAYQFPLTETKNAASRLG
                     PRWAQAFLLISLLIHLFA"
     gene            complement(67583..67654)
                     /locus_tag="KLTH0B00638r"
                     /db_xref="GeneID:8290645"
     tRNA            complement(67583..67654)
                     /locus_tag="KLTH0B00638r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=64.56"
                     /db_xref="GeneID:8290645"
     gene            complement(68588..68659)
                     /locus_tag="KLTH0B00660r"
                     /db_xref="GeneID:8290646"
     tRNA            complement(68588..68659)
                     /locus_tag="KLTH0B00660r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=64.56"
                     /db_xref="GeneID:8290646"
     repeat_region   complement(68720..68981)
                     /rpt_type=long_terminal_repeat
     gene            complement(<69489..>69854)
                     /locus_tag="KLTH0B00704g"
                     /db_xref="GeneID:8290648"
     mRNA            complement(<69489..>69854)
                     /locus_tag="KLTH0B00704g"
                     /product="KLTH0B00704p"
                     /transcript_id="XM_002551780.1"
                     /db_xref="GeneID:8290648"
     CDS             complement(69489..69854)
                     /locus_tag="KLTH0B00704g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B00704p"
                     /protein_id="XP_002551826.1"
                     /db_xref="GeneID:8290648"
                     /db_xref="UniProtKB/TrEMBL:C5DC77"
                     /translation="MNSTAEQSQIIIPCGRIYNLTVTSNTSVLEGWCCGIAASSGADD
                     REQTLSHEFSSISCGDNTMLQITANTTVMDGYFCGSGMANPSNAGQSSLTQTNAASDL
                     APRWTQFFILLSFFMQYFA"
     gene            complement(70106..70177)
                     /locus_tag="KLTH0B00726r"
                     /db_xref="GeneID:8290649"
     tRNA            complement(70106..70177)
                     /locus_tag="KLTH0B00726r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=64.56"
                     /db_xref="GeneID:8290649"
     gene            complement(71137..71208)
                     /locus_tag="KLTH0B00748r"
                     /db_xref="GeneID:8290650"
     tRNA            complement(71137..71208)
                     /locus_tag="KLTH0B00748r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=64.56"
                     /db_xref="GeneID:8290650"
     gene            complement(<71519..>71890)
                     /locus_tag="KLTH0B00770g"
                     /db_xref="GeneID:8290651"
     mRNA            complement(<71519..>71890)
                     /locus_tag="KLTH0B00770g"
                     /product="KLTH0B00770p"
                     /transcript_id="XM_002551781.1"
                     /db_xref="GeneID:8290651"
     CDS             complement(71519..71890)
                     /locus_tag="KLTH0B00770g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B00770p"
                     /protein_id="XP_002551827.1"
                     /db_xref="GeneID:8290651"
                     /db_xref="UniProtKB/TrEMBL:C5DC78"
                     /translation="MGPSAKQCQTVLPCGGLYNLTITSNTSVMEGYRCGSTERSGVDD
                     RDELLSIEIGGINCNANPAFDLYISENTTVIDGYRCGLDSTNYTEYSQCSNTKENGAS
                     NLSPRWTHIFVFVSLFAYLFG"
     gene            complement(72118..72189)
                     /locus_tag="KLTH0B00792r"
                     /db_xref="GeneID:8290652"
     tRNA            complement(72118..72189)
                     /locus_tag="KLTH0B00792r"
                     /product="tRNA-Glu"
                     /note="tRNA-Glu (CTC) cove score=64.56"
                     /db_xref="GeneID:8290652"
     gene            complement(72513..72584)
                     /locus_tag="KLTH0B00814r"
                     /db_xref="GeneID:8290653"
     tRNA            complement(72513..72584)
                     /locus_tag="KLTH0B00814r"
                     /product="tRNA-Asp"
                     /note="tRNA-Asp (GTC) cove score=69.96"
                     /db_xref="GeneID:8290653"
     gene            <73357..>74829
                     /locus_tag="KLTH0B00836g"
                     /db_xref="GeneID:8290654"
     mRNA            <73357..>74829
                     /locus_tag="KLTH0B00836g"
                     /product="KLTH0B00836p"
                     /transcript_id="XM_002551782.1"
                     /db_xref="GeneID:8290654"
     CDS             73357..74829
                     /locus_tag="KLTH0B00836g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B00836p"
                     /protein_id="XP_002551828.1"
                     /db_xref="GeneID:8290654"
                     /db_xref="GOA:C5DC79"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DC79"
                     /translation="MSSNLSTAPEEGKKVYATRSRDSGTSESIAALPEAMQQTTKYSS
                     ETPLLILENESEHDIQYKTCSWVHTSGLMLSEYIVLAIMSFPWSYSVLGIVPGIILTL
                     FVASTVLYTGLTIIDYCERFPHLKNVCDIGQHLFWGQKWAWYATLVCFLANNTLIQGL
                     HVLVGAKYLNTVTDHSLCTVKFGVIVACISFVVSVPRTFSSLSKVAYFSAATMFIAVV
                     LAMIFAGVQDHPYGYDGTPVTFRAFPEKGTTFVQGMGAFLNIVYTFVGQITYPQFISE
                     MQRPAEFRKVLYIVTTCEIVIFTLAGVIIYVYVGNEYMSAPAFGSLTRTFKIIAFSFA
                     VPTIIFAGSLYSNVSGRLLFFTFFKRSKHLYSHTTVGWLTWIGILALTWVGAFIIAEV
                     VPFFSDLLSLMSSLFDCWFGFVFWGMAYFKLKEAKYQNPRYYSQLTASEKFHFFIAIF
                     LIAVGLFILGPGLYAAIDSIILNYQDDAYGTVFSCASNGS"
     gene            <75377..>76294
                     /locus_tag="KLTH0B00858g"
                     /db_xref="GeneID:8290655"
     mRNA            <75377..>76294
                     /locus_tag="KLTH0B00858g"
                     /product="KLTH0B00858p"
                     /transcript_id="XM_002551783.1"
                     /db_xref="GeneID:8290655"
     CDS             75377..76294
                     /locus_tag="KLTH0B00858g"
                     /note="highly similar to uniprot|P23641 Saccharomyces
                     cerevisiae YJR077C MIR1 Mitochondrial phosphate carrier
                     imports inorganic phosphate into mitochondria functionally
                     redundant with Pic2p but more abundant than Pic2 under
                     normal conditions"
                     /codon_start=1
                     /product="KLTH0B00858p"
                     /protein_id="XP_002551829.1"
                     /db_xref="GeneID:8290655"
                     /db_xref="GOA:C5DC80"
                     /db_xref="InterPro:IPR002067"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DC80"
                     /translation="MSAPIPQYSMSDYAKFALAGAIGCGVTHSAMVPIDVVKTRIQLE
                     PTVYNKGMVSSFKQIVSAEGAGALLTGFGPTLLGYSMQGAFKFGGYEVFKKLFIDTLG
                     YDQAVNYKNSIYIGSAAIAEFFADIALCPLEATRIRLVSQPSFADGLFGGFSRILREE
                     GAASFYNGFTPILFKQIPYNIAKFLVYERAAEVYFGMVGPKDTLSNTTATGLNLLSGL
                     TAGLAAAVVSQPADTLLSKVNKAKKAPGQSTIGLLGQLAKELGFVGSFAGLPTRLVMV
                     GTLTSLQFGIYGTLKKSLGCAPAIEIASK"
     gene            complement(<76459..>76767)
                     /locus_tag="KLTH0B00880g"
                     /db_xref="GeneID:8290656"
     mRNA            complement(<76459..>76767)
                     /locus_tag="KLTH0B00880g"
                     /product="KLTH0B00880p"
                     /transcript_id="XM_002551784.1"
                     /db_xref="GeneID:8290656"
     CDS             complement(76459..76767)
                     /locus_tag="KLTH0B00880g"
                     /note="some similarities with uniprot|P36036 Saccharomyces
                     cerevisiae YKL214C YRA2 Member of the REF (RNA and export
                     factor binding proteins) family when overexpressed can
                     substitute for the function of Yra1p in export of poly(A)
                     mRNA from the nucleus"
                     /codon_start=1
                     /product="KLTH0B00880p"
                     /protein_id="XP_002551830.1"
                     /db_xref="GeneID:8290656"
                     /db_xref="GOA:C5DC81"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR025715"
                     /db_xref="UniProtKB/TrEMBL:C5DC81"
                     /translation="MVKEIAEPVYSNIYDHESGRTAVFEFEAPEKTEEVHRALNEKEI
                     SGAKVTVEVFESRSRQSRRSQKKGHRGGRRGPRAPKREKPAQPTADQLDQELENYMNS
                     "
     gene            <77624..>78652
                     /locus_tag="KLTH0B00902g"
                     /db_xref="GeneID:8290657"
     mRNA            <77624..>78652
                     /locus_tag="KLTH0B00902g"
                     /product="KLTH0B00902p"
                     /transcript_id="XM_002551785.1"
                     /db_xref="GeneID:8290657"
     CDS             77624..78652
                     /locus_tag="KLTH0B00902g"
                     /note="similar to uniprot|Q08913 Saccharomyces cerevisiae
                     YOR390W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B00902p"
                     /protein_id="XP_002551831.1"
                     /db_xref="GeneID:8290657"
                     /db_xref="GOA:C5DC82"
                     /db_xref="InterPro:IPR003691"
                     /db_xref="UniProtKB/TrEMBL:C5DC82"
                     /translation="MESKEKLDAEPRKTRIGAQLRAEGEVVLQLLFFSILGNYSRLGL
                     VRLTDYRGSYVQGPTVLWANLAACFLMGAAQALKPRDVFTPLFFTAVTTGYCGSVSSF
                     SSFLVEVFEHATNTAADSGSHSFPNRAYGIMEFLSVLFVQLMVSMCSHLFGLCLAREF
                     SGSLETSGSWEASKNARRVRKVLKLAENIARILAVPVLIVQIVLAAVYTNGSRYWTFA
                     AVFSFPGTLLRYVLAKYLNPRVKHFPLGTFAANVFGTVLLAIFTLLSRGKLPDGSRII
                     KFTTTNDVVVGLGNGFCGCLTTISTFINEGHVLPLKKTLIYYFTSIAVSFCLIVVTLG
                     SYAWTRGI"
     gene            complement(<79302..>81446)
                     /locus_tag="KLTH0B00924g"
                     /db_xref="GeneID:8290658"
     mRNA            complement(<79302..>81446)
                     /locus_tag="KLTH0B00924g"
                     /product="KLTH0B00924p"
                     /transcript_id="XM_002551786.1"
                     /db_xref="GeneID:8290658"
     CDS             complement(79302..81446)
                     /locus_tag="KLTH0B00924g"
                     /note="similar to uniprot|P36037 Saccharomyces cerevisiae
                     YKL213C DOA1 WD repeat protein required for
                     ubiquitin-mediated protein degradation forms complex with
                     Cdc48p plays a role in controlling cellular ubiquitin
                     concentration also promotes efficient NHEJ in
                     postdiauxic/stationary phase"
                     /codon_start=1
                     /product="KLTH0B00924p"
                     /protein_id="XP_002551832.1"
                     /db_xref="GeneID:8290658"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR013535"
                     /db_xref="InterPro:IPR015155"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DC83"
                     /translation="MVKKVFKLSATLFGHEQDVKSVAVMSNDEVATCSRDGSVRLWKK
                     GSNDMWQDTILYKVDEFINSLCYDKLSRLLYCGGKDTLINSISPLLGELGQEPEFVLV
                     GHKSNVCALNSSQGYILSGSWDATAKVWFQGALKHELVGHKASVWDVKMLPEVGFYLT
                     ASADGTVKLWEGEKVLKTFSNLHTDVVRHLDISPDGDQFASCSNDGTIKINDMDGNTL
                     RTLKGHESFVYCVKYTPCGGLVSCGEDRSVRVWGPDGAVKQVIRVPAVSVWDLDVLPN
                     GDILVGCSDSLARIFTCHEGRVAPQQELDTFAKEVERTAISSQTMGFDESKLSPSEAL
                     LNPGKEGQVIVVKSPNGVNEAHQYTQGAWTKVGDVVSSAGNDKKKEFEGKMYDYVFDV
                     DVTEGAPPLKLPFNANGNAYQAADDFLARYELPASYREEVVRFLITNTTGVSLEQDQS
                     STSNGQSNSIPQSKPMSVLPVREYLDIRSFSPDAIFNGVVKLNAQERSFDDEDLAAIG
                     AALHDVEDNYELLFAQASIIRSSWSNKIPAYDIMRLIVEYLPHADAMSEFIEEGLGSA
                     MPQLEMLTVRTLANCFKNKKWGTELMSKNAVYDSVFQTIEPNRPQASKTVNLAVSIAT
                     LIFNYSVMIIKSGNLDLLPTVADALNNKFGPSQMIQDSEEAAYRMLVAYGNLATVEPT
                     LLQFAKSIAWIKPVKEKYGHLSRFSHVFADLL"
     gene            <81585..>83456
                     /locus_tag="KLTH0B00946g"
                     /db_xref="GeneID:8290659"
     mRNA            <81585..>83456
                     /locus_tag="KLTH0B00946g"
                     /product="KLTH0B00946p"
                     /transcript_id="XM_002551787.1"
                     /db_xref="GeneID:8290659"
     CDS             81585..83456
                     /locus_tag="KLTH0B00946g"
                     /note="similar to uniprot|P32368 Saccharomyces cerevisiae
                     YKL212W SAC1 Lipid phosphoinositide phosphatase of the ER
                     and Golgi involved in protein trafficking and secretion"
                     /codon_start=1
                     /product="KLTH0B00946p"
                     /protein_id="XP_002551833.1"
                     /db_xref="GeneID:8290659"
                     /db_xref="GOA:C5DC84"
                     /db_xref="InterPro:IPR002013"
                     /db_xref="UniProtKB/TrEMBL:C5DC84"
                     /translation="MAGPLLYSHLGEKIVFKLATPSSEKDVVLSLGPSGQDISLESPE
                     IFPTRGKIVKSAALIGCIKLKLNSYAIFAHRVEEFGVLAGHRIFKVVEHTILPLNKGG
                     QRDKDEQQYLDLLEMQLSSATLFYSYTYDLTNSAQRNEKLDGSSWKTADTRFFWNHYV
                     THSLRTLAEKCPAAGDFIQPMIFGYAHFIETALNNVPITIGLVTRRSRFRAGTRYFRR
                     GIDSDGNVANFNETEQFLLVKKPEGGNSEFFSFLQTRGSVPVYWGEINNLKYKPNLVL
                     GENSSLDATAKHFDQQKSLYGENYLVNLVNQKGHELPVKNAYESAVNALNDPMIHYVY
                     FDFHHECRKMKWYRVKLLIDHLQKMGLDPEDTFHKIVSPDGKTVDVVREQKSVVRTNC
                     MDCLDRTNVVQSVLASWVLQHEFQIANVVPEGTLWELDLKLLAKFQNFWADNADAVSF
                     SYSGTGALKTDFTRTGKRTRKGAFADFMNSVSRYYQNNLSDGPRQDSFDLFHGNFLPF
                     ENSFQSPFPDRRPLSIQIVPTVICAAITVIAATVFFPKGHFFSTKNLSFFFVSSAIVI
                     LSLRFIFRNGEQYVNWPKFNNLGFLTAVQTHNKERTFKGIRYVQSPKFSKPGELKRD"
     gene            complement(<83522..>84985)
                     /locus_tag="KLTH0B00968g"
                     /db_xref="GeneID:8290660"
     mRNA            complement(<83522..>84985)
                     /locus_tag="KLTH0B00968g"
                     /product="KLTH0B00968p"
                     /transcript_id="XM_002551788.1"
                     /db_xref="GeneID:8290660"
     CDS             complement(83522..84985)
                     /locus_tag="KLTH0B00968g"
                     /note="highly similar to uniprot|P00937 Saccharomyces
                     cerevisiae YKL211C TRP3 anthranilate synthase Component II
                     and indole-3-phosphate (multifunctional enzyme)"
                     /codon_start=1
                     /product="KLTH0B00968p"
                     /protein_id="XP_002551834.1"
                     /db_xref="GeneID:8290660"
                     /db_xref="GOA:C5DC85"
                     /db_xref="InterPro:IPR001468"
                     /db_xref="InterPro:IPR006221"
                     /db_xref="InterPro:IPR011060"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013798"
                     /db_xref="InterPro:IPR017926"
                     /db_xref="InterPro:IPR029062"
                     /db_xref="UniProtKB/TrEMBL:C5DC85"
                     /translation="MVFSAKRRVVLIDNYDSFTWNLYEYLCQEGAEVLVYRNDQITLE
                     EIDDLKPDCVFISPGPGHPRTDSGISRDCVRHFAGKIPVVGVCMGLQCMFDVFGGTVS
                     YAGEIVHGKTSQVTHDNKGIFKDIPQGVAVSRYHSLAGEPLSLPEVLEVTARTENGII
                     MGVRHKNLTVEGVQFHPESILTEAGHVMVRNILNIQGGTWEEHEKLSKEKRVKGSSIL
                     DKIYAQRQKDVDELSATPGFTLRDLQSNFNQGLAPEVQDFYTKLSSGPKSAVIAEIKR
                     ASPSKGDIDMNAIAAEQGLKYAKAGASAISVLTEPHWFKGSIQDLVNVRRALDIEFKN
                     APQDRPCVLRKEFIFSKYQILEARLAGADSVLLIVKMLSQDLLLELYNYSKFEVGIEP
                     LVEVSSKEEMGRALELNAKVVGVNNRDLHSFNVDLNTTSSLASSVPEGTILLALSGIT
                     SGADAEKYKKEGVKGLLVGEALMRAANVDSLIKDLSA"
     gene            <86383..>87597
                     /locus_tag="KLTH0B00990g"
                     /db_xref="GeneID:8290661"
     mRNA            <86383..>87597
                     /locus_tag="KLTH0B00990g"
                     /product="KLTH0B00990p"
                     /transcript_id="XM_002551789.1"
                     /db_xref="GeneID:8290661"
     CDS             86383..87597
                     /locus_tag="KLTH0B00990g"
                     /note="similar to uniprot|P32458 Saccharomyces cerevisiae
                     YJR076C CDC11 Component of the septin ring of the
                     mother-bud neck that is required for cytokinesis septins
                     recruit proteins to the neck and can act as a barrier to
                     diffusion at the membrane and they comprise the 10nm
                     filaments seen with EM"
                     /codon_start=1
                     /product="KLTH0B00990p"
                     /protein_id="XP_002551835.1"
                     /db_xref="GeneID:8290661"
                     /db_xref="GOA:C5DC86"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DC86"
                     /translation="MASIIEASAALRKRKNLKRGINFTLMVVGESGSGRSTFVNTLCG
                     QQVVDVSTSIMLPTDRSTQIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSQS
                     FNVVSDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKETDVEFMKTL
                     GPLVNVIPVISKADSLTPAELKLNKKLIMEDIDYYHLPIYNFPFEENDISDEDYETNM
                     YLRSLVPFSVIGSNEVYDLGDGAMIRGRQYPWGTLDVEDSSLSDFVVLRNTLLISHLH
                     DLKDYTHEILYERYRTEALSGETSSQRANGNSSTAYADSPVASGKSFQHAETDSLNSS
                     KQASANQDTYLAREEQIRLEEERLRAFEERVQQELLMKRQELLQREQELREIEERIER
                     EARIKEESGDLE"
     gene            87881..88001
                     /gene="SNR64"
                     /locus_tag="KLTH0B01012r"
                     /db_xref="GeneID:8290662"
     ncRNA           87881..88001
                     /ncRNA_class="snoRNA"
                     /gene="SNR64"
                     /locus_tag="KLTH0B01012r"
                     /product="snR64"
                     /note="C/D snoRNA monocistronic SNR64"
                     /transcript_id="XR_002432176.1"
                     /db_xref="GeneID:8290662"
     gene            complement(<88067..>89371)
                     /locus_tag="KLTH0B01034g"
                     /db_xref="GeneID:8291090"
     mRNA            complement(<88067..>89371)
                     /locus_tag="KLTH0B01034g"
                     /product="KLTH0B01034p"
                     /transcript_id="XM_002551790.1"
                     /db_xref="GeneID:8291090"
     CDS             complement(88067..89371)
                     /locus_tag="KLTH0B01034g"
                     /note="similar to uniprot|P47124 Saccharomyces cerevisiae
                     YJR075W HOC1"
                     /codon_start=1
                     /product="KLTH0B01034p"
                     /protein_id="XP_002551836.1"
                     /db_xref="GeneID:8291090"
                     /db_xref="InterPro:IPR007577"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DC87"
                     /translation="MRLYHIFRFTLRNNSSNHLDADQSFNSTIKIFPTQRSANMPKSR
                     RPTWKRYVVWAVLLTIALALVGRFVSNRTATDVQAILQGLPKDIAPGADAASAQKQDV
                     NMVELFEKLSQDLLAKQEDQIKKFEKERKILEKKIQDLKQPATHATLREKLAHMFEYG
                     TSKKFPAFIWQTWPYSDLDDRMDPTLQSFERRWGDKNPGFVHEIINDDTASALIHYMY
                     ASIPEVIEAYDALPSVYLKADFFKYLILFARGGVYADIDTDPLQPVPNWIPENVSPRE
                     IGLIIGIENDANSPDWRSNYVRRLQFGNWIMQAKPGHPVMREIVAKVTEETLKRRADG
                     ELRMNLRNDLNIMSWTGSGIWTDVVFTYFNDYVQSGILSKITWKEFHNLGVPKLVGDV
                     LVFPQFSFDAPEKEEDGNKALQFCRHTGLKSWKAAPKVAGDN"
     gene            complement(<89368..>89970)
                     /locus_tag="KLTH0B01056g"
                     /db_xref="GeneID:8290663"
     mRNA            complement(<89368..>89970)
                     /locus_tag="KLTH0B01056g"
                     /product="KLTH0B01056p"
                     /transcript_id="XM_002551791.1"
                     /db_xref="GeneID:8290663"
     CDS             complement(89368..89970)
                     /locus_tag="KLTH0B01056g"
                     /note="similar to uniprot|P47123 Saccharomyces cerevisiae
                     YJR074W MOG1 Conserved nuclear protein that interacts with
                     GTP-Gsp1p which is a Ran homolog of the Ras GTPase family
                     and stimulates nucleotide release involved in nuclear
                     protein import nucleotide release is inhibited by Yrb1p"
                     /codon_start=1
                     /product="KLTH0B01056p"
                     /protein_id="XP_002551837.1"
                     /db_xref="GeneID:8290663"
                     /db_xref="InterPro:IPR007681"
                     /db_xref="InterPro:IPR016123"
                     /db_xref="UniProtKB/TrEMBL:C5DC88"
                     /translation="MFQKQALYGGAISTVIPKGFLDASILREVPDTQEVFVNSREEKE
                     IAVFKDGLGLDESVIVDLLQRVEEDDSCRALDVHLQEIAGLNGSHEWNLVECEQSAPE
                     VGQVPHLTCIAVEAAYKWGKSDMRETLVLCVALLRFDDVQTDVVLSVNIPVTSEPELQ
                     LLNAWLSKTSSTIPLRIAAAYHLVKQMASEFRILDKGLFV"
     gene            <91145..>94192
                     /locus_tag="KLTH0B01078g"
                     /db_xref="GeneID:8290664"
     mRNA            <91145..>94192
                     /locus_tag="KLTH0B01078g"
                     /product="KLTH0B01078p"
                     /transcript_id="XM_002551792.1"
                     /db_xref="GeneID:8290664"
     CDS             91145..94192
                     /locus_tag="KLTH0B01078g"
                     /note="highly similar to uniprot|P22515 Saccharomyces
                     cerevisiae YKL210W UBA1 Ubiquitin activating enzyme
                     involved in ubiquitin-mediated protein degradation and
                     essential for viability"
                     /codon_start=1
                     /product="KLTH0B01078p"
                     /protein_id="XP_002551838.1"
                     /db_xref="GeneID:8290664"
                     /db_xref="GOA:C5DC89"
                     /db_xref="InterPro:IPR000011"
                     /db_xref="InterPro:IPR000127"
                     /db_xref="InterPro:IPR000594"
                     /db_xref="InterPro:IPR009036"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018074"
                     /db_xref="InterPro:IPR018075"
                     /db_xref="InterPro:IPR018965"
                     /db_xref="InterPro:IPR019572"
                     /db_xref="InterPro:IPR023280"
                     /db_xref="UniProtKB/TrEMBL:C5DC89"
                     /translation="MVKPGEIDESLYSRQLYVLGKEAMLKMQHSTVLIIGLKGLGVEI
                     AKNIALAGVKSLTLFDPAPVVLEDLSTQFFLSEKDVGKPRAAVSQAKLAELNSYVPID
                     VLDSLQDQEQLKKYQVIVATETLPLERKIELNNFCHAAGIKFIATETRGLFGSVFNDF
                     GEEFTVVDPTGEEPQSGIVSDIEPDGTVTMLDDNRHNLEDGNYVKFSEVEGLEKLNDG
                     TPYKVEVLGPFAFRIGSVKELGTYKKGGVFTQVKMPLKLSFKTLQQSLPNPEHLYSDF
                     AKFERPGQLHLGFQALDQFQATHQGQLPRPFNEEDANELIELTSKLAVQQPKVLGEGN
                     SVNKDIIRELSFQARGDIPGMVAFFGGLVAQEALKACSGKFTPLKQYMYFDSLESLPD
                     AKEYPRNEETTRSINSRYDPQIAVFGLEFQRKLANSKVFLVGSGAIGCEMLKNWALLG
                     LGSGPDGKIFITDNDSIEKSNLNRQFLFRPKDVGRNKSEVASEAVSNMNPDLQGKIKW
                     MTEKVGAESEDLFNDDFWNGLDFVTNALDNVDARTYVDRKCVFYKKPLLESGTLGTKG
                     NTQVVIPNVTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFTEAPENV
                     NLYLTQPDFVQQTLKQAGDVKGILESIADSLNNRPYDFDDCIKWARLEFEKKFNHEIQ
                     QLLYNFPKDSKTSTGAPFWSGPKRAPEPLVFDIKNPDHFYFVVGAANLRAFNYGLTGD
                     EGEPDISHYESVLANTNVPAFSPRSDVKIQANDDEPDPNSNSDVGGDALEALTASLPD
                     PSTLAGFKLLPAEFEKDDDSNHHIEFITSASNDRALNYSIETADRQKTKFIAGRIIPA
                     IATTTGLVTGLVNLELYKVVDGKTDIEAYQNGFINLALPFFGFSDPIASPQGKYNDKS
                     YDKIWDRFDIRGNITLKELIDHFDEKEGLEITMLSYGVSLLYASFFPPKKLKDRLNLP
                     ITEVVKLVTKNEVAPHVKTMILEICADDKNGEDVEVPYITIHL"
     gene            complement(<94260..>98156)
                     /locus_tag="KLTH0B01100g"
                     /db_xref="GeneID:8290665"
     mRNA            complement(<94260..>98156)
                     /locus_tag="KLTH0B01100g"
                     /product="KLTH0B01100p"
                     /transcript_id="XM_002551793.1"
                     /db_xref="GeneID:8290665"
     CDS             complement(94260..98156)
                     /locus_tag="KLTH0B01100g"
                     /note="similar to uniprot|P12866 Saccharomyces cerevisiae
                     YKL209C STE6 ATP-binding cassette (ABC) transporter
                     required for the export of a-factor catalyzes ATP
                     hydrolysis coupled to a-factor transport contains 12
                     transmembrane domains and two ATP binding domains
                     expressed only in MATa cells"
                     /codon_start=1
                     /product="KLTH0B01100p"
                     /protein_id="XP_002551839.1"
                     /db_xref="GeneID:8290665"
                     /db_xref="GOA:C5DC90"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DC90"
                     /translation="MRQLRNLQLSNVYANVHLKQDWSLLVVITVCSVAYGLVPAVTSI
                     LTGTVFNLLQQPAAREFGSVNALMHELALRSMAILATGIASIPLCWLSVSAWMSLGER
                     QAFRLRRKMLQSYLDKSMAWYDANEQISGDFTQLNRCVEELRSSSAESSAIVFQNVVT
                     VAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAWS
                     LDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFW
                     YGNSRINIGKLKPGDVVTCFSSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNSRD
                     ASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFV
                     IGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTET
                     LANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRV
                     ALARAYFRNAPILILDEALSAQDRIHKSLLMEAIRKWRADKTTIILTHELSDILDTDY
                     VYVMSDGQIREHGYKSGLLSNPKSEFSNLHRFQACDDDFGDVATLGDGTSQIVDQKLE
                     GVRTDVEELYSELGSPSTLRTCCVPESDYHPVTSHALRSSVDLLQSSIMMPHRTRRVA
                     KTKERVDATELGPLPTVPDIEKGQTEPSLLPLRDIIKQFFINSRQKRLLAVGGTSALL
                     AGVANPLFSYTFSKLLSGIASSNAYPATGRRSTKWSLIVLSVALLDSTFTFLKCFTLS
                     KCGENWIRALRLRAFKNISNRELAWFNSEQNSTSNVSSLVINDLRDLRALASEFLAAV
                     TTLVVVSFCGLIWALASGWKLSLVCISLIPAFILFTGAYGGLLQKCEANYKSAVASME
                     DQLYSAVRRIKTIRCLQVEERVIKEYEVLEGKAKLAGRKRALGTGFGVALSNALTLIT
                     QSILLYYGMKLVITGEYSSERMFQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFR
                     ILDSETQFADANLEGESALTSRGCSNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAG
                     ETVALVGLSGSGKSTLWHLITRLYRVPSGSIWFDGLDVNEWEEWALRKRIAVVEQRPS
                     LFRGSIFDNLTYGLSTSVDEREIRELLELVGMMDFVNSNPLGLQSFIDTDVLSGGQLQ
                     RLAIVRALLRKPQLLVLDECTSALDAQHGFIMSEFVRQGSQSTTTLVLTHSEQMMRAC
                     NRILTFANGNIIEDGSFERLYSQKGELFKILSSCSE"
     gene            <98689..>99342
                     /locus_tag="KLTH0B01122g"
                     /db_xref="GeneID:8290666"
     mRNA            <98689..>99342
                     /locus_tag="KLTH0B01122g"
                     /product="KLTH0B01122p"
                     /transcript_id="XM_002551794.1"
                     /db_xref="GeneID:8290666"
     CDS             98689..99342
                     /locus_tag="KLTH0B01122g"
                     /note="similar to uniprot|P05375 Saccharomyces cerevisiae
                     YJR073C OPI3 Phospholipid methyltransferase
                     (methylene-fatty-acyl-phospholipid synthase) catalyzes the
                     last two steps in phosphatidylcholine biosynthesis"
                     /codon_start=1
                     /product="KLTH0B01122p"
                     /protein_id="XP_002551840.1"
                     /db_xref="GeneID:8290666"
                     /db_xref="GOA:C5DC91"
                     /db_xref="InterPro:IPR007318"
                     /db_xref="InterPro:IPR024960"
                     /db_xref="UniProtKB/TrEMBL:C5DC91"
                     /translation="MDLFNDLTGKLGKVQDVYIEMLSEVVTDEKNLKLALFFIVFNPL
                     FWNTAARLEYKTHFLTKITGSAKRGCYVLAVTIFSLGIVRDYFFHQALMQQPTSRVLD
                     TDAVRKAGMVLSAFGQVLVATSMYQLGVTGTYLGDYFGILMDNIVTAFPFNVSNNPMY
                     HGSTLTFLGTSLYYGKAAGVFATVLVNLVYNIAQQFEEPFTAQIYAKRDAERTKKSS"
     gene            <99614..>100849
                     /locus_tag="KLTH0B01144g"
                     /db_xref="GeneID:8290667"
     mRNA            <99614..>100849
                     /locus_tag="KLTH0B01144g"
                     /product="KLTH0B01144p"
                     /transcript_id="XM_002551795.1"
                     /db_xref="GeneID:8290667"
     CDS             99614..100849
                     /locus_tag="KLTH0B01144g"
                     /note="highly similar to uniprot|P42942 Saccharomyces
                     cerevisiae YGR210C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B01144p"
                     /protein_id="XP_002551841.1"
                     /db_xref="GeneID:8290667"
                     /db_xref="GOA:C5DC92"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR013646"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DC92"
                     /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDAAAQVGSFPFTTIEPNKA
                     TGYLQVDCVCGRFGKQALCKPNYGWCSNGKRHVPIMLLDVAGLVPGAHSGRGLGNKFL
                     DDLRHADALIHVVDVSGTTDAEGKNTRGYDPLYDIEWLQDEIRLWIEGNLEKRWGSIV
                     RRHTATKSSAVDTLQAQFGGYGSHAPMVQRALHRIRGLPPLEQWDKEWITKVVRSFMI
                     EKFPTVLALNKIDHPDADKNVSKIMLKYPETKAVLASAVTEVFLRKLKKQGFVHYEEG
                     TEFVDTFEDDPDGLKPLDDKLLQRIENIRDLVLYRFGSTGVVQVLQAAAGVLDLVPVY
                     TVRNIHTFTGGHGENVFRDCFLIKRGTPVGKVARYVMGEVTIAAVETVGGVRVSEDDV
                     VDAGKNDVLSFKLAPKSVN"
     gene            <102227..>103960
                     /locus_tag="KLTH0B01166g"
                     /db_xref="GeneID:8290668"
     mRNA            <102227..>103960
                     /locus_tag="KLTH0B01166g"
                     /product="KLTH0B01166p"
                     /transcript_id="XM_002551796.1"
                     /db_xref="GeneID:8290668"
     CDS             102227..103960
                     /locus_tag="KLTH0B01166g"
                     /note="similar to uniprot|P53388 Saccharomyces cerevisiae
                     YPL265W DIP5 Dicarboxylic amino acid permease mediates
                     high-affinity and high-capacity transport of L- glutamate
                     and L-aspartate also a transporter for Gln Asn Ser Ala and
                     Gly"
                     /codon_start=1
                     /product="KLTH0B01166p"
                     /protein_id="XP_002551842.1"
                     /db_xref="GeneID:8290668"
                     /db_xref="GOA:C5DC93"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DC93"
                     /translation="MSESLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDG
                     KHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT
                     VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY
                     WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIML
                     GGGPNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVA
                     AEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPF
                     VVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGW
                     GVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAV
                     IAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIP
                     VYAICYVGYKLVHRSKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLT
                     WFYDTFLGWIF"
     gene            complement(<104224..>106005)
                     /locus_tag="KLTH0B01188g"
                     /db_xref="GeneID:8290669"
     mRNA            complement(<104224..>106005)
                     /locus_tag="KLTH0B01188g"
                     /product="KLTH0B01188p"
                     /transcript_id="XM_002551797.1"
                     /db_xref="GeneID:8290669"
     CDS             complement(104224..106005)
                     /locus_tag="KLTH0B01188g"
                     /note="highly similar to uniprot|P06169 Saccharomyces
                     cerevisiae YLR044C PDC1 Major of three pyruvate
                     decarboxylase isozymes key enzyme in alcoholic
                     fermentation decarboxylates pyruvate to acetaldehyde
                     subject to glucose-ethanol- and autoregulation involved in
                     amino acid catabolism and to YLR134W uniprot|P16467
                     Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
                     pyruvate decarboxylase, key enzyme in alcoholic
                     fermentation, decarboxylates pyruvate to acetaldehyde,
                     regulation is glucose- and ethanol-dependent, repressed by
                     thiamine, involved in amino acid catabolism"
                     /codon_start=1
                     /product="KLTH0B01188p"
                     /protein_id="XP_002551843.1"
                     /db_xref="GeneID:8290669"
                     /db_xref="GOA:C5DC94"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="InterPro:IPR012110"
                     /db_xref="InterPro:IPR029035"
                     /db_xref="InterPro:IPR029061"
                     /db_xref="UniProtKB/TrEMBL:C5DC94"
                     /translation="MSDLILYCDFYKTRNLNSNRVSQNKPEITMSEITLGRYVFERLK
                     QVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGMSCLITT
                     FGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMSAN
                     ISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDLAL
                     KPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPM
                     GKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKTKN
                     VVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPST
                     PLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGA
                     CLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKL
                     IHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIE
                     LMLPVMDAPESLVKQAQLTAATNAKSA"
     gene            <107203..>108198
                     /locus_tag="KLTH0B01210g"
                     /db_xref="GeneID:8290670"
     mRNA            <107203..>108198
                     /locus_tag="KLTH0B01210g"
                     /product="KLTH0B01210p"
                     /transcript_id="XM_002551798.1"
                     /db_xref="GeneID:8290670"
     CDS             107203..108198
                     /locus_tag="KLTH0B01210g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B01210p"
                     /protein_id="XP_002551844.1"
                     /db_xref="GeneID:8290670"
                     /db_xref="GOA:C5DC95"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DC95"
                     /translation="MALDLTPDQWERLTAWIRDRSGLPDSEALTLFQDFVLELLRNLH
                     SCNERKWLEEQLSGLVDNPTEFLRDLEIFLKGLGASAPPSLNSGTPFVLVAHVPYKNL
                     NAQDVQAAFAPFGAIVSCRADVDSRSLLVQFRKVACAIRCTKAATLFFSNRFVTVELY
                     QGDPESFGSVRLIGSAPQPVAADSDPVPPSAAKPSPVPFNDRVQQVQTAQQTIFEQNQ
                     RSAEAYKHNFAQLFESKEKLLRAHQAALQELKQKVLATEDPASISRTIIEFQELQKNM
                     ESLGITPIAMVQLKLQKFNLDDPSEFPVESPRALAVKQKRTKKAASFRRKIKRRR"
     gene            complement(<108265..>110865)
                     /locus_tag="KLTH0B01232g"
                     /db_xref="GeneID:8290671"
     mRNA            complement(<108265..>110865)
                     /locus_tag="KLTH0B01232g"
                     /product="KLTH0B01232p"
                     /transcript_id="XM_002551799.1"
                     /db_xref="GeneID:8290671"
     CDS             complement(108265..110865)
                     /locus_tag="KLTH0B01232g"
                     /note="similar to uniprot|P46675 Saccharomyces cerevisiae
                     YLR045C STU2 Microtubule-associated protein (MAP) of the
                     XMAP215/Dis1 family regulates microtubule dynamics during
                     spindle orientation and metaphase chromosome alignment
                     interacts with spindle pole body component Spc72p"
                     /codon_start=1
                     /product="KLTH0B01232p"
                     /protein_id="XP_002551845.1"
                     /db_xref="GeneID:8290671"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR021133"
                     /db_xref="InterPro:IPR024395"
                     /db_xref="UniProtKB/TrEMBL:C5DC96"
                     /translation="MADSEDGDFTSLPLSERLDHKLWKARLHGYQELQALFQKASVTS
                     VPRELAQYWANPDLFAGYIVDSNVVAQEQAITALQNMLEYLCEFRDTPRSDEMRGRWL
                     PLLAEKGLSSSRNSTKAKAQECVLILVSLDRSVEHSIELLEPSLTNKLPRLVANCVEC
                     ISNIVESFGLAQVSNMSGFLPVLLEPLPKLSSHADRNVRSQTMNLILQLYKWLGRDLL
                     QELLLEKLKPIQQRDLDKTFGKYDGEIPPTSQPRPFQWQKGLEVQNLEGSKDKDGDTL
                     MGESFPDVKAHANPGLPQLDPFELLPVSPVLEKFPLDFMERITSSKWKDRVEVLEEIL
                     NQVLIPTKKFEAKGQDYSDFLRAVAHVIEKDANVQAVTLAAQCVQQLCQKLKANFTRS
                     YGSIVLRSLLERSKEKKASVNEAICEALNNIADCCGVDACLEDNLSFINHKTPQVRTE
                     STRFLTRLLKKWTPEGRHFGDELLIKLVPDISQMLLKIVGDTQPTVRDAGFECLATLM
                     KLVGEREVSDVLDKLDNLKKKKVYEHYEKVEVAGGATKGAVTSAPARREKPSMPYTPN
                     ASRRQAPRTTPTPDLSAQATSGSTLPLRKPLSTIPSKRGPSSPLKTGTRVETYQDGAS
                     SMKSRLTARSLTTDSAPASKPQAAPHAGFEELQRQKQKWLKERQEFLATITDFQNKAS
                     HLSSENSSLRQQLDTVQSSLHESNIELRSKEMQITRLQDRISNLEQELEAKSTLPSSN
                     YGVRSASSFEPPSAPLSLAPPGTPPTKRVFSSSSNGRASPSFDANSDRIADSRLPSVG
                     SRLRSPSECSDDLPHRVNSLQLRSAERAATTGNSFLNDESWKRAAEVTSQLKARIERM
                     RAKTRGMGNS"
     gene            111566..111647
                     /locus_tag="KLTH0B01254r"
                     /db_xref="GeneID:8290672"
     tRNA            111566..111647
                     /locus_tag="KLTH0B01254r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=80.04"
                     /db_xref="GeneID:8290672"
     gene            <112166..>112477
                     /locus_tag="KLTH0B01276g"
                     /db_xref="GeneID:8290673"
     mRNA            <112166..>112477
                     /locus_tag="KLTH0B01276g"
                     /product="KLTH0B01276p"
                     /transcript_id="XM_002551800.1"
                     /db_xref="GeneID:8290673"
     CDS             112166..112477
                     /locus_tag="KLTH0B01276g"
                     /note="similar to uniprot|P22217 Saccharomyces cerevisiae
                     YLR043C TRX1 thioredoxin"
                     /codon_start=1
                     /product="KLTH0B01276p"
                     /protein_id="XP_002551846.1"
                     /db_xref="GeneID:8290673"
                     /db_xref="GOA:C5DC97"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="UniProtKB/TrEMBL:C5DC97"
                     /translation="MVAQIGSASEFEQAVKVDKLVVVDFFATWCGPCKMIAPMIEKFA
                     EQYPSAAFYKLDVDQVPEVAQQNEVSAMPTILLFKNGQVIDKVVGANPAAIKQKIAAH
                     A"
     gene            complement(<112541..>113476)
                     /locus_tag="KLTH0B01298g"
                     /db_xref="GeneID:8290674"
     mRNA            complement(<112541..>113476)
                     /locus_tag="KLTH0B01298g"
                     /product="KLTH0B01298p"
                     /transcript_id="XM_002551801.1"
                     /db_xref="GeneID:8290674"
     CDS             complement(112541..113476)
                     /locus_tag="KLTH0B01298g"
                     /note="similar to uniprot|P42941 Saccharomyces cerevisiae
                     YGR208W SER2 phosphoserine phosphatase"
                     /codon_start=1
                     /product="KLTH0B01298p"
                     /protein_id="XP_002551847.1"
                     /db_xref="GeneID:8290674"
                     /db_xref="GOA:C5DC98"
                     /db_xref="InterPro:IPR004469"
                     /db_xref="InterPro:IPR006383"
                     /db_xref="InterPro:IPR023190"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DC98"
                     /translation="MSSAEIVVTLIAHGSELSEQTKSGFRAFLNDLSDVELEQEKALS
                     VRAYDFFLRTQKDVAVIKETMGSLGNGILDVIVQKNSEWRKKKGLVVFDMDSTLIYQE
                     VIELIAAYAQVEDRVAEITERAMNNELDFKQSLQERVALLKGIKTATLYDEIKAKLRV
                     TEGVPELTRGLQKTGCKLAVLSGGFTPFANHMKEVLGLDFARANVLATETDASTGEEV
                     LSGYTLGDVVDGECKAATLIELAREHGVPIEATVMVGDGGNDLPAMGVAGFGIAWNAK
                     PKVQAAAPSKLNTRSMQDAFYIFGYTDGEIQELLK"
     gene            <113672..>114448
                     /locus_tag="KLTH0B01320g"
                     /db_xref="GeneID:8290675"
     mRNA            <113672..>114448
                     /locus_tag="KLTH0B01320g"
                     /product="KLTH0B01320p"
                     /transcript_id="XM_002551802.1"
                     /db_xref="GeneID:8290675"
     CDS             113672..114448
                     /locus_tag="KLTH0B01320g"
                     /note="highly similar to uniprot|P42940 YGR207C
                     Saccharomyces cerevisiae YGR2 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B01320p"
                     /protein_id="XP_002551848.1"
                     /db_xref="GeneID:8290675"
                     /db_xref="GOA:C5DC99"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR012255"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="UniProtKB/TrEMBL:C5DC99"
                     /translation="MSKSLRILVPVKRVIDYAIKPRINKAGTGVEKTGVKFSMNPFDD
                     IAVEEAVRIREKHKKLVENIHAVSIGPLKAQDILRTALAKGADTCSHVDVKEAELEPL
                     AVAKILKEMVAKQNANLVILGKQSIDDDCNNTGQMLAGLLNWPQATFAAKVEIDEANM
                     TARVTREIDGGEETVSAPLPLVVTTDLRLNQPRYATLPNLMKAKKKPLEKLSLSDFSK
                     VDAEPRLKVMKVEEPPTRSAGIKVGSVDELIEKLKEVKAI"
     gene            complement(<114503..>114817)
                     /locus_tag="KLTH0B01342g"
                     /db_xref="GeneID:8290676"
     mRNA            complement(<114503..>114817)
                     /locus_tag="KLTH0B01342g"
                     /product="KLTH0B01342p"
                     /transcript_id="XM_002551803.1"
                     /db_xref="GeneID:8290676"
     CDS             complement(114503..114817)
                     /locus_tag="KLTH0B01342g"
                     /note="similar to uniprot|P42939 Saccharomyces cerevisiae
                     YGR206W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B01342p"
                     /protein_id="XP_002551849.1"
                     /db_xref="GeneID:8290676"
                     /db_xref="InterPro:IPR019014"
                     /db_xref="UniProtKB/TrEMBL:C5DCA0"
                     /translation="MGLSAEDVLHQIPLRNAHADLLPQAQRKLDLPPLALPETTPAKQ
                     HLEAWIEECSQISQAIKQRKDRGKRFDTWYAENCLSKQPPGITDCAVLSPSRRQVKEN
                     SV"
     gene            <115101..>115676
                     /locus_tag="KLTH0B01364g"
                     /db_xref="GeneID:8290677"
     mRNA            <115101..>115676
                     /locus_tag="KLTH0B01364g"
                     /product="KLTH0B01364p"
                     /transcript_id="XM_002551804.1"
                     /db_xref="GeneID:8290677"
     CDS             115101..115676
                     /locus_tag="KLTH0B01364g"
                     /note="highly similar to uniprot|P47096 Saccharomyces
                     cerevisiae YJR025C BNA1 3-hydroxyanthranilic acid
                     dioxygenase required for biosynthesis of nicotinic acid
                     from tryptophan via kynurenine pathway"
                     /codon_start=1
                     /product="KLTH0B01364p"
                     /protein_id="XP_002551850.1"
                     /db_xref="GeneID:8290677"
                     /db_xref="GOA:C5DCA1"
                     /db_xref="InterPro:IPR010329"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="UniProtKB/TrEMBL:C5DCA1"
                     /translation="MSSINQVKAYLHSFQMLNTTPINIEKWLQENGHLLQPPVNNFCL
                     HRGGFTVMIVGGPNERTDYHVNPTPEWFHQKKGFMTLRVVDETLQGNERFKDVTIEEG
                     DSFLLPANVPHNPVRYANTVGIVVEQDRPEGQHDMLRWYCSNCREVVCQFDFQMLDLG
                     TQVKEGIQKFDSDKEYRICKKCGTENFSSPQ"
     gene            <116004..>116777
                     /locus_tag="KLTH0B01386g"
                     /db_xref="GeneID:8290678"
     mRNA            <116004..>116777
                     /locus_tag="KLTH0B01386g"
                     /product="KLTH0B01386p"
                     /transcript_id="XM_002551805.1"
                     /db_xref="GeneID:8290678"
     CDS             116004..116777
                     /locus_tag="KLTH0B01386g"
                     /note="highly similar to uniprot|P47095 Saccharomyces
                     cerevisiae YJR024C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B01386p"
                     /protein_id="XP_002551851.1"
                     /db_xref="GeneID:8290678"
                     /db_xref="GOA:C5DCA2"
                     /db_xref="InterPro:IPR001303"
                     /db_xref="InterPro:IPR017714"
                     /db_xref="InterPro:IPR027514"
                     /translation="MASCFCNKVDVTEGTHGTSSSDDALVSSQDPRHPANLICTLCKM
                     FYYNNWVTGTGGGISIKHSKTGHIYIAPSGVQKEQLKPADMFVMDPASGSYLRTPQLY
                     KPSACTPLFMSCYKQRDAGAVIHTHSQHAVMCSLIFDKELRIANIEQIKAIPSGKKDA
                     KTGKDINLSFFDTLVIPIIDNTAHEEDLTEGLQEALQKYPNTTAVIVRRHGIYVWGPS
                     VDKAKVYNEAIDYLMEVAWKMHQLGIPPDCGIGEEKKYL"
     gene            complement(<116792..>117124)
                     /locus_tag="KLTH0B01408g"
                     /db_xref="GeneID:8290679"
     mRNA            complement(<116792..>117124)
                     /locus_tag="KLTH0B01408g"
                     /product="KLTH0B01408p"
                     /transcript_id="XM_002551806.1"
                     /db_xref="GeneID:8290679"
     CDS             complement(116792..117124)
                     /locus_tag="KLTH0B01408g"
                     /note="weakly similar to uniprot|P47093 Saccharomyces
                     cerevisiae YJR022W LSM8 Component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing and
                     splicing"
                     /codon_start=1
                     /product="KLTH0B01408p"
                     /protein_id="XP_002551852.1"
                     /db_xref="GeneID:8290679"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="UniProtKB/TrEMBL:C5DCA3"
                     /translation="MSPLLKDFLNKRIVVVTTDGQCVKAMLEGFDKSTNLLLSDVRDR
                     VSGDVVASSYLVRGNQVVCCGLLEEESSPQPDFGAESVSAQLKDTKNIVPDEHLIWQR
                     VWGMKAGK"
     gene            complement(<118238..>119137)
                     /locus_tag="KLTH0B01452g"
                     /db_xref="GeneID:8290681"
     mRNA            complement(<118238..>119137)
                     /locus_tag="KLTH0B01452g"
                     /product="KLTH0B01452p"
                     /transcript_id="XM_002551807.1"
                     /db_xref="GeneID:8290681"
     CDS             complement(118238..119137)
                     /locus_tag="KLTH0B01452g"
                     /note="similar to uniprot|P42938 Saccharomyces cerevisiae
                     YGR205W Protein that binds ATP crystal structure resembles
                     that of E.coli pantothenate kinase"
                     /codon_start=1
                     /product="KLTH0B01452p"
                     /protein_id="XP_002551853.1"
                     /db_xref="GeneID:8290681"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCA4"
                     /translation="MTKRTLVDESTHFVLTHYDSKPEGKEGDDRSPFLVLISGPQGSG
                     KTTSTHAIKQKLHELRPELKCLCVSIDDFYLTHADQQKVSNNNSGNGLQQGRGLPGTH
                     DMRLLDSFMQRLHENKGSVHVPVYDKSLFGGEGDRSASADEVALPVDVVIVEGWFLGF
                     EAVGEKTLEQMRSEVSSPRGKLLRTHELQHLLQVDSGLGAYARALWNNPTFRSVGVVI
                     AADVANIYRWRQQQEAQMIAKYGSGMNEEQVKAFVLRYMPCYELYYRSLMEHGSLGTE
                     AALVVHIDADRTVTGVEEKTRAA"
     gene            <119312..>120331
                     /locus_tag="KLTH0B01474g"
                     /db_xref="GeneID:8290682"
     mRNA            <119312..>120331
                     /locus_tag="KLTH0B01474g"
                     /product="KLTH0B01474p"
                     /transcript_id="XM_002551808.1"
                     /db_xref="GeneID:8290682"
     CDS             119312..120331
                     /locus_tag="KLTH0B01474g"
                     /note="similar to uniprot|P41903 Saccharomyces cerevisiae
                     YJR019C TES1 Thioesterase peroxisomal acyl-CoA
                     thioesterase"
                     /codon_start=1
                     /product="KLTH0B01474p"
                     /protein_id="XP_002551854.1"
                     /db_xref="GeneID:8290682"
                     /db_xref="GOA:C5DCA5"
                     /db_xref="InterPro:IPR003703"
                     /db_xref="InterPro:IPR029069"
                     /db_xref="UniProtKB/TrEMBL:C5DCA5"
                     /translation="MSSLKTLLRLTRISETKFVSPAAAPPPGGSGVFGGTLVAQSLWA
                     AIQTSGQAFEPSSLHCYFIVRGDTSVRITYNVEVLRQGTNFVHRQVRAYQLDKLIFVA
                     SVLLHKTSAFEGPEDDRSRARDVRHVTKADGLYPLEDTVPADDLFRSQVLENIDRYSR
                     LDRAWSDPQFTHPFLERFTSGPVEYRFPRDVFNSGAYHEGPAEDHLDHLDYYQRVREP
                     LEGSEAPEDSLSSSELSDPRFNYVAFAYLSDAYLLLMLPYFHQLPLYCSRFSVSLDHT
                     IHFHQRPPVYDWMALRVTNPRSRRGKHLVNGDYFNAASKSLIASVRQEGLVVYDSPSG
                     IRARF"
     gene            complement(<121140..>123977)
                     /locus_tag="KLTH0B01496g"
                     /db_xref="GeneID:8290683"
     mRNA            complement(<121140..>123977)
                     /locus_tag="KLTH0B01496g"
                     /product="KLTH0B01496p"
                     /transcript_id="XM_002551809.1"
                     /db_xref="GeneID:8290683"
     CDS             complement(121140..123977)
                     /locus_tag="KLTH0B01496g"
                     /note="similar to uniprot|P07245 Saccharomyces cerevisiae
                     YGR204W ADE3 Cytoplasmic trifunctional enzyme
                     C1-tetrahydrofolate synthase involved in single carbon
                     metabolism and required for biosynthesis of purines
                     thymidylate methionine and histidine"
                     /codon_start=1
                     /product="KLTH0B01496p"
                     /protein_id="XP_002551855.1"
                     /db_xref="GeneID:8290683"
                     /db_xref="GOA:C5DCA6"
                     /db_xref="InterPro:IPR000559"
                     /db_xref="InterPro:IPR000672"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020628"
                     /db_xref="InterPro:IPR020630"
                     /db_xref="InterPro:IPR020631"
                     /db_xref="InterPro:IPR020867"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCA6"
                     /translation="MVASLIDGKAIAKTIREEISQEIKTMSSGASGFRPTLAIFQVGN
                     RPDSATYVRMKCKAAEDAGIEVRFVHLDEDVAEHTLLTQVQEMNEDSSVDGILVQLPL
                     PGHIDEDKITSAVAARKDVDGFGAFNIGELNKKNGKPFFHPCTPEGIIELLVRNDVPI
                     AGARALVIGRSDIVGSPVAELLKARDATVTVVHSKSKDIPDYVSKADIVVVAIGRPEF
                     VKGAWFEGNSNCVVIDVGTNYVDDASKKSGYRCVGDVEFEAARQHVRLITPVPGGVGP
                     MTVAMLMSNVFKAAKRSLEGEGKPAFEPLPLNLANPVPSDFEISRAQKPKEITQVAAE
                     AGILPSELEPYGSTKAKVKLDILDRLGSRQNGKYVLVAGITPTPLGEGKSTTTVGLAQ
                     ALGAHLKKTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISMAN
                     NLLAAAIDTRMFHEQTQKDAALYKRLVPSKRGVRKFTPTMLRRLEKLGINKEDPDSLT
                     PEEITQFARLDIDPETITWKRVVDCNDRFLRGITIGEAPTERGFKRETGFDISVASEC
                     MAILALANSLSDMRERLGKIVIGASKSGVPVTCEDIGCAGAMTALLKDAVKPNIMQTL
                     EGTPVFVHAGPFANISIGANSAISDKIALKLAGVDPTASEEVKKESQGYVVTEAGFDF
                     TMGGERFLNIKCRSSGLVPDVVVIVATIRALKVHGGGPEVKADAPLPTEYLNENVDLL
                     RKGCANLAKHITNVKAYNLPVVIAINKMSSDTEREHEVVREEALKAGADDALVSNHWE
                     EGGKGAVDLAEGVIKACEQPNNKFKFLYETEGSSVEEKINTIAKEMYGAGSVEFLPEA
                     QKKIDLYTKQGFSNLPICIAKTQYSLSHDANLKGVPTGFKFPIRDVRASVGAGYLYAL
                     AAEIQTIPGLPTHCGFMNIEVNEKGEIEGMF"
     gene            complement(<124215..>124559)
                     /locus_tag="KLTH0B01518g"
                     /db_xref="GeneID:8290684"
     mRNA            complement(<124215..>124559)
                     /locus_tag="KLTH0B01518g"
                     /product="KLTH0B01518p"
                     /transcript_id="XM_002551810.1"
                     /db_xref="GeneID:8290684"
     CDS             complement(124215..124559)
                     /locus_tag="KLTH0B01518g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B01518p"
                     /protein_id="XP_002551856.1"
                     /db_xref="GeneID:8290684"
                     /db_xref="UniProtKB/TrEMBL:C5DCA7"
                     /translation="MLAARRRRQDTHHCVRNWSNLLNISSHPTVLDLNFSFGYKQARN
                     RPGSASHRPEAAPLRCDCAHRRVGALARTLSHCASRCHSFLASLSNILHLRATNRVAR
                     TRKTCIAQEYII"
     gene            <124955..>125440
                     /locus_tag="KLTH0B01540g"
                     /db_xref="GeneID:8290685"
     mRNA            <124955..>125440
                     /locus_tag="KLTH0B01540g"
                     /product="KLTH0B01540p"
                     /transcript_id="XM_002551811.1"
                     /db_xref="GeneID:8290685"
     CDS             124955..125440
                     /locus_tag="KLTH0B01540g"
                     /note="similar to uniprot|P22696 Saccharomyces cerevisiae
                     YJR017C ESS1 Peptidylprolyl-cis/trans-isomerase (PPIase)
                     specific for phosphorylated serine and threonine residues
                     N-terminal to proline"
                     /codon_start=1
                     /product="KLTH0B01540p"
                     /protein_id="XP_002551857.1"
                     /db_xref="GeneID:8290685"
                     /db_xref="GOA:C5DCA8"
                     /db_xref="InterPro:IPR000297"
                     /db_xref="InterPro:IPR001202"
                     /db_xref="InterPro:IPR023058"
                     /db_xref="UniProtKB/TrEMBL:C5DCA8"
                     /translation="MSSGLPEPWTVRFSKSKRREYFFHPETKQSQWEEPEGTDHQQLK
                     QYLADHPLRVRCLHLLIKHKDSRRPASHRSEHITLSKDEALQELAAYQQRLEQGERFE
                     DLARERSDCSSFKRGGDLGFFARGEMQPAFESVAFALPVSAVSAPVDTDSGVHLIKRV
                     A"
     gene            complement(<125475..>125924)
                     /locus_tag="KLTH0B01562g"
                     /db_xref="GeneID:8290686"
     mRNA            complement(<125475..>125924)
                     /locus_tag="KLTH0B01562g"
                     /product="KLTH0B01562p"
                     /transcript_id="XM_002551812.1"
                     /db_xref="GeneID:8290686"
     CDS             complement(125475..125924)
                     /locus_tag="KLTH0B01562g"
                     /note="similar to uniprot|P42937 YGR203W Saccharomyces
                     cerevisiae Probable protein tyrosine phosphatase of the
                     CDC25-like phosphatase family"
                     /codon_start=1
                     /product="KLTH0B01562p"
                     /protein_id="XP_002551858.1"
                     /db_xref="GeneID:8290686"
                     /db_xref="InterPro:IPR001763"
                     /db_xref="UniProtKB/TrEMBL:C5DCA9"
                     /translation="MNSRSVAAIRYVDAAELFQWIKRGTTGAGEPFQVIDVRGSDYIG
                     GHIVNGWNYPYRELRDGGARMEELMQRLRSAAGAAGAQPINCVFHCAQSQQRGPSAAM
                     KFLRSVADEDLARMRVCVLRGGFNHWQAEYGEDASVTEAYVPDLWRM"
     gene            <126091..>127368
                     /locus_tag="KLTH0B01584g"
                     /db_xref="GeneID:8290687"
     mRNA            <126091..>127368
                     /locus_tag="KLTH0B01584g"
                     /product="KLTH0B01584p"
                     /transcript_id="XM_002551813.1"
                     /db_xref="GeneID:8290687"
     CDS             126091..127368
                     /locus_tag="KLTH0B01584g"
                     /note="weakly similar to uniprot|P13259 Saccharomyces
                     cerevisiae YGR202C PCT1 Cholinephosphate
                     cytidylyltransferase, also known as CTP:phosphocholine
                     cytidylyltransferase"
                     /codon_start=1
                     /product="KLTH0B01584p"
                     /protein_id="XP_002551859.1"
                     /db_xref="GeneID:8290687"
                     /db_xref="GOA:C5DCB0"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DCB0"
                     /translation="MAKDSSQGSLKSRLSSGSLTNLFKLNRKRRLDDEDSDSAASHSG
                     ESGSESRSETKKRRRSAGEASEPQQGMDKQQQEQEREWDAALPEELRKFRPVGFPLNL
                     PPTDRPVRVYADGVFDLFHLGHMKQLEQCKKCMPNVTLICGVPSDRITHKLKGLTVLS
                     DVQRYETLRHCRWVDEVVEDAPWCVTPEFLEQHRIDYVAHDDLPYAAADSDDIYRPIK
                     QMGKFVATQRTDGISTSDIITRIIRDYDKYLMRNFARGATRRELNVSWLKKNELEFKK
                     HIQDFRSYFKKSHDSINHASKDLYVEVREMLLRKTLGKKVYSKLAGQDRPQQALRGSS
                     PASEFARTFTDHHGGANALESSHESSHEGSREDSHDYDDQEDHNDDDDDDDGSESDRA
                     NEKERENDDSSYKDTDSSGSSRRTRRARHAGGR"
     gene            <127592..>129364
                     /locus_tag="KLTH0B01606g"
                     /db_xref="GeneID:8290688"
     mRNA            <127592..>129364
                     /locus_tag="KLTH0B01606g"
                     /product="KLTH0B01606p"
                     /transcript_id="XM_002551814.1"
                     /db_xref="GeneID:8290688"
     CDS             127592..129364
                     /locus_tag="KLTH0B01606g"
                     /note="highly similar to uniprot|P39522 Saccharomyces
                     cerevisiae YJR016C ILV3 Dihydroxyacid dehydratase
                     catalyzes third step in the common pathway leading to
                     biosynthesis of branched-chain amino acids"
                     /codon_start=1
                     /product="KLTH0B01606p"
                     /protein_id="XP_002551860.1"
                     /db_xref="GeneID:8290688"
                     /db_xref="GOA:C5DCB1"
                     /db_xref="InterPro:IPR000581"
                     /db_xref="InterPro:IPR004404"
                     /db_xref="InterPro:IPR015928"
                     /db_xref="InterPro:IPR020558"
                     /db_xref="UniProtKB/TrEMBL:C5DCB1"
                     /translation="MGFLGRLSSTETRRCFSNTRNVYKKLNKYSYIITEPKDQGASQA
                     MLFATGFKQEDFNKPQVGVGSCWWSGNPCNMHLLDFNHRITASVEKAGLKGMQFNTIG
                     VSDGISMGTKGMRYSLQSREIIADSFETIMMAQHYDANIAIPSCDKNMPGVLMAMGRH
                     NRPSIMVYGGTILPGHPSCGSQNIPKNIDVVSAFQSYGQYLSKSFTENERQDVVKNAC
                     PGPGSCGGMYTANTMASVAEVLGITLPNSSSHPAVSKEKLAECDSIGEAIKKTMELGI
                     TPRDIMTKEAFLNAITYVVATGGSTNAVLHMVAVAQSAGVKITPDDFQRISDKTPLLG
                     DFKPSGKYVMADLIKVGGTQSVIKFLYEEGFLNGNTMTVTGETLEQRAAKAAPLPEGQ
                     DIIKPISQPIKPQGHLQILYGSLAPGGAVGKITGKEGTYFKGKARVFDEEAGFIHALE
                     RGEIKKGEKTVVVIRYEGPKGGPGMPEMLKPSSALMGYGLGKDVALLTDGRFSGGSHG
                     FLIGHIVPEAAEGGPIALVKDGDEIIIDSNNNKIDVCVSEEELAQRKTQWQEPAPRYA
                     RGTLSKYRKLVSNASLGCVTDGDN"
     gene            <129632..>132004
                     /locus_tag="KLTH0B01628g"
                     /db_xref="GeneID:8290689"
     mRNA            <129632..>132004
                     /locus_tag="KLTH0B01628g"
                     /product="KLTH0B01628p"
                     /transcript_id="XM_002551815.1"
                     /db_xref="GeneID:8290689"
     CDS             129632..132004
                     /locus_tag="KLTH0B01628g"
                     /note="similar to uniprot|P42935 Saccharomyces cerevisiae
                     YGR200C ELP2 Elongator protein part of the six- subunit
                     RNA polymerase II Elongator histone acetyltransferase
                     complex target of Kluyveromyces lactis zymocin"
                     /codon_start=1
                     /product="KLTH0B01628p"
                     /protein_id="XP_002551861.1"
                     /db_xref="GeneID:8290689"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DCB2"
                     /translation="MSGMAKAEAIFIGGNRQTQASDYNPKHGILAYGAGKTIAFWKPL
                     DPAHRGVYATLKGHDAEVTCVRFVPGTEFMITASEDSQVRLWAFDGEDNSAMACIQST
                     DHHKHTITSLSVLSNLLTVGCADGSVSVWQINERQISLVHSFVLKAGVFPLCMALKSV
                     EDSKVLLAVGGTNSNVFIYSFTREAAALENFQLAATLEGHEDWIKAMDFYEEGPGNML
                     LATGSQDRYIRLWRIRTNDLIDNSDEDDSKLKLLSNKQSKFYIDGSLRVAINFEALII
                     GHDDWVSCLKWHSDKLQLLASTADTAVMVWEPDAESGIWVCASRLGELSSKGASTATG
                     SSGGFWSCNWFTQEKADYILTNGKTGSWRMWKSDDISGWEQQLAITGPTKPTTDVAWS
                     PNGLYLLGTSLDQTTRLFARCKLDGEQDKISGSWFEFSRPQIHGYDMICVEPISNTRF
                     ISGGDEKIMRSFDEPKGVAQILQKFAGVPFENEKYMPESASLPALGLSSKATADVDED
                     EDEDPDARETNETKNISFDIVASLHSPPVEDQLQRHTLWPEIEKLYGHGYEISCLDVS
                     PDAKIIASACRSNNLQHAVIRFFDSNTWLHLEPAPQFHNLTITRLRFSKDNTQLLSVS
                     RDRQWAVWKRDLETNQFTLAYKNEKAHTRIIWDCEWAPLSFGSVFLTASRDKSIKLWR
                     FSEEEQDYLQEASIKLGISVTAISVHEKLFDNKLIIAAGLENGSLQVYTYENEFQKVL
                     EIEDRYTPADRISRLRWSSNGNELFLAAASADTSFRIYSVKSESIKNSPN"
     gene            complement(<132053..>134317)
                     /locus_tag="KLTH0B01650g"
                     /db_xref="GeneID:8290690"
     mRNA            complement(<132053..>134317)
                     /locus_tag="KLTH0B01650g"
                     /product="KLTH0B01650p"
                     /transcript_id="XM_002551816.1"
                     /db_xref="GeneID:8290690"
     CDS             complement(132053..134317)
                     /locus_tag="KLTH0B01650g"
                     /note="similar to uniprot|P42934 Saccharomyces cerevisiae
                     YGR199W PMT6 Transfers mannose residues from dolichyl
                     phosphate-D-mannose to specific serine/threonine residues
                     of proteins in the secretory pathway dolichyl
                     phosphate-D-mannose:protein O-D-mannosyltransferase"
                     /codon_start=1
                     /product="KLTH0B01650p"
                     /protein_id="XP_002551862.1"
                     /db_xref="GeneID:8290690"
                     /db_xref="GOA:C5DCB3"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="InterPro:IPR016093"
                     /db_xref="InterPro:IPR027005"
                     /db_xref="UniProtKB/TrEMBL:C5DCB3"
                     /translation="MSSSGFLPKSSELNLRERRKNFDGDQLSDTDDNELHEKNDEKLV
                     ETHGAELKKRKIAKFANMGGIAAITLLSFYVRFMKIDASDIVVWDEAHFGKFGSYYIK
                     HEFYHDVHPPLGKMLIALSEYLAGFDGNFDFSSGDPYPNGVNFKFMRQFNATFGALCA
                     PIMLLSAQNLGFSTLCSYLLGLMVALELSFISLSKFILLDSMLLFFTATTFHCITEVH
                     KLRGKQFTKKWSLWMLLLGISIGCVCSVKWVGLFVTVIAGVYTVADLLSYHYDKNMGR
                     LRYYKHWFIRIIDLIVIPFMIYLFCFKIHFTILSRSGTGDAATNTLFQVNLDGNNIEV
                     GPRDVAYGSELTIRSHGLSPNLLHSHVQLYPLGSGQHQVTGYGHSDDNNRWVVKFSRE
                     SGLSLDNSTILDSKHLLLRDNSEIRLVHKNTQANLHSHEIPAHVSKNSYEVSGYGDEV
                     IGDTKDDWVVEIVEQLDSSNSSLPQEDPSVLHPISTSFRLRHKELGCYLATTGLAYPA
                     WGFKQAEIVCKHSWTKRDKSTWWNVEDHWNPAMEKTEGYIPPKSKFWADFVLINFAMA
                     SSNNALVPDEDKYDSLASEAWEWPILHVGLRMCGWGHHTVKYFLMGSPFQTWLSTGSL
                     VAFVFIILRLAYKWRRQSVLVTSDFLSKVGMQGILPFLAWLLHYLPFVAMGRVTYVHH
                     YVPALYFALLVLGFVLETCVPKRFYLNYIIYALLYAGCIYIYNLFSPIAQGMQGSAID
                     FRYLQWFNTWNIAL"
     gene            complement(<134593..>136791)
                     /locus_tag="KLTH0B01672g"
                     /db_xref="GeneID:8290691"
     mRNA            complement(<134593..>136791)
                     /locus_tag="KLTH0B01672g"
                     /product="KLTH0B01672p"
                     /transcript_id="XM_002551817.1"
                     /db_xref="GeneID:8290691"
     CDS             complement(134593..136791)
                     /locus_tag="KLTH0B01672g"
                     /note="similar to uniprot|P46951 Saccharomyces cerevisiae
                     YGR198W Essential protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cytoplasm in a punctate pattern"
                     /codon_start=1
                     /product="KLTH0B01672p"
                     /protein_id="XP_002551863.1"
                     /db_xref="GeneID:8290691"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DCB4"
                     /translation="MQEDYEQVEAALGSRLLGASEFRTKNKRLNQVLSLQYRVHYHVH
                     QKGIIKEAACKVLLEECNRFERDSSDALVEKVWLNLAGILNYHLSHPQTADKCLAESA
                     KISAAQGAFGTFLSVENLYYSGLLRGDKSRDFYVKHLPEVVTSLPKESNVLTYHYLDR
                     IISRLSMNWSQAISAFPRTVISSFIAIMSEPDGHDQELLALGKTILASAKFPNAEEAN
                     NASLEQFHLVLQHYLRSTKSELSPDWHSFVVESMSRTFQSMIVTKTAMIYFGRENQLR
                     ESILNFNVFLNYNRSYRDLNNGEWFDVLAIIDAYEHIVSRSEGRDIPKIFALKDVMKR
                     FEGLLCSFYEDSALPLVKVERSIEWASEGTRVFVPERASSLLARSWNALYEYSREDLD
                     KLLNDNHTYYLANALAARPDNSKIAFNYAFTLAQKREITHAVKFLKSNILEREPENYK
                     AWHLLALCESIKEDKNVSFKIVCSVLQALENAVHEDPQAPARDRWQLIHLKLTQLAII
                     QEMFGVNDALELLPELFELFNFAFPENGKNGDLGSAYNKTKDYLHQSVWLFAVKLYLT
                     QGLIVDAREALAESRNVTKNFQNLNNDLADGYLSLDVDGKKALRSFEKVLFYDALNID
                     AIVGFAKCLVPTSQENSSHQLQPQTPSAAGLDAFTGEKDRSAAYARLKMVLEEVVERS
                     IEGCHAPEVWWYLSRVYENYDDTERLETSLWNCVKYQELQPIRDFKNCNF"
     gene            complement(<136942..>137535)
                     /locus_tag="KLTH0B01694g"
                     /db_xref="GeneID:8290692"
     mRNA            complement(<136942..>137535)
                     /locus_tag="KLTH0B01694g"
                     /product="KLTH0B01694p"
                     /transcript_id="XM_002551818.1"
                     /db_xref="GeneID:8290692"
     CDS             complement(136942..137535)
                     /locus_tag="KLTH0B01694g"
                     /note="similar to uniprot|P47089 Saccharomyces cerevisiae
                     YJR014W RBF22 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B01694p"
                     /protein_id="XP_002551864.1"
                     /db_xref="GeneID:8290692"
                     /db_xref="GOA:C5DCB5"
                     /db_xref="InterPro:IPR001950"
                     /db_xref="InterPro:IPR005873"
                     /db_xref="UniProtKB/TrEMBL:C5DCB5"
                     /translation="MSLRTVIYCGVCSFPPEFCEFTGKLKRCKVWLLENHPEKYQSLY
                     GDAEVEDAAAKLAGSSIGEEREEKLEKDLLKLQSKQENREQRELAKKLSSKVIIKREA
                     RTKRKTMVAIAGLEVFEIDMKKLAKTFASKFATGCSVSKNAEKKEEIIIQGDVADEAE
                     TYIQKLLEEKGLKEVKVEQMDMKKKKKPTTTTPTPAA"
     gene            <137755..>140211
                     /locus_tag="KLTH0B01716g"
                     /db_xref="GeneID:8290693"
     mRNA            <137755..>140211
                     /locus_tag="KLTH0B01716g"
                     /product="KLTH0B01716p"
                     /transcript_id="XM_002551819.1"
                     /db_xref="GeneID:8290693"
     CDS             137755..140211
                     /locus_tag="KLTH0B01716g"
                     /note="weakly similar to uniprot|P46949 Saccharomyces
                     cerevisiae YGR196C FYV8 Protein of unknown function
                     required for survival upon exposure to K1 killer toxin"
                     /codon_start=1
                     /product="KLTH0B01716p"
                     /protein_id="XP_002551865.1"
                     /db_xref="GeneID:8290693"
                     /db_xref="InterPro:IPR026248"
                     /db_xref="UniProtKB/TrEMBL:C5DCB6"
                     /translation="MSDNVERRKSQRWVSVGKGSYDGKEWDSSDEDGSYEAWEDDNGE
                     TAQSPKRSGTVTKLPPLPKLQYGRDVDSAPEGSNGSSPKLESTSSNLDQLMSQISHEM
                     TPRSESRERFSPNDGTPRPPRQFGDEGDEHSSAFSYSDSEEELQVSKTGYFSNMVGAT
                     QSAGRSGSYSDDEVYVTPDPSSLSRATAEPEAARMDTRGSDSASSAAHASKSELERYN
                     ASPDDRESMSASTTEVSKSSSPKENSASLSGGQPASVKSDNGSSETDHLTGSVLSSAD
                     EVHTGSKDVQSGLESVQGSQPSGSAVEESKETISKGTLAHQGDDTAPQQEPHESHGTP
                     IKDARNNSSDEYGDNESFFNHYGNNSSQSSPANNPDNSPKKHDSSPLKLRQSSKTQLG
                     YENVKSQAQDENSSDNASSTSEPGSFKFKDRVRESILESSDEDIGDDESVLRVPTSGY
                     YAKMLKDSSQAERGDDQSTETEGSSIVSSETDTGSITKSINGSNQDGATTPEAISPRK
                     HNEEDQTTDTEPLEEQEGSKNLQSRQSINLGKWQPDTDATRAAFLGEARPEVPEDFVI
                     DQDGNMVDVNPSSMRNPRVVSTYSEAESAWNAFPSAGNAEGDLDTIYDTKTIYDNQTI
                     YNVPGIATNNSSLPPLPNNISALESSDSAAVTDSDSILRHLSGEKKPHFSNLKENFSV
                     HTPNSEEIAQVRGREAPSVNLDSLISAKGKTHAMKISDLRNHSEQLNAYDTGLHTWIN
                     YALKNSSSDKDYIFQDYKVNKHVRDAYAQADELSKKMTVSNTVANVNQNVSHLKRKVF
                     SHTMKEKSKGLFSSIGKKKA"
     gene            complement(<140265..>141002)
                     /locus_tag="KLTH0B01738g"
                     /db_xref="GeneID:8290694"
     mRNA            complement(<140265..>141002)
                     /locus_tag="KLTH0B01738g"
                     /product="KLTH0B01738p"
                     /transcript_id="XM_002551820.1"
                     /db_xref="GeneID:8290694"
     CDS             complement(140265..141002)
                     /locus_tag="KLTH0B01738g"
                     /note="highly similar to uniprot|P46948 Saccharomyces
                     cerevisiae YGR195W SKI6 superkiller ExtraCellular Mutant
                     Ribosomal RNA Processing homolog of RNAse PH"
                     /codon_start=1
                     /product="KLTH0B01738p"
                     /protein_id="XP_002551866.1"
                     /db_xref="GeneID:8290694"
                     /db_xref="InterPro:IPR001247"
                     /db_xref="InterPro:IPR015847"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027408"
                     /db_xref="UniProtKB/TrEMBL:C5DCB7"
                     /translation="MSRLEIYSPEGLRVDGRRWNELRRLECSINTHANASDGSSYLEQ
                     GNNKVITLVTGPQEPKLRSQMNVTKATISVALNITRFSKIERSKSSHKNERRVLEMQT
                     ALVRTFEKNVMLHLYPRTQIEIQIHVLQQDGGLMSSLINGITLALIDAGIAMYDYISG
                     VSIGLYDTTPLLDLNSVEENAMSSVTLGVVGKSEKLSLLLVEDKIPLDRMESVLAIGI
                     AGSHRIRELMDKELRKHGERRLANMST"
     gene            complement(<141964..>143148)
                     /locus_tag="KLTH0B01760g"
                     /db_xref="GeneID:8290695"
     mRNA            complement(<141964..>143148)
                     /locus_tag="KLTH0B01760g"
                     /product="KLTH0B01760p"
                     /transcript_id="XM_002551821.1"
                     /db_xref="GeneID:8290695"
     CDS             complement(141964..143148)
                     /locus_tag="KLTH0B01760g"
                     /note="similar to uniprot|P47088 Saccharomyces cerevisiae
                     YJR013W GPI14 Glycosylphosphatidylinositol- alpha 1 4
                     mannosyltransferase I involved in GPI anchor biosynthesis
                     requires Pbn1p for function homolog of mammalian PIG-M"
                     /codon_start=1
                     /product="KLTH0B01760p"
                     /protein_id="XP_002551867.1"
                     /db_xref="GeneID:8290695"
                     /db_xref="GOA:C5DCB8"
                     /db_xref="InterPro:IPR007704"
                     /db_xref="UniProtKB/TrEMBL:C5DCB8"
                     /translation="MDTATVSLFLGALALRLGFFFYGIYQDKYFEVKYTDVDYFVFND
                     AASYVFHGLSPYLRDTYRYTPLLSWLLVPNHYLQWIHFGKMMFVLFDLLTGLLILNLL
                     EAQSKRKKLILSSLWLLNFMVITISTRGNAESVLCFLILLSLYFLKARQFVLSGLFLG
                     FAIHFKIYPIIYSIPIAVYVYRQRQGGLFNVFKVGVSAILALAGTSYWMYQIYGMEFL
                     DNAYFYHLSRTDHRHNFSVFHMLLYFESALPTDSFWAKLAFLPQAAITLGVVPLLLRD
                     PSFNSLLSLLFIQTFAFVTYNKVCTSQYFIWYLIFLPFYLARTSITLKKGLTMALIWV
                     GTQGAWLFFGYLLEFKGKNVFYPGLFLASLSFFLGNVWILGQFIDDFKVKTELSEEKK
                     KR"
     gene            <143331..>143672
                     /locus_tag="KLTH0B01782g"
                     /db_xref="GeneID:8290696"
     mRNA            <143331..>143672
                     /locus_tag="KLTH0B01782g"
                     /product="KLTH0B01782p"
                     /transcript_id="XM_002551822.1"
                     /db_xref="GeneID:8290696"
     CDS             143331..143672
                     /locus_tag="KLTH0B01782g"
                     /note="some similarities with uniprot|P47087 Saccharomyces
                     cerevisiae YJR012C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0B01782p"
                     /protein_id="XP_002551868.1"
                     /db_xref="GeneID:8290696"
                     /db_xref="UniProtKB/TrEMBL:C5DCB9"
                     /translation="MSGPLTYEELVDHIVNEKPIPNILSVPNVTLDPSLVTKSNMKPR
                     PKPWERNNAATSELAGEPPHQQTAVAEGPEICTRSRSSESLSKYYAIEAEFEQQLQSF
                     LGGNEESEKLQ"
     gene            complement(<143910..>144818)
                     /locus_tag="KLTH0B01804g"
                     /db_xref="GeneID:8290697"
     mRNA            complement(<143910..>144818)
                     /locus_tag="KLTH0B01804g"
                     /product="KLTH0B01804p"
                     /transcript_id="XM_002551823.1"
                     /db_xref="GeneID:8290697"
     CDS             complement(143910..144818)
                     /locus_tag="KLTH0B01804g"
                     /note="weakly similar to uniprot|P38087 Saccharomyces
                     cerevisiae YBR104W YMC2 Putative mitochondrial inner
                     membrane transporter, member of the mitochondrial carrier
                     (MCF) family"
                     /codon_start=1
                     /product="KLTH0B01804p"
                     /protein_id="XP_002551869.1"
                     /db_xref="GeneID:8290697"
                     /db_xref="GOA:C5DCC0"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DCC0"
                     /translation="MSARTDNNVVVPNEAYSRIMGFVSGMFSGLAKNAVGHPFDTVKV
                     RLQTSQDTGRFKGPLDCVYQTMRQQGVRGFYLGFTPPLVGWILMDSVMLGCLHNYRML
                     LKKYVYQHEEKLPLSGCILSGVMAGWSVSFIAAPVELAKAKLQVQYDAKTTKYRGPID
                     VIKKVYVADGIRGLYKGLISTLIFRTHFIYWWGSYELLTRWFKANTNLSDTAINFWAG
                     GFSASFGFWTTAYPSDVIKQVVLCSDKYDGSFKSWKMAASDIWRSKGFKGFFKGFVPS
                     FLRSFPANAAALASFEFVLRVSGAKP"
     gene            <145103..>145798
                     /locus_tag="KLTH0B01826g"
                     /db_xref="GeneID:8290698"
     mRNA            <145103..>145798
                     /locus_tag="KLTH0B01826g"
                     /product="KLTH0B01826p"
                     /transcript_id="XM_002551824.1"
                     /db_xref="GeneID:8290698"
     CDS             145103..145798
                     /locus_tag="KLTH0B01826g"
                     /note="some similarities with uniprot|P47086 Saccharomyces
                     cerevisiae YJR011C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B01826p"
                     /protein_id="XP_002551870.1"
                     /db_xref="GeneID:8290698"
                     /db_xref="UniProtKB/TrEMBL:C5DCC1"
                     /translation="MDSQAFSPSFEDELTRCATIIERFIVSLVNVAYYACFHKQNEDA
                     SPSTAAAKSAAFKKVRDSLLALAVRAEKLTSSEKISPADMKGLVCRDFLQELHRCSEV
                     ASDELLQVLNPITTKPLDGYEEPSSLNKIPTHLRNCILGFVQIFHFFRKLPVQEQYHI
                     SALQARILERELKSDLLGPWTRQVETLHSTIGWILLSDSHFQQKLNEYKSKTQTEPGA
                     LAFNEWLRHEIRQ"
     gene            <146051..>146317
                     /locus_tag="KLTH0B01848g"
                     /db_xref="GeneID:8290699"
     mRNA            <146051..>146317
                     /locus_tag="KLTH0B01848g"
                     /product="KLTH0B01848p"
                     /transcript_id="XM_002551825.1"
                     /db_xref="GeneID:8290699"
     CDS             146051..146317
                     /locus_tag="KLTH0B01848g"
                     /note="similar to uniprot|P46965 Saccharomyces cerevisiae
                     YJR010C-A SPC1 Subunit of the signal peptidase complex
                     (SPC) which cleaves the signal sequence from proteins
                     targeted to the endoplasmic reticulum (ER) homolog of the
                     SPC12 subunit of mammalian signal peptidase complex"
                     /codon_start=1
                     /product="KLTH0B01848p"
                     /protein_id="XP_002551871.1"
                     /db_xref="GeneID:8290699"
                     /db_xref="GOA:C5DCC2"
                     /db_xref="InterPro:IPR009542"
                     /db_xref="UniProtKB/TrEMBL:C5DCC2"
                     /translation="MSEVLQEIQKKLVFPIDFASQRRLDRSVYLCLMIGTVVSCFIGL
                     FTQSLFNLVVSFGLTFCVCLALGLPSYPAYNKQRLEWVKPKISH"
     gene            <146628..>148373
                     /locus_tag="KLTH0B01870g"
                     /db_xref="GeneID:8290700"
     mRNA            <146628..>148373
                     /locus_tag="KLTH0B01870g"
                     /product="KLTH0B01870p"
                     /transcript_id="XM_002551826.1"
                     /db_xref="GeneID:8290700"
     CDS             146628..148373
                     /locus_tag="KLTH0B01870g"
                     /note="similar to uniprot|P42826 Saccharomyces cerevisiae
                     YGR194C XKS1 third enzyme in the xylose pathway;
                     Xylulokinase"
                     /codon_start=1
                     /product="KLTH0B01870p"
                     /protein_id="XP_002551872.1"
                     /db_xref="GeneID:8290700"
                     /db_xref="GOA:C5DCC3"
                     /db_xref="InterPro:IPR018484"
                     /db_xref="InterPro:IPR018485"
                     /db_xref="UniProtKB/TrEMBL:C5DCC3"
                     /translation="MTADKVGAFYLGFDLSTQQLKCLVIDQNLALVHSETIGFDKDLS
                     HYKTTKGVYLHEDGTVECPVAMWLEAVDLVFERMSKHKHIDLSLVRAMSGSCQQHGSV
                     YWAESGPGLLPKLDSKQSLKQQLYPEAFSRNVAPNWQDHSTGEECREFEESCGGAAQL
                     AQVTGSRAHHRFTGPQIMKIAKKEPEVYRATSKVSLVSSFLASILAGEFTPLEEADAC
                     GMNLYNIDKRDYDDKLLRNVDDDTETLRSKLGGPPINCDKPAPVGTLSPYFVEKYGLN
                     PECQIFPFTGDNLATICSLPLQPNDVLVSLGTSTTILLVTDQYHPSPNYHLFIHPTIP
                     RHYMGMICYCNGALARERIRDQLSETHDWEPFNAAVKSTTLNTDNEIACYFPLGEIVP
                     NVPSSYRRATFAKSPDSQEVKLELKDAFADIAHDAKNIVESQALSCRVRISPLLSKDC
                     ADPSVDLGDSMVHFDCDDFPLSEYKKRPRRAFFVGGASKNDAIVERFAQVLGATDGNF
                     RLETPNSCALGGCYRAMWSHLYYGGLTKAPFDNFLNEQFRWDTDVQSLSLTKDKEWQY
                     FNNKIQALSELEKTL"
     gene            <148776..>150023
                     /locus_tag="KLTH0B01892g"
                     /db_xref="GeneID:8290701"
     mRNA            <148776..>150023
                     /locus_tag="KLTH0B01892g"
                     /product="KLTH0B01892p"
                     /transcript_id="XM_002551827.1"
                     /db_xref="GeneID:8290701"
     CDS             148776..150023
                     /locus_tag="KLTH0B01892g"
                     /note="similar to uniprot|P16451 Saccharomyces cerevisiae
                     YGR193C PDX1 Dihydrolipoamide dehydrogenase (E3)-binding
                     protein (E3BP) of the mitochondrial pyruvate dehydrogenase
                     (PDH) complex plays a structural role in the complex by
                     binding and positioning E3 to the dihydrolipoamide
                     acetyltransferase (E2) core"
                     /codon_start=1
                     /product="KLTH0B01892p"
                     /protein_id="XP_002551873.1"
                     /db_xref="GeneID:8290701"
                     /db_xref="GOA:C5DCC4"
                     /db_xref="InterPro:IPR000089"
                     /db_xref="InterPro:IPR003016"
                     /db_xref="InterPro:IPR004167"
                     /db_xref="InterPro:IPR011053"
                     /db_xref="UniProtKB/TrEMBL:C5DCC4"
                     /translation="MIARGLLRGNAGRLACLRALHRSSALSKAQTFAMPAMSPTMEKG
                     GIVEWKFKVGDPFSAGDVLLEVETDKAQIDVEAQDDGKLAKIVVDNGAKDINVGEVIA
                     YLAEPEDDLATLELPQPEKSTGKSKAETKSAAKPSATAKTSPASISQENKPEPKKNAP
                     SKSSSDSKSSTGVAVKANPSQTLLPSVQMLLHVNNISAEDALNNIPASGPNGRILKGD
                     VLSYLGKVSQESVTKLAEYIEKGSALDLTNIELKEPEPAPKAKEEVAKKEPVVLSEQL
                     HLKVASGVTYEQLARSLESYVKEAKYLAHEQPTTNPYSEHFDAVFEELITPEPRAPRF
                     EVSYDLISLGSSGISAKQQDDIFDLLAGTKPSPAASEVETAQPNEFLVSVRVQVSDKF
                     TDAPTKAERFVQYLRDLESSAEL"
     gene            complement(<150142..>151659)
                     /locus_tag="KLTH0B01914g"
                     /db_xref="GeneID:8290702"
     mRNA            complement(<150142..>151659)
                     /locus_tag="KLTH0B01914g"
                     /product="KLTH0B01914p"
                     /transcript_id="XM_002551828.1"
                     /db_xref="GeneID:8290702"
     CDS             complement(150142..151659)
                     /locus_tag="KLTH0B01914g"
                     /note="highly similar to uniprot|P08536 Saccharomyces
                     cerevisiae YJR010W MET3 ATP sulfurylase catalyzes the
                     primary step of intracellular sulfate activation essential
                     for assimilatory reduction of sulfate to sulfide involved
                     in methionine metabolism"
                     /codon_start=1
                     /product="KLTH0B01914p"
                     /protein_id="XP_002551874.1"
                     /db_xref="GeneID:8290702"
                     /db_xref="GOA:C5DCC5"
                     /db_xref="InterPro:IPR002650"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015947"
                     /db_xref="InterPro:IPR024951"
                     /db_xref="InterPro:IPR025980"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="InterPro:IPR027535"
                     /db_xref="UniProtKB/TrEMBL:C5DCC5"
                     /translation="MPAPHGGVLQDLIARDAQIKDQLLQEAAQASIKWDLTPRQICDL
                     ELIQNGGFSPLSGFMNQKDYDGVVEKSRLSNGLVWTIPINLDVDEAFAKQLKPDARVV
                     LLQDNEIPVAILTVTDVYKPDKQNEAKKVFRGDPEHPAVKYLKETAGEYYVGGEIQAI
                     QYPVHYDYPGLRKTPAQLRLEFDSKQWDRIVAFQTRNPMHRAHRELTVRAAREHNAKV
                     LIHPVVGLTKPGDIDHHTRVRVYQEIIKRYPNGMAQLSLLPLAMRMGGDREAVWHAII
                     RKNYGATHFIVGRDHAGPGKNSAGVDFYGAYDAQELVESYKNELGIEVVPFRMVTYLP
                     EEDRYAPIDQIDLSTTSTLNISGTELRNRLRSGGPIPEWFSYPEVVKILRESNPPRPK
                     QGFAIVLSSSLKSNKQLSTALLTTFLQFGGGRHFKVLEHNNDANVLGLVPDFISSGAG
                     LIIPSQYEKWNSVSNAYLVGTSEDADITLDSDDEAVLHVVQKVVLFLEDHGFFTF"
     gene            complement(<152392..>153252)
                     /locus_tag="KLTH0B01936g"
                     /db_xref="GeneID:8290703"
     mRNA            complement(<152392..>153252)
                     /locus_tag="KLTH0B01936g"
                     /product="KLTH0B01936p"
                     /transcript_id="XM_002551829.1"
                     /db_xref="GeneID:8290703"
     CDS             complement(152392..153252)
                     /locus_tag="KLTH0B01936g"
                     /note="similar to uniprot|P38892 Saccharomyces cerevisiae
                     YHR209W Putative S-adenosylmethionine-dependent
                     methyltransferase of the seven beta-strand family"
                     /codon_start=1
                     /product="KLTH0B01936p"
                     /protein_id="XP_002551875.1"
                     /db_xref="GeneID:8290703"
                     /db_xref="GOA:C5DCC6"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR029063"
                     /db_xref="UniProtKB/TrEMBL:C5DCC6"
                     /translation="MSLYLNGVIDSDKYQKYRITYPKSLYEAIMAHHAGGRLLAVDVG
                     CGTGIGTFPLLEYFDTVVGCDPSAKMLATAAQVREKLPGVSRRRVSFQQAAGEDISRL
                     FEERSVDMITGGESIQYVKHDEFFRAAARLLRPGATLAFWFYADPVFVDYPEANAIFK
                     HCAYEDQRSFAPLWPPEMELVRRLGESIQVPSHEFEMVHSEVNVPLKTKGTRSFRVTR
                     EGCTLKDLRDLISTWSVYDAWKKNNKDCAEDVIDALIEKLKRGCGWDDNIKLRLEWET
                     SFYVARRRQT"
     gene            <154881..>155879
                     /locus_tag="KLTH0B01958g"
                     /db_xref="GeneID:8290704"
     mRNA            <154881..>155879
                     /locus_tag="KLTH0B01958g"
                     /product="KLTH0B01958p"
                     /transcript_id="XM_002551830.1"
                     /db_xref="GeneID:8290704"
     CDS             154881..155879
                     /locus_tag="KLTH0B01958g"
                     /note="highly similar to uniprot|P00358 TDH2, to YGR192C
                     uniprot|P00359 TDH3 and to YJL052W uniprot|P00360 TDH1
                     Saccharomyces cerevisiae glyceraldehyde 3-phosphate
                     dehydrogenases"
                     /codon_start=1
                     /product="KLTH0B01958p"
                     /protein_id="XP_002551876.1"
                     /db_xref="GeneID:8290704"
                     /db_xref="GOA:C5DCC7"
                     /db_xref="InterPro:IPR006424"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR020828"
                     /db_xref="InterPro:IPR020829"
                     /db_xref="InterPro:IPR020830"
                     /db_xref="InterPro:IPR020831"
                     /db_xref="UniProtKB/TrEMBL:C5DCC7"
                     /translation="MVTTVAINGFGRIGRLVLRIALSRKDLKVVAINDPFISVDYAAY
                     MFKYDSTHGRYQGTVSHEGSDLVIDGQKIAVFQERDPAQLPWGKLNVDIAIDSTGVFK
                     ELDSAQKHIDAGAKKVVITAPSSTAPMFVVGVNEDEYKGQNIVSNASCTTNCLAPLAK
                     VINDKFGIEEGLMTTVHSLTATQKTVDGPSQKDWRGGRTASGNIIPSSTGAAKAVGKV
                     LPVLQGKLTGMAFRVPTVDVSVVDLTVKLAKETTYDEIKAAVKEASEGKMKGVLGYTE
                     EDVVSSDFLSDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHVAKA"
     gene            complement(<156072..>157040)
                     /locus_tag="KLTH0B01980g"
                     /db_xref="GeneID:8290705"
     mRNA            complement(<156072..>157040)
                     /locus_tag="KLTH0B01980g"
                     /product="KLTH0B01980p"
                     /transcript_id="XM_002551831.1"
                     /db_xref="GeneID:8290705"
     CDS             complement(156072..157040)
                     /locus_tag="KLTH0B01980g"
                     /note="similar to uniprot|P47085 Saccharomyces cerevisiae
                     YJR008W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B01980p"
                     /protein_id="XP_002551877.1"
                     /db_xref="GeneID:8290705"
                     /db_xref="InterPro:IPR002737"
                     /db_xref="UniProtKB/TrEMBL:C5DCC8"
                     /translation="MSVRPASHAGSWYSTNSGKLGLQLQQYLGQGLPVAGARVIISPH
                     AGYAYCGATMGKVYAALDLTNVKRIFVLGPSHHIYFKNRAHVSNFKEVATPLGSLPVD
                     IATVKELVEDEAFEYMDPEVDVEEHSLEMQFPMLRALLKLRGVDTASVGVVPIMISHN
                     STRSDQHLGKVLSEYLADQSTVFIISSDFCHWGRRFSFTGYVGDKSEIQEALAEDTEI
                     ESLTARSKLSHHQVPIWKSIEILDQYAMSILSQTEPRDKYELWKHYLEVTGNTICGEK
                     AISVMLCALSHQAEPAVFQWPAYAQSSQVTSVMDSSVSYGGGYCKI"
     gene            complement(<157328..>158236)
                     /locus_tag="KLTH0B02002g"
                     /db_xref="GeneID:8290706"
     mRNA            complement(<157328..>158236)
                     /locus_tag="KLTH0B02002g"
                     /product="KLTH0B02002p"
                     /transcript_id="XM_002551832.1"
                     /db_xref="GeneID:8290706"
     CDS             complement(157328..158236)
                     /locus_tag="KLTH0B02002g"
                     /note="highly similar to uniprot|P20459 Saccharomyces
                     cerevisiae YJR007W SUI2 Alpha subunit of the translation
                     initiation factor eIF2 involved in the identification of
                     the start codon phosphorylation of Ser51 is required for
                     regulation of translation by inhibiting the exchange of
                     GDP for GTP"
                     /codon_start=1
                     /product="KLTH0B02002p"
                     /protein_id="XP_002551878.1"
                     /db_xref="GeneID:8290706"
                     /db_xref="GOA:C5DCC9"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR011488"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="InterPro:IPR024054"
                     /db_xref="InterPro:IPR024055"
                     /db_xref="UniProtKB/TrEMBL:C5DCC9"
                     /translation="MSTSNCRFYENKYPEVDDVVMVNVQQIAEMGAYVKLLEYDNIEG
                     MVLLSELSRRRIRSIQKLIRVGRNEVVVVLRVDKEKGYIDLSKRRVSSEDIIKCEERY
                     QKSKAVHSILRHCAEKFSFPLEDLYKSIAWPLSRKYGHAYDAFKLSIVDETVFEGIEP
                     PSKEIFEELRLYISRRLTPQAVKIRADIEVSCFSYEGIDAIKAALKAAEEMSTEQMQI
                     KAKLVAAPLYVLTTQALEKQHGIELLEKAIEKITKVITSHDGFCNITMAPKAVTATED
                     AELQALLENKALENGSDSEEEDSDYE"
     gene            complement(<158779..>163020)
                     /locus_tag="KLTH0B02024g"
                     /db_xref="GeneID:8290707"
     mRNA            complement(<158779..>163020)
                     /locus_tag="KLTH0B02024g"
                     /product="KLTH0B02024p"
                     /transcript_id="XM_002551833.1"
                     /db_xref="GeneID:8290707"
     CDS             complement(158779..163020)
                     /locus_tag="KLTH0B02024g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B02024p"
                     /protein_id="XP_002551879.1"
                     /db_xref="GeneID:8290707"
                     /db_xref="GOA:C5DCD0"
                     /db_xref="InterPro:IPR000331"
                     /db_xref="InterPro:IPR003913"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR018515"
                     /db_xref="InterPro:IPR024584"
                     /db_xref="UniProtKB/TrEMBL:C5DCD0"
                     /translation="MAPPLIYKAYTSGLKRELFRTLSGNFKSTPTPSNYEQCAVTKEP
                     LHAQKLIPLIADRASGYSSRARLVKEIIPELSFLSAESVLELWDGANDLIAPEIPSST
                     RAYGLDLLHACIERLLPVMSETLRLAFFYNIMDNCGVADEKAGKAEKELHKVIKSLDA
                     LTCHGTRLESILRADESTCGLEDFFESIFASISVGGEPKPPHQTVVSALRFAESCARH
                     GVPITDELISCVVTISRGWDENEVRKGALDLLKAAFSERPVESKELSRSVLQALLTIY
                     HENNELSDSVTETLHLALSGQNGTQLLPLFLDMGFFDGGNTDVSYISLLVSLLTVDNV
                     EGLWQKCGSSPRHIAELLLRLLRQEFNKHSSSNISASQLFGNILCLLESEEFLRWISK
                     FRGFWLVSEEEPSIQDLLTPFLQKVELDDLDVKYLRMIFNQILNISQSGNYKLFGINE
                     FKDIFEFLFAYSRHLNDSLANQLLDLLDQSTSDAVLVDGLVHDIITRVYLADFGTNVR
                     CRTLEVIEKCCYEIISKRKQWDSSLCRSLKHLFSMLETEKDNTVALKQIEIYCETCRY
                     LPSGFIAAVNSEVFGQAFTKPSSRRRSSLIPLSLGSSPAPAWSEVKLIKLTEGLAGLL
                     VWCIAFERGDCFGSFYRLLTKAAQYAYQTAQSELFLASARVLSKVYCGNSRQVVFQET
                     NDVEGITIALNKNSRAASTLENNGWSYPETIIYFNEAQSKVLKCDAYSPELVKDDFVT
                     PGAVDIRTWISTAIDMIGNPTTWEVYSYLLTFMCPQFANLVALRSIDDLVGLYRDVIC
                     RHMKSGLPSKLKIPSGLCTDNLHAVYVRSLSPLLAYHSYLPKDFTDGIVESLLYGLHT
                     KDSTLTLSLHLLTICCQEIPGSVKKLLTPILVQLQTRVTSSMCTPAILEFLLALSNSP
                     FITSHLTADEFKRVFAIAFKFIQSSRDLKERAQTQNIIQQISYLEQAADSSPSTHSFK
                     ITASVAHFFLTLSYKVISSWFLRMKLSNRVELAPFVVKCLVSSASEAESKDYDVSAHI
                     DIISHLTATPHGPSFPHRINEDRANESNDGYDFGRWILSDKIVSIETDIQTGDSVITM
                     RSPSSSEVFKLQFERSQIPKPYDIFRIGQEEEEEPSTEKFEQFKFTASFVLTQLGCVG
                     RHPVKVPDDSSIARSVHLFDKTPVSEYHKIGLIYVGPQQDSEAEVLSNTNGSYQYKLF
                     LSRLGHLVKLKDCMNVYTGGLEPDVDGEFALVYNAEKTQAVFHAATLMPNNPQDDQYS
                     MKKRHIGNNFVTIFFDESGSASFDFNIIKSQFNFINIVIKPYQATDTGKGSKHFKVRM
                     YRKAGVPAFFSTSHFKILSAENLAKYVRHVSLIADTFSTCWFSASAPEVCTTWARRAK
                     QMSSIREKTLKWYEGHGEPVSPPDFASVVEAAGGL"
     gene            complement(<163199..>164968)
                     /locus_tag="KLTH0B02046g"
                     /db_xref="GeneID:8290708"
     mRNA            complement(<163199..>164968)
                     /locus_tag="KLTH0B02046g"
                     /product="KLTH0B02046p"
                     /transcript_id="XM_002551834.1"
                     /db_xref="GeneID:8290708"
     CDS             complement(163199..164968)
                     /locus_tag="KLTH0B02046g"
                     /note="similar to uniprot|P06775 Saccharomyces cerevisiae
                     YGR191W HIP1 High-affinity histidine permease also
                     involved in the transport of manganese ions"
                     /codon_start=1
                     /product="KLTH0B02046p"
                     /protein_id="XP_002551880.1"
                     /db_xref="GeneID:8290708"
                     /db_xref="GOA:C5DCD1"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="InterPro:IPR004762"
                     /db_xref="InterPro:IPR004840"
                     /db_xref="InterPro:IPR004841"
                     /db_xref="UniProtKB/TrEMBL:C5DCD1"
                     /translation="MAESRSTWQRMIDSFKPAETQPSRLRSARSRYDSADDRADSKQK
                     DLMSGSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAAL
                     TTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLN
                     YLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVL
                     SMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVGHTAGDRFHGLCSVFVT
                     AAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRL
                     LNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQ
                     IGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCW
                     FAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWTSLFPGG
                     GEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLELMKD
                     EKRIEEQAMRQKSLFARFIHLWC"
     gene            165854..165956
                     /locus_tag="KLTH0B02068r"
                     /db_xref="GeneID:8290709"
     tRNA            join(165854..165889,165921..165956)
                     /locus_tag="KLTH0B02068r"
                     /product="tRNA-Trp"
                     /note="tRNA-Trp (CCA) cove"
                     /db_xref="GeneID:8290709"
     gene            <166400..>167779
                     /locus_tag="KLTH0B02090g"
                     /db_xref="GeneID:8290710"
     mRNA            <166400..>167779
                     /locus_tag="KLTH0B02090g"
                     /product="KLTH0B02090p"
                     /transcript_id="XM_002551835.1"
                     /db_xref="GeneID:8290710"
     CDS             166400..167779
                     /locus_tag="KLTH0B02090g"
                     /note="highly similar to uniprot|P53301 Saccharomyces
                     cerevisiae YGR189C CRH1 Putative glycosidase of the cell
                     wall may have a role in cell wall architecture"
                     /codon_start=1
                     /product="KLTH0B02090p"
                     /protein_id="XP_002551881.1"
                     /db_xref="GeneID:8290710"
                     /db_xref="GOA:C5DCD2"
                     /db_xref="InterPro:IPR000757"
                     /db_xref="InterPro:IPR013320"
                     /db_xref="InterPro:IPR017168"
                     /db_xref="UniProtKB/TrEMBL:C5DCD2"
                     /translation="MVQVNKILTGIVGGAGLALAADSCNPLKSSGCSADAALAGSFSE
                     DFTSEPAHFKKTEYATGIIDYSDSGMNMTIAKRYDNPSLKSDFYIMYGKVEVELKAAP
                     GQGIVSSFYLQSDDLDEIDLEWVGGDTTQFQTNYFSKGNTATYDRGAFHSAASPQETF
                     HNYTIDWAMDKTVFYLDGVAVRTLTNDSSQGYPESPMYVMMGSWAGGDSDNAPGTIEW
                     AGGLTDYTQAPFSMFIKRVIVSDYSSGEEYSYNGQSGSWESIEAKNGEVYGRYDQAQS
                     EFAALAGGESISSSATVHSSSTSSASRSASSTASSTSNSSSTVSSTSSTSSSASTTLS
                     SSSKAGYNSTSSAAPSSTSSLSSVSSKASTSSSAASTKASASSSVSSSAASSKASASA
                     SASSTAAAASSKVSAATTTSASSTLATSTAEAASSSTSEYLAIATTNGAFALQSKLSS
                     FLAALVFLI"
     gene            complement(167943..168015)
                     /locus_tag="KLTH0B02112r"
                     /db_xref="GeneID:8290711"
     tRNA            complement(167943..168015)
                     /locus_tag="KLTH0B02112r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8290711"
     gene            <168159..>168626
                     /locus_tag="KLTH0B02134g"
                     /db_xref="GeneID:8290712"
     mRNA            <168159..>168626
                     /locus_tag="KLTH0B02134g"
                     /product="KLTH0B02134p"
                     /transcript_id="XM_002551836.1"
                     /db_xref="GeneID:8290712"
     CDS             168159..168626
                     /locus_tag="KLTH0B02134g"
                     /note="similar to uniprot|P47076 Saccharomyces cerevisiae
                     YJL011C RPC17 RNA polymerase III subunit C17 physically
                     interacts with C31 C11 and TFIIIB70 may be involved in the
                     recruitment of pol III by the preinitiation complex"
                     /codon_start=1
                     /product="KLTH0B02134p"
                     /protein_id="XP_002551882.1"
                     /db_xref="GeneID:8290712"
                     /db_xref="GOA:C5DCD3"
                     /db_xref="InterPro:IPR005574"
                     /db_xref="InterPro:IPR010997"
                     /db_xref="UniProtKB/TrEMBL:C5DCD3"
                     /translation="MKIESVRDAFLSDYEVLQFLSQLERRHDWGLNQDDELAAGNNRK
                     RKRRPYNHPELQAITRDTIRYLSEAKGAADAEESEAGAGDTKSPLTKLNDKKFAELMT
                     QLNQFSLFKAEKLQIVNQLPTNLVHLYAIVEECDSRFSEEQSGQILEIVRNAC"
     gene            <169117..>171258
                     /locus_tag="KLTH0B02156g"
                     /db_xref="GeneID:8290713"
     mRNA            <169117..>171258
                     /locus_tag="KLTH0B02156g"
                     /product="KLTH0B02156p"
                     /transcript_id="XM_002551837.1"
                     /db_xref="GeneID:8290713"
     CDS             169117..171258
                     /locus_tag="KLTH0B02156g"
                     /note="highly similar to uniprot|P47075 Saccharomyces
                     cerevisiae YJL012C VTC4 Phosphate metabolism transcription
                     is regulated by PHO system polyphosphate synthetase
                     (putative)"
                     /codon_start=1
                     /product="KLTH0B02156p"
                     /protein_id="XP_002551883.1"
                     /db_xref="GeneID:8290713"
                     /db_xref="InterPro:IPR003807"
                     /db_xref="InterPro:IPR004331"
                     /db_xref="InterPro:IPR018966"
                     /db_xref="UniProtKB/TrEMBL:C5DCD4"
                     /translation="MKFGEQLNRSLIREYSYYYICYDDLKTELEENLESNNGEWSEAL
                     ETQFLESLEVELDKVYTFCKVKHNEVVRRVKEAQEQVHMTVRAIESNAPPSELDFEIL
                     EEELSDIIADVHDLAKFARLNYTGFQKIIKKHDKKTKFILKPVFQVRLDAKPFFKENY
                     DDLVVKISQLYDLVRTRGNPIKGDSSSGGKQQNFIRQTTKYWVHPDNITELKLIILKH
                     LPVLVFNTNKEFEKEDSAITSIYYDNENLDLYYGRLRKDEGAEAHRLRWYGGMSSDTI
                     FVERKTHREDWTGEKSVKARFALKERYVNDFMHGNYTVEQAFAKMRKDGKKSLKEIEN
                     LEALATEIQYTMLKKKLRPVVRSFYNRTAFQLPGDARVRISLDTELSMVREDNFDGYD
                     RTKGNWRRMDIGVDWPFKQLPEKDICRFPYAVLEVKLQTQLGQEPPEWVRELVGSHLV
                     EPVPKFSKFIHGVATLLNNKVESIPFWLPQMDVDIRKPPIPTHINISRPGRSDNDSDD
                     DLYTNESHPAGNLMDPEERVGYGAIEGGDPQNSQPAADQHSASAVLQRKARNASNPVT
                     RMFYQVGAAVDHYLHGDQVTKVPQGTVFDTEVRAPPGKTICVPVRVEPKVYFATERTF
                     LSWMSIGLIFNGVAISMLTYGTRTTMVASVGFFLTALVTIIYNAYVYCKRVVNIRLKR
                     AIDYQDKVGPPLVCACLLASTIFSFYCKLAS"
     gene            <171582..>174551
                     /locus_tag="KLTH0B02178g"
                     /db_xref="GeneID:8290714"
     mRNA            <171582..>174551
                     /locus_tag="KLTH0B02178g"
                     /product="KLTH0B02178p"
                     /transcript_id="XM_002551838.1"
                     /db_xref="GeneID:8290714"
     CDS             171582..174551
                     /locus_tag="KLTH0B02178g"
                     /note="similar to uniprot|P41695 Saccharomyces cerevisiae
                     YGR188C BUB1 Protein kinase that forms a complex with
                     Mad1p and Bub3p that is crucial in the checkpoint
                     mechanism required to prevent cell cycle progression into
                     anaphase in the presence of spindle damage associates with
                     centromere DNA via Skp1p"
                     /codon_start=1
                     /product="KLTH0B02178p"
                     /protein_id="XP_002551884.1"
                     /db_xref="GeneID:8290714"
                     /db_xref="GOA:C5DCD5"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR012572"
                     /db_xref="InterPro:IPR013212"
                     /db_xref="InterPro:IPR015661"
                     /db_xref="UniProtKB/TrEMBL:C5DCD5"
                     /translation="MSIGKAPVTNFDVIEVEKENIVPLRSGRSAAALSRSLKVRSDAG
                     AGTKVSEIRLEFEKRILHELDELDDPLELYLDYINWINNAYPQGGQSKQSGMLEVLER
                     CLMYFKDFDTYKNDPRYLKLWLWYLELFAGSESEKQSLFVFMMRKQIGSKLSLFYEEL
                     AAFLEKQQDLPQAKDVLARGIENNARPLGRLRRTSQRFDERMRDMSVDVPSVPHGGSI
                     LDGELPSIVLGRARGQIEEASLKSKPSHSASAKHEIFKDVAGTDQFDDLKKEGWDHLD
                     GRAQRNKENEASKQLLAPGVNLGTLKQEGSTKISVNRVPIFKDSIGRSGPIYKILEIP
                     GRKPEKIDCNFDLVYPTKNQEYCFEELLAMSRGIYHKRPKAKRVLEIETIDISDNHSR
                     ERPSKQQKKALKEISPPPEAYRPSAQESQISNENDNLQDFKAVERTSILPLNDEPTLH
                     YGTQKKSAPSSPTVTFFSKDAIEEVYSMFNQNFSEPNRHLDNDDTTSKFAAFENFTQE
                     FTRKTIDDLTEVKQKIQSEQVNETPQKNENVPHGIEAPTEVSKETTTPSYKSKLQEYM
                     TPIQERSESSFKLASNSNEEYDNEVTKNNTITNTAESSPFLTQPQRLQLSLEHEPLII
                     ENPLSNETRSAQLSTMEPPLSAYPNFYHYNQSLKMSALLKKIHTASKNANKNPIVDFK
                     KTNELYCIRSQLGQGGFATVYLAESSTGSLKALKVEKPASIWEFYILKQVEKRLAGQQ
                     ILASIINVDSLHCFEDESYLVLNYASQGTMLDLINLEKERNGGPLDESLCMYFAVELM
                     KVLEYIHNVGIIHGDLKPDNCMVRFEENPEALSDYDASGNGGWDRKGVYLIDFGRSFD
                     LTLFPSGTRFKANWKTDQQDCSEMREGRPWTFEADYYGLAGIIHAMLFGKFIETRLLP
                     NQTYALTNSFKRYWRQDLWAPLFDVLINSGNSTKLPITSTIREHRLAFEASLEESGGR
                     LRSQVLSLESDLQRLRK"
     gene            complement(<174660..>176267)
                     /locus_tag="KLTH0B02200g"
                     /db_xref="GeneID:8290715"
     mRNA            complement(<174660..>176267)
                     /locus_tag="KLTH0B02200g"
                     /product="KLTH0B02200p"
                     /transcript_id="XM_002551839.1"
                     /db_xref="GeneID:8290715"
     CDS             complement(174660..176267)
                     /locus_tag="KLTH0B02200g"
                     /note="highly similar to uniprot|P39077 Saccharomyces
                     cerevisiae YJL014W CCT3 Subunit of the cytosolic
                     chaperonin Cct ring complex related to Tcp1p required for
                     the assembly of actin and tubulins in vivo"
                     /codon_start=1
                     /product="KLTH0B02200p"
                     /protein_id="XP_002551885.1"
                     /db_xref="GeneID:8290715"
                     /db_xref="GOA:C5DCD6"
                     /db_xref="InterPro:IPR002194"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012719"
                     /db_xref="InterPro:IPR017998"
                     /db_xref="InterPro:IPR027409"
                     /db_xref="InterPro:IPR027410"
                     /db_xref="InterPro:IPR027413"
                     /db_xref="UniProtKB/TrEMBL:C5DCD6"
                     /translation="MQAPVVFMNTSQERTTGREAQISNITAAKAVADVIRTCLGPKAM
                     LKMLLDPMGGLVLTNDGHAILREIDVAHPAAKSMLELSRTQDEEVGDGTTTVIILAGE
                     ILAQCAPYIIEKNIHPVIIIQALKRALSDALEVVKQVSRPVDVENTEAMNKLIQAAIG
                     TKYVNHWSEKMCDLALSAVRTVRVDQGAVDDDTNRYEIDIKRYVRVEKIPGGDVLDSR
                     VLEGVMLNKDVVHPKMSRYIENPRVVLLDCPLEYKKGESQTNIEITREEDWNRILQIE
                     EEQVQYMCEQILSVKPDLVITEKGVSDLAQHFLLKGGCSVLRRTKKSDNNRIARVTGA
                     TIVNRVEDLKESDVGTRCGVFKVELIGDEYFTFLDKCKDPQACTVMLRGASKDILNEI
                     ERNLQDAMAVARNVMLSPSLSPGGGATEMAVSVKLAEKAKQLEGIQQWPYQAVADAME
                     CIPRTLIQNAGGNPIRILSQLRSKHAQGNYTAGIDGDAGKVTDMVEYGVWEPEVIKQQ
                     SIKTAIESACLLLRVDDIVSGVRKQEE"
     gene            complement(<176446..>178038)
                     /locus_tag="KLTH0B02222g"
                     /db_xref="GeneID:8290716"
     mRNA            complement(<176446..>178038)
                     /locus_tag="KLTH0B02222g"
                     /product="KLTH0B02222p"
                     /transcript_id="XM_002551840.1"
                     /db_xref="GeneID:8290716"
     CDS             complement(176446..178038)
                     /locus_tag="KLTH0B02222g"
                     /note="weakly similar to uniprot|P47072 Saccharomyces
                     cerevisiae YJL016W"
                     /codon_start=1
                     /product="KLTH0B02222p"
                     /protein_id="XP_002551886.1"
                     /db_xref="GeneID:8290716"
                     /db_xref="UniProtKB/TrEMBL:C5DCD7"
                     /translation="MKSFLGLTKLGNSGRKKVAPDQFSHIKSGMETMGTQDYEPLKPL
                     LILLDCQKRKPYVSWDEGNELLLQVRGLTEVLPVRSLALQGTQLRVIVEPEDNGYDNV
                     MVLDVANGVSPSGWKLGQTSLELNDGAMVFLCRSVEAQAHLQFLYDMCMLSRFESMSL
                     YKALTATVISTHGSRISDISSILMSQRSYKDWCYISINGEWVKAWCHVDRSPKHSDSR
                     KGRHQVKFFRDDKSLTAKNLICYIPDCGDIEDLFFVEDQSADLTQGSPDDGFGDLHFQ
                     NHLNSVRDQKVPLQMSLEPLLTRLTTLRFIGDVYWPAPSSNSTSSRSRSSTVLSFGAG
                     NSNNESPKKSRDRRAMSTSSTSMFTSPKKSVKHTRTRSTASVTSTVHHADVNDACAIT
                     SELLIKPIPHSGVTHLESLIRAALPMMGCLSLYGRPVHFKNTREDIDSLLFALPKLPV
                     IDYFAAEELPLLFQYVGSVNSTAGSLNKTLTAYKRFLHERLQEPGRDKRSFTTLSDLL
                     QNNSKNTYGVGSSRSTSSSPLM"
     gene            complement(<178507..>180393)
                     /locus_tag="KLTH0B02244g"
                     /db_xref="GeneID:8290717"
     mRNA            complement(<178507..>180393)
                     /locus_tag="KLTH0B02244g"
                     /product="KLTH0B02244p"
                     /transcript_id="XM_002551841.1"
                     /db_xref="GeneID:8290717"
     CDS             complement(178507..180393)
                     /locus_tag="KLTH0B02244g"
                     /note="weakly similar to uniprot|P47069 Saccharomyces
                     cerevisiae YJL019W MPS3 Essential integral membrane
                     protein required for spindle pole body duplication and for
                     nuclear fusion localizes to the spindle pole body half
                     bridge interacts with DnaJ-like chaperone Jem1p and with
                     centrin homolog Cdc31p"
                     /codon_start=1
                     /product="KLTH0B02244p"
                     /protein_id="XP_002551887.1"
                     /db_xref="GeneID:8290717"
                     /db_xref="InterPro:IPR012919"
                     /db_xref="UniProtKB/TrEMBL:C5DCD8"
                     /translation="MDTSTHSRGFYNSKTEDAYNQMLADRRSERSAQISDSDDSVSAD
                     FSNEMLDFSNSSSHSDLGINEDYEHFKTSLLQDDWGEPLEDDDDEDYTEEADQSFIME
                     SDAAEALSRGPDYHIKSFSTWIRGSLVPLVASLVVVVLAIMVLAPGGSPQAPEIQNAV
                     PGTNAQLRTQLNSLYREFQEEKKAAKKDLDNAIKLIILQVEKHMKQLLPRDLGSVNSQ
                     LRRLDTQVQDLSQSLSLNNVTEWQESLMHELERLLPDQIPVVLDNSTNALMVVPELHR
                     YLAEVIPQAVNRTLPRGLAAPFNYDAGQYVREILRDEYEYVDKSDFLRELDSALRVNK
                     EDILREMEARISTLENVPQQYSNVLQRKLIHKIYNANQHQWQDDVDFATVAQGTRILN
                     HLCSSTFKGHQGIPPNGVSPLDLLADTPAATSTYWLCKDKRATGSCSWAMHFAQPLYL
                     TRISYLHGRFTNNLHLMNSAPKSIAVYVKLQSPPTAEFQRIAAKHGQGAVWDRDNSFV
                     EIGSWDYDVSDARIRQYFLLPPWFVQCKPQVRSLALVVRSNHGNTHYTALRKFVINAV
                     TAQDLQLSSTYAQQRQFEIPEYASPFEDRERSRASQIAAWQRRGPSDADPAVPSFGQD
                     EYDR"
     gene            <180934..>182203
                     /locus_tag="KLTH0B02266g"
                     /db_xref="GeneID:8290718"
     mRNA            join(<180934..181515,181757..>182203)
                     /locus_tag="KLTH0B02266g"
                     /product="mitochondrial 37S ribosomal protein MRPS35"
                     /transcript_id="XM_002551842.1"
                     /db_xref="GeneID:8290718"
     CDS             join(180934..181515,181757..182203)
                     /locus_tag="KLTH0B02266g"
                     /note="similar to uniprot|P53292 Saccharomyces cerevisiae
                     YGR165W MRPS35 Mitochondrial ribosomal protein of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein MRPS35"
                     /protein_id="XP_002551888.1"
                     /db_xref="GeneID:8290718"
                     /db_xref="InterPro:IPR021036"
                     /db_xref="UniProtKB/TrEMBL:C5DCD9"
                     /translation="MLSPARSGPALQQVQLQQVRFISRRRTAYPFYAFKRLGKQHPKK
                     HDSNLKYAMRQFLGPKNFKGEYVYNKYYGVPQNHEPNYIMPEIERGQSLKDNVTGEQL
                     AIQTDGSIAPARVGAGRPRDPVSGKRKLQPFPSNRHCLTNRVLGEELKLQVHDDIQNK
                     HLSAQEVSQKYGLKIPRVEAAVKLVELEQKWEKYNRIAPSLKSMSSVLYKMFPLFVPR
                     VEVSRENLSEIPVPAKALRSRFMTIAESEPFGPIDAAKALELEPAAETLEKLATLGEH
                     SAHHASRSSAHKEKVIYGELLKGEKSLFKFENKHVGKVGFRYGSGNRDSKKDRKIGFN
                     ELGKMVYL"
     gene            <182351..>183724
                     /locus_tag="KLTH0B02288g"
                     /db_xref="GeneID:8290719"
     mRNA            <182351..>183724
                     /locus_tag="KLTH0B02288g"
                     /product="KLTH0B02288p"
                     /transcript_id="XM_002551843.1"
                     /db_xref="GeneID:8290719"
     CDS             182351..183724
                     /locus_tag="KLTH0B02288g"
                     /note="similar to uniprot|P32893 Saccharomyces cerevisiae
                     YGR166W KRE11 Protein involved in biosynthesis of cell
                     wall beta-glucans subunit of the TRAPP (transport protein
                     particle) complex which is involved in the late steps of
                     endoplasmic reticulum to Golgi transport"
                     /codon_start=1
                     /product="KLTH0B02288p"
                     /protein_id="XP_002551889.1"
                     /db_xref="GeneID:8290719"
                     /db_xref="InterPro:IPR024662"
                     /db_xref="UniProtKB/TrEMBL:C5DCE0"
                     /translation="MKILLPLDKHLDSGPESIENSHEDRKFIVFNEDLRVFFKGDQAR
                     IESISVFINEACVYSSSQPARSIKEREHDLWELHRSIVVDHIFNSNIVMNNGHKNTLR
                     IVVEYRSCAGRSTPQSARSSPDLPDLLPSFEPLNSGRTASASPQKMSMPKLQTAELAF
                     PIHSLLNARLRSVAVHTNQCIFSSLDLQSSKSCHTMMTLYDLARIRMSIKEIDYRIVR
                     NFSSVPVKPLCQLELPLEMGLWDSYSVNYQLPQTKNLDSHRVRVSLYYILEVGNYNFV
                     VRTCWETDVNVRKQSAPTALPSQPTSIISTPMLTPSMIFASSVNSLVANKLNNVKFKF
                     LTSRITCRKGFKFSLPLQIVNQSQSPLEIVVYCTNSAIQPQGQLPVEKEYQMHKRWMK
                     ITEGIVLLSSDHKLPTIPVSETFCANLEFVAIQSGYYHSIPGLKVLDLNTQEIMNVGN
                     GVKVLVE"
     gene            <184055..>184708
                     /locus_tag="KLTH0B02310g"
                     /db_xref="GeneID:8290720"
     mRNA            <184055..>184708
                     /locus_tag="KLTH0B02310g"
                     /product="KLTH0B02310p"
                     /transcript_id="XM_002551844.1"
                     /db_xref="GeneID:8290720"
     CDS             184055..184708
                     /locus_tag="KLTH0B02310g"
                     /note="similar to uniprot|P17891 Saccharomyces cerevisiae
                     YGR167W CLC1 Clathrin light chain"
                     /codon_start=1
                     /product="KLTH0B02310p"
                     /protein_id="XP_002551890.1"
                     /db_xref="GeneID:8290720"
                     /db_xref="GOA:C5DCE1"
                     /db_xref="InterPro:IPR000996"
                     /db_xref="UniProtKB/TrEMBL:C5DCE1"
                     /translation="MADKFPPLENEDFDTEVTAGQEETDFLKREAELLGDEFKTEEDS
                     EFLQENKNDELENFEEQYPALDEGAAVSKAEGQAQADDDDDFGEPQSAVSQNARATNS
                     EAIAKWKESRDKEISERDASQEKAKAELQEKAVKHMDDFYDNYNRKKEQQLKDTEAEA
                     EKFSKEREGFFNQDNTTWDRVLQLINVDDADLVAGRDRSKFKEILLKLKGNKNAPGA"
     gene            complement(<184844..>185872)
                     /locus_tag="KLTH0B02332g"
                     /db_xref="GeneID:8290721"
     mRNA            complement(<184844..>185872)
                     /locus_tag="KLTH0B02332g"
                     /product="KLTH0B02332p"
                     /transcript_id="XM_002551845.1"
                     /db_xref="GeneID:8290721"
     CDS             complement(184844..185872)
                     /locus_tag="KLTH0B02332g"
                     /note="weakly similar to uniprot|P53293 Saccharomyces
                     cerevisiae YGR168C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B02332p"
                     /protein_id="XP_002551891.1"
                     /db_xref="GeneID:8290721"
                     /db_xref="UniProtKB/TrEMBL:C5DCE2"
                     /translation="MNKALSKIIAIILSEPITMRQVLRRALAVYGLASILSLVKLRRA
                     SAGIRRALVIGIFQNASWLLALLNGYPVARKVLKNKFLSFNAALVAAMQLMLPPWVSS
                     YALVESIVDAVRNIHVSIAGSVHFDDVTSNSVRQAALSLLLPLLWKTRNARVKSLLFD
                     RKSVARDFLALFALWNTISLYSFVKSSLYKKEDRQKRRGPDTNKDRETHNALNSRVLK
                     DKFREISELRTSRGTWDKVISCCFGENLTIAAKWAIWRQLLWFLMRVEKKPCSNLQLS
                     SMLMLGFYVLDSSYSRMFVRPGVLRYLARVLVADKLQHRGDWQKTALWAGFNLSLWSK
                     IQEEGQRP"
     gene            <186128..>189772
                     /locus_tag="KLTH0B02354g"
                     /db_xref="GeneID:8290722"
     mRNA            <186128..>189772
                     /locus_tag="KLTH0B02354g"
                     /product="KLTH0B02354p"
                     /transcript_id="XM_002551846.1"
                     /db_xref="GeneID:8290722"
     CDS             186128..189772
                     /locus_tag="KLTH0B02354g"
                     /note="weakly similar to uniprot|P47068 Saccharomyces
                     cerevisiae YJL020C BBC1 Protein possibly involved in
                     assembly of actin patches interacts with an actin assembly
                     factor Las17p and with the SH3 domains of Type I myosins
                     Myo3p and Myo5p localized predominantly to cortical actin
                     patches"
                     /codon_start=1
                     /product="KLTH0B02354p"
                     /protein_id="XP_002551892.1"
                     /db_xref="GeneID:8290722"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="UniProtKB/TrEMBL:C5DCE3"
                     /translation="MEEPEPPFTVIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYF
                     GEYQDESGTYKEGIFPRSFVKLAGDEEPSKPVEDPLDRVPSPTQNPGAVASSERNSIP
                     AQEEDVYSSEQEEDPKNSAEHNAASQAASVPVPVPVPVPAPITSSVKQEKANQPLQAE
                     AGETKKAPVPIFPASFPNFGGVESGLDKSPVAPQASSADMPRDSEEDQPKMSLKQRIA
                     MLQEQQRLQQEREQELVQKKLEKKKKQERHEAAVIEASSTEALVIGEEQPEHPQEDSV
                     PSTPEESAGPQLPSSTTVANDESTSVRRDTSEQEAAEGTQATIGGAEQERQLKDHETD
                     DAESEGGHAAAEEEDEEARRAALRERMAKLAGAGRMGMPGSFNPFGIPIAPPEATAAK
                     TKKPEETSKGDKEVSNLPRAVPVMPFADPNALPMFKNKALDTSEKEALSDSSEVPKES
                     AGISDPRDEENDQGSGHVVEEVISKNGASKSAHEYAKLAAPPPPLDTPGMEADAEEEA
                     GMVENNYFGKDARHTTVQPTQSETATPVKSQTPTQSPPIEMNRSNSKSDLASDSDGYL
                     SSVEDISETGPKFPKDIPHLSKHAVKNAFSSTRSLSSGIESTGDGTEANLGQNKEGGF
                     DVVKAAQDTRLDTATLNEYVPPHSNYLTNQHGEANIRAPPVPSAPPVPLRPSVDRVLP
                     TDGDGERPSEAFGASTSREAPPVPTGGSAPPIPVEKRAPPVPPVGGVPPIPLEKSTPQ
                     IPSSRGAPQVPTDKGVPPIPTNKGAPPVPTGKQPLPIPSEPISRSTQHSATDRGHPDV
                     PPVPSVPHAVNPIPSENLTESNSKIGSISSEADTPNQFASSTQKTPKEAPPPPPPIAT
                     KNENILEEGPKSPPPPPPPSVSQPSRRHNSVSSVGREKRNSGIPEVPRNIPPIPVATA
                     SHAPPSSAPSPSKSIPESFKNTEHSVPSSQAPSGPAGKEMKRSQTFEANLENQRPCIK
                     FDAAEEWWLTKSIPAGLIGNNRLKYLWEMDENRIEKRGKEQWVMRDFYFLFEDYSQLH
                     VTVTFNEANPQLSVKFWEEFIPRPSAGHDLEKFASKIGYKIFEQANQLINTSSRNFVP
                     KLIEGSREPAIPPIASRTFGVPLLTYSPESTLDEDALKLIRPGDILAVRRGKFQSHGK
                     LLQKTTHEIGMDAVPFAGVITEYDFSKHKFRVIEEHNGKIKQSSYRVHDMKSGKLKVY
                     RVVGRSYVGW"
     gene            complement(<189853..>191046)
                     /locus_tag="KLTH0B02376g"
                     /db_xref="GeneID:8290723"
     mRNA            complement(<189853..>191046)
                     /locus_tag="KLTH0B02376g"
                     /product="KLTH0B02376p"
                     /transcript_id="XM_002551847.1"
                     /db_xref="GeneID:8290723"
     CDS             complement(189853..191046)
                     /locus_tag="KLTH0B02376g"
                     /note="similar to uniprot|P53294 Saccharomyces cerevisiae
                     YGR169C PUS6 RNA:Psi-synthase"
                     /codon_start=1
                     /product="KLTH0B02376p"
                     /protein_id="XP_002551893.1"
                     /db_xref="GeneID:8290723"
                     /db_xref="GOA:C5DCE4"
                     /db_xref="InterPro:IPR006145"
                     /db_xref="InterPro:IPR020103"
                     /db_xref="UniProtKB/TrEMBL:C5DCE4"
                     /translation="MMGAEVYFANGLRKIKPYHHSRLSFAKGRWLDRTLLDVLSDEFR
                     ANTKEEYEKGILQKKFQIIRDGAELSVEEVLKGQIRNKDVIRTTSHKHEPPVRQWAKE
                     ENSGLGWVAGMKVVHECEDLLVIDKPSGIPIHPTGQYYQNTLVEVLKSHGKTVFPSHR
                     LDKITSGVLILTKNPHMANKIQHQIRQRTMSKIYLARVDGAFPMADTLGSLTPFESPD
                     KTQTVDSAIYTVELKKQFPAAFSPPREAKTKFYPLKYYPKSDETLVACQPITGRTHQI
                     RIHLARLGHPIVNDPFYNLKNSRYPKRLTFMLECHNWNKQANKSPSLSELFEEFLGEA
                     EKLQRSERSALTLEKCPECDASIYPDPTCEELQLFLHAWKYTDDSGSLKFETEIPKWA
                     KSGWT"
     gene            <191249..>192256
                     /locus_tag="KLTH0B02398g"
                     /db_xref="GeneID:8290724"
     mRNA            <191249..>192256
                     /locus_tag="KLTH0B02398g"
                     /product="KLTH0B02398p"
                     /transcript_id="XM_002551848.1"
                     /db_xref="GeneID:8290724"
     CDS             191249..192256
                     /locus_tag="KLTH0B02398g"
                     /note="weakly similar to uniprot|P47065 Saccharomyces
                     cerevisiae YJL023C PET130 Protein required for respiratory
                     growth"
                     /codon_start=1
                     /product="KLTH0B02398p"
                     /protein_id="XP_002551894.1"
                     /db_xref="GeneID:8290724"
                     /db_xref="UniProtKB/TrEMBL:C5DCE5"
                     /translation="MTSRLVLKELKAGFKATNKFPVTEKTSPVSKATAPKLMGDVMTL
                     GSISATNNFCKPNKRLEKPPRGERALVEVRSMLRGTNSVAQVYQNTFRIFSGQSKVYH
                     CDFFRLLYFPPEHFLSVFRKSKPAVNVRIVGEVFLNGNVSKSQGRSVANTAVYARGSR
                     IEGYGKSQDVSNLKQLQNVFANDGSNVPRNYAYLRRSLRASLNKWFIQHWMALQGPQA
                     VEEQIRRQGEAGSSAQWQYLDAQGRSKTSVAKDGFYLFQVLVFPDKTTKQEFKANVAR
                     GVKTVADLEWDDFLRSKSNKSRTWVQECNDRVRVPVMNSYLANDQMPRVLRKLQSSRA
                     K"
     gene            complement(<192399..>192665)
                     /locus_tag="KLTH0B02420g"
                     /db_xref="GeneID:8290725"
     mRNA            complement(<192399..>192665)
                     /locus_tag="KLTH0B02420g"
                     /product="KLTH0B02420p"
                     /transcript_id="XM_002551849.1"
                     /db_xref="GeneID:8290725"
     CDS             complement(192399..192665)
                     /locus_tag="KLTH0B02420g"
                     /note="some similarities with uniprot|Q3E772 Saccharomyces
                     cerevisiae YGR169C-A"
                     /codon_start=1
                     /product="KLTH0B02420p"
                     /protein_id="XP_002551895.1"
                     /db_xref="GeneID:8290725"
                     /db_xref="UniProtKB/TrEMBL:C5DCE6"
                     /translation="MGKRFSESAAKKAAGNQRKREQAAAKGRAEREKAESEEAAKWEE
                     GSKKPSTKKQLEEQKKQEKLRAKQEREELLAAEEAALGRGGKGK"
     gene            <193387..>196533
                     /locus_tag="KLTH0B02442g"
                     /db_xref="GeneID:8290726"
     mRNA            <193387..>196533
                     /locus_tag="KLTH0B02442g"
                     /product="KLTH0B02442p"
                     /transcript_id="XM_002551850.1"
                     /db_xref="GeneID:8290726"
     CDS             193387..196533
                     /locus_tag="KLTH0B02442g"
                     /note="similar to uniprot|P53037 Saccharomyces cerevisiae
                     YGR170W PSD2 Phosphatidylserine decarboxylase of the Golgi
                     and vacuolar membranes converts phosphatidylserine to
                     phosphatidylethanolamine"
                     /codon_start=1
                     /product="KLTH0B02442p"
                     /protein_id="XP_002551896.1"
                     /db_xref="GeneID:8290726"
                     /db_xref="GOA:C5DCE7"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:C5DCE7"
                     /translation="MGIIRRRSRRARLTLRVHAIQAHDVTMQNSGCNPVCLVTSNGVF
                     SRTAKLKNTTSPHWDQMLKLKLPERPTSEYLRVVVYDALASTVDESAVDEFHTRSAGL
                     NDLDSSAKYLYLGETQLSLRDLFRRKDQPTSYKFSRDAAWYPLYNKNALRFEHTDMQN
                     APAAMAVGEIQLALSLSCTKGQSLFKAFNSWQSAFSEPRSSSSMSSSISAAAKSGSDG
                     PSSSAAGSGIFDDFDEETNFDLITQDPSMDELEPTENDLEGLQFIYSKLEDEDGVEDI
                     SSSSDELEPGAQLNFTKVATALDEYDVAISRSDFDPSSGNSRVSTPPLISEDDLIDED
                     NASSSDSKESRYVRMIQTRKRRPRRPRKGNASAKFELSKRGHAAGVAYVDIDSINDLP
                     TLKNKFSKKYMMDPFIIITFGRRVFKTSWRKHSLNPVYNERLAFEVYENEMNFSLHFR
                     IIDKDNFSYHNNVAKGDVSLTDLINRQQKSEAGEEWVAMHIPLQFNKTIDSSISPPIL
                     NLKAKFVSYTDLKKHFWEKALDLLTKQETFDVIDINLLMEKLGSFSDEEIEDFFYFFG
                     KSPWAHDKLSRDEVISYLQQSKNSSGFKKLKKCPLCSGWCKSTRNVVKSKLILENDLV
                     THLSICSSNSEKKKMLKASYVSSDFASKRWFSKFLIKLTYGKYALGSNNANILVQDRD
                     TGIVLEEKISAHVKVGIRIIYNARGTESKKFKTLLRNLSIKQGRKFDNPSSVRQIDSF
                     IRFHSLDTSECEETEYKTFNEFFYRKLKPGSRSPEVENPEILLSPADCRCTVFSNIKA
                     SKEIWIKGKTFTITKLTNSYHPEIYNDASCSIGIFRLAPQDYHRFHCPCDGVIGKPQE
                     ISGEYYTVNPMAVRTELDVFGENVRVVVPIHSKEFGTILYIAVGAMMVGSIILTCKEG
                     ETVERGQELGYFKFGGSTILLVVPSQNVMFDTDLLNNSNERIETLVKVGMSIGHTPAV
                     KEHKREKRVLYSKEDIDRIKRTISVSDETVEKADNAPWEYHSLRKLAPHHHSAETTVS
                     SDPTETARELDLLSIFSD"
     gene            <196583..>198121
                     /locus_tag="KLTH0B02464g"
                     /db_xref="GeneID:8290727"
     mRNA            join(<196583..196677,196756..>198121)
                     /locus_tag="KLTH0B02464g"
                     /product="KLTH0B02464p"
                     /transcript_id="XM_002551851.1"
                     /db_xref="GeneID:8290727"
     CDS             join(196583..196677,196756..198121)
                     /locus_tag="KLTH0B02464g"
                     /note="similar to uniprot|P46957 Saccharomyces cerevisiae
                     YJR006W HYS2 DNA polymerase III (delta) 55 kDa subunit
                     essential for cell viability involved in DNA replication
                     and DNA repair"
                     /codon_start=1
                     /product="KLTH0B02464p"
                     /protein_id="XP_002551897.1"
                     /db_xref="GeneID:8290727"
                     /db_xref="GOA:C5DCE8"
                     /db_xref="InterPro:IPR007185"
                     /db_xref="InterPro:IPR024826"
                     /db_xref="UniProtKB/TrEMBL:C5DCE8"
                     /translation="MFKMLIKFRMSVMPTFIYGTVKSMDSVLRQFNESRETGEIEPRK
                     RDKLVVEPQPNEFYLKYEDRKYDEQYYSMYQYRLKVLRERVTKNCEVKWDSHFKLKNR
                     KVVKKNKVLDIQANEPCWCVGTIYCEMKYKPNILEEVVNDVYGAPDLVKGYLDEDGTD
                     EVMLEDESGRVLLVGELAKTKPLVSGTVVGILGMEADAGTFQVLDICFPSALPQTELP
                     AGSQPGKVALVSGLNANPSNPRLSLKLQLLQQYLTGDVMSPESVAEIGRLIICGNSIN
                     PVDPDQLTGCLTEAGTFFGNTLQSMPIDLMPGPRDLSDQSLPQQPLHKALFGPMISPF
                     FEESNKELFCPTTNPAWFQLNGVQLLGTSGQNIDDMCKYVLPFEPDSQENLAEANIAT
                     RMDIIEGCLRWQNIAPTAPDTLWCYPYKDEDPFVLKKWPHVFFVGNQPQFASKDVQLE
                     GGVKVKAIAVPEFSKTGQVVILDLETLDTTLVTIDM"
     gene            complement(<198167..>200032)
                     /locus_tag="KLTH0B02486g"
                     /db_xref="GeneID:8290728"
     mRNA            complement(<198167..>200032)
                     /locus_tag="KLTH0B02486g"
                     /product="KLTH0B02486p"
                     /transcript_id="XM_002551852.1"
                     /db_xref="GeneID:8290728"
     CDS             complement(198167..200032)
                     /locus_tag="KLTH0B02486g"
                     /note="similar to uniprot|P22438 Saccharomyces cerevisiae
                     YGR171C MSM1 Mitochondrial methionyl-tRNA synthetase
                     (MetRS), functions as a monomer in mitochondrial protein
                     synthesis; functions similarly to cytoplasmic MetRS
                     although the cytoplasmic form contains a zinc-binding
                     domain not found in Msm1p"
                     /codon_start=1
                     /product="KLTH0B02486p"
                     /protein_id="XP_002551898.1"
                     /db_xref="GeneID:8290728"
                     /db_xref="GOA:C5DCE9"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="UniProtKB/TrEMBL:C5DCE9"
                     /translation="MWGTSIRIVVAHSTPKGLRFWCISLFRKIINASHFKSRKPVRRT
                     STMPPSRGVPARLKGALFHITTPIFYPNARPHLGHLYSSLLCDVTKRWRAMQGYNTLF
                     TTGTDEHGLKIQNASEKNGYSNPKQFVDVLYREFVKLDQMANISYTRFIRTTDYDHVR
                     AVRELWNRCWESGYIYKGEHEGWYSISDECFYPESKVVQLQGDGQELPFGSPEIRKDG
                     KFINTETRNGVVYHSETNYFFKLSSFQNRLLTFLEKENPHFISPPSRRDQIINELRGS
                     KLRDLSISRPSSRIKWGIDVPQDPSQKIYVWFDALCNYLTSVGGLQAVLDNSPAAVKH
                     TITSQLKMPRNWWVNTTHIIGKDIAKFHAIYWPCFLMAAGIPLPKQIIVHGHWLSGGV
                     KMSKSVGNVVDPLDMILHYECDPVRWYLLENSHIEADGDFREERLHATREQIVSKWGN
                     LLNRCCSNKFNIPRAVETFASQAANPENNAATLIGTEAQESYRELIQLLQTLPELFSS
                     HMRQLETRSALKLLWDVIGKANAFVQTSTPWLKSGEEQDLIIFTAIEVVRITSILAQP
                     IMPTLSNALLDRIGVDTENRDLSRTRLGADTLYGKGSNDKGREVPIKKVNFRGTT"
     gene            complement(<200122..>200841)
                     /locus_tag="KLTH0B02508g"
                     /db_xref="GeneID:8290729"
     mRNA            complement(<200122..>200841)
                     /locus_tag="KLTH0B02508g"
                     /product="KLTH0B02508p"
                     /transcript_id="XM_002551853.1"
                     /db_xref="GeneID:8290729"
     CDS             complement(200122..200841)
                     /locus_tag="KLTH0B02508g"
                     /note="similar to uniprot|P53039 Saccharomyces cerevisiae
                     YGR172C YIP1 Golgi integral membrane protein binds to the
                     transport GTPases Ypt1p and Ypt31p"
                     /codon_start=1
                     /product="KLTH0B02508p"
                     /protein_id="XP_002551899.1"
                     /db_xref="GeneID:8290729"
                     /db_xref="GOA:C5DCF0"
                     /db_xref="InterPro:IPR006977"
                     /db_xref="UniProtKB/TrEMBL:C5DCF0"
                     /translation="MSFNNGANPQGGFGFYQPSPQFQMPQGSMNFAQQPATQAFSQDP
                     LPPGLLNALSTKGYPHELPLLEEIGINFSHILTKTKNVLQPLRRSDSLPLEIISDCDL
                     AGPLIFCLLFGTLLLAAGKVHFGYIYGVALFGTISLHTLLRLMGNEDNKAQPQQLFLR
                     TASILGYCFLPLCLLSLVGVFFPLNNMMGYALALIFVCWCTWSSSGFFTAVLQLKNAR
                     VLIAYPLSIFYSVFALMAIFV"
     gene            <201208..>202314
                     /locus_tag="KLTH0B02530g"
                     /db_xref="GeneID:8290730"
     mRNA            <201208..>202314
                     /locus_tag="KLTH0B02530g"
                     /product="KLTH0B02530p"
                     /transcript_id="XM_002551854.1"
                     /db_xref="GeneID:8290730"
     CDS             201208..202314
                     /locus_tag="KLTH0B02530g"
                     /note="highly similar to uniprot|P53295 Saccharomyces
                     cerevisiae YGR173W"
                     /codon_start=1
                     /product="KLTH0B02530p"
                     /protein_id="XP_002551900.1"
                     /db_xref="GeneID:8290730"
                     /db_xref="GOA:C5DCF1"
                     /db_xref="InterPro:IPR004095"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR006073"
                     /db_xref="InterPro:IPR006074"
                     /db_xref="InterPro:IPR012676"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCF1"
                     /translation="MGVIEKIKAIEEEMARTQKNKATEYHLGLLKGKLARFRQQLLAE
                     ETAPTGGGGTGFEVAKSGDARVVLIGYPSVGKSSLLGKVTTTKSEIAHYAFTTLTSVP
                     GVLKYQGAEVQIVDLPGIIYGASQGKGRGRQVVATARTADLILMVLDATKGAHQRESL
                     EKELEAVGIRLNKEKPNIYYKKKETGGVKVTFTSPSRANLTEEAIKMILKDYRVHNAE
                     VLVRDDKCTIDDFIDIINDQHCNYIKCLYAYNKIDAVSLEEVDRLAREPNTVVMSCEN
                     DLGLDDVVDEIWYQLNLSRVYTKKRGVKPDFSDPLVVRNASTIGDMCHSIHRDFKEKF
                     KYALVWGSSAKHSPQKCGLTHKLHDEDVVSLFTK"
     gene            202478..202559
                     /locus_tag="KLTH0B02552r"
                     /db_xref="GeneID:8290731"
     tRNA            202478..202559
                     /locus_tag="KLTH0B02552r"
                     /product="tRNA-Ser"
                     /note="tRNA-Ser (AGA) cove score=80.04"
                     /db_xref="GeneID:8290731"
     gene            complement(<202770..>203798)
                     /locus_tag="KLTH0B02574g"
                     /db_xref="GeneID:8290732"
     mRNA            complement(<202770..>203798)
                     /locus_tag="KLTH0B02574g"
                     /product="KLTH0B02574p"
                     /transcript_id="XM_002551855.1"
                     /db_xref="GeneID:8290732"
     CDS             complement(202770..203798)
                     /locus_tag="KLTH0B02574g"
                     /note="highly similar to uniprot|P43534 Saccharomyces
                     cerevisiae YFL058W THI5 Protein involved in synthesis of
                     the thiamine precursor hydroxymethylpyrimidine (HMP)
                     member of a subtelomeric gene family including THI5 THI11
                     THI12 and THI13"
                     /codon_start=1
                     /product="KLTH0B02574p"
                     /protein_id="XP_002551901.1"
                     /db_xref="GeneID:8290732"
                     /db_xref="GOA:C5DCF2"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="InterPro:IPR027939"
                     /db_xref="UniProtKB/TrEMBL:C5DCF2"
                     /translation="MSTEKITFLLNWQPAPYHIPIFLALQKGYFKEQGLDLALIEPTN
                     PSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVGSLLDEPFTGLLYMAGRGITDD
                     FQSLRGKKIGYVGEFGKIQLDELTKHYGMTPDDYTAVRCGMNVAKYIIEGKIDAGIGI
                     ECMQQVELEEYLKAQGKPATDAKMLRIDKLACLGCCCFCTILYICNDKFLAANPEKVR
                     KFLTAVKKATDFVLAHPIDAWKEYVDFKPELDNDLSFKQFQRCYAYFSSSLFNVHRDW
                     NKVTGYGKRLEILPLDYKANYTNEYLSWDEPNEVEDPLEAQRLMAIHQETCRDCGGFK
                     RLSVPLKA"
     gene            <204289..>204732
                     /locus_tag="KLTH0B02596g"
                     /db_xref="GeneID:8290733"
     mRNA            <204289..>204732
                     /locus_tag="KLTH0B02596g"
                     /product="KLTH0B02596p"
                     /transcript_id="XM_002551856.1"
                     /db_xref="GeneID:8290733"
     CDS             204289..204732
                     /locus_tag="KLTH0B02596g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B02596p"
                     /protein_id="XP_002551902.1"
                     /db_xref="GeneID:8290733"
                     /db_xref="UniProtKB/TrEMBL:C5DCF3"
                     /translation="MSILVVDMDEVRSLAQRHSIEMGLERLRVVGQYVGSWWDAGRLR
                     LEFGNVSGLASAGGRAVLDASESALERVRRARAGLVEGAVCDVRCCVMGRDVEVMELR
                     VLTLREVQALGEFLAGDAGREFMSLSSGALQHAGHDRRDDEDRAR"
     gene            complement(<204902..>205501)
                     /locus_tag="KLTH0B02618g"
                     /db_xref="GeneID:8290734"
     mRNA            complement(<204902..>205501)
                     /locus_tag="KLTH0B02618g"
                     /product="ribosome biogenesis protein RLP24"
                     /transcript_id="XM_002551857.1"
                     /db_xref="GeneID:8290734"
     CDS             complement(204902..205501)
                     /locus_tag="KLTH0B02618g"
                     /note="similar to uniprot|Q07915 Saccharomyces cerevisiae
                     YLR009W RLP24 Ribosomal Like Protein 24"
                     /codon_start=1
                     /product="ribosome biogenesis protein RLP24"
                     /protein_id="XP_002551903.1"
                     /db_xref="GeneID:8290734"
                     /db_xref="GOA:C5DCF4"
                     /db_xref="InterPro:IPR000988"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="InterPro:IPR023441"
                     /db_xref="InterPro:IPR024546"
                     /db_xref="UniProtKB/TrEMBL:C5DCF4"
                     /translation="MRVYSCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRR
                     NPRKLRWTKAFRKAAGKELAVDSTLAFAQRRNVPVRYNRELVATTLRAMARVEEIRQK
                     RERAFYKNRMRGNKEREFLRDRQLVEKNPELLNMRDVELLRTAERAERVEAASDAESE
                     EMDVDSESEHESEDESEAEAQKQKVVLTNKRKVGKKIAF"
     gene            <205524..>206159
                     /locus_tag="KLTH0B02640g"
                     /db_xref="GeneID:8290735"
     mRNA            <205524..>206159
                     /locus_tag="KLTH0B02640g"
                     /product="KLTH0B02640p"
                     /transcript_id="XM_002551858.1"
                     /db_xref="GeneID:8290735"
     CDS             205524..206159
                     /locus_tag="KLTH0B02640g"
                     /note="similar to uniprot|Q07914 Saccharomyces cerevisiae
                     YLR008C PAM18 Constituent of the mitochondrial import
                     motor associated with the presequence translocase along
                     with Ssc1p Tim44p Mge1p and Pam16p stimulates the ATPase
                     activity of Ssc1p to drive mitochondrial import contains a
                     J domain"
                     /codon_start=1
                     /product="KLTH0B02640p"
                     /protein_id="XP_002551904.1"
                     /db_xref="GeneID:8290735"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="UniProtKB/TrEMBL:C5DCF5"
                     /translation="MGCDAMRCPCRLSKNFFQLNFYSHFLPELENSLETGRRKAKWTG
                     EKDEKASNMAPIEAPQLAIPGEPSAVAPQAFNELVPATAAPVGSAKKSMDEKFDEALA
                     FMGRHPVMSGVGGFLGLYFAAGAFKSVSRMMGGGPKAAQFAKGGFDPKMNTKEALQIL
                     NLSENNLNRKKLKEVHRRIMLANHPDKGGSPYLATKINEAKDFLEKRGLRK"
     gene            complement(<206266..>207135)
                     /locus_tag="KLTH0B02662g"
                     /db_xref="GeneID:8290736"
     mRNA            complement(<206266..>207135)
                     /locus_tag="KLTH0B02662g"
                     /product="KLTH0B02662p"
                     /transcript_id="XM_002551859.1"
                     /db_xref="GeneID:8290736"
     CDS             complement(206266..207135)
                     /locus_tag="KLTH0B02662g"
                     /note="weakly similar to uniprot|Q07913 Saccharomyces
                     cerevisiae YLR007W NSE1 Essential nuclear protein required
                     for DNA repair forms a complex with Smc5p and Rhc18p"
                     /codon_start=1
                     /product="KLTH0B02662p"
                     /protein_id="XP_002551905.1"
                     /db_xref="GeneID:8290736"
                     /db_xref="GOA:C5DCF6"
                     /db_xref="InterPro:IPR011513"
                     /db_xref="InterPro:IPR014857"
                     /db_xref="UniProtKB/TrEMBL:C5DCF6"
                     /translation="MEVDAVREESGGDEAQLSYEDKGKFLLQYVLSRRGVCSEKALAK
                     ALKTLERDGEQLEDSETEAQVVKMVGRLNVRLSALDYKLVRQRDQLGAWMYAYVDVSP
                     SGDTKLATPLTIEELKYVQWCVREMLEAGQEVAEARGAKSAVERSVDEALVQSGSGRD
                     ELSAEFDSKSLRFRVSYTAGARQLFQFDDLGPLETERLLTRLCQLRWFYRTNEGHFGL
                     ATRALSELQEYLRTQYTVPVCTVCDEVALRGVKCQCAEGAWHAPCFQHYVAHVSNACA
                     RCERPVLEAIYMA"
     gene            <207260..>209047
                     /locus_tag="KLTH0B02684g"
                     /db_xref="GeneID:8290737"
     mRNA            <207260..>209047
                     /locus_tag="KLTH0B02684g"
                     /product="KLTH0B02684p"
                     /transcript_id="XM_002551860.1"
                     /db_xref="GeneID:8290737"
     CDS             207260..209047
                     /locus_tag="KLTH0B02684g"
                     /note="some similarities with uniprot|Q07084 Saccharomyces
                     cerevisiae YLR006C SSK1 Cytoplasmic response regulator
                     part of a two-component signal transducer that mediates
                     osmosensing via a phosphorelay mechanism dephosphorylated
                     form is degraded by the ubiquitin-proteasome system
                     potential Cdc28p substrate"
                     /codon_start=1
                     /product="KLTH0B02684p"
                     /protein_id="XP_002551906.1"
                     /db_xref="GeneID:8290737"
                     /db_xref="GOA:C5DCF7"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="UniProtKB/TrEMBL:C5DCF7"
                     /translation="MAQKVGFRSPVPSPSGLAVQVPHKEIRLKVWVRLDSQKLPPDTI
                     NQATAIEFEREDTIDDLKDRIFRRFRDTRWAQENDSFGIAIGCWCECGFGATSAGDLK
                     DLLLQPVPNMASNAAPIDLSHAPPYIRRTSRTCSPHAATLGTPPSYSPHPAHPSYNKL
                     QCSTQSSTPLAQLRLSVGAGNKELGGGMDGCALSPVRLGSARRLSRTATPAVGEVDPD
                     SIPHQSLLEPDELVFNVCKNLFGGVAAQTANDALVVFSNNPDIPLFDETMDGAPMVED
                     LTDYKLVVDEEQLRKLSHTNDEENIDCPKQAILLLPRGFEGDVNLPSPNVATPSASSP
                     PALEEVSPGAAISPTQRVSPVLMTSAPLVEEEIGLVPPRDPIVQREGSPFILSAMESV
                     TTESITRDKVFPKISVLVVEDNMINQAILSSFLRKHKIHYKVAKNGVEAVDRWKEGGM
                     HLILMDLEMPLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTA
                     SNSQTDKTEALLAGCNDYLTKPVNLDWLTRKITEWGCMQALIDFDDWKDNDERLNSCI
                     EQKAKASQKTTSTSNASKSTNLNKRITTS"
     gene            <209215..>211308
                     /locus_tag="KLTH0B02706g"
                     /db_xref="GeneID:8290738"
     mRNA            <209215..>211308
                     /locus_tag="KLTH0B02706g"
                     /product="KLTH0B02706p"
                     /transcript_id="XM_002551861.1"
                     /db_xref="GeneID:8290738"
     CDS             209215..211308
                     /locus_tag="KLTH0B02706g"
                     /note="similar to uniprot|P27351 Saccharomyces cerevisiae
                     YJR005W APL1 beta-adaptin large subunit of the
                     clathrin-associated protein complex"
                     /codon_start=1
                     /product="KLTH0B02706p"
                     /protein_id="XP_002551907.1"
                     /db_xref="GeneID:8290738"
                     /db_xref="GOA:C5DCF8"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016342"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="UniProtKB/TrEMBL:C5DCF8"
                     /translation="MSELRLFSKCKAYEIRAELQQTNIKKHRASATKRKDALRKIIAN
                     LSMGNFGEMALLFPDVLRFWQVEDDLEVKRICHHYLVAMAPTKSGHFATALSMVLEDF
                     NSGTEAVQILALRTLSSVPLPAYLEEASKCASAVLHQHSEPEALKKAALYALLRLAQL
                     DSERSQLLMGIVGKVLQSAKEKPSVRAHALFVLYQEEESSSETRTMGLGRDLCLSMLE
                     LLPRLNEWDNGRVLDALTANYVPQTHDDAHFMIDKALPQLQHANTSVVLNALKLIVFL
                     TNYVDRLSESIVKQLSSSVISLLNKPPELQFLVLRNVILLLLGREKPLLKVDVPYFFV
                     EFNDPIYIKDTKLEILYLLAKEDNLAQIFQELKEYATDIDIQMSRKAIRAVGNLAVKL
                     KNSVDECINLLLDLLDFEVEYIVQEIISVFKNVLRRYPEKSKLCLYKLVRFTDSVQEP
                     ESRSSMIWIITQYSSQLPNYFELFEGFSNNFLEESLEVQFTILSSTVKLFTRHPTPAT
                     EKLCINILKSSTEKLDNPDLRDRAFMYWRLLSCTQKSGGNILTMDAVREVVDGNLPLI
                     TLNSRLDPHVIEELELSIGTIVSIYLKPVNQVFRLNKPRVLPKSPALNSDKDNLEIIA
                     DDTRSHSSSFTDDSSLASRRQSSSPVKKMDDYDRPAEVVNQLKLKRKTSSATSLLSRK
                     PSVLGRKLSMKRPFG"
     gene            complement(<211394..>212266)
                     /locus_tag="KLTH0B02728g"
                     /db_xref="GeneID:8290739"
     mRNA            complement(<211394..>212266)
                     /locus_tag="KLTH0B02728g"
                     /product="KLTH0B02728p"
                     /transcript_id="XM_002551862.1"
                     /db_xref="GeneID:8290739"
     CDS             complement(211394..212266)
                     /locus_tag="KLTH0B02728g"
                     /note="similar to uniprot|Q07897 YLR003C Saccharomyces
                     cerevisiaeCMS1 Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B02728p"
                     /protein_id="XP_002551908.1"
                     /db_xref="GeneID:8290739"
                     /db_xref="UniProtKB/TrEMBL:C5DCF9"
                     /translation="MPLGDDLDDGLDYQVDSSEGENFGDVVEEQPNHSASDSENAKRP
                     HSAGEEDETAKQPQSKRQKKLAKSKVHQKKLEKLEADREQKKQLPRSSSERIAEHLGT
                     LIREKNPDLSALELEELYFKKTDFISTERYDKERSLHNILDFVNNFSKSPRAIVLSTS
                     NLRVADVFRGLGGSKNAVKLFSKNKLKEDLARVDQLLKAPSSKDRQAKNKGKKKGDAM
                     VKFFTATPGRMLKIVQETDAFFLGKDKLDIFVDASYLDPKMNTIFTSDDCTALLKVLK
                     EFLGKKSSVKILLF"
     gene            complement(<212432..>213997)
                     /locus_tag="KLTH0B02750g"
                     /db_xref="GeneID:8290740"
     mRNA            complement(<212432..>213997)
                     /locus_tag="KLTH0B02750g"
                     /product="KLTH0B02750p"
                     /transcript_id="XM_002551863.1"
                     /db_xref="GeneID:8290740"
     CDS             complement(212432..213997)
                     /locus_tag="KLTH0B02750g"
                     /note="highly similar to uniprot|Q07904 Saccharomyces
                     cerevisiae YLR004C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B02750p"
                     /protein_id="XP_002551909.1"
                     /db_xref="GeneID:8290740"
                     /db_xref="GOA:C5DCG0"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DCG0"
                     /translation="MSASLTESENSKKQITEKTNAVCTEEDADVALQYLKRAHAENVA
                     LSDESSAVDVAEKMAKNYYGSHELEPKLLRKVDFFILPFLCCTYLLMFLDKALLNYAA
                     SMGIKQHLKGDEFSNLGTIFSAAYIFAEPFVTFCIQRYPISKVMGVFITLWGAVLACH
                     SACKSYASLMIVRTLLGLFESSSAVGCIAISGMYYTKSEQSARIGFWATQAGTGYIVG
                     GLISFGFLHYHGTDFTSWQIMFLVVGLVTVLFGVITFLYLPDNVTNAWFLDEKEKIEV
                     LQHIRANQTGLENKKFKKHQLKELFFHDKLTYPMLLLTACSQISTGAIGTFSVTITQT
                     FGFDKYETALLQLPIGAITALIILITTQMLSLWGHYTLVTFSMYIPAIIGCIVMICLP
                     LSHKIGNLFALYLLYSGSCVITNIYIWNSCNTSGYSKRVFRNAITMVVYNVSCIVAPQ
                     MFRTSSAPRYIPAKIALLVTQCVCVPLQLYIGYLCKKENKKRDREQEGQVTSSYQFLD
                     LTDIENRSFRYVY"
     gene            <214541..>217132
                     /locus_tag="KLTH0B02772g"
                     /db_xref="GeneID:8290741"
     mRNA            <214541..>217132
                     /locus_tag="KLTH0B02772g"
                     /product="KLTH0B02772p"
                     /transcript_id="XM_002551864.1"
                     /db_xref="GeneID:8290741"
     CDS             214541..217132
                     /locus_tag="KLTH0B02772g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B02772p"
                     /protein_id="XP_002551910.1"
                     /db_xref="GeneID:8290741"
                     /db_xref="GOA:C5DCG1"
                     /db_xref="InterPro:IPR005887"
                     /db_xref="InterPro:IPR008928"
                     /db_xref="InterPro:IPR012939"
                     /db_xref="InterPro:IPR014718"
                     /db_xref="UniProtKB/TrEMBL:C5DCG1"
                     /translation="MNVLLSFLALSKFFLLAIAVPVRDDDLYTEMVEAQLDEEFEEQV
                     ERTEVRSSGFESSPGATGRALFGLSDGLFEEFPFLNYVDVFYGTEGGGHMFPGTTVPF
                     GMCKMGVDVLHPHSTDAYSGYHSTGDVCGISMLHESGTGGSPTYGVVSQLPLMASSAS
                     DVDTSRQIAFPRSKPDAGHIGYYRVSLSNRVTIEFSSNSRSGLYKYTFPTKHQQHHMS
                     PIVMVNVTQHLHSVKRPWWTQNFEGGYIKVDKSYKSYRGKAYFSGGWSDPGTWSVSFY
                     GVFDKPAKRVRAFHGSKAYNRLRLNLAKSLNSNMGMLFEFEKGTKVLYSHVGVSFSET
                     DGINVARQNLALNYPEENMFDLHWSVRSTAEAWDNEVFSKVNIDESKEDPIIVEKMYN
                     ALYGSHLMPSDKSGREAPWPTNEPYYDDWFTLWDTFRCLHPLLNILNTKRSADMTRSL
                     IEIWRKEGYMPDGRSASRSGRTQGGSNADIVLADAFVKGVGEGVDWQDGFSAMRSNAD
                     KSPEYILDKAAPDSTNKYGRGALNDWLELGYITRRFSRSVTRTMEYAYNDFALSVVAE
                     GLGYFELAKQYLKRSSNWQNIWNFEATTPEYDYSGFIQPKDSNGNFIEKKYNPLSCFG
                     CYWRDDEYEGKPIEYGWAVPHDIQSLKEFIGPDELFMRRLDDMFDLYGDGIADIGNEP
                     SFLTPYLFNFINAQYRTSETLGYLIDHKFLLGPKGLPGNSDAGAMQAWLWFGLVGFYP
                     IAGTDIYLITSPKITELEIQLEGNGKALIQAHNLYAEDADSEYDYDKAHSSFTRNLYI
                     SSVELNGKLINRNWFTHEELFGSNGGLLVFTMTDEPTFWDADGEYPPSRGHFQRDDIE
                     RPNRLVD"
     gene            <217284..>218696
                     /locus_tag="KLTH0B02794g"
                     /db_xref="GeneID:8290742"
     mRNA            <217284..>218696
                     /locus_tag="KLTH0B02794g"
                     /product="KLTH0B02794p"
                     /transcript_id="XM_002551865.1"
                     /db_xref="GeneID:8290742"
     CDS             217284..218696
                     /locus_tag="KLTH0B02794g"
                     /note="highly similar to uniprot|Q04673 YLR005W
                     Saccharomyces cerevisiae SSL1 Component of RNA polymerase
                     transcription factor TFIIH"
                     /codon_start=1
                     /product="KLTH0B02794p"
                     /protein_id="XP_002551911.1"
                     /db_xref="GeneID:8290742"
                     /db_xref="GOA:C5DCG2"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="InterPro:IPR004595"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR007198"
                     /db_xref="InterPro:IPR012170"
                     /db_xref="UniProtKB/TrEMBL:C5DCG2"
                     /translation="MAPIVESDSEDESLNRPKKQVRGRTSKGKKHVRIEEDYNEDGHS
                     MSEDDENLFSEDEADSGPSNGRKKKKLANKNLQGANGGYAWEEDIQRSWDLVKVDDEG
                     NMAALVSSIIEARKKRASNKNLTPFQRGIIRTMVLVLDCSDAMMEKDLRPNRYAMTIQ
                     YAINFVHEFFDQNPISQIGIVCMRNDLAQLVSQVSGNPQDHIDALKAIRKQEPKGNSS
                     LQNALEMARGLLLHVPAHCTREVLIIFGALSSTDPGDIHQTIASLVQERIRVRVIGLS
                     AQVAICKELCKQTNYGDNSFYGVILNEVHFKDLFAEAVTPLPVNKINKGFTLVKMGFP
                     TRVYEDMPSFCTCHSKLMYGGYFCPNCKSKVCSLPTVCPCCDLMLILSTHLARSYHHL
                     MPLKTFQEVDVAETFPTDTCYSCQKRFPRLKNQKTQELLTSSRYRCADCHQDFCIDCD
                     VFIHEILHNCPGCESQPGIW"
     gene            <219220..>220971
                     /locus_tag="KLTH0B02816g"
                     /db_xref="GeneID:8290743"
     mRNA            <219220..>220971
                     /locus_tag="KLTH0B02816g"
                     /product="KLTH0B02816p"
                     /transcript_id="XM_002551866.1"
                     /db_xref="GeneID:8290743"
     CDS             219220..220971
                     /locus_tag="KLTH0B02816g"
                     /note="highly similar to uniprot|P53389 Saccharomyces
                     cerevisiae YNR055C"
                     /codon_start=1
                     /product="KLTH0B02816p"
                     /protein_id="XP_002551912.1"
                     /db_xref="GeneID:8290743"
                     /db_xref="GOA:C5DCG3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="UniProtKB/TrEMBL:C5DCG3"
                     /translation="MDKYTNIHHPDYLPGTFNIYSSSSLENGVIYESSLRKTTEDVVL
                     IPQPSESPNDPLNWSKARKFLHFALMSFITAFTAATSNDAGAAQDSLNEFYGISYDSM
                     NTGAGVLFLGIGWSTLFLAPLANLYGRKITYIICTALGLAGAIWFGFARRTSDTIWSQ
                     LFVGISESCAEAQVQLSLSDIFFQHQLGSVLTVYILATSAGTFLGPLIAGYISALTSF
                     RWVGWIAAIISGALLIIIVFGCEETYFDRNRYVTPVSRKAHLRSGGNYDSQCSAQPLL
                     ASQDNCDEYGFKHDPKNVPNQKTEKTTEVEPSFNASIEDFKLIDGSEEKLKPYYKRVA
                     IITKSTNLRGWGVKQYFNYLGINMRMFLFPPVWLSGLFWGIQDVFLTFYLTTEDTYFP
                     EAPWNYSDYGVAIMNVPTLIGAIIGCIYAGIVSDYFVLWMARRNHGILEAEYRLYFSF
                     ATAIIGPAGLLMFGIGAARQLPWQVIYVGLGFIGFSWGCSGDIAMAYLMDCYPDMILE
                     GMVCTAIINNTISCIFTFVCSYWLDASGTENTYIALAVINFGITMLAVPMFIWGKKIR
                     QATRKWYIRSVGVRDGV"
     gene            222444..222516
                     /locus_tag="KLTH0B02838r"
                     /db_xref="GeneID:8290744"
     tRNA            222444..222516
                     /locus_tag="KLTH0B02838r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8290744"
     gene            <223097..>225583
                     /locus_tag="KLTH0B02860g"
                     /db_xref="GeneID:8290745"
     mRNA            <223097..>225583
                     /locus_tag="KLTH0B02860g"
                     /product="KLTH0B02860p"
                     /transcript_id="XM_002551867.1"
                     /db_xref="GeneID:8290745"
     CDS             223097..225583
                     /locus_tag="KLTH0B02860g"
                     /note="some similarities with uniprot|P20840 Saccharomyces
                     cerevisiae YJR004C SAG1 Alpha-agglutinin of alpha-cells
                     binds to Aga1p during agglutination N-terminal half is
                     homologous to the immunoglobulin superfamily and contains
                     binding site for a-agglutinin C-terminal half is highly
                     glycosylated and contains GPI anchor"
                     /codon_start=1
                     /product="KLTH0B02860p"
                     /protein_id="XP_002551913.1"
                     /db_xref="GeneID:8290745"
                     /db_xref="InterPro:IPR024672"
                     /db_xref="UniProtKB/TrEMBL:C5DCG4"
                     /translation="MLCRMLALVLATSFFLGHTLATQIKSVSFEGLSIDSISSQSFPH
                     KMWELSFEFTIEDVNQISESDYFLLDLPHVYRVKFSNDADYQYITMADGSDAFKCYAS
                     QQAAYKYGSSVLRCDAVRTFSSFTSLRGNLSIGAVFSNGGSSYEFELENSKYFKSGEQ
                     LVELSEKLSAVANFARAPDFDSYYYEGRTTTYGSMESYYLGLSCPDGYILGGTQVIDY
                     SPGTQPSSFDCSDAQVQLSSDFNDWFFPESYQSFSGDYVCNGATLSISFDKIDSGKRI
                     WVNNLQYLDASASTVYHSIYFDYTCTNTLSSLVYTTAVHQSPAFVIKDGVFTGSAVVD
                     ALSTSAILTTTTTTTTTWKSAYATTTTGSVSSGATVITIHVDTPGTSSTQSFSSSRSD
                     SSESIIASTSSDFSKPTTSTLTVTSCVSNRCSKLELISPSTSSIVSIVTSSPSESSTS
                     PSESSTPSSASSTSPSESSTPSSASSTSSSVSSTPSSVSSTPSSVSSTPSSESSTSPS
                     ESSTSPSESTTSTPITTFANRTSAPPSTGHYSSTISTPGFPSSARGSQSISFGTVPFT
                     ELSYSVSTSRPSSLVLTSTTLKSTSPTSSLSGSSPCLGTACFETVSFVKPSDSSPPSH
                     PASTSSTRPTMQTGTTTMEFQTSSSSISASKFTDSKLLSSGGVSKATSSFSESTAATW
                     KVTSSITKSTASSLDKSIVTTPSLTTNIIKSSETGTQSDLASSDSSQVERPGSSNGGV
                     ITSTTHLSKASSNAFLGSIAASSFSSSSDSATTTTKVSAQITSTPSLVLSSTSAFSSA
                     SFSVYEGLAARHKFQVTLGALASLVLYSFT"
     gene            <225842..>227395
                     /locus_tag="KLTH0B02882g"
                     /db_xref="GeneID:8290746"
     mRNA            <225842..>227395
                     /locus_tag="KLTH0B02882g"
                     /product="KLTH0B02882p"
                     /transcript_id="XM_002551868.1"
                     /db_xref="GeneID:8290746"
     CDS             225842..227395
                     /locus_tag="KLTH0B02882g"
                     /note="weakly similar to uniprot|P47084 Saccharomyces
                     cerevisiae YJR003C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B02882p"
                     /protein_id="XP_002551914.1"
                     /db_xref="GeneID:8290746"
                     /db_xref="UniProtKB/TrEMBL:C5DCG5"
                     /translation="MLSLRRQFSARLGLRNSAQKSLRQTYSGLLADPCFKNFNINESL
                     NDELEPYDLSASIIGKLSSLHAAPSVRETIHNRMIEALTKHDFSIGTIHTRELLKMGG
                     QLSLESFVQIINSNPGRVQSSWELFLQHYHLVNSSPEALLTVLRKLLYFDPVDIEDGK
                     KELDTRDLARCIFLMKLISSAGCLEQVPNDYWNIILEATIEGKASTLIPLITRSFMPS
                     YDSFDETQELTSYQVFQLFHDGGKRLADENLPMFKRVLSVLGRNSCIKLTPQENEVEK
                     ELEKELENISKKLHTLIPVTFPYEEVSSQSAFENMLQTVLELDKNKISKCGVYEVALR
                     SLGIYKGNLSSADKYFEEFMKVAPSEVDNMQYELFLAFIHRGVQTRDEKLLQKAVLLV
                     PQSSSKYLELSVDRALIIAYSIFDIEKALEYYNRSISSFGKAQLEGCSNSEAGLLTEA
                     LILAYLGKKDRDFAHVILEGAIGEGLFPSPYAIKSVKKTFAAYGDILDQDNSDAQLQA
                     LVLDYIKGL"
     gene            complement(<227825..>228442)
                     /locus_tag="KLTH0B02904g"
                     /db_xref="GeneID:8290747"
     mRNA            complement(<227825..>228442)
                     /locus_tag="KLTH0B02904g"
                     /product="KLTH0B02904p"
                     /transcript_id="XM_002551869.1"
                     /db_xref="GeneID:8290747"
     CDS             complement(227825..228442)
                     /locus_tag="KLTH0B02904g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B02904p"
                     /protein_id="XP_002551915.1"
                     /db_xref="GeneID:8290747"
                     /db_xref="UniProtKB/TrEMBL:C5DCG6"
                     /translation="MTFRLIMVDPSPSSKEHLDFSTEKPESVKQHDARGSSKRRKDLS
                     VVMHTFEKGRVEKVSPPCRGICTKKKNHKNAAAAKPSEKRCKKLEGVQDEEKMNSSCV
                     IPPKPLTFVTSVASDYSLEYANAWQSSLEFNSKKAQRPLFRITKYKGRKGCEKVESST
                     ELLGTIDPNFCFSYNSLNSSKEKGAKTPPMNFSTAPVFKVLLNDR"
     gene            <228615..>230591
                     /locus_tag="KLTH0B02926g"
                     /db_xref="GeneID:8290748"
     mRNA            <228615..>230591
                     /locus_tag="KLTH0B02926g"
                     /product="KLTH0B02926p"
                     /transcript_id="XM_002551870.1"
                     /db_xref="GeneID:8290748"
     CDS             228615..230591
                     /locus_tag="KLTH0B02926g"
                     /note="similar to uniprot|Q92280 Saccharomyces cerevisiae
                     YLR002C NOC3 Protein that forms a nuclear complex with
                     Noc2p that binds to 66S ribosomal precursors to mediate
                     their intranuclear transport also binds to chromatin to
                     promote the association of DNA replication factors and
                     replication initiation"
                     /codon_start=1
                     /product="KLTH0B02926p"
                     /protein_id="XP_002551916.1"
                     /db_xref="GeneID:8290748"
                     /db_xref="InterPro:IPR005612"
                     /db_xref="InterPro:IPR011501"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR016903"
                     /db_xref="UniProtKB/TrEMBL:C5DCG7"
                     /translation="MGSKKRSQRVAEDKASKRRKEQDSLLEGGIFTREDVQEIEDSIP
                     AKKSWDDEEQDYERKPRKLAGYPEDNIEQLPIKIGAKVERRIVRAPKVEPESNNDDSE
                     DVDLMKNDDEEQSTEADDSAVADSPEAVLQLKEQIAELVENIMEDAEENVGSLTRLRK
                     MAQSKNSNTCKFSLLALIPVFKSVIPSYKIRPLSDAEKKEKVSKEVAKLRNFEEHLVR
                     NYKEYIDLLSKLAKTPNSADQKQVAMGNLAANALVELLPSASNFNFSTEVFTAIIRRI
                     CKPNPLADPVYQKMVKALETLLNEDDDGRNSLEIVRILAKTIKSRSYMIDESVLNILL
                     SLDVLQDFDPNTKDEDFTKVKVKKKDRAHLSKKQRKVRKEMKKVEEEMQKAEQTVLAE
                     EREKNQAEILKFTLSLYLNILKSNVAKLIGSVLEGLSKFGHMANFDLLGDFLEVMREL
                     IANSELDNLSPLEVRKVLLCIVTAFSLVSRHSQMKLSMDLTSFVDALYSVIPNLSVDA
                     EIEYSHKTLRLADPLGSDLVKPSVNVSTKAELLLRALDHVFFRSRSGSKVRAAAFAKR
                     LYVAMLATPEKTSIAILKFLEKLMDKYPEVGGLYSTEDRIGNGNFKLQAETPARSNAE
                     AATIWENILLLKHYSPAVIKGTKALLEKSRGSLK"
     gene            complement(<230675..>232498)
                     /locus_tag="KLTH0B02948g"
                     /db_xref="GeneID:8290749"
     mRNA            complement(<230675..>232498)
                     /locus_tag="KLTH0B02948g"
                     /product="KLTH0B02948p"
                     /transcript_id="XM_002551871.1"
                     /db_xref="GeneID:8290749"
     CDS             complement(230675..232498)
                     /locus_tag="KLTH0B02948g"
                     /note="weakly similar to uniprot|P47083 Saccharomyces
                     cerevisiae YJR002W MPP10 Component of the SSU processome,
                     which is required for pre-18S rRNA processing, interacts
                     with and controls the stability of Imp3p and Imp4p"
                     /codon_start=1
                     /product="KLTH0B02948p"
                     /protein_id="XP_002551917.1"
                     /db_xref="GeneID:8290749"
                     /db_xref="GOA:C5DCG8"
                     /db_xref="InterPro:IPR007151"
                     /db_xref="InterPro:IPR012173"
                     /db_xref="UniProtKB/TrEMBL:C5DCG8"
                     /translation="MTSFINKISDNPISIISENEDTSTDSLRLVKTYIDDVILSQKAL
                     DGKVLLDEIVVEGLDANQIWQQVRLVLENSGPKLMGKISTIRTSLAEVNESDEEISSS
                     ESSEVEENKEEELEGMNEFDSDESEKVDAIITTGQSAGLPINNSDDEYHSEVREGHNS
                     NRGSGDEGSEEEEGGANNSDGAEEITVGPKKDSFGLNDEFFDLEEFNRQTIDNENTAE
                     PDNEINYFEDVPSEEDEEVLYYDDFFDKPSSSKRKVTSGGDKQVKFGEHGEDFHENSD
                     DEYDRAMESAKLDLFAEVEDDEMKPEVDPVSKLSTFQRQQLDIQRQIAQLEKEAVAEK
                     KWALKGEVKAGDRPEDALLTEDLDFERTSKPVPVITSDVTESLEDMIRRRIQQREFDD
                     LARRVEANLNFSSAKPQFELSDSKSSKSLAELYENDYNNIPQDSEVSEELKKSHAEIS
                     DLYSKLVYSLDALSSAHFIPKPAQKTLEVRVQTPAINMEDAQPLTMSTAPTLAPQEVY
                     APGASRSTNEISLKNGVVMSRDELSKDDKNRLRRALKRKRSKRLENQSGLSQKKSKKD
                     SVIQTLSSAKNVTLIDKRGDKRDVKGNIVKDGTTGRKNFKL"
     gene            complement(<232632..>234431)
                     /locus_tag="KLTH0B02970g"
                     /db_xref="GeneID:8290750"
     mRNA            complement(<232632..>234431)
                     /locus_tag="KLTH0B02970g"
                     /product="KLTH0B02970p"
                     /transcript_id="XM_002551872.1"
                     /db_xref="GeneID:8290750"
     CDS             complement(232632..234431)
                     /locus_tag="KLTH0B02970g"
                     /note="similar to uniprot|P47082 Saccharomyces cerevisiae
                     YJR001W AVT1 Vacuolar transporter imports large neutral
                     amino acids into the vacuole member of a family of seven
                     S. cerevisiae genes (AVT1-7) related to vesicular
                     GABA-glycine transporters"
                     /codon_start=1
                     /product="KLTH0B02970p"
                     /protein_id="XP_002551918.1"
                     /db_xref="GeneID:8290750"
                     /db_xref="GOA:C5DCG9"
                     /db_xref="InterPro:IPR013057"
                     /db_xref="UniProtKB/TrEMBL:C5DCG9"
                     /translation="MPGEAGTQSSLLRHRPSQNVHYMSIPVNRASQASSPEDPGAFCD
                     NARRQSILDHPIGSFRGVNSLGRFASSLRRANSFMNIEVNTDKERSFLKDGQDALYDP
                     NTLAPSADGRRLSIALTSGRGVSVRPSVTDLTSGRFDGSAFADDQDSSSAVRSVISSD
                     QLISRRPTLCFNDFNNAIDPDTESIMLKQVERKDGKIVTLLAGQSTGPQTIFNSVNVL
                     IGIGLFALPLGMKYAGFVAGAILLFVFAGATFCSAELLSRCLDTDPTMISYGDLGAAA
                     FGPKGRALVSFLFTLDLLGSGVALIIIFGDSLNALFPKYSVNFFKLVAFFAITPQAFM
                     PLSVLSNVSLLGIASTLGTVFCIIFCGLYKSSSPGSLLNPASTSLWPENFKGFCLSIG
                     LLSACWGGHAVFPNLKSDMRHPAKFKKCLVTTYSITATADIATAIVGFLMFGTDVKDE
                     VTKSLLLTEGYPHYAYVAISALMALIPVAKAPLCARPIASVFNVLMGVSQEDTNVEGA
                     KYHFKKIVCAFNALLVNVLFVAIGIKFPEFDKFIAFLGAGLCFAICLILPCLFYMKLC
                     ADSIKPWERKACIFTILLSTVFSILGVGAALVT"
     gene            complement(<234560..>235174)
                     /locus_tag="KLTH0B02992g"
                     /db_xref="GeneID:8290751"
     mRNA            complement(<234560..>235174)
                     /locus_tag="KLTH0B02992g"
                     /product="KLTH0B02992p"
                     /transcript_id="XM_002551873.1"
                     /db_xref="GeneID:8290751"
     CDS             complement(234560..235174)
                     /locus_tag="KLTH0B02992g"
                     /note="weakly similar to uniprot|P40561 Saccharomyces
                     cerevisiae YIR001C SGN1 Cytoplasmic RNA-binding protein"
                     /codon_start=1
                     /product="KLTH0B02992p"
                     /protein_id="XP_002551919.1"
                     /db_xref="GeneID:8290751"
                     /db_xref="GOA:C5DCH0"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DCH0"
                     /translation="MSDTRWTTSYPHMNEFLSDSSQQDNKPDYYHVITEETSRLKDIE
                     KRMAENAHGAGCPGFSRFNDQSADARSVYVGNLDPSINAETLQEFFKGSVSRVNRVEI
                     QINKLTGFAKGFAFVEFAQPRDVMDAIKLSNTKLGGKPLKIVPKRPSFHQESPNRGSH
                     RMRRATTRTHPPLRGRPHGRHLHNAWRGNRRGRVRARGRGKRFI"
     gene            <235495..>238068
                     /locus_tag="KLTH0B03014g"
                     /db_xref="GeneID:8290752"
     mRNA            <235495..>238068
                     /locus_tag="KLTH0B03014g"
                     /product="KLTH0B03014p"
                     /transcript_id="XM_002551874.1"
                     /db_xref="GeneID:8290752"
     CDS             235495..238068
                     /locus_tag="KLTH0B03014g"
                     /note="weakly similar to uniprot|Q07895 Saccharomyces
                     cerevisiae YLR001C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B03014p"
                     /protein_id="XP_002551920.1"
                     /db_xref="GeneID:8290752"
                     /db_xref="InterPro:IPR000782"
                     /db_xref="UniProtKB/TrEMBL:C5DCH1"
                     /translation="MINIIWLAISVLWLKLLPFSTATPKSGDDDDFPFTTVVDYLWQN
                     AEFSTFLRVLQKDGLIPYLNELDNFTIFAPINSAFAQSNQNTVLDHYLLQNHVLDFEK
                     YGSGTHVLTLNDSRPHLIEKRTDGAWKINGVSVLKEILKPSMQNAVLYSITSLISGTL
                     ELEDLIEKSANISSFSMLLDRVVFGNLQVFDNKTLIIPKDSAFNASFNDIELEYLLGP
                     TDTAISNPHLLKTYKNRKKDQNFLFERLLVDGILGGDINKTDALNLDNELLNFESHEN
                     GTVISVNNTFSALSNQLYTKGIAHMFSKLDFLPSHLSFTAEKYLIGLGADRFVEEIYM
                     RKLDHLINGAHDRNLTIFVSVESSNEGSGFSKSSLLYHFVDDQVDLTDYALPTSSKRL
                     YDTMFCSSNKRLGGECQRLKIERSSRGKQRVLINGKYCLKSLEPIKVGNTSIYLLEND
                     VTLPADLLSSIDPFSGCSKSLHFLDELNLLELRPNNQGYTVLLPCFDSWDYFDLNLDY
                     LEHNITALNLIMKNYILNGLIYTDSKEQTLETRNFYNELIQVEILGRESDSSQFAMNL
                     STVAGPVTLKNGADTFFDRGVLHPMERVFFPKSLDITLLNLLETTKSFEFLSFLENFP
                     EFDNIVHQGKPSSILVPTSQSLLLDDISLDSSRLKEFLELHIIPANSTEALLNCQSNI
                     QTLHGEYLQCRESSSNTHLLRFKSGLDKEVRVLRKGCASTDNNTCVFVIDQPLSLSWL
                     DQARYQIGLPGIAFAVGMLLGVLGIFSLLSCTLMLFMRRRNVEDRGSGQVYNEQEGLL
                     SSQPQPQQPYSSMNMSTPPPTAAQRNSSKNDTNSRSRIFENSYSMHSSRNPVSIQQNR
                     G"
     misc_feature    complement(238187..238312)
                     /note="Centromere Klth0B"
     gene            complement(<238392..>240707)
                     /locus_tag="KLTH0B03058g"
                     /db_xref="GeneID:8290754"
     mRNA            complement(<238392..>240707)
                     /locus_tag="KLTH0B03058g"
                     /product="KLTH0B03058p"
                     /transcript_id="XM_002551875.1"
                     /db_xref="GeneID:8290754"
     CDS             complement(238392..240707)
                     /locus_tag="KLTH0B03058g"
                     /note="highly similar to uniprot|P54861 Saccharomyces
                     cerevisiae YLL001W DNM1 Dynamin-related GTPase required
                     for mitochondrial fission and the maintenance of
                     mitochondrial morphology assembles on the cytoplasmic face
                     of mitochondrial tubules at sites at which division will
                     occur also participates in endocytosis"
                     /codon_start=1
                     /product="KLTH0B03058p"
                     /protein_id="XP_002551921.1"
                     /db_xref="GeneID:8290754"
                     /db_xref="GOA:C5DCH2"
                     /db_xref="InterPro:IPR000375"
                     /db_xref="InterPro:IPR001401"
                     /db_xref="InterPro:IPR003130"
                     /db_xref="InterPro:IPR019762"
                     /db_xref="InterPro:IPR020850"
                     /db_xref="InterPro:IPR022812"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCH2"
                     /translation="MASLEDLIPTVNKLQDVMYDAGIDTLDLPVLAVIGSQSSGKSSI
                     LETLVGKDFLPRGTGIVTRRPLVLQLNNISPNSPLINEYQDIHGQNYDTSDTKGELTL
                     EDHLRKSQGFEPTTKDEWGEFLHLPGRRFYDFGEIRQEIENETARIAGKNKGISRIPI
                     NLKVFSPRVLNLTLVDLPGITKVPIGEQPADIEKQIKNLILEHVAKPNCIILAISPAN
                     VDLVNSESLKLARDVDPHGKRTIGVITKMDLMDSGTNALDILSGKLYPLKLGFVGIVN
                     RSQQDIQANRSVEEALNNEEIFFTRHPVYRTISTKCGTRYLAKLLNHILMNHIRDKLP
                     DIKARLNTLMGQTEQELATYGGSGIITKENRAGLVLQLMNKFAARFVSSIEGTSSDIS
                     TKELCGGARIYYIYNNIFGHSLESINPTSNLSTADIRTAIRNSTGPRPSLFVPELAFD
                     LLVKPQIYLLLEPSQRCVEMVYEELMKICHNCGSPELARYPKLQAKLIEVVSELLRER
                     LGPTRSYVESLIDIHRAYINTNHPNFLSATDAMSDIAEAKKNKQKATPGKSDLENAKI
                     SLVKELSRKDAELQFSNATGKEIPESSTPSEASSEEEERIPSKESKDSFLNYFFGKDQ
                     QKSGHFTKFPENGQFPGSHSFDQAENAPPSSDFEKLQINGSTTERTFDEPKLTEREEL
                     ECELIRRLIISYFGIVREMIQDQIPKAVMCLLVNFSKEIIQNRLVTKLYKESLFEELL
                     LEDQNLAQDREKCVKLLDTYKEASKIIGDIL"
     gene            complement(<240890..>242173)
                     /locus_tag="KLTH0B03080g"
                     /db_xref="GeneID:8290755"
     mRNA            complement(<240890..>242173)
                     /locus_tag="KLTH0B03080g"
                     /product="KLTH0B03080p"
                     /transcript_id="XM_002551876.1"
                     /db_xref="GeneID:8290755"
     CDS             complement(240890..242173)
                     /locus_tag="KLTH0B03080g"
                     /note="similar to uniprot|Q07794 Saccharomyces cerevisiae
                     YLL002W RTT109 Regulator of Ty1 Transposition Regulation
                     of mitochondrial network Killed in Mutagen sensitive to
                     diepoxybutane and/or mitomycin C diepoxybutane and
                     mitomycin C resistance"
                     /codon_start=1
                     /product="KLTH0B03080p"
                     /protein_id="XP_002551922.1"
                     /db_xref="GeneID:8290755"
                     /db_xref="InterPro:IPR013178"
                     /db_xref="UniProtKB/TrEMBL:C5DCH3"
                     /translation="MSSLENLLSRVLPENKKFELLHLQSPPKESHSVFVQQRSDCTQT
                     VVKVQHFFGLGADEKIFYSLELFVYLTIESSKAIEKLIFVSKADTNGYCDEKISVKDI
                     TTAILDYIVTLDPSHYLSKEIKVSGTSPGCGPSITRCTTTKRALKILKARHDSKKGDN
                     CPNRGFFRNIEGKDPDWTCKICLFTRSEPQYLFSESSRNPKKHILSGEQLLRWWLSVI
                     DKILVRHFDSGTKATLQIPGEEESRTLRYLSNNKAPFWRVGDIFSGKSSELAIFAIPV
                     FPDDPKGRFLEQVVEENRAKKVRLSDFWVELQVQQEFRLGCTVSVIGVDGRIPKKCFG
                     PHNNEVIVMPSKKVFSIVKSYIVGEQYDTSEGAYEAYANLRDFLHLRMQRSLLEIRGC
                     RKSSEPGSKGTGSDRNAPVRPLNTLTVRRKVKKSI"
     gene            complement(<242293..>243024)
                     /locus_tag="KLTH0B03102g"
                     /db_xref="GeneID:8290756"
     mRNA            complement(join(<242293..242875,242960..>243024))
                     /locus_tag="KLTH0B03102g"
                     /product="KLTH0B03102p"
                     /transcript_id="XM_002551877.1"
                     /db_xref="GeneID:8290756"
     CDS             complement(join(242293..242875,242960..243024))
                     /locus_tag="KLTH0B03102g"
                     /note="highly similar to uniprot|P38624 YJL001W
                     Saccharomyces cerevisiae PRE3 20S proteasome beta-type
                     subunit"
                     /codon_start=1
                     /product="KLTH0B03102p"
                     /protein_id="XP_002551923.1"
                     /db_xref="GeneID:8290756"
                     /db_xref="GOA:C5DCH4"
                     /db_xref="InterPro:IPR000243"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR016050"
                     /db_xref="InterPro:IPR023333"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DCH4"
                     /translation="MNGIQVDINHLKKGEVSLGTSIMAVTFRDGVILGADSRTTTGAY
                     IANRVTDKLTRVHEKVWCCRSGSAADTQAVADIVQHYLELYTAQFGEPSTKTAASIFK
                     TLCYENKDNLTAGIIVAGYDEKNKGEVYSIPLGGSVHKQKYAIAGSGSTFIYGYCDKN
                     YKENMSKDETVSFMKNSLSQAIKWDGSSGGVIRMVVLTKDGAERLIFYPEDYENL"
     gene            complement(<243194..>246085)
                     /locus_tag="KLTH0B03124g"
                     /db_xref="GeneID:8290757"
     mRNA            complement(<243194..>246085)
                     /locus_tag="KLTH0B03124g"
                     /product="KLTH0B03124p"
                     /transcript_id="XM_002551878.1"
                     /db_xref="GeneID:8290757"
     CDS             complement(243194..246085)
                     /locus_tag="KLTH0B03124g"
                     /note="weakly similar to uniprot|Q12369 Saccharomyces
                     cerevisiae YLL003W SFI1"
                     /codon_start=1
                     /product="KLTH0B03124p"
                     /protein_id="XP_002551924.1"
                     /db_xref="GeneID:8290757"
                     /db_xref="InterPro:IPR013665"
                     /db_xref="InterPro:IPR018907"
                     /db_xref="UniProtKB/TrEMBL:C5DCH5"
                     /translation="MSRLGTKASLSTRFTAQDDQLTSALIHGDSMYSTGSLLKKDIHD
                     LLKEAKASSSQFLPENNHLNPPDEPEEPLYHLPFHPAKETGYLGDLSQIFGEFDPNFT
                     SKNRAKCDDALILLLFNKTQVFLLRNGFSLDFLMILKRFVELLVEEGLNPLENESLLE
                     LQNELEKGWEITPSFVALLDTFMMNPKNIYIALALFEFKSKRHSLKINFTRWKLQTEL
                     ELNLRQLTDIWNSYIKQKHLQRWENTYRFRSEDLKGEADSFYNFKSLSNATDKWMKRM
                     DEQKIKQELADAFLIQKEFKTIQKAYTLQIRSRELALRAHSKSCLGRFFTTWRLAARL
                     KETRRQLSAPTEGLFFRKFRQKYRNLDSLSDKARILEKSLVLSPILILWKERLIQRVE
                     KTKHLEILELIFQRKMALKVLKSAFTWKEREAAAKESIHFTLLKYFFCDVWRKRLNER
                     QLFSEHTLRQDALLCCKYCTLWRNRVMVKKKANDHYQRAMSQKYFELFQLKCAYSRNE
                     RRKRESSTRLIFERWQRATELNLQLKAYESNFLRLFWRHEWKRKYANFNDLTSITIKC
                     HNSLVVKQYFFRWAKKKENYETLRSKAFLFAKTRVITKMRLVAQRVKKLDAVARKYRT
                     ESDAECKRRYMTLWLASLKVQMRLKHEILLDQYSSLTGQVLIVRYLKVWRTRTRYLRT
                     ECEEAADRLRYESLVGMMFRKALDKMRTYEQWNSVSEELNLQSVLLNHFNIFKQSYAE
                     LKQMSEYLERIRAEKDLTALVKCMNMWTMKQLKCTRNIETVEIFRNRWNRASLRAIML
                     LWKEKAETVNTSSATKLRHELYEGGDKVEDQSLVTPTRIKKSGNITIPGSERMKQNRM
                     EAMRNHYRRARKAIPSPIKFSDNLDTITKKRLEIGDRESSEPSPPPKLDLGKINKKLA
                     SRHTKISFKTIPETKFSMEASPERPPRLVVDPSFLSSRPDEVDSSPSIR"
     gene            <246188..>247645
                     /locus_tag="KLTH0B03146g"
                     /db_xref="GeneID:8290758"
     mRNA            <246188..>247645
                     /locus_tag="KLTH0B03146g"
                     /product="KLTH0B03146p"
                     /transcript_id="XM_002551879.1"
                     /db_xref="GeneID:8290758"
     CDS             246188..247645
                     /locus_tag="KLTH0B03146g"
                     /note="similar to uniprot|P41543 Saccharomyces cerevisiae
                     YJL002C OST1 Alpha subunit of the
                     oligosaccharyltransferase complex of the ER lumen which
                     catalyzes asparagine-linked glycosylation of newly
                     synthesized proteins"
                     /codon_start=1
                     /product="KLTH0B03146p"
                     /protein_id="XP_002551925.1"
                     /db_xref="GeneID:8290758"
                     /db_xref="GOA:C5DCH6"
                     /db_xref="InterPro:IPR007676"
                     /db_xref="UniProtKB/TrEMBL:C5DCH6"
                     /translation="MYYKCSSLLKTVGEMLSATRLAAIFLLFLNFVVGDLDAGIIPKL
                     WENLELHRTIDVSRSYTQELVDIRIKNIHDEPVRQYYFVLPEEVFDAISLFSSTLKGV
                     DAYIESAIMPEQNFVANGRTIKVGVIGLPSPIEPGHETSILLNLVYNSRYQPYPGHVD
                     LGEEQKLLLRTNRFPISAYNTQKYTLEFQGSSSFEELQSFNGEEHAGMVANGKMVVGP
                     FDSIMPYEDFSPIEVVFEHNTPLPRVSHLKRDIWVSHWASSLQFEEYYELINDAASLK
                     SGFSRADYMKGQHALKKGGHLTALEMILPDSSEAHYCTDLVGAVSTFKVLKDHFFLKP
                     RYPLFGNWKYNFTVGWTNQLSQFLHSQEDGSDTYILSFPILNGPADTVYDSVSLSIYL
                     PEGAEVLDVWCPLPVQKTEVTTEKSYFDLNQGHTKVNIELKNLIDRIAGSEAFVRYKV
                     TSTTFYKKPFSIAVSVFTALMAYFFLKHISLMIDS"
     gene            complement(<247739..>249631)
                     /locus_tag="KLTH0B03168g"
                     /db_xref="GeneID:8290759"
     mRNA            complement(<247739..>249631)
                     /locus_tag="KLTH0B03168g"
                     /product="KLTH0B03168p"
                     /transcript_id="XM_002551880.1"
                     /db_xref="GeneID:8290759"
     CDS             complement(247739..249631)
                     /locus_tag="KLTH0B03168g"
                     /note="similar to uniprot|P54790 Saccharomyces cerevisiae
                     YLL004W ORC3 Subunit of the origin recognition complex
                     which directs DNA replication by binding to replication
                     origins and is also involved in transcriptional silencing"
                     /codon_start=1
                     /product="KLTH0B03168p"
                     /protein_id="XP_002551926.1"
                     /db_xref="GeneID:8290759"
                     /db_xref="GOA:C5DCH7"
                     /db_xref="InterPro:IPR020795"
                     /db_xref="UniProtKB/TrEMBL:C5DCH7"
                     /translation="MSLNEFAEAQKTHYTVCPKVKRRRISCEKGIDPFVKLLAGKESM
                     QMVNKRWVLYHQLHSQFHAQVEEIVHRVSIDMYREISSVLSKDTSKRTSPSFNCLFLL
                     GSDSTTTIELHEQNSKTMQAIIDLTPKESPNVRMMLRRSMFKLLSATEAPLRVKTDEK
                     ESFAPEGDMGELPRTSPLGISYDLSLVQNFRKLFGKRLKLIFNFKDVDSFNSQVLDDF
                     IILLKSALNYKDVEICLVLNINTNLSNIQKNLRQSTIRLLKKDFTVIDLSHNKGHKYA
                     NQTFQSFLNTVDGKLNLSAEFIKFILDKMSNNATHNLQLLIKILDYSLMSYFFQNPFS
                     VFIDPTNVVNFDENYLPPLLKCPTFMTFVEGMVHAHAPSEEIMALLDNKNSTLEEFFT
                     EFLVRENPINDHLKLVVDVLENQLGVFNYNLIDLYYHMLTGKLHEFLQRWPECQQFED
                     ILKFEPVDIIFQELFTLDNSKELFSQSLFPFLRTNLENNLINSDRMLPPAKRLPGIKD
                     PFEAEFNSSVDLPLCQLFSLYREASSIINLYDFFLAFKETLPRSEIANFVNYSVENKE
                     SDLRHEDREKLSILLKEKGLDNLLDKMMLVWFVQSISEFQHMGLLKTQSNKSYEVVEK
                     CIWRGL"
     gene            complement(<250346..>250702)
                     /locus_tag="KLTH0B03190g"
                     /db_xref="GeneID:8290760"
     mRNA            complement(<250346..>250702)
                     /locus_tag="KLTH0B03190g"
                     /product="KLTH0B03190p"
                     /transcript_id="XM_002551881.1"
                     /db_xref="GeneID:8290760"
     CDS             complement(250346..250702)
                     /locus_tag="KLTH0B03190g"
                     /note="highly similar to uniprot|P47081 Saccharomyces
                     cerevisiae YJL003W COX16 Mitochondrial inner membrane
                     protein required for assembly of cytochrome c oxidase"
                     /codon_start=1
                     /product="KLTH0B03190p"
                     /protein_id="XP_002551927.1"
                     /db_xref="GeneID:8290760"
                     /db_xref="GOA:C5DCH8"
                     /db_xref="InterPro:IPR020164"
                     /db_xref="UniProtKB/TrEMBL:C5DCH8"
                     /translation="MSFGDRKFRSRRQQLAYEASIAGKYQARMKKNPFLYFGLPFCSI
                     IVLGSYWLSGFTAVRYEQKDRKIQEMSEDDLVKMKANKRQFDIKEEYYRLQGLGEQDW
                     EPVRVPRMKGESENVW"
     gene            <250834..>253770
                     /locus_tag="KLTH0B03212g"
                     /db_xref="GeneID:8290761"
     mRNA            <250834..>253770
                     /locus_tag="KLTH0B03212g"
                     /product="KLTH0B03212p"
                     /transcript_id="XM_002551882.1"
                     /db_xref="GeneID:8290761"
     CDS             250834..253770
                     /locus_tag="KLTH0B03212g"
                     /note="some similarities with uniprot|Q07798 Saccharomyces
                     cerevisiae YLL005C SPO75 Meiosis-specific protein of
                     unknown function required for spore wall formation during
                     sporulation dispensable for both nuclear divisions during
                     meiosis"
                     /codon_start=1
                     /product="KLTH0B03212p"
                     /protein_id="XP_002551928.1"
                     /db_xref="GeneID:8290761"
                     /db_xref="GOA:C5DCH9"
                     /db_xref="InterPro:IPR003864"
                     /db_xref="UniProtKB/TrEMBL:C5DCH9"
                     /translation="MPKCCLYSLLPVSAKMASMLGSNQNTPKPEFAKCIQPIIETDYM
                     TTAISMDFNTASFRSENRHYSITESILTTFLNTTRAGSAQKHTGMSFDALISSLVVSI
                     VYCGLQTLLFTMLRGKLKTLYQTRNFQLSEANEMRSLQENGPLGWVKSAWKTPLNEYK
                     RANGLDSFFFLRFMKAFGLFFLSLSVINIPVLIPIHYCSGAKVLRQRCKIDSLQAFNE
                     TEARLTSHFLEIEDSLKAQGLDKLSISNVSLQHADRLIFHFILAAFVVLWFHALLIKE
                     LKFFIAERNKALSNNEVPGSFYQSVLFLDNIPRDMFLNRAQLPKLFRFADSNDIQLTF
                     LPTNYQRLKKYYQKDKKIIDKLEHLQLKLIVLQSNQCGTQKALPPNERAVSGFATDVS
                     DKYAVRTNKLGRKAESAQQCYGPERSKKIYNNGTARKIRKEKVSRYGCARWASKLRLS
                     SHNLNITIKHISKQKSHIKINTRWLRALGIPSSFNIIKFRLNKDQARESLMKALEKLA
                     TELIQNREKWKELSEKPTPFVADGDQKQEEHPKKLFITFKSSRTAHLFAQVLISDKFK
                     ELNNVIIGPNPIDMIWSNVIQSSRWLKVVRIIFADLIAVLVILGWVLPVAFVGLISQV
                     PNMKILVPFFTWLDSDNAFFSSVLSSLVPILFLIFLIDIVPFIFRWLSILKVNRTGAE
                     IELDVQRWLFVFFFVHIFLVVTVSSGISVIFEKLINNPTSLPDLLAANLPKSSNFFYS
                     FIFIRGLAYFGGNLLQVKELLFELFYYRWCIRTPRKVRKRMEVVSENMWGSVYPLFST
                     IASIGIVYSVIAPLVLIFATVTFLIVQFSFKCRLNHQQHSRGKSETFGKLYPQALMQS
                     YAGIYCLEICMIGLFALSNRYVLVICMALVFIFTILAHFKISKFYDKYINFLPLKEDE
                     ESLLTEHPRKDLFPFFVKEKCLWIPQDSSGASNDQCHLMNEKFDIFCRNEGCFFDGAT
                     GSLNFL"
     gene            complement(<253796..>255139)
                     /locus_tag="KLTH0B03234g"
                     /db_xref="GeneID:8290762"
     mRNA            complement(<253796..>255139)
                     /locus_tag="KLTH0B03234g"
                     /product="KLTH0B03234p"
                     /transcript_id="XM_002551883.1"
                     /db_xref="GeneID:8290762"
     CDS             complement(253796..255139)
                     /locus_tag="KLTH0B03234g"
                     /note="similar to uniprot|P41800 Saccharomyces cerevisiae
                     YLL006W MMM1 Mitochondrial outer membrane protein required
                     for normal mitochondrial morphology and mtDNA stability
                     involved in tethering mitochondria to the actin
                     cytoskeleton and in anchoring mtDNA nucleoids"
                     /codon_start=1
                     /product="KLTH0B03234p"
                     /protein_id="XP_002551929.1"
                     /db_xref="GeneID:8290762"
                     /db_xref="GOA:C5DCI0"
                     /db_xref="InterPro:IPR019411"
                     /db_xref="InterPro:IPR027537"
                     /translation="MKSPNETSFTNHTLENASTFGADLSIESNESLVSLDEYLSNTLP
                     LHLQQLFLENLQKRQQGILESASDSIIEAVRDSSQQKFQNGLHLSLDSGVGSKGSVFS
                     AWSFAQGLVIGQLSVIVVLIFFIKFFIFSEGPIKTEGPKGGKSGPKRDSAYVSPLLST
                     STSHFLSSIIKRGESDGADSSENTDTDRKFSQINTILEKTYYNVETHSPETLDWFNVL
                     IGQTIQQFREEALQKDNIVHSLNNFIARKSGELPQYLDTIKITELDIGEDFPILSNCR
                     IQYSPNSNKQRLEAKIDIDLSDRLALGIETKLLVNYPKPFTAALPIQLTVSIVRFQAC
                     LTVSLTTAEEFVPTSENEASYGSENGGYFLMFSFSPEYRMEFDVKSLIGARSKLQDIP
                     KIGSLIESQIKKWFVERCVEPRFQFIKLPSLWPRSKNTREEKTENDDISMKSTDL"
     gene            <255399..>257324
                     /locus_tag="KLTH0B03256g"
                     /db_xref="GeneID:8290763"
     mRNA            <255399..>257324
                     /locus_tag="KLTH0B03256g"
                     /product="KLTH0B03256p"
                     /transcript_id="XM_002551884.1"
                     /db_xref="GeneID:8290763"
     CDS             255399..257324
                     /locus_tag="KLTH0B03256g"
                     /note="some similarities with uniprot|Q07799 Saccharomyces
                     cerevisiae YLL007C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B03256p"
                     /protein_id="XP_002551930.1"
                     /db_xref="GeneID:8290763"
                     /db_xref="UniProtKB/TrEMBL:C5DCI1"
                     /translation="MSDSFTTQSFGSPRDYAEQLLNLLSKTTDKTALVTLHRTLSTAE
                     NSVFEDCLIARPERWAFVFTAVEKLPKDEEVIKAADFIVRKGASILTSKAEQNGSLKH
                     FCAAVNSNFIINTVLTQFMWPHCDAQLEIEVISTVGSFLECLLLLDQYEPQLTSAMLC
                     DTCLALRTGGFFTLLTAVLETGPQHDNKVEHMAHRTALKLVEVDQEMYGRGIDKLPSH
                     LMRKMLDLLSKQFKVNEWDNENSFPSVDEGGKQISELSLLNAIDLITFATDSNLSFRK
                     KFLERLLFEDDAFPIVKALSWLSDQLTHCFSSSFRAEEPTVFILQCFLNKDILIFSLV
                     DKLMELWIESNAQSFDDLRSVLETFKVAFFQRDSFLGAKEPDVGACLVNIRSLTYEDL
                     RKLQLKQIRASHYKKWEKQISQFDSMLSNQVLEYVRHQRLLQLQKGAWVYSENPLDNN
                     VKQPKVYFLVLCDNQMNLLAREFRIRSEENPSVQGNEIISSSDTPASKSKTIVIPLRR
                     INKFQHWRVQSENKVPENAKLINILNKAVYTEIHLLDKDAAKLLRFFLDTKEASYIWL
                     DGLQLIVASALGKKPALSDDIKSQISTLVDLRKNVQIIGLDDQTKLEHSDQDSEAEEM
                     YYDLETLQSVATDFHYD"
     gene            complement(<257395..>259614)
                     /locus_tag="KLTH0B03278g"
                     /db_xref="GeneID:8290764"
     mRNA            complement(<257395..>259614)
                     /locus_tag="KLTH0B03278g"
                     /product="KLTH0B03278p"
                     /transcript_id="XM_002551885.1"
                     /db_xref="GeneID:8290764"
     CDS             complement(257395..259614)
                     /locus_tag="KLTH0B03278g"
                     /note="similar to uniprot|P32892 Saccharomyces cerevisiae
                     YLL008W DRS1 Nucleolar DEAD-box protein required for
                     ribosome assembly and function including synthesis of 60S
                     ribosomal subunits"
                     /codon_start=1
                     /product="KLTH0B03278p"
                     /protein_id="XP_002551931.1"
                     /db_xref="GeneID:8290764"
                     /db_xref="GOA:C5DCI2"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCI2"
                     /translation="MDKQKFKDFEDFVPTISDSENEVPDLDGSEDETLHPETSTKTKS
                     KKKKANNSNPNEDIHEDLNPSFRFDLDGAEVSSGFEGWNFDGDKKLETNPDVDLDGII
                     RRKGGLIQMAGTGDSESDGSEKESESEGELALDGFGMGADEKSSKCQSATHEGDATDS
                     EGDESGVDEDSGVESDKQTEGQEALMTAGNGSVSDIEDDSEEAKAEFYALEEESTEAK
                     KTVHTNFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAA
                     YMIPIIERLLYKPAQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVGGLN
                     LRQQEQTLRSRPDIVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDELN
                     EIMSLIPSKRQTLLFSATMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRK
                     RDELKPALLFHLIRKLDDLSQKRVVVFVARKEVAHKLRIILGLLGMKVAELHGSLSQE
                     QRLQAVNGFKSLQVPVLICTDLASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAG
                     REGRSISFVGESSQDRNVVKNAIKSAEENKKQDTVVGRMVDWAKVEEINKLTTNKDDV
                     IAEILEEEKQEKEILRAEMEVRKGENMLKHKDEISARPRRTWFQTEGEKKNSKVIQAL
                     SKGKKTVNSKKRKRIEATEDRSRSYKKTQKDRGSDQQRTYAKQKAKKEMKKKKQARK"
     gene            <259839..>260405
                     /locus_tag="KLTH0B03300g"
                     /db_xref="GeneID:8290765"
     mRNA            <259839..>260405
                     /locus_tag="KLTH0B03300g"
                     /product="KLTH0B03300p"
                     /transcript_id="XM_002551886.1"
                     /db_xref="GeneID:8290765"
     CDS             259839..260405
                     /locus_tag="KLTH0B03300g"
                     /note="similar to uniprot|P41544 Saccharomyces cerevisiae
                     YJL004C SYS1 Multicopy suppressor of ypt6 null mutation"
                     /codon_start=1
                     /product="KLTH0B03300p"
                     /protein_id="XP_002551932.1"
                     /db_xref="GeneID:8290765"
                     /db_xref="InterPro:IPR019185"
                     /db_xref="UniProtKB/TrEMBL:C5DCI3"
                     /translation="MVTIRRYLRIPQELRPTQIFRQDSLSPIKIALQIILLQLFYYCT
                     AYILFYGWARLGGYDVSITKWLFTWEFIDFSNSLGIVLSLLWLLDSLICVLFLTVIVG
                     RSKLAWDFGITIHAVNLLVVWINTGRWPSLSWFVVQLLSSAILVFLGTWTTRWSELRD
                     TFFDGLVSSQPNPEGQVEMKDLEAQKPI"
     gene            complement(<262380..>268052)
                     /locus_tag="KLTH0B03322g"
                     /db_xref="GeneID:8290766"
     mRNA            complement(<262380..>268052)
                     /locus_tag="KLTH0B03322g"
                     /product="KLTH0B03322p"
                     /transcript_id="XM_002551887.1"
                     /db_xref="GeneID:8290766"
     CDS             complement(262380..268052)
                     /locus_tag="KLTH0B03322g"
                     /note="similar to uniprot|P08678 Saccharomyces cerevisiae
                     YJL005W CYR1 Adenylate cyclase required for cAMP
                     production and cAMP-dependent protein kinase signaling
                     involved in cell cycle control and glucose and nitrogen
                     repression of sporulation"
                     /codon_start=1
                     /product="KLTH0B03322p"
                     /protein_id="XP_002551933.1"
                     /db_xref="GeneID:8290766"
                     /db_xref="GOA:C5DCI4"
                     /db_xref="InterPro:IPR000159"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR003591"
                     /db_xref="InterPro:IPR025875"
                     /db_xref="InterPro:IPR029787"
                     /db_xref="UniProtKB/TrEMBL:C5DCI4"
                     /translation="MSEQTRRRANSLEAEKSFQVPEDAAEAGASGGLHGRPHFRKQYS
                     VGGFGPTFSGGASGASGGIAGAGSASAQGHGARGRAAKALGKGRYKGFHNPVALHSPD
                     DPIPPYAHPIKPRIPGLNRTISGNSLFSSSQAARDPQQLQHQQQQQQRKGSRAGSLFK
                     RLTGMKMTNASASEPSDQESAAANPTAGPAGIRRKMSTLIHGGSGAGSGQAQDAGHVS
                     GSDLNSKTSKSGFLNTPSSTNSRRGSAASIITSPSGNNSPKISHISNSNVNNALSATS
                     ASASANDSGNQVSDSSESPGRNALNRSTSYFLLDTDLNNLSDITNISDKKPKEKAKLP
                     PKSRSQTPVAKVQPQDIGKAPLVDTETSAPHEAAHSKVQWIAPESWDIDEEVGKPLPG
                     KKNKRRVHRHHTSNTTSKIDRERAGGATKKPGRPKQKENTPKLGSLKEVTDQEHNHLS
                     TTAQEDTKESSGSAASISSAASRSQEFSEAASSTSDYEDDYGDESHWRAGSLDSLQTY
                     DSDQAKNDEAFDRVGYELDKYYNDFSDIDPTRRYAIRVFNTDETFTTLSLTPNTTVQE
                     MIPQLKRKFNIGQGNYQVSLKVAKILKVLRPTARPILIQRKLLLLNGYQKGDPLHILG
                     IEDLSYVFNFIFHPVATSHLSYEEEQRLTRGDFIHVDLRSMNLTTPPIIFYQYTPNIE
                     SLDVSNNANIFLPLDFIESASKLSSLRMVNIRASRFPPNITEAHVLVSLDLERNFIER
                     IPPSISNLSELTILNLQCNELDRLPTGFTELKNLRLLDISSNNFAQYPEVINHCTNLL
                     QVDLSYNKIQTLPDSINRLTKLAKMNLSNNKLTNIGSLSGMVNLRTLNLKDNRITSLK
                     LENSNLQNLSISNNRISVFDDKLPKLKSLEIHENPITSISYDGEYLVNIVTLSLNKAK
                     LASLPPELLCKLPRLEKLELNGNNLTQIPPEISKLTKLVYLSAARNKLESISEDITEL
                     RNLKTLDIHSNNLSNLVKGLGKMELINFNVSSNLLGNTMDIQEVFLNRRDSVLAKSLR
                     FLSMADNNLGDQFWTLFNMYENLKTLNLSYNNLSDLSNFKLENLTELYLSGNKFITLQ
                     GDTVLRWKSLKVLMLNGNNLLSLPSELSQLTQLNVLDVGSNQLKYNISNYHYDWNWNN
                     NKNLKYLNFSGNKRFEIKSTAALDSESKADLSDLTILKELRILGLMDVTLKTSKVPDE
                     GVNMRLRTTASVLNGMKYGVADTLGLKDSVTSRDVTFERFRGKEDECLVCLFDGKNEN
                     VSTGHNISKIIRDIYHKILIRQLEKYGDTAEGIKNALRFSFLQLNKEINSTLNSVDNE
                     ATSEDFSSADLLSGSSATVLYMKGKRLYTANIGDTMAILSKNNGDVVPLTKLHVPSKR
                     EEYERIRISGGYVNNYKLDGVSDVSRAVGFFDLLPHIHASPDLSEFNLTTTDDLVIIA
                     TAKLWDYLDYQTACDICRENKVEPMLAAEKLKDYAISFGCAANMTILCISLDKSSSNQ
                     NNFMLNKNDLISRRSTFEDSTLRRLQPEISPPTGNLAMVFTDIKNSTFLWESFPNAMR
                     SAIKTHNDIMRRNLRIFGGYEVKTEGDAFMVAFPTPISALVWCMSVQLKLLEAEWPEE
                     ITSIQGGCLITDNEDRKIYLGLSVRMGIHWGCPVPELDVVTQRMDYLGPVVNKASRVS
                     GIADGGQITLSSDFCSEFNKILGLHERVVKENAPLKEVYGEEFVGEIMEREVHLLESI
                     GWEFRELGEKKLKGLETKEFITIAYPKALEARHGFTTRDAETSLVDEETLFQLRAVST
                     KLESLVSVLNGVMLEKKEYSEAGSYVNLDKKQISAVSHSTTEGDRIALLDHIITRLES
                     IVATLQIRQRVEGALEPPKIGDAGGERSIFEIVDQLLLETGRLTDSRK"
     gene            <270448..>271410
                     /locus_tag="KLTH0B03344g"
                     /db_xref="GeneID:8290767"
     mRNA            <270448..>271410
                     /locus_tag="KLTH0B03344g"
                     /product="KLTH0B03344p"
                     /transcript_id="XM_002551888.1"
                     /db_xref="GeneID:8290767"
     CDS             270448..271410
                     /locus_tag="KLTH0B03344g"
                     /note="highly similar to uniprot|Q07938 Saccharomyces
                     cerevisiae YLR017W MEU1 Methylthioadenosine phosphorylase
                     (MTAP) catalyzes the initial step in the methionine
                     salvage pathway affects polyamine biosynthesis through
                     regulation of ornithine decarboxylase (Spe1p) activity
                     regulates ADH2 gene expression"
                     /codon_start=1
                     /product="KLTH0B03344p"
                     /protein_id="XP_002551934.1"
                     /db_xref="GeneID:8290767"
                     /db_xref="GOA:C5DCI5"
                     /db_xref="InterPro:IPR000845"
                     /db_xref="InterPro:IPR001369"
                     /db_xref="InterPro:IPR010044"
                     /db_xref="UniProtKB/TrEMBL:C5DCI5"
                     /translation="MVNASELPKTFNGPIDLGIIGGTGLYQLDCLEAIAVLPPVKTPW
                     GQTSSPITISKITGDSEEHFHVAFISRHGLHHQFSPSTVPFRANMAALKHLRCKAVLS
                     FSAVGSLQQQIKPRDFVLPQQIIDRTKGVRDSSYFNDIGLVAHVGFGEPFSKSFAEYI
                     SKFHGILENPGVDEPCELHFDIDTTVVCMEGPQFSTRAESKMYRMLGGDVINMSVLPE
                     AKLARECELPYQMVCMSTDYDAWRDEAEPVTVETVIGNLQNNGANANALASAIITDMA
                     NKMPEFMKTGDGLKGSIKMSISTKPAAMSKDALEKLKFLFPDYW"
     gene            complement(<271449..>272618)
                     /locus_tag="KLTH0B03366g"
                     /db_xref="GeneID:8290768"
     mRNA            complement(<271449..>272618)
                     /locus_tag="KLTH0B03366g"
                     /product="KLTH0B03366p"
                     /transcript_id="XM_002551889.1"
                     /db_xref="GeneID:8290768"
     CDS             complement(271449..272618)
                     /locus_tag="KLTH0B03366g"
                     /note="weakly similar to uniprot|Q7LGY6 Saccharomyces
                     cerevisiae YLR018C POM34 nuclear pore integral membrane
                     protein"
                     /codon_start=1
                     /product="KLTH0B03366p"
                     /protein_id="XP_002551935.1"
                     /db_xref="GeneID:8290768"
                     /db_xref="InterPro:IPR012578"
                     /db_xref="UniProtKB/TrEMBL:C5DCI6"
                     /translation="MSNSAMDNSFEPSSSNSAFSALYRRDFGNAMNSSTVPRKMFSTP
                     VKPVTQERFASVREKVVRESPYLYKSKILSSPVKDGKRVSKSVGGTPLARPTVFQKSR
                     PTSSESTSNETEAKGTVASENTESVLGGFENPVLAQYSCRIVNKELETRKIISNLLAV
                     LVWNLALKFLSLYLDHTLHGAGFSKRVAKWVQETLVYRINPYADFEHSRWARLITLAN
                     VSHIFHLIIFYNVTVSLWRLLVKSQNVKIDDLHLNQRQKQLLGLSDQTQTSSALPRVV
                     LAASPQEPLSKPTSLASSPHKASAPPVFLFKSLQTPLKSKERAAAAERAGVRSERAPK
                     INAFGDLRSSVLKKSSLTPSHVSSGLLPTAMNRTGYIPSSKYAYMRDSPSPRKTM"
     gene            <272914..>274143
                     /locus_tag="KLTH0B03388g"
                     /db_xref="GeneID:8290769"
     mRNA            <272914..>274143
                     /locus_tag="KLTH0B03388g"
                     /product="KLTH0B03388p"
                     /transcript_id="XM_002551890.1"
                     /db_xref="GeneID:8290769"
     CDS             272914..274143
                     /locus_tag="KLTH0B03388g"
                     /note="similar to uniprot|Q07800 Saccharomyces cerevisiae
                     YLL010C"
                     /codon_start=1
                     /product="KLTH0B03388p"
                     /protein_id="XP_002551936.1"
                     /db_xref="GeneID:8290769"
                     /db_xref="GOA:C5DCI7"
                     /db_xref="InterPro:IPR004274"
                     /db_xref="InterPro:IPR011948"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="UniProtKB/TrEMBL:C5DCI7"
                     /translation="MGFISSLLCCSSSQSGNQREKANGKRPLTAQQSRIHTALSNSTR
                     QMNTAPSRNDGKPAGEAKATGSSKAIRTSKARSEAQVVSSAQHGHASTEEPAETEDDT
                     LNKEEKQVVSVYNGETESSTGTAEDHGLLARKAAGGAGETDEEDADEDEDRNSTSHEV
                     TAVVHEAEQSSSAEDDSDAALAEHQDREGDMQRAPSYDYDPENAVSEEMVDLAALQPD
                     QAHAPGVNTLLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVIPVEIDNQVHNV
                     YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNHCIHHRLFRDSCYNYD
                     GNYIKNLSQIGRPLSDLIILDNSPASYIFHPQHAIPISSWFSDVHDNELLDILPLLED
                     LAEENVPDVGKILDVTI"
     gene            complement(<276115..>277548)
                     /locus_tag="KLTH0B03410g"
                     /db_xref="GeneID:8290770"
     mRNA            complement(<276115..>277548)
                     /locus_tag="KLTH0B03410g"
                     /product="KLTH0B03410p"
                     /transcript_id="XM_002551891.1"
                     /db_xref="GeneID:8290770"
     CDS             complement(276115..277548)
                     /locus_tag="KLTH0B03410g"
                     /note="highly similar to uniprot|P33750 Saccharomyces
                     cerevisiae YLL011W"
                     /codon_start=1
                     /product="KLTH0B03410p"
                     /protein_id="XP_002551937.1"
                     /db_xref="GeneID:8290770"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR007287"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR020472"
                     /db_xref="UniProtKB/TrEMBL:C5DCI8"
                     /translation="MKIKTISRSADDYVPVKSTQESQLPRNLDPALHPFERAREYTKA
                     LNATKMERMFAKPFIGQLGYGHRDGVYTIAKNYHALNKLASASADGVVKYWNMSTREE
                     ICSFKAHYGLVHGLCVTPQHLSANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQ
                     SSTDGLIKTFHGDYAFLGIDHHRSKPYFVTAGAEINLWDSSRSRPTANLSWGADNVST
                     VKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFTQRMRTNALCWNPMEAYNFVVASE
                     DHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIVTGSYDKTIRIYQVKHGHSR
                     EVYHTKRMQHVFQVKYSMDSKYIMSGSDDGNIRMWRAKAWERSSVKTTREKNKLEYDE
                     KLKERFKYMPEISRISRHRHVPKVVKKAQEIKNIEIGSMKRRETNERRTNKDMAFVPE
                     RKKQIVGVVHQYQDNKREKSTDADQED"
     gene            complement(<277684..>279213)
                     /locus_tag="KLTH0B03432g"
                     /db_xref="GeneID:8290771"
     mRNA            complement(<277684..>279213)
                     /locus_tag="KLTH0B03432g"
                     /product="KLTH0B03432p"
                     /transcript_id="XM_002551892.1"
                     /db_xref="GeneID:8290771"
     CDS             complement(277684..279213)
                     /locus_tag="KLTH0B03432g"
                     /note="similar to uniprot|Q07950 Saccharomyces cerevisiae
                     YLR020C YEH2 Steryl ester hydrolase catalyzes steryl ester
                     hydrolysis at the plasma membrane involved in sterol
                     metabolism"
                     /codon_start=1
                     /product="KLTH0B03432p"
                     /protein_id="XP_002551938.1"
                     /db_xref="GeneID:8290771"
                     /db_xref="GOA:C5DCI9"
                     /db_xref="InterPro:IPR006693"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DCI9"
                     /translation="MALSMDLVYTPISLVVSTTFLTVLLVLSLCHNVVEAHFKKKDPR
                     DTRSSNVRNSPKNHSRDSSVGSATPLGYGRYEMGNIEYDHDVTNPDTRPNTAFENSAY
                     QPRPVGIRENPFSSVLNAEDLKLVPDLKYYFEEYGIAIEEFEIQTLDGFFIDLWHLKP
                     KGHSNPSKGGHPMLMLHGLLQSSGSFASGGRKSLAYYFYESGYDIWLGNNRCGFKPKW
                     NDYIVKKKDRWNWDMRDLVQYDLRALVSTVLEKTGKEKLTLIAHSQGTTQGFMGLANG
                     ETVYDDDFKLLDKLENFVALAPAVYPGPLIEEKMFVRFMSKFIDSPYVFGRCCFLPLM
                     MLMRSLMVGWKLFSFLSYVMFNYLFDWNDSLWDKPLRNRHFLFSPVCISVNLLQWWLS
                     QDKRKSSFKTYSNGIFPDSKTWFPSGGEPAKKQTEMHSNQEKITTDEYPRILMFIPKQ
                     DRLVDGERLINHFTNCEPQSLYKIWYIDEYSHLDVLWSHDVIERVGKPILNTIRTNSS
                     H"
     gene            <279356..>279877
                     /locus_tag="KLTH0B03454g"
                     /db_xref="GeneID:8290772"
     mRNA            <279356..>279877
                     /locus_tag="KLTH0B03454g"
                     /product="KLTH0B03454p"
                     /transcript_id="XM_002551893.1"
                     /db_xref="GeneID:8290772"
     CDS             279356..279877
                     /locus_tag="KLTH0B03454g"
                     /note="similar to uniprot|Q07951 Saccharomyces cerevisiae
                     YLR021W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B03454p"
                     /protein_id="XP_002551939.1"
                     /db_xref="GeneID:8290772"
                     /db_xref="InterPro:IPR018854"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ0"
                     /translation="MFCREIRKVVPSDLNLGADNTLEAVAVHFTNKVVLKLRFNGELD
                     TCYEILSKGLPAEGLGSTPLGKVVLNSGIGPEDEDFEDLSPIEDGLSNFHVTTRLGNS
                     NDMKLPIVCTQIAEMYQKAVLPSNIDGLRDIAPSRDFVVSLSAKMWKRDTSETDFALL
                     VFILQTIKEMYNS"
     gene            complement(<279956..>280684)
                     /locus_tag="KLTH0B03476g"
                     /db_xref="GeneID:8290773"
     mRNA            complement(<279956..>280684)
                     /locus_tag="KLTH0B03476g"
                     /product="KLTH0B03476p"
                     /transcript_id="XM_002551894.1"
                     /db_xref="GeneID:8290773"
     CDS             complement(279956..280684)
                     /locus_tag="KLTH0B03476g"
                     /note="highly similar to uniprot|Q07953 Saccharomyces
                     cerevisiae YLR022C SDO1 Protein required for cell
                     viability"
                     /codon_start=1
                     /product="KLTH0B03476p"
                     /protein_id="XP_002551940.1"
                     /db_xref="GeneID:8290773"
                     /db_xref="GOA:C5DCJ1"
                     /db_xref="InterPro:IPR002140"
                     /db_xref="InterPro:IPR018023"
                     /db_xref="InterPro:IPR018978"
                     /db_xref="InterPro:IPR019783"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ1"
                     /translation="MINQPSGQIKLTNVSIVKLKKGKKKFEIACYQNKVQDFRKGVEK
                     DVDEVLQIHQVFINVSKGQVASKEDLTKSFEAKDLDTIIKEILTRGEIQLSEKERQLM
                     LNKINNEMLTIVSAKCINPKSKKRYPPTMIHKALVELKFNVVLNKPAKLQALEAIKVL
                     VAKQIIPIVRARMRIKVDLQKPGNDDLIEKLLPLIKSPELTEAESSWCCAGLIDPVSY
                     RTIVEACNNRGTLQVLDMAVVDNK"
     gene            complement(<281148..>282788)
                     /locus_tag="KLTH0B03498g"
                     /db_xref="GeneID:8290774"
     mRNA            complement(<281148..>282788)
                     /locus_tag="KLTH0B03498g"
                     /product="KLTH0B03498p"
                     /transcript_id="XM_002551895.1"
                     /db_xref="GeneID:8290774"
     CDS             complement(281148..282788)
                     /locus_tag="KLTH0B03498g"
                     /note="some similarities with uniprot|Q07959 Saccharomyces
                     cerevisiae YLR023C IZH3 Membrane protein involved in zinc
                     metabolism member of the four-protein IZH family
                     expression induced by zinc deficiency deletion reduces
                     sensitivity to elevated zinc and shortens lag phase
                     overexpression reduces Zap1p activity"
                     /codon_start=1
                     /product="KLTH0B03498p"
                     /protein_id="XP_002551941.1"
                     /db_xref="GeneID:8290774"
                     /db_xref="GOA:C5DCJ2"
                     /db_xref="InterPro:IPR004254"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ2"
                     /translation="MDRLESLLPNDGAYRPRLHKLRTRGKQIVRWSKSQVAGVPAYAL
                     RKITWGAASEADEDAGDDARAAAAEPPTELFAADFDAITMVDSRPQSMLNSYRMKDAQ
                     TARWHAKTATAAAAMASGVSYVSSAATLVSSSSFSSAENISLSLPSASPARSLSSADS
                     CGTSPVSPVAGLRICDAKAIEKSFQSIQNDAEAVAASIKFHNYEVALQLGQQRHLHYY
                     ELPFPWRENRFIIHGYRFYNSYSKSLLSIFNWYGWHNETVNIWTHLCGALYFAFLIFK
                     GFSQTTVYQSELVPTAAKFMAFVFLTAGLECFLFSVVWHTFNGICHLKQRSNCACVDY
                     TGITVLVTASILTTEFVTLSGSSDATFTWSLLFFTGASAALGAVGVFMNWSPKFDRPE
                     SRPLRIAFYLLLASFGFFSYLHSRLFNTAVDSSDLIKPVFMKSLAWYIIGVVFYGTFI
                     PERWRSDVQVDANIPTEEQLTTDLEIITKHRHIHFRSQPASHHKCKNADHKRSFKSLW
                     WVDYFCCSHTLWHLFVLLGVIGHYTAMLEMFEKRWLRG"
     gene            <284167..>286437
                     /locus_tag="KLTH0B03520g"
                     /db_xref="GeneID:8290775"
     mRNA            <284167..>286437
                     /locus_tag="KLTH0B03520g"
                     /product="KLTH0B03520p"
                     /transcript_id="XM_002551896.1"
                     /db_xref="GeneID:8290775"
     CDS             284167..286437
                     /locus_tag="KLTH0B03520g"
                     /note="some similarities with uniprot|Q02601 Saccharomyces
                     cerevisiae YLL013C PUF3 member of the PUF protein family
                     which is named for the founding members PUmilio and Fbf"
                     /codon_start=1
                     /product="KLTH0B03520p"
                     /protein_id="XP_002551942.1"
                     /db_xref="GeneID:8290775"
                     /db_xref="GOA:C5DCJ3"
                     /db_xref="InterPro:IPR001313"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ3"
                     /translation="MSTTENQRDPWVTHDAAGSAGGAHAANMDSELASIVSSLSALSS
                     VSAHQQHGQIGSFRRGSFHSNQGSDVESEMLFHTQTSPPIKRTTLSVGGMPLGGPSGV
                     NNRLSKMKNYSGSLAGGSVLQQQPIQGGFFERFGRSLAEGTREVELNLGSTSGRASRR
                     ESMNAMDSLSRATTNSTFQGVAMEGRRTSVASDAMESLSENLNMQPEEPGNLNHRNIW
                     KVAEAPVFRPQASENSGMEPAFPQPPAEALNQPYGFSYPNYWKMGAPMIPLAVPPSEQ
                     LKAGKDFPEPSAAGGNVPVDPSSQPFPPFMFPNNPYLFFPPGATPPPPPHPFQPAASN
                     PKDLPKGPNAKTHGNPYLYNSRNHKPARGSPSAPFPPQPNPAAAANSSTPRGKGKYNV
                     VRSPLLEEFRNNSSGKEYRLPDIYGSALEFCKDQHGSRFIQQELVKATDTEKEVIFNE
                     IRDEAINLADDVFGNYVIQKYFEHGLKSQKDVLFEKFTGKMEKLSLQMYACRVIQRAL
                     ECIDLDQKVILVNELSGCVLKMIKDQNGNHVIQKAIERIPIEKLPFILGSLEGQIYHL
                     STHSYGCRVVQRLLEYGTLEDQEKILADLDQFIPFLIQDQYGNYVIQHILKQGPETDD
                     THIGRTKQNIVDIVCKNVVEYSKHKFASNVVEKTMVFGSPAQKKQFMEKVLPESAEHA
                     TRLEDNAPLILMMRDQYANYVVQKLVGVAEGDDKKVTVIAIRSYLEKLNKINALGNRH
                     LASVEKLAAIVENVQV"
     gene            complement(<286578..>286901)
                     /locus_tag="KLTH0B03542g"
                     /db_xref="GeneID:8290776"
     mRNA            complement(<286578..>286901)
                     /locus_tag="KLTH0B03542g"
                     /product="KLTH0B03542p"
                     /transcript_id="XM_002551897.1"
                     /db_xref="GeneID:8290776"
     CDS             complement(286578..286901)
                     /locus_tag="KLTH0B03542g"
                     /note="similar to uniprot|Q12431 Saccharomyces cerevisiae
                     YLL014W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B03542p"
                     /protein_id="XP_002551943.1"
                     /db_xref="GeneID:8290776"
                     /db_xref="GOA:C5DCJ4"
                     /db_xref="InterPro:IPR008504"
                     /db_xref="InterPro:IPR029008"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ4"
                     /translation="MSSQELFRNIKAQESIAYNKKVLLYIQDATSLGIGCGAGILQLE
                     GSRGFAAFVSGYAVVALLFIAWFCGLSPKRFFQSPIQEIFFDSFFRELMGFVMAWTFV
                     YALVD"
     gene            <287100..>288245
                     /locus_tag="KLTH0B03564g"
                     /db_xref="GeneID:8290777"
     mRNA            <287100..>288245
                     /locus_tag="KLTH0B03564g"
                     /product="KLTH0B03564p"
                     /transcript_id="XM_002551898.1"
                     /db_xref="GeneID:8290777"
     CDS             287100..288245
                     /locus_tag="KLTH0B03564g"
                     /note="similar to uniprot|P48362 Saccharomyces cerevisiae
                     YGR187C"
                     /codon_start=1
                     /product="KLTH0B03564p"
                     /protein_id="XP_002551944.1"
                     /db_xref="GeneID:8290777"
                     /db_xref="InterPro:IPR007205"
                     /db_xref="InterPro:IPR007206"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ5"
                     /translation="MPSQLEELVSFLHSPQPAVRQIALDNLVGFSTGSNATVFRYDNY
                     RAISDLKGLARENSKLLVQQSVTILANLCDDLTMRKMIASDEGFLKYLTCKICDLRNT
                     SADIMCILLTNLAKEDCITKVFSFTTMDSKDVTLDKNVFKSERIVDCLMDCFVKGSDR
                     TLNKFANFDYLAYFFADISRFRLGREYFIQKQKYDGVIPISKLLVFTEKYDSKTRREG
                     VASTIKNSLFDSEKHEELLSNEEINLLPYILLPIASAKDSEIDDEDMFNLPEELQLLP
                     EDKQRDPIPEIICVHLESILLLCTTKKGREYLRSKSVYPLVRELEKNVENNDISELCD
                     RIVNMLMRGEIGTDQIEEMPTRNAEDEKSRLSDDEDSEDDNAIVEVA"
     gene            complement(<288352..>290331)
                     /locus_tag="KLTH0B03586g"
                     /db_xref="GeneID:8290778"
     mRNA            complement(<288352..>290331)
                     /locus_tag="KLTH0B03586g"
                     /product="KLTH0B03586p"
                     /transcript_id="XM_002551899.1"
                     /db_xref="GeneID:8290778"
     CDS             complement(288352..290331)
                     /locus_tag="KLTH0B03586g"
                     /note="similar to uniprot|P41895 Saccharomyces cerevisiae
                     YGR186W TFG1 Largest subunit of the RNA Polymerase general
                     transcription factor IIF (TFIIF) interacts with Fcp1p
                     phosphatase and with TFIIB potentially phosphorylated by
                     Cdc28p"
                     /codon_start=1
                     /product="KLTH0B03586p"
                     /protein_id="XP_002551945.1"
                     /db_xref="GeneID:8290778"
                     /db_xref="GOA:C5DCJ6"
                     /db_xref="InterPro:IPR008851"
                     /db_xref="InterPro:IPR011039"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ6"
                     /translation="MPNPLKSSNSASPFIKREQLRRDFLRSRLKKNGTPRPYVKKEDP
                     EAYDERTRQLLSGGQSHSGIKREEGSQYNEFPLRAVSHEQLENIRTHILKFQSKKKVD
                     PQRDMHLPVRLHRKDTRNLQFQLTRAEIVQRQKEIAEYKMKADSERNGGEQSQAGSSA
                     TNLQSDSNVASSAAQTPVETPGDTPADTPVKQESVKEEHGSSSMAIKKEGADLPATKL
                     EEAGVAEDPTKVGMVKYDGKEKPLETESKEDPFADVAPDGGGRFRRGNTKRKTRQLKL
                     LDENAKRLRFEEFYPWVLEDFDGLNTWVGSYEAGNSDSYVLLSVENDGSFTMIPADKV
                     YKFTARNKYATLTIDEAEKRMEKNGKGIPRWLMKHLDDIGTTTTRYDRTQRKLRAVDA
                     RQGEEDDRNDNSEVELDFDEEFADDEEAPIIDGDEKENKESEQRIKKEMLQANAMGLR
                     DDDEEADDDLFGEKKIDDEGERVMKALQKSDMAALYESDDESKSNPYLSESEGENTEE
                     AKAKDENQENGKSSRKGSPKKKSSRGSPSGPRIYVKSIKDFQLVLRADKSVLRNFPEG
                     NWNPHAKDEKSRTPGAASSPSSPPIKIEDDIENPDLLTERDIIDVVTGRQMTLKQLIK
                     ELKEKVAKHPSNKDRMKYLVKRLVRLNNGYLELNK"
     gene            <291073..>292290
                     /locus_tag="KLTH0B03608g"
                     /db_xref="GeneID:8290779"
     mRNA            <291073..>292290
                     /locus_tag="KLTH0B03608g"
                     /product="KLTH0B03608p"
                     /transcript_id="XM_002551900.1"
                     /db_xref="GeneID:8290779"
     CDS             291073..292290
                     /locus_tag="KLTH0B03608g"
                     /note="highly similar to uniprot|P36421 Saccharomyces
                     cerevisiae YGR185C TYS1 tyrosyl-tRNA synthetase
                     cytoplasmic"
                     /codon_start=1
                     /product="KLTH0B03608p"
                     /protein_id="XP_002551946.1"
                     /db_xref="GeneID:8290779"
                     /db_xref="GOA:C5DCJ7"
                     /db_xref="InterPro:IPR002305"
                     /db_xref="InterPro:IPR002307"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR023617"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ7"
                     /translation="MTGESQTIQDPQAAYELITKNLQEVLNPQIIKNVLEVEKRPLKL
                     YWGTAPTGRPHCGYFVPMTKLADFLKAGCEVRVLLADLHAFLDNMKAPLEVVKYRAKY
                     YECVIKSLLRSINVPIEKLDFVVGSSYQLSSEYTMDIFKISNVVSQNDAKRAGADVVK
                     QVANPLLSGLIYPLMQALDEEHLGVDVQFGGVDQRKIFVLAEENLPSLGYKKRAHLMN
                     PMVPGLTQGGKMSASDPNSKIDILEEPKQVKKKINTAFCAPGVVEDNGLLSFIEYVVA
                     PIQELKHGANYFKFYIDRPEKFGGPVTYNSFKELVEDFKNEKLAPPDLKTGVSDIINE
                     LLAPIREDFAKDPEFQEAQAKGYPVVSTEKVKKQKKPKNKGTRYPGGQAPNNDPTAVV
                     AEKLEQTELKESS"
     gene            complement(<292423..>297858)
                     /locus_tag="KLTH0B03630g"
                     /db_xref="GeneID:8290780"
     mRNA            complement(<292423..>297858)
                     /locus_tag="KLTH0B03630g"
                     /product="KLTH0B03630p"
                     /transcript_id="XM_002551901.1"
                     /db_xref="GeneID:8290780"
     CDS             complement(292423..297858)
                     /locus_tag="KLTH0B03630g"
                     /note="similar to uniprot|Q07963 Saccharomyces cerevisiae
                     YLR024C UBR2 Cytoplasmic ubiquitin-protein ligase (E3)"
                     /codon_start=1
                     /product="KLTH0B03630p"
                     /protein_id="XP_002551947.1"
                     /db_xref="GeneID:8290780"
                     /db_xref="GOA:C5DCJ8"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ8"
                     /translation="MTPEVNSLREFLVSLPRLASYKYNPSIEYLLWKTLDECVKDGLS
                     SVNWLEKEQFFASQNWENGAYQALRLPENWRDSFFSTAAKSGLNHAGSSCNRLCSPTE
                     TVFYCFDCTRNPLYEICERCFDAQKHKGHRFTSRVVTRPEGRACHCGDPSGFNSGTNE
                     LLCKNEANNQVRSPNYNYDANLTSIFEQILDYLIDTIIFLKELYEEPNKTVMSDGKGC
                     PETTSTTCALQLYESDCSLHIKDLAYRISLLLNKPIEFGLMMVDKLQRDCSFITLFEC
                     ADTKKLAIIQDAFASENITLHVKATSNVFKEYLIDEIINWLYKLCLYSPSLTSKLSLR
                     LALSGAWNSGLLSTKHTPHDFSPFTSKIALLGGFVVPFEQRETFPWPKPWGFPFESDA
                     RHDPRILQVMHEYDKRLQETNSSGVTTRFTSILGSRLQTILVEEAALLPKIARFRILK
                     IVSSIFTITDDSRKCIAAQYIDVYPNLLYNAVACDSFSQKVSLMSSLSQHIFQVPEIA
                     NMIISSGFIERIIQFAFTLMSFSPEELTECPPVPLYGDFKLPTDMIKNKRSVVCFKDI
                     YLLMSTNTQPEMLLTNDSITQCMIRCFSAFNNVLPLRRETAEHVEFENFEFSSYFFYF
                     SSILVMVDGFIRNICLLEDPHARGRVVRHFLKLSLSKEFELLGNAKSLMPGKLSTSCE
                     LKTSNGLRVIREKVCNTISSVIQFQVGIDCQSFFNPMSYFFKFVTLWSQCGRYEPLPY
                     NFSDFFDIREVFGDKIQMNWMCESALSTIVLLAQINVGFWVRNGSPIQHQARMYTRYS
                     MREFTYFSDIFMLQLAMSIADPNEFMVTFLSRWGLKNWAEGIPIGDYPDAEITAGMVD
                     QLLLLLIQLFSEIRSLTMKSSVEGFEKTMQMEISHALCFKNSTHSEILNLIPEHVTKH
                     PAFDLYLREMADYAPPNGPVDAGIYTLKEKYFSLIDPYFIGFSPSKRFEAEKLIRKRL
                     SIETQTDYNMSYIPARDFASCLKETPYKNLYQICSTEIFGCFLKNTLDHINKFNYESM
                     LTKATHLVHLCVVNDLLGFTSIFWKEYGFSNSEYLYNSSIGSLLYSFLFKEEFVNEHG
                     KIREIFQHFMKYAPHVNIEGYLTEQTPSFNFEILKTPFKTTERKDEEYEKRKQLAKHK
                     REKIMKRIAKQQQKFLANNHISLEDESGSLCKNRDQGENQFFPEMTCVFCKMHKVNDT
                     FIYFAYLERNICEAEVELDWELSHARVSAIPKEGGRSHSNEAARDMDIVEMPQSLSSK
                     ISVFPVLRTCGHGSHVCCLTSHMKSTRTVHNHITKNIPSSLGFSLMFCPLCSALTNCF
                     LPRMCGDSSGSAPNPSEPIERNDPFESSLKNCNRSVAVLRELVQMDGVGESPIQVLNY
                     IYRNTLRNTELATRLKRPHRETVKECSDFASHQQLLTLRLLSDLRRIYSQFSEPKEYV
                     SPKEYSLFPPPFKYTPNQKSTKQECELDLLNLADYRILNTDFGSKVCVKEFLLEFINK
                     GLHQDFLAICGSIATKGSREVTACKHQLQKKTSFTSSEEKHVFCILRSYLSNFSTADL
                     TAVELATSITRGVLKDSMVIRLRRLFALLYFGGTPEFELKERIIDFGVLGDLLKGFDL
                     PDFSELLQNYIDRDLQQMLKHVELTLKEQGEEELIKNANALKIGCFKKNFLINLPQSY
                     SEFMSNEDEFLQMRAKKQEIAICLFCGSRVRVQNAVLLHNYSIGECTNHSLNVCRVNP
                     IYGCFLLVRSNTVYLSYGHRGTFYQAPYLNSHGETDDDYRNGAPVFLDRNRYLHLSQD
                     VILNNMVPHLVFRLTENTLDLGGWESL"
     gene            <298170..>303941
                     /locus_tag="KLTH0B03652g"
                     /db_xref="GeneID:8290781"
     mRNA            <298170..>303941
                     /locus_tag="KLTH0B03652g"
                     /product="KLTH0B03652p"
                     /transcript_id="XM_002551902.1"
                     /db_xref="GeneID:8290781"
     CDS             298170..303941
                     /locus_tag="KLTH0B03652g"
                     /note="similar to uniprot|P19812 Saccharomyces cerevisiae
                     YGR184C UBR1 Ubiquitin-protein ligase (E3) that interacts
                     with Rad6p/Ubc2p to ubiquitinate substrates of the N-end
                     rule pathway binds to the Rpn2p Rpt1p and Rpt6p proteins
                     of the 19S particle of the 26S proteasome"
                     /codon_start=1
                     /product="KLTH0B03652p"
                     /protein_id="XP_002551948.1"
                     /db_xref="GeneID:8290781"
                     /db_xref="GOA:C5DCJ9"
                     /db_xref="InterPro:IPR001841"
                     /db_xref="InterPro:IPR003126"
                     /db_xref="InterPro:IPR003769"
                     /db_xref="InterPro:IPR013083"
                     /db_xref="InterPro:IPR013993"
                     /db_xref="UniProtKB/TrEMBL:C5DCJ9"
                     /translation="MIREGSADFQLHLRRTLQLIQNEPHFKKAKGPKDRAELDKLLKS
                     FIFRYLYFIVSNNGKFLPQLFTSVPHEKFPATLQEALDVDRASISRHDPFYVIDDSVA
                     NESHRHTGRNCGRKFQAGEPIYRCKECSFDDTCVLCIHCFNAKDHINHHVYTSICTHV
                     NNGICDCGDVEAWNVPLNCKAETEDEGSESEGAFESPEMTYILELTLTEIFDHFLDVF
                     NQNIEPLPTMQRDITVKLRDMVQSEKSEEKEEFLQDLQYKNEDMQDLKKGLTEIEAPD
                     YTVLVYNDEYHNYSQATAALKQGVPDDKNTDKLTARIDGEGRAMLKCSKDISSVLSGF
                     FAVRTNGLSATLTAWSEYIQQEACKYIIAWVGHCLTIPNSSFQQGFRSAMGRVLCSGS
                     ERLPEAVDVSLLVDKHFPAKHSEEDPYRYANLSVLDRENVVPFSHHKVLAEGETDHIS
                     LTLNKTEPPSPKRYANSRLQLLLFFDNRYWKKLRKDIQDIVIPTMASSLEFKPIFCEQ
                     LVEIFNHMTRSVAFMDREPQLTVLRESVVQLFTCPTNAYSIFQSGSFCDIMWSVIDIF
                     TEFSKKDAGVLVWQKVKKTNPTKSYSISFKQNLYSVETILSKVSDPNLLLRPKEFIAI
                     VTLCKLFNGAWKIKRKEGEHVLREDQNFIPYLEYTTSIYSIVQTVDKILENKRDEVDE
                     TLLLQAIKLLSTFLGHRTPSQTVYDSHEIIKFKVSKQPVAFMNPVHTLMSFLIEKVPL
                     AKAFAALSGCNDFLTISDFSLRAVVLCSQIDVGFWVRNGMSVLRQSSYYKNNPEMACY
                     IRDVHLNQLTFLNEKDDLVRLIYNILDRWELLEWFNGKEDFDKTVYEDKIVYILQQFI
                     AFVYQLLTERQSFKIFKSPEEKEYYQIKRAIMYGLYMEPLSYSSLLSAVPEYLTESTD
                     QFDRALEDVSVYMGPKGLMDNGVFKLKPELYKRIDPLQLPNMGNDFEHSASIIKARLA
                     ESGEDPKNTVLEPQLISPKFLDESAKNLGAFTRTKVFAKVIYNLLRVSIDLDEGTFLY
                     ALLHLVHSILKDDELVNGKNSIPEVYISKPICNLLFIIIDIKSSVFSENVVAKADYLL
                     ESLIWKNPTSILESLVSSFGEECVERYKARKLHQGINFEESEKGRKRRLAKERQEKIL
                     SKFSRQQHKFMKENQSEFGSNDDDIEMADNGLSQAVEDYTCALCQDTSSVDAFVIPVY
                     HENTPIFRNGDIRNVKEFGVEWNRFQNNKDSATTYEEESVQNFREDGSKGSRKVFVSC
                     NHYIHYKCFKRYAQKKRFSTNSFICPLCQTFSNCVIPVAGYSPKPSESSIKELLQNSG
                     AKSNIDHLHQTDPNEDFNGVFNMFLEINKKNMYYDRHWATTPESQRPDVAYILAVHWA
                     NTISMLEVSARIADHPNDSLLQGKEQKFRTLKNVLSSIAWLHKVLGRPSKEIIPYVNG
                     EDTIWNQNQLFQFIVRRSLFSSEPITNVITGGLSVFSRQLLVDFLKGSTPNDVKMMRE
                     ASANFGGIHDIDNETLDVLRDVCDISVSDEDTCRQLYSLAFASLIKNVLPTIRRCLIL
                     LKAINMLIMKSDEASLIVNGINLELVTSSSTPEYINSVIGLITPFSSFNDLLRKSNSY
                     VKSVTDPYLSNIPYEFTGIVKLMDLAPHLNTYLTNSKEVKLREEHPARMRNAGNRLDF
                     KICLTCGVKVHARNDRTELVRHLANHCFKPFGLFLIPNLNEVTLILTNPRSSISISAP
                     YLNSHGEAGRNAIQRGDLTALSLQRYEHLNNVWLNSEVPGLISRVMGDEFRVLIVSNG
                     VVLNFNRNVLRPRRANAEEPDGDSSSSEAEDDDLEGGEVRWEIRPEEFFEEAGIRFEG
                     AGAIPGGDIRDFFQFINNLDTETDAFEEDEETGGEAQGLANAFVPRFEFLPNFRNFNA
                     RNEDEPDDEDEDEVNHPVSDDIE"
     gene            <304162..>304797
                     /locus_tag="KLTH0B03674g"
                     /db_xref="GeneID:8290782"
     mRNA            join(<304162..304164,304585..>304797)
                     /locus_tag="KLTH0B03674g"
                     /product="KLTH0B03674p"
                     /transcript_id="XM_002551903.1"
                     /db_xref="GeneID:8290782"
     CDS             join(304162..304164,304585..304797)
                     /locus_tag="KLTH0B03674g"
                     /note="similar to uniprot|P22289 Saccharomyces cerevisiae
                     YGR183C QCR9 7.3 kDa subunit 9 of the ubiquinol cytochrome
                     c oxidoreductase complex"
                     /codon_start=1
                     /product="KLTH0B03674p"
                     /protein_id="XP_002551949.1"
                     /db_xref="GeneID:8290782"
                     /db_xref="GOA:C5DCK0"
                     /db_xref="InterPro:IPR008027"
                     /db_xref="UniProtKB/TrEMBL:C5DCK0"
                     /translation="MAFSTIYNIFFKRNSIFVGTVFASSFVFQAAFDSAVTSWYEQHN
                     KGKLWKDVKAKLAQGGDDDDEDDEDDE"
     gene            complement(<305074..>305463)
                     /locus_tag="KLTH0B03696g"
                     /db_xref="GeneID:8290783"
     mRNA            complement(<305074..>305463)
                     /locus_tag="KLTH0B03696g"
                     /product="KLTH0B03696p"
                     /transcript_id="XM_002551904.1"
                     /db_xref="GeneID:8290783"
     CDS             complement(305074..305463)
                     /locus_tag="KLTH0B03696g"
                     /note="similar to uniprot|P53299 Saccharomyces cerevisiae
                     YGR181W TIM13 Translocase of the inner membrane
                     mitochondrial intermembrane space protein mediating import
                     and insertion of polytopic inner membrane proteins Subunit
                     of mitochondrial protein import machinery"
                     /codon_start=1
                     /product="KLTH0B03696p"
                     /protein_id="XP_002551950.1"
                     /db_xref="GeneID:8290783"
                     /db_xref="GOA:C5DCK1"
                     /db_xref="InterPro:IPR004217"
                     /db_xref="UniProtKB/TrEMBL:C5DCK1"
                     /translation="MELPLEAIPLYSQRTLSRTNDCSTFRMALSSIFGGASPSQQRTT
                     TSSSKASSVKEQLKTQIAQELAVANASELVNKVTENCFEKCLTNPYSNAEEGCVDQCL
                     AKYMRSWNVVSKAYVARIQQASTSGEI"
     gene            305780..305850
                     /locus_tag="KLTH0B03718r"
                     /db_xref="GeneID:8290784"
     tRNA            305780..305850
                     /locus_tag="KLTH0B03718r"
                     /product="tRNA-Gly"
                     /note="tRNA-Gly (GCC) cove score=62.63"
                     /db_xref="GeneID:8290784"
     gene            <306104..>306745
                     /locus_tag="KLTH0B03740g"
                     /db_xref="GeneID:8290785"
     mRNA            join(<306104..306125,306192..>306745)
                     /locus_tag="KLTH0B03740g"
                     /product="KLTH0B03740p"
                     /transcript_id="XM_002551905.1"
                     /db_xref="GeneID:8290785"
     CDS             join(306104..306125,306192..306745)
                     /locus_tag="KLTH0B03740g"
                     /note="highly similar to uniprot|P47064 Saccharomyces
                     cerevisiae YJL024C APS3 Small subunit of the
                     clathrin-associated adaptor complex AP-3 which is involved
                     in vacuolar protein sorting related to the sigma subunit
                     of the mammalian clathrin AP-3 complex suppressor of loss
                     of casein kinase 1 function"
                     /codon_start=1
                     /product="KLTH0B03740p"
                     /protein_id="XP_002551951.1"
                     /db_xref="GeneID:8290785"
                     /db_xref="GOA:C5DCK2"
                     /db_xref="InterPro:IPR000804"
                     /db_xref="InterPro:IPR011012"
                     /db_xref="InterPro:IPR016635"
                     /db_xref="InterPro:IPR022775"
                     /db_xref="InterPro:IPR027155"
                     /db_xref="UniProtKB/TrEMBL:C5DCK2"
                     /translation="MIHAVLIFNKKAQPRLVKFYTPVELPQQKLLIQQVYELISQRNS
                     EFQSSFLTTPPSLVHAGSDELSDDQDIQVIYKNYATLYFTFIVDDQESELAILDLIQT
                     FVESLDRCFAEVNELDLIFNWQTLESVLEEIVQGGMVIETSVAKIVSAVDQLNRSSSG
                     DNRAGRFAGAGLGNALQSIVQAGFSGWGANQ"
     gene            complement(<306845..>307276)
                     /locus_tag="KLTH0B03762g"
                     /db_xref="GeneID:8290786"
     mRNA            complement(<306845..>307276)
                     /locus_tag="KLTH0B03762g"
                     /product="KLTH0B03762p"
                     /transcript_id="XM_002551906.1"
                     /db_xref="GeneID:8290786"
     CDS             complement(306845..307276)
                     /locus_tag="KLTH0B03762g"
                     /note="weakly similar to uniprot|P37267 Saccharomyces
                     cerevisiae YGR174C CBP4 Essential for the expression and
                     activity of ubiquinol-cytochrome c reductase
                     ubiquinol--cytochrome-c reductase assembly factor"
                     /codon_start=1
                     /product="KLTH0B03762p"
                     /protein_id="XP_002551952.1"
                     /db_xref="GeneID:8290786"
                     /db_xref="InterPro:IPR012420"
                     /db_xref="UniProtKB/TrEMBL:C5DCK3"
                     /translation="MDKPLWLRWLRVYIAGGAIIGVGAVLFKYTTPTDEELINSLSPE
                     LRLQYERERQLRQAEQKELMNIVRETAKSDDPIWKTGAINSPWEKNSSEQSREQFQRV
                     KAEEIQKEELQRIRQELQQIRADSVAKTQEEVKKSAGWKFW"
     gene            complement(<307535..>309028)
                     /locus_tag="KLTH0B03784g"
                     /db_xref="GeneID:8290787"
     mRNA            complement(<307535..>309028)
                     /locus_tag="KLTH0B03784g"
                     /product="KLTH0B03784p"
                     /transcript_id="XM_002551907.1"
                     /db_xref="GeneID:8290787"
     CDS             complement(307535..309028)
                     /locus_tag="KLTH0B03784g"
                     /note="highly similar to uniprot|P32476 Saccharomyces
                     cerevisiae YGR175C ERG1 Squalene epoxidase catalyzes the
                     epoxidation of squalene to 2 3-oxidosqualene plays an
                     essential role in the ergosterol-biosynthesis pathway and
                     is the specific target of the antifungal drug terbinafine"
                     /codon_start=1
                     /product="KLTH0B03784p"
                     /protein_id="XP_002551953.1"
                     /db_xref="GeneID:8290787"
                     /db_xref="GOA:C5DCK4"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR013698"
                     /db_xref="UniProtKB/TrEMBL:C5DCK4"
                     /translation="MSGGKATNTDLKNADASITYDAIIVGCGVIGPCVATGLARKGKK
                     VLIVEREWSMPDRIVGELMQPGGVRALRSLGMVQSINDIEAIPVTGYTVFYNGEKVAI
                     PYPYKADIAPVEKVPKLVRDGNDKVTEDKTIHVKDFEEDERERGVGFVHGKFLQNLRA
                     IVAEEPNVTRLQGNVVEILKNGHNEVVGAKVDIDGRGKVEFKAHITFVCDGIFSKFRK
                     ELSTDHVPTVGSSFVGMSLFHAKMPSPNHGHVILGTEHMPILVYQISPEETRILCAYN
                     SPKLPSDVKAWMTKKVQPYIPESLRPSFDEALAQGKFRSMPNSYLPGRQNNVIGMCVI
                     GDALNMRHPLTGGGMTVGLNDVVLLMKKIGDLDFSDREVVLDELLDYHYERKSYDSVI
                     NVLSIALYSLFAADSKDLKVLQKGCFKYFKRGGDCVKLPVSFLSGVMPRPFLLTRVFF
                     AVAFYAVYVNFQERGMAGFPVALIEAFSILFTAARVFTPYLYTEMIG"
     gene            complement(<309522..>311090)
                     /locus_tag="KLTH0B03806g"
                     /db_xref="GeneID:8290788"
     mRNA            complement(<309522..>311090)
                     /locus_tag="KLTH0B03806g"
                     /product="KLTH0B03806p"
                     /transcript_id="XM_002551908.1"
                     /db_xref="GeneID:8290788"
     CDS             complement(309522..311090)
                     /locus_tag="KLTH0B03806g"
                     /note="similar to uniprot|P40353 Saccharomyces cerevisiae
                     YOR377W ATF1 Alcohol acetyltransferase with potential
                     roles in lipid and sterol metabolism responsible for the
                     major part of volatile acetate ester production during
                     fermentation"
                     /codon_start=1
                     /product="KLTH0B03806p"
                     /protein_id="XP_002551954.1"
                     /db_xref="GeneID:8290788"
                     /db_xref="GOA:C5DCK5"
                     /db_xref="InterPro:IPR010828"
                     /db_xref="UniProtKB/TrEMBL:C5DCK5"
                     /translation="MTTSQADTKLEELEKRGHARRLGNLENYFALGQRQDLYSNFGMF
                     CELDRACSENELAEALRGMCLEYPLLLHTVLEKKEAQDVNFYQTSEYLSKPWPQHDYI
                     RVLQRVRFADVLLNDQEEYAEIVNAALKEFASNGGQYSSEVFELINKVRIPYCHNSRP
                     NWRIMCFPEEGNAQSREWRKILLLSNHCSSDGMSSANFFHDLQDHLNNLPPSLPQADV
                     IFDYSQDHETLGKLPAPIETQISYVGPKSYFAQLVGNQVLREYFGYKSPTPPIPRVNE
                     PGGNDFYSYFLKITPSEVAAVKKKLKNKLDPSCTLTPFFQACWFAALYKSGIVFSKSF
                     SQQLSNIMVAMNTAQLLPEDKQLKKQYRYGANVGGSHYNYQISSFNVADKPEAFWKLV
                     RYYQDVFVDAKRKKHFLYPLGALMIDSIYKTKNIDLAVTNSILGKSRLGTMLSNVGYF
                     PQKARATVGGFHIQDLIFAQTTGSFRFTFDINLCATDIGGLNITACVAEGALPTREDW
                     KKLCELFKTIILES"
     gene            complement(<311528..>313060)
                     /locus_tag="KLTH0B03828g"
                     /db_xref="GeneID:8290789"
     mRNA            complement(<311528..>313060)
                     /locus_tag="KLTH0B03828g"
                     /product="KLTH0B03828p"
                     /transcript_id="XM_002551909.1"
                     /db_xref="GeneID:8290789"
     CDS             complement(311528..313060)
                     /locus_tag="KLTH0B03828g"
                     /note="similar to uniprot|P40992 Saccharomyces cerevisiae
                     YJL025W RRN7 involved in the transcription of 35S rRNA
                     genes by RNA polymerase I member of yeast Pol I core
                     factor (CF) also composed of Rrn11p Rrn6p and TATA-
                     binding protein"
                     /codon_start=1
                     /product="KLTH0B03828p"
                     /protein_id="XP_002551955.1"
                     /db_xref="GeneID:8290789"
                     /db_xref="InterPro:IPR021752"
                     /db_xref="UniProtKB/TrEMBL:C5DCK6"
                     /translation="MSTFFRGPVCGTDNCRSRLWRIIDGRRTCQYGHVMEGDVEFNDD
                     EDDINSMGVITRRLNLTTNATGSFRSSMNSQSQLSQKEDANQKVYGAEGERLFLRCFQ
                     YILKLQCTWLIEHQNFPPVFTDVVKLMWMRFIRSLEIADQRSATGDDNGGTSMQVPGK
                     KPRLSLLSSICLLYMANTHLRMPVHSCDYIRWICSMKLVYFKANLHLPALWRKQLPNY
                     YHQVLEGGKTPSEGQFFHKLAHMCFAVQLSSCFSTYVSYEALTLKLLFAVKLPPQILF
                     DVKELIRISGESDSSFCLYENHRERVERLYQCSDLRIAAYFILAVRYKILQDDPFFVN
                     YCLAWLEIEGSEDSPAATEDLVTKLSHDAASLHQNNHRWSDQQTTDYLDWMEQHFLPA
                     STKTQTEAQTIDHRIASKKLYSMFPLEKAPTGSAEDRATRPSYVDKTQEAYLEISDAL
                     AHGVRVPRQKQTPMLAQLAEAKLLREISYRFAVSQPQLRECLGHLQSRICKTRNSMNC
                     AS"
     gene            complement(<313316..>315457)
                     /locus_tag="KLTH0B03850g"
                     /db_xref="GeneID:8290790"
     mRNA            complement(<313316..>315457)
                     /locus_tag="KLTH0B03850g"
                     /product="KLTH0B03850p"
                     /transcript_id="XM_002551910.1"
                     /db_xref="GeneID:8290790"
     CDS             complement(313316..315457)
                     /locus_tag="KLTH0B03850g"
                     /note="similar to uniprot|P53297 Saccharomyces cerevisiae
                     YGR178C PBP1 Protein interacting with poly(A)- binding
                     protein Pab1p likely involved in control of the extent of
                     mRNA polyadenylation"
                     /codon_start=1
                     /product="KLTH0B03850p"
                     /protein_id="XP_002551956.1"
                     /db_xref="GeneID:8290790"
                     /db_xref="InterPro:IPR009604"
                     /db_xref="InterPro:IPR025852"
                     /db_xref="UniProtKB/TrEMBL:C5DCK7"
                     /translation="MKGTYSGKRREGNGNSNNGINRNPNANTSSGAFYETEETTKNFN
                     DRLNYLLATSISTEATVTVTTGVKYSGILAACNPEGSNGVDVVLKFPKVIDKGFATSN
                     IDQLASDLKENLVIKGEDVAELQLHDVNFSGEGKVGKEAKEESGQKAEVKAEFKPSSK
                     LAGPATERKIKAEFKTDTDISGANTVIKERELEKWVPDDHETFDMNESLEDSTTSWNQ
                     FAVNEEKFGVTSTFDEHLYTTRINKDDPNYLHRLKEADRIAKEIESQGASGNVHLAEE
                     RGIIVDDSGIDEEDKYSGVDRRGDELLAALKLNAKSNPPKAKKYVPPTLRSQPHNADP
                     AIISSKAAVISPQTVHPKEHKNQELAPEGGHSHSRKKNQLDELKEFSEKFKVPYEMPE
                     EVKAMLKKSSENSPKAPQAALKVNPSLPPKPTSTPPTNPNSSASSKNARATRDLTPSA
                     NKAELRKPPARMSQGHTPVHSPSSGRHANISRRRNISQGSFFGSKCPLANKKDFSKNF
                     NMFIKGKEAFEQNRAAGKSKGGAASVFVIEKPYFTAPTWFSNVEQSYRTMFPDEHTAI
                     QRSQMKMQQRSMSAMSSPGSPHMMGVPGMMMGMPMGPSGSPNPYMMAPNASANMYMPF
                     QPPAFYPPVMQMMPMGDERGGSGTPPPQNTGSPLGGPTFMNAGPGGPIPPFNYSAAAP
                     FQPVMGSRSFRQGFQNQSYQNHHNRHRAHDR"
     gene            complement(<315749..>316837)
                     /locus_tag="KLTH0B03872g"
                     /db_xref="GeneID:8290791"
     mRNA            complement(<315749..>316837)
                     /locus_tag="KLTH0B03872g"
                     /product="KLTH0B03872p"
                     /transcript_id="XM_002551911.1"
                     /db_xref="GeneID:8290791"
     CDS             complement(315749..316837)
                     /locus_tag="KLTH0B03872g"
                     /note="weakly similar to uniprot|P53298 Saccharomyces
                     cerevisiae YGR179C OKP1 Outer kinetochore protein required
                     for accurate mitotic chromosome segregation forms a
                     complex with Mcm21p and Okp1p that binds to centromeres
                     via the CBF3 complex"
                     /codon_start=1
                     /product="KLTH0B03872p"
                     /protein_id="XP_002551957.1"
                     /db_xref="GeneID:8290791"
                     /db_xref="UniProtKB/TrEMBL:C5DCK8"
                     /translation="MSLQKPLLDAIVESDHEGSVMVDHATDDSTSEVDESFVQLDGDE
                     FRLDQEARRKGPVGKKLFVEEDSIAESPLRNGLLGPSLIASSPQKSDLESPSKRVQFK
                     HHIDSASEEEPISEQPIDQWNFKDLIGDRFRERLPETDLKAWQRPSKRLLNSITDILE
                     NNIDLALEATFEKYEAECERLAIGRSVKHIRRDKERMLHKTIGKIERQLQSSKFPSRV
                     KDRDFDIEYIYAKRTFIQNSFSQELEHTDSVEHQVLREQKALEDLKHVQAKLSNRALR
                     QTKLLTEQLSHNLHPALSKAMVNSFGLIGDNAINKERYKKDVDELNLKLADPSAGVTH
                     SLLHKYLPSLKNYEKTAEKLQGSLPNLN"
     gene            complement(<317072..>318892)
                     /locus_tag="KLTH0B03894g"
                     /db_xref="GeneID:8290792"
     mRNA            complement(<317072..>318892)
                     /locus_tag="KLTH0B03894g"
                     /product="KLTH0B03894p"
                     /transcript_id="XM_002551912.1"
                     /db_xref="GeneID:8290792"
     CDS             complement(317072..318892)
                     /locus_tag="KLTH0B03894g"
                     /note="weakly similar to uniprot|P53283 Saccharomyces
                     cerevisiae YGR138C TPO2 Polyamine transport protein"
                     /codon_start=1
                     /product="KLTH0B03894p"
                     /protein_id="XP_002551958.1"
                     /db_xref="GeneID:8290792"
                     /db_xref="GOA:C5DCK9"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DCK9"
                     /translation="MASISSSELESIQSHAQEYTPHQEKVSGDGATGAQTHRMMSKES
                     DEAELRKLLTAHSRGVQKRLSRLESNTHGIGPVEPPLDLERRETRPAPDSTFHEQDKW
                     KYPIDEETGMRIVEFIDDDSEDPRNWPTRQKWNYTVLLGIICFDVAMMSAIITGDMDS
                     PAAYFGVSMEVMCLCVSLMVWGFGLGPMLFAPLSEEFGRNPVYLVTLFIAVVFIVPCG
                     AAKNIGTLLAFRFLDGLAFSAPMCLIGGSLSDMWRNKERGVAMSLFSAAPFLGPVMGP
                     IVGSLLSVKCSWRWVYWFMVIFSGCLYAVMAVFLPETHHQTLLKKRAKKLRKLTGDPS
                     YRAICEIKVRSMKEVAQETLFRPLVLLTELIVFLITMYMSVIYGLLYMFFFAYPMVYT
                     EGKHYGAIKTSIMFIPVGAGVIGSTVAAPFLNKDYVKRAQRYLDRGEVPPAELRLIPM
                     MIGCWFVPAGLFAYAWSSYPRLSWAGPCFSGFACGFGFNMLYNPANNYIVDSYQHYAA
                     SGLAAKTFVRSMWGGAVPLFTIQMYRRLNYEWASTLMAFISLACCAIPYLFYFYGARI
                     RQKSKYAYSPSVDTTNTTRTDIENQAAGSHSSNSEGSSKV"
     gene            <320151..>321128
                     /locus_tag="KLTH0B03916g"
                     /db_xref="GeneID:8290793"
     mRNA            <320151..>321128
                     /locus_tag="KLTH0B03916g"
                     /product="KLTH0B03916p"
                     /transcript_id="XM_002551913.1"
                     /db_xref="GeneID:8290793"
     CDS             320151..321128
                     /locus_tag="KLTH0B03916g"
                     /note="highly similar to uniprot|P32318 Saccharomyces
                     cerevisiae YGR144W THI4 Protein required for thiamine
                     biosynthesis and for mitochondrial genome stability"
                     /codon_start=1
                     /product="KLTH0B03916p"
                     /protein_id="XP_002551959.1"
                     /db_xref="GeneID:8290793"
                     /db_xref="GOA:C5DCL0"
                     /db_xref="InterPro:IPR002922"
                     /db_xref="InterPro:IPR027495"
                     /db_xref="UniProtKB/TrEMBL:C5DCL0"
                     /translation="MSTTTTNTETAQLQVSAGTIRHALSDVVKQEDWSDFQFAPIRES
                     TVSRAMTSRYFQDMDKFAVSDVVIVGAGSSGLSAAYVIAKNRPDLKVACVESNVAPGG
                     GAWLGGQLFSAMIMRKPAHLFLDELELPYEDEGDYVVVKHAALFTSTVLSKVLLFPNF
                     KLFNATAVEDLVTRPADDNTGGVSVAGVVTNWTLVSMAHDLQSCMDPNVIELSGYQND
                     GTRDPSKKHGVILSTTGHDGPFGAFSAKRIVSIDKNKKLGGMKGLDMNRAEAGVVKGA
                     GAYSGVANMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAAEEILRHFAE"
     gene            complement(<321488..>322699)
                     /locus_tag="KLTH0B03938g"
                     /db_xref="GeneID:8290794"
     mRNA            complement(<321488..>322699)
                     /locus_tag="KLTH0B03938g"
                     /product="KLTH0B03938p"
                     /transcript_id="XM_002551914.1"
                     /db_xref="GeneID:8290794"
     CDS             complement(321488..322699)
                     /locus_tag="KLTH0B03938g"
                     /note="highly similar to uniprot|P09938 Saccharomyces
                     cerevisiae YJL026W RNR2 Ribonucleotide-diphosphate
                     reductase (RNR) small subunit the RNR complex catalyzes
                     the rate-limiting step in dNTP synthesis and is regulated
                     by DNA replication and DNA damage checkpoint pathways via
                     localization of the small subunits"
                     /codon_start=1
                     /product="KLTH0B03938p"
                     /protein_id="XP_002551960.1"
                     /db_xref="GeneID:8290794"
                     /db_xref="GOA:C5DCL1"
                     /db_xref="InterPro:IPR000358"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="InterPro:IPR012348"
                     /db_xref="UniProtKB/TrEMBL:C5DCL1"
                     /translation="MVNAKETPSKAAASALSDLELKDSKNNLSGRLGAVPESAGEDAA
                     ALELKLSQAAEQHRQFLKSHHVHRHQLKEMEKEEPLLMENKRRFVLFPIKYHEIWQAY
                     KRAEASFWTAEEIDLSKDLHDWNNRMNENERFFISRVIAFFAASDGIVNENLVENFSA
                     EVQSPEAKCFYGFQIMMENIHSETYSLLIDTYIKDPKESDFLFNAIETIPQIKEKAEW
                     AIRWIQDEDALFAERLVAFAAVEGVFFSGSFAAIFWLKKKGLMPGLTFSNELICRDEG
                     LHTDFACLLFAHLKNKPDPAIIERIITEAVEIEQRYFRDALPVSLLGMNADLMNQYVE
                     FVADRLLVALGNQKFYNVTNPFDFMENISLAGKTNFFEKRVSDYQKAGVMAKSTKAET
                     EGGEFAFDEDF"
     gene            complement(323080..323192)
                     /locus_tag="KLTH0B03960r"
                     /db_xref="GeneID:8290795"
     tRNA            complement(join(323080..323123,323155..323192))
                     /locus_tag="KLTH0B03960r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAA) cove"
                     /db_xref="GeneID:8290795"
     gene            <323351..>323989
                     /locus_tag="KLTH0B03982g"
                     /db_xref="GeneID:8290796"
     mRNA            <323351..>323989
                     /locus_tag="KLTH0B03982g"
                     /product="KLTH0B03982p"
                     /transcript_id="XM_002551915.1"
                     /db_xref="GeneID:8290796"
     CDS             323351..323989
                     /locus_tag="KLTH0B03982g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B03982p"
                     /protein_id="XP_002551961.1"
                     /db_xref="GeneID:8290796"
                     /db_xref="UniProtKB/TrEMBL:C5DCL2"
                     /translation="MPCSFILYVPYTPCVRALRAPYTSRVLSDALLSELSGSSDVRPW
                     LRSRLNTCSISVSLYIHLMPAYPTTPSAPNPARYPKNCEGGVSALCSWLALCDMLVRR
                     LTAILQEAGLIMWCAGVLVCYCALAGSAGPGRYVRAASPPLYTAATGLCAPTPVPRDA
                     EQSALAGSNAGGRARRNLKAAPQTGRQGRHNGAIYSGSIHKGYVETGTDAHT"
     gene            complement(<324153..>324614)
                     /locus_tag="KLTH0B04004g"
                     /db_xref="GeneID:8290797"
     mRNA            complement(<324153..>324614)
                     /locus_tag="KLTH0B04004g"
                     /product="KLTH0B04004p"
                     /transcript_id="XM_002551916.1"
                     /db_xref="GeneID:8290797"
     CDS             complement(324153..324614)
                     /locus_tag="KLTH0B04004g"
                     /note="highly similar to uniprot|P36010 Saccharomyces
                     cerevisiae YKL067W YNK1 Nucleoside diphosphate kinase
                     catalyzes the phosphorylation of nucleoside diphosphates
                     into the corresponding triphosphates for nucleic acid
                     biosynthesis"
                     /codon_start=1
                     /product="KLTH0B04004p"
                     /protein_id="XP_002551962.1"
                     /db_xref="GeneID:8290797"
                     /db_xref="GOA:C5DCL3"
                     /db_xref="InterPro:IPR001564"
                     /db_xref="InterPro:IPR023005"
                     /db_xref="UniProtKB/TrEMBL:C5DCL3"
                     /translation="MSSQTERTFIAIKPDGVQRGLVAKILARFEDRGFKLVAVKLLRP
                     SQELLRQHYAEHVDKPFFPKMSAFMSSGPVLATVWEGKDAVRQGRVILGATNPLNSAP
                     GTIRGDFAIDMGRNVCHGSDSVESAQREIALWFQPEELVEWTPAQAAWVYE"
     gene            <325075..>325740
                     /locus_tag="KLTH0B04026g"
                     /db_xref="GeneID:8290798"
     mRNA            <325075..>325740
                     /locus_tag="KLTH0B04026g"
                     /product="KLTH0B04026p"
                     /transcript_id="XM_002551917.1"
                     /db_xref="GeneID:8290798"
     CDS             325075..325740
                     /locus_tag="KLTH0B04026g"
                     /note="some similarities with uniprot|P11746 Saccharomyces
                     cerevisiae YMR043W MCM1 Transcription factor involved in
                     cell-type-specific transcription and pheromone response
                     plays a central role in the formation of both repressor
                     and activator complexes"
                     /codon_start=1
                     /product="KLTH0B04026p"
                     /protein_id="XP_002551963.1"
                     /db_xref="GeneID:8290798"
                     /db_xref="GOA:C5DCL4"
                     /db_xref="InterPro:IPR002100"
                     /db_xref="UniProtKB/TrEMBL:C5DCL4"
                     /translation="MSDTGVDDKELSAGPQPQPQQKERRKIEIKFIQDKTRRHITFSK
                     RKHGIMKKAYELSVLTGTQVLLLVVSETGLVYTFTTPKFQPIVTQPEGKNLIQACLNA
                     PEEDEDAEEEEDDDEDADDDDDAAKLPSAHQQVPMAGAPPQQHGQQPHQQQQQQVQQH
                     AHAHAHAHAQQHPHQQQQQQQPPQAAAAAAYGNPAAAYLSADQAAVYQQYFNGVNPQQ
                     GQY"
     gene            <326073..>327434
                     /locus_tag="KLTH0B04048g"
                     /db_xref="GeneID:8290799"
     mRNA            <326073..>327434
                     /locus_tag="KLTH0B04048g"
                     /product="KLTH0B04048p"
                     /transcript_id="XM_002551918.1"
                     /db_xref="GeneID:8290799"
     CDS             326073..327434
                     /locus_tag="KLTH0B04048g"
                     /note="weakly similar to uniprot|Q04213 Saccharomyces
                     cerevisiae YMR044W IOC4 Member of a complex (Isw1b) with
                     Isw1p and Ioc2p that exhibits nucleosome-stimulated ATPase
                     activity and acts within coding regions to coordinate
                     transcription elongation with termination and processing
                     contains a PWWP motif"
                     /codon_start=1
                     /product="KLTH0B04048p"
                     /protein_id="XP_002551964.1"
                     /db_xref="GeneID:8290799"
                     /db_xref="InterPro:IPR000313"
                     /db_xref="UniProtKB/TrEMBL:C5DCL5"
                     /translation="MPPKKHIYQPTDIVLAKVKGFPAWPALVVPEEIAPANVLEERPG
                     RPTVEELDDEQNPENFIPYSDTLRFRKNFKPHNSYLLKFLCDDSYIWLKPTDFKPLTP
                     EQCDAWLSKSSKKSKKLIPAFELARRGTHGPDAIDVLEFVQYGSSGKPAEEEYVEPAA
                     EQEEEDEEEGEAEPAAEQEPLDEDADADADQESPLSELPSSGSDSDFEDDTTHRRRPV
                     RGTRQSKRTRARTNEREPELQELQDEPAPKKARSHKKKQPQKVEVEKYKFEDDEDWSI
                     VGLGPQDPPVSKFNSLVNKLSQKRNLEVHNEFKADLRDRLGIVNKMLVGIVFDTKRKS
                     VTEDLHVLLDELEQCSALRGTQDELITVFLSDHELVINISALFNLKQDQLREAGLYDK
                     LQQWYSQIYGGQFVADPVAWSLDKINDVHAPPQEDAPSAADAASNGAGPAAPPVTTSD
                     ANM"
     gene            complement(<327578..>331249)
                     /locus_tag="KLTH0B04070g"
                     /db_xref="GeneID:8290800"
     mRNA            complement(<327578..>331249)
                     /locus_tag="KLTH0B04070g"
                     /product="KLTH0B04070p"
                     /transcript_id="XM_002551919.1"
                     /db_xref="GeneID:8290800"
     CDS             complement(327578..331249)
                     /locus_tag="KLTH0B04070g"
                     /note="weakly similar to uniprot|Q02629 Saccharomyces
                     cerevisiae YKL068W NUP100 Subunit of the nuclear pore
                     complex (NPC)"
                     /codon_start=1
                     /product="KLTH0B04070p"
                     /protein_id="XP_002551965.1"
                     /db_xref="GeneID:8290800"
                     /db_xref="GOA:C5DCL6"
                     /db_xref="InterPro:IPR007230"
                     /db_xref="InterPro:IPR025574"
                     /db_xref="UniProtKB/TrEMBL:C5DCL6"
                     /translation="MFGSTGTAFGNSGSTPFGSAATPATTGASPFGSAAPNPTPAFGA
                     AQPSNAASGFGGFGAANSNPSAGGTGLFGMSNNSNSSSSTTGAAAPFGQATSAPANGP
                     SLFGSAVPTGAPNTSVPGAAQGPGTAIKPFSTYTEKDATTGSNNVFQSISCMPEYRAY
                     SFEELRYQDYQANRRFPTGPVGSAGVASPFGAQTSSPFAQNNSTNTNAFGMVGNNNNN
                     NNNNTTGGLFGQNNTGAAGTSAFGQPAGGSLFGANNAANNSPFGLNKPASSGGLFGQP
                     SNTAAPGGSGLFGQSNNTAQGSGGLFGQNNNTGTTGSSMFGATNNAPGQQPGGLFGQP
                     STNTGGGLFGQNNNANANNSPFGQSNTNTGGGLFGQNPNNGAANSPFGQNNQAQAGGG
                     LFGNKSAPSGGLFGQNNNTSGGGLFGQANNTNNSPFGQNNNAGGGLFGQNNSGNTGGG
                     LFGQNNNNNNTTGGGLFGQNNNNNNNAGGGLFGQNNNNATGGGLFGQNTANNSTFGQN
                     SGSAPFGQSQQQGSSLFGNKPAGSGGLFGQNNTASTGFGQNNSSAGGGLFGQNNNNNS
                     TGNTGGLFGQNNTNTGSGLFGQNNSQQQQQQQPAGGLFGQNTQQNQGGLFGQNNANTG
                     GGLFGQNNQQQQQQPSGGLFGAKPATGATGGGLFGQNNNQQPPATGGLFGQNNNANQP
                     STSGGLFGNKPAGSTGGGLFGQNNTAGNTGTTGGGLFGQNNSTAANNSSGGGLFGAKP
                     ATNTGGGLFGNKPAGAPTTGGGLFGSKPAGTATGTTGGGLFGAKPAGAATGGLFGNTN
                     GTNNTNATGTQPGVSGGLFGNQQNQQQAAPGSQPSLQQTGANPYGTNELFSRVLIPDS
                     ITQPTKPSATKLNADFKKKASLSGAYRLAPKPLFAPRSASTSPVARLGSTTTSQSNGR
                     VLSVASSTDSLGREIVPANTGSSSIFTNESDELILSSNDTLFNPDKKSFKNLIINRKK
                     MEDTVDSKEDDQVLRITFKADGDSTSNEGVQGGAKTESTKIETPLYDDVQGTPLRQGS
                     RIDAPFKNSVSTPLAKTPLKSSNLASSSATSTTINEKPSGVIGDDISFMDDGYYISPS
                     LETLSSMTLLQLRKVSGLTIGRRDYGKIDFLEPVDLSNISLPALCGQLVVFEPKTCTV
                     CPNASMQPAEGEGLNVRARISTSGCYPVDKSTRKPIKDPNHPIIKRHINRLKSISDTK
                     FDSYDPQTGTWVFTVDSPV"
     gene            <332711..>333547
                     /locus_tag="KLTH0B04092g"
                     /db_xref="GeneID:8290801"
     mRNA            <332711..>333547
                     /locus_tag="KLTH0B04092g"
                     /product="KLTH0B04092p"
                     /transcript_id="XM_002551920.1"
                     /db_xref="GeneID:8290801"
     CDS             332711..333547
                     /locus_tag="KLTH0B04092g"
                     /note="weakly similar to uniprot|Q04659 Saccharomyces
                     cerevisiae YMR048W CSM3 Protein required for accurate
                     chromosome segregation during meiosis"
                     /codon_start=1
                     /product="KLTH0B04092p"
                     /protein_id="XP_002551966.1"
                     /db_xref="GeneID:8290801"
                     /db_xref="GOA:C5DCL7"
                     /db_xref="InterPro:IPR012923"
                     /db_xref="UniProtKB/TrEMBL:C5DCL7"
                     /translation="MSQQLQERFSDGTALSQDPDSSLLVDPTAINPSGLGPDGDAPLQ
                     DPTAVTTRVRRPQVKLTAEKLCSAKGLPAVMKHAPRRLRISKRRSSYDNLCHLLQFYQ
                     LWAHDLYPKAKFHDFVELCRNLGKTDPQLREYRIELLRQELEMGSALEEGAPAFPQER
                     SPAPEPTPDAPGIADLRSEPPSPAPAPAGADSDDDLIYNITRRAPARVLHDSDIDEDS
                     LMETQPPASSTAGDAPRSAESGPGPILNNNNNNNNNNKNNDDDDDDEDEDELAVMREM
                     GL"
     gene            complement(<333569..>335644)
                     /locus_tag="KLTH0B04114g"
                     /db_xref="GeneID:8290802"
     mRNA            complement(<333569..>335644)
                     /locus_tag="KLTH0B04114g"
                     /product="KLTH0B04114p"
                     /transcript_id="XM_002551921.1"
                     /db_xref="GeneID:8290802"
     CDS             complement(333569..335644)
                     /locus_tag="KLTH0B04114g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B04114p"
                     /protein_id="XP_002551967.1"
                     /db_xref="GeneID:8290802"
                     /db_xref="InterPro:IPR008429"
                     /db_xref="UniProtKB/TrEMBL:C5DCL8"
                     /translation="MNAAQPSEGRSYIQYGVLALSLASLLKKSLSPSKEPINALNCAQ
                     DEEKNITSTTFSQRVARRIISSALEKRSLKVGDLKKSQERLEYESSLKVLPQENETFV
                     EHTPPSVQSINITSTSHANGIPEYFLEEAPTLEALAYKNSKKAPKLLIPGWRAGTPLA
                     LEYYLSTNSSYDRADFSPQDSSAWRGSLDSLDLDEPQTISENFKFRVPEGFGNDFVYL
                     HLYLMTSCEGSEEVGYTNCEYVSKNTIPLSYKLTKTEKAAKKNLLASKKKTREDNIGY
                     ELSYMDDVPFWHPEITIYLGKPFGIVEADSVPKAMKSLISVDEGTKRDNLTGLAQRYS
                     PPVLYNNFWQMAHEMIEINTTTRELPINLRLEIPPAWKFRVYSTALHNLRELAMFGGA
                     SKANSSVFTLDHYKLVWLGTKTSVLALTVIATVLHSALGVLALKSDTAHWQKRENHIG
                     VSVRGLFANILMQALVMLYLLDNFEGTSSTVFVSQVVGFLIECWKVSTILKIQIVASR
                     EEASLNADTEVVMMPLARGKRLAISNKHLLNEEEKKTREYDATAFRILLKVFVPLILG
                     YAGFSLVYGEHKSWYSFFVRVMVGIVYTYGFLIQLPAVYINYKLKSVAHMSKRAFAYK
                     VVNTFIDDLFAFVAKMPWLHKIATFRDDVVFFIYLYQFWAYRVDYARTNEFGEPAAAP
                     GSEKAEKQE"
     gene            complement(<335902..>338352)
                     /locus_tag="KLTH0B04136g"
                     /db_xref="GeneID:8290803"
     mRNA            complement(<335902..>338352)
                     /locus_tag="KLTH0B04136g"
                     /product="KLTH0B04136p"
                     /transcript_id="XM_002551922.1"
                     /db_xref="GeneID:8290803"
     CDS             complement(335902..338352)
                     /locus_tag="KLTH0B04136g"
                     /note="similar to uniprot|Q04660 Saccharomyces cerevisiae
                     YMR049C ERB1 Protein required for maturation of the 25S
                     and 5.8S ribosomal RNAs homologous to mammalian Bop1"
                     /codon_start=1
                     /product="KLTH0B04136p"
                     /protein_id="XP_002551968.1"
                     /db_xref="GeneID:8290803"
                     /db_xref="GOA:C5DCL9"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR012953"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR028598"
                     /db_xref="UniProtKB/TrEMBL:C5DCL9"
                     /translation="MAKNQQAKRLSTTRSNSKGEAEKKRELEEESSDDELNVQGLIDD
                     EADESDEDYSEVDSEADETGQFQSAEEGEDGASEEEAGSDSDEEFNKLLAEEEPEDGS
                     EANESLEFSDASNSNSMVEKLSSIKLNMIPDQDEEVIRTKFSDGRPRTIKPEINPVYD
                     SDDSDVEVQNTIGNIPLSAYDEMPHIGYSINGKRIMRPAKGSALDQLLETIELPEGWT
                     GLLDKDTGASLNLSQEELELISKIQKNEKTDDSVDPYQPYVDWFTRHTETMPLTAVPE
                     PKRRFVPSKNEAKRIMKIVRAIREGRIIPPNKLKEMREEEESSHHYDLWGASDESDDH
                     VMNLRAPKLPPPTNEESYNPPEEYLLSKEEKEEWENQEPSERERNFVPQKFNALRKVP
                     GYVESVRERFERSLDLYLAPRVRKNKLNIDPESLIPELPSPKDLRPFPTRCSTIYRGH
                     EGRIRTLSIDPSGLWLATGSDDGSVRIWEILTGREVYKVQVVDPEAKSGDNVEAIEWN
                     PDKTTGILAIAAGENIFLIVPPIFGFEVENTGRTKIEDGFGFDTYGNSKTSNLNVNSD
                     DENDQPESTAVKSQVAQWHKASQKQAEKDIAVVITCRHTVKKLSWHRKGDYFVTVQPK
                     SGHTSVLIHQLSKHLSQSPFKKSKGIVMDAKFHPFKPQLFVCSQRYVRIYDLSQQALV
                     KKLMPGARWLSTIDIHPRGDNLLASSFDKRVLWHDLDLASTPYKTLRYHEMAVRKVAF
                     HKKLPLFCSASDDSIIHVFHATVYDDMLKNPLLVPLKKLEGHKVVNSLGVLDLVWHPR
                     EAWLFSAGADNTARLWTS"
     gene            338551..338624
                     /locus_tag="KLTH0B04158r"
                     /db_xref="GeneID:8290804"
     tRNA            338551..338624
                     /locus_tag="KLTH0B04158r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (AAC) cove score=65.28"
                     /db_xref="GeneID:8290804"
     gene            complement(<338704..>339237)
                     /locus_tag="KLTH0B04180g"
                     /db_xref="GeneID:8290805"
     mRNA            complement(<338704..>339237)
                     /locus_tag="KLTH0B04180g"
                     /product="KLTH0B04180p"
                     /transcript_id="XM_002551923.1"
                     /db_xref="GeneID:8290805"
     CDS             complement(338704..339237)
                     /locus_tag="KLTH0B04180g"
                     /note="similar to uniprot|P36088 Saccharomyces cerevisiae
                     YKL069W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B04180p"
                     /protein_id="XP_002551969.1"
                     /db_xref="GeneID:8290805"
                     /db_xref="InterPro:IPR000614"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR029016"
                     /db_xref="UniProtKB/TrEMBL:C5DCM0"
                     /translation="MGEQGEHHADYAHFDGLQREEALQLLLDSYAALAADQDNWVCNL
                     ANASSLLWHAYRSLPLDVNWAGFYISRTENKQELLLGPFQGKVACQTIRAGSGVCGAA
                     AQTKETQVVPDVNKFPGHIACDGETKSEIVVPILSDAGECLGVIDIDCLEYNGFGETD
                     KKHLEELANLISRTCKF"
     gene            complement(339997..340099)
                     /locus_tag="KLTH0B04202r"
                     /db_xref="GeneID:8290806"
     tRNA            complement(join(339997..340032,340064..340099))
                     /locus_tag="KLTH0B04202r"
                     /product="tRNA-Trp"
                     /note="tRNA-Trp (CCA) cove"
                     /db_xref="GeneID:8290806"
     gene            <340239..>340847
                     /locus_tag="KLTH0B04224g"
                     /db_xref="GeneID:8290807"
     mRNA            <340239..>340847
                     /locus_tag="KLTH0B04224g"
                     /product="KLTH0B04224p"
                     /transcript_id="XM_002551924.1"
                     /db_xref="GeneID:8290807"
     CDS             340239..340847
                     /locus_tag="KLTH0B04224g"
                     /note="similar to uniprot|P46671 Saccharomyces cerevisiae
                     YMR052W FAR3 Protein involved in G1 cell cycle arrest in
                     response to pheromone in a pathway different from the
                     Far1p-dependent pathway interacts with Far7p Far8p Far9p
                     Far10p and Far11p"
                     /codon_start=1
                     /product="KLTH0B04224p"
                     /protein_id="XP_002551970.1"
                     /db_xref="GeneID:8290807"
                     /db_xref="UniProtKB/TrEMBL:C5DCM1"
                     /translation="MENSADSFEYLLHLTKGLSTECRSTRQGTERIEHLVKRLAKLTQ
                     TSYEELSKNPGPQVLQKYRELGRESERDRLERENYALIYQIERQEYVCRRIWSLIDQV
                     EDLLESIKKFVVEQQGHRLRTENEFLETVVHSRMANLQVNTEDLVEAKNASRTKLDLL
                     TRELKDLCKQIDWNKMSDSEDATLLSRKVSEVESKYKLKLKS"
     gene            complement(<340919..>343189)
                     /locus_tag="KLTH0B04246g"
                     /db_xref="GeneID:8290808"
     mRNA            complement(<340919..>343189)
                     /locus_tag="KLTH0B04246g"
                     /product="KLTH0B04246p"
                     /transcript_id="XM_002551925.1"
                     /db_xref="GeneID:8290808"
     CDS             complement(340919..343189)
                     /locus_tag="KLTH0B04246g"
                     /note="weakly similar to uniprot|P46679 Saccharomyces
                     cerevisiae YMR053C STB2 or to uniprot|P36085 Saccharomyces
                     cerevisiae YKL072W STB6"
                     /codon_start=1
                     /product="KLTH0B04246p"
                     /protein_id="XP_002551971.1"
                     /db_xref="GeneID:8290808"
                     /db_xref="UniProtKB/TrEMBL:C5DCM2"
                     /translation="MQNDDPKTPATPRKLAAAHSSIPLSHQSPPAQDVECPPLTAFVF
                     PDLRAVYTMKLHEIPGIAFSEVTLFGFEIYIVEQWILERKHSTIIASYTGNSQDIVHA
                     VEFALPESPYFWPAPFKAYYDELITFSAPKWTDDGTLFVSTSSQIPSALNLLHVECGD
                     LRKIWNVLKVNLDLKRLHCGGRSAMLLCEPSSASCEKFAQLYKVVSPTKMSQDTESIS
                     LTHAVVELITLVQISLTYFDLLDLQYRDGILCSFTERAINDWWVLYGSVYLGISRPKH
                     EGTLGPTTVAALLSLVLTVFFKLTVVNCISSKEPFDEEAFHGGIYLFQKKHGLLKSNS
                     TSISVLDPIVLAKLFEVTPKVSNTDFFKIKKVVKSTVQDITGKGNPMQLANGILTTDL
                     DYLAKNVHGSILCFLWRGKNTKQSAQKLSSKRKFANITFNRGDPADEILKSNVYASKR
                     DDEIWEDFDDQNSSNSPRQESHQFDKDSIQRYSPKNEDLREAREVELSRKSDGRVFET
                     ELHRRPSVPYLPEDVGMLQMEYENAPRKNNLGNVKTRRRSLSTVQDAIETWANPFDPS
                     LIRLARNALRLEKEISWNQTQRTTKSEKDQLITPHMKRLRENHSELRSKLQGLEHLRE
                     TLNNKHSVVLGDISELDSLGSKLKYDVRILENRMRDVEERVAQFGSKLNSMARSMEDK
                     EACQLITSSFYNNPKKLDRYAREILEGAGRFKSHGVILNLWELTKSMPSPLLAEVQRI
                     WIYLCDRFAPQGHLRK"
     gene            <343801..>346512
                     /locus_tag="KLTH0B04268g"
                     /db_xref="GeneID:8290809"
     mRNA            join(<343801..343825,343937..>346512)
                     /locus_tag="KLTH0B04268g"
                     /product="KLTH0B04268p"
                     /transcript_id="XM_002551926.1"
                     /db_xref="GeneID:8290809"
     CDS             join(343801..343825,343937..346512)
                     /locus_tag="KLTH0B04268g"
                     /note="similar to uniprot|P37296 Saccharomyces cerevisiae
                     YMR054W STV1 Subunit of vacuolar-ATPase V0 domain one of
                     two isoforms (Stv1p and Vph1p) Stv1p is located in
                     V-ATPase complexes of the Golgi and endosomes while Vph1p
                     is located in V-ATPase complexes of the vacuole"
                     /codon_start=1
                     /product="KLTH0B04268p"
                     /protein_id="XP_002551972.1"
                     /db_xref="GeneID:8290809"
                     /db_xref="GOA:C5DCM3"
                     /db_xref="InterPro:IPR002490"
                     /db_xref="InterPro:IPR026028"
                     /db_xref="UniProtKB/TrEMBL:C5DCM3"
                     /translation="MTREEAIFRSADMTYVQLYIPLELSREVVCLLGNMGNVMFRDLN
                     TDLTTFQRGYVNQIRKFDDLERLIDYMSNVASRYSEATWKYVFHGDNDNATQHPSMNF
                     LMSSMHTHSLDTVSDLTAEITEFESRVRQLDESLVNLRKRLNTLIEHRHAAFECGRYM
                     EVNPGLRGRAARSQQHRDLEQLTVEDFRLSDDEVSETLSDTFSFDEVSEDNSVPSAGR
                     DLSAELEEGFRHRTTIIGSINRSKVETLNKILWRILRGNLFFHNIPIEEPLLEKGELV
                     QKDCFVVFTHGDVLLKKVKRVVESLNGTIFPGNEGRSTIKNLNTQIADLQQICQTTEQ
                     TLHTELLIVSDQLPMWRAVARREKLIYAALNLFRQESQGLVAEGWLPSTELLIVSNAL
                     KNHSENIGSENSAVVSVIKTSKKPPTYHRTNKFTQSFQAIVDAYGIATYKEVNPGLAT
                     IVTFPFMFAIMFGDTGHGAIVFLIALFLVLNEKKLAQAQNGEIFDMAFSGRYVILLMG
                     FFSIYTGLLYNDIFSLSMTFFKSGWKWNSGFKEGEAIEATNTGVYPFGLDYAWHGTEN
                     NLIFSNSYKMKLSILMGFIHMTYSLFFSLVNYRYFRSRVDIIGNFIPGFIFMQSIFGY
                     LSWAIIYKWSKDWIKDGKVAPGLLNMLINMFLAPGVVDEPLFRGQSYLQVFLLLCALI
                     CVPWLLLYKPLKLRAQNKAAISNGYQNIHDQNASESLLESQEDAGGEILVTDYDENHS
                     NTFEFGDIMIHQVIHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLWTMTIANAFSS
                     KDSGSPLAVIKVVFLFGMWFVLTVCILVLMEGTSAMLHSLRLHWVEAMSKFFEGDGYP
                     YEPFSFKALD"
     gene            complement(<346686..>349340)
                     /locus_tag="KLTH0B04290g"
                     /db_xref="GeneID:8290810"
     mRNA            complement(<346686..>349340)
                     /locus_tag="KLTH0B04290g"
                     /product="KLTH0B04290p"
                     /transcript_id="XM_002551927.1"
                     /db_xref="GeneID:8290810"
     CDS             complement(346686..349340)
                     /locus_tag="KLTH0B04290g"
                     /note="similar to uniprot|P36016 Saccharomyces cerevisiae
                     YKL073W LHS1 Molecular chaperone of the endoplasmic
                     reticulum lumen"
                     /codon_start=1
                     /product="KLTH0B04290p"
                     /protein_id="XP_002551973.1"
                     /db_xref="GeneID:8290810"
                     /db_xref="GOA:C5DCM4"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DCM4"
                     /translation="MKLSTFIGGLSVFGSIASGALLGFDAGQEFSKAMLVSPHAPLEL
                     VLTPDSKRKDVSGLAIKPWKNDIERVYGSGVDSAHVRAPEGALLHIKPLLGKQEEEDL
                     TFYHKSHPGITFVPTERGSIALKCFGHEYPVEQVLAMNLDETIGRANKLLAEKNGLDV
                     VDSLAITVPEFFNQDQRLALKSAAELPHGVKAQLVNDGMSVAIDFALKQRDFPPGERE
                     YYVFYDMGSGSTRASLFAIEQPLNKSEPLMIEFGGYGFDTTLGGAKFTQNVAELLKNK
                     FLEQNPAIRTEQLDRSARSLVRIHQAAEKAKLVLSANVDASVSIESLYDDIDFKAVIT
                     RQEFEDFSEDLTGRIVQPIEDALKNQFFENTVDTSNVKSLVLTGGSTRTPIVQKQLTH
                     YLGSDLIARNVNADESSVNGVTIRGIQLFKSFQTKAIDILDRSIFSYGIIVNGSASPV
                     EIFPRGSQYPNKTSFLIPPTNYTREFSIDLKENGNTFKKHVIETGPIQERFSEEICPQ
                     GVAFNATFTLSQERIFDLDSVEAICLHNSKNSTGLFKKLFSGGTPRQEQDTIGKGDLD
                     DIVPHKVKMLKTSESFTHVGPMSITEKLRVRQHIDDLNQKDKMRLQTQELLNALESIL
                     YSTRAFLEQEDVIAGGPRQDIDSLSEYVTVNLEWLDYESDEASVAELMEKIDHISSLK
                     DKIELYLMSSGEPLSFEQFSELHTNGSRLVQELRGIEVTANATLEALKDAFSEIGLDV
                     AKEFKKLKAPRHLSSPNYKLKDKIEAFEKNLADISSLLSAQDFDSFSREELFELKLIF
                     DSSFDDLRKRLELEQAIQNFKMNELASLHSRRLRVLKKREERRKSQESSTSLNASNST
                     LTSTTTESTKSEEEASKAEEFTIDHDEL"
     gene            <349547..>350941
                     /locus_tag="KLTH0B04312g"
                     /db_xref="GeneID:8290811"
     mRNA            <349547..>350941
                     /locus_tag="KLTH0B04312g"
                     /product="KLTH0B04312p"
                     /transcript_id="XM_002551928.1"
                     /db_xref="GeneID:8290811"
     CDS             349547..350941
                     /locus_tag="KLTH0B04312g"
                     /note="some similarities with uniprot|P36084 Saccharomyces
                     cerevisiae YKL074C"
                     /codon_start=1
                     /product="KLTH0B04312p"
                     /protein_id="XP_002551974.1"
                     /db_xref="GeneID:8290811"
                     /db_xref="GOA:C5DCM5"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR003954"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DCM5"
                     /translation="MSNSREKSRFSAGPAGEYDSRSSYRRDTRGPRRFDRGDMGGTDG
                     GRSRYGGRSSRNFENRSRYQGGGRYRQEPRYGDSRKPEDVDWSAVVSISQRRRMRETQ
                     WDMAPKGFEKVPAERAKLSGLFPLPGQPQDLDRSKLEGIVSSGVLTRRTRILFEDPTE
                     SNMSKTKYNQILILTSVGSSPAEMNQLAEYVKEFVKLVDETQELKEHKILQENRLYLR
                     FSSEEITTIALSCQKFIERKTGSKFIWQRPGECVEKKEPVDPICAGSVIALQELGDCT
                     EEGLQSDLNQSGVETNWLKLISLGKTNEFTGTALIDPKANVDELSHYKWIRPNDCKLR
                     QDFTEITFQQLPHLVARKDHAESRVIVLLNCVDPMDLKNDEFVKEIRDSMTSSKTMTA
                     LGEIESVKIPQPGADYRTSFESIEESVGKIYVKFKEQESAKAAMSQLSGVSFNDRTVL
                     CAYYSERDYNMDVL"
     gene            complement(<350971..>351879)
                     /locus_tag="KLTH0B04334g"
                     /db_xref="GeneID:8290812"
     mRNA            complement(<350971..>351879)
                     /locus_tag="KLTH0B04334g"
                     /product="KLTH0B04334p"
                     /transcript_id="XM_002551929.1"
                     /db_xref="GeneID:8290812"
     CDS             complement(350971..351879)
                     /locus_tag="KLTH0B04334g"
                     /note="similar to uniprot|P26448 Saccharomyces cerevisiae
                     YMR055C BUB2 Mitotic exit network regulator forms
                     GTPase-activating Bfa1p-Bub2p complex that binds Tem1p and
                     spindle pole bodies blocks cell cycle progression before
                     anaphase in response to spindle and kinetochore damage"
                     /codon_start=1
                     /product="KLTH0B04334p"
                     /protein_id="XP_002551975.1"
                     /db_xref="GeneID:8290812"
                     /db_xref="GOA:C5DCM6"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5DCM6"
                     /translation="MSSLEKFLGQQPLIVHSSLAQLRYLVLSEGIPLSKEKSAARLRC
                     NAWSVLARCSMDGATSDYVSLVRRGPPPHPIYSKIKNDTFRTLNTDPQFIACVSEDAI
                     TRCLSSFAWSVLDEEDEEFHLSTYVQGMNVLLAPILYTCPSEPMAFRLFRSLCQDHIK
                     TYLNQSLTGVHNGAKLLDMCLKVIDPKLSKFLADNLLTAEIYGIPSILTLSSCTKPLD
                     QVCKLWDFMFAYGFHMNILFIVAQLVVIRSRVLKSSAPMNLLRMFPEFDAEEIIRLGV
                     GFVAKLPSNLYDLLVQHLEDPNLVIE"
     gene            <353523..>355418
                     /locus_tag="KLTH0B04356g"
                     /db_xref="GeneID:8290813"
     mRNA            <353523..>355418
                     /locus_tag="KLTH0B04356g"
                     /product="KLTH0B04356p"
                     /transcript_id="XM_002551930.1"
                     /db_xref="GeneID:8290813"
     CDS             353523..355418
                     /locus_tag="KLTH0B04356g"
                     /note="similar to uniprot|P38993 Saccharomyces cerevisiae
                     YMR058W FET3 Ferro-O2-oxidoreductase required for
                     high-affinity iron uptake and involved in mediating
                     resistance to copper ion toxicity belongs to class of
                     integral membrane multicopper oxidases"
                     /codon_start=1
                     /product="KLTH0B04356p"
                     /protein_id="XP_002551976.1"
                     /db_xref="GeneID:8290813"
                     /db_xref="GOA:C5DCM7"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR008972"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="UniProtKB/TrEMBL:C5DCM7"
                     /translation="MIGSSWLLVMLAAVQSVAAETHVFNWTTGWGNYNVDGGAERPVI
                     TCNGEFPWPDVRVKKGDQVEVYLKNGFDDRNTSMHFHGLFQNGTNSMDGPPMVVQCPI
                     GPGDTFLYNFTVDDNVGTYWYHSHTAGQYQDGMRGAFVIEDDDFPYDYDEDVILQLGE
                     WYHDTTDVLNPKFMSVYNPTGAEPIPQNLIMNNTRNMTWEVQPDTTYLLRVINTGGFV
                     SQYFWIEDHEFDVVEVDGIYTEKNTTDMIYITTAQRYTLLLHTKNDTSRNYAIMTKFD
                     DTMLDLLPKDLQLNSTNYLIYNTSADKPTESYVDELAPLDDFYLVPYQKEEALGDPDY
                     RVVVNVTMDNLVSGINYAFFNNLTYTAPVVPTLFTVLSADEDDVKNPEIYGSNINAFV
                     LDKDEIVEIVLNNEDTGTHPFHLHGHAFQVMVRDVTYDDALGETPHAYDENDHPDFPE
                     YPMIRDTLYVRPQSNFVIRFKANNPGVWMFHCHIEWHLTQGLAIILIEDPESIKATQS
                     QQLSDNHKSVCANVGMATEGNAAGNTDDFFNLKGEPIQEKFIPDGFTAKGIVAMTFSC
                     LAGVLGLIMIAIYGLMDISNVEEKVIDELHLDADKVAAVDVDDVDDIDNDETSSISAA
                     REEVVNK"
     gene            <356395..>357537
                     /locus_tag="KLTH0B04378g"
                     /db_xref="GeneID:8290814"
     mRNA            <356395..>357537
                     /locus_tag="KLTH0B04378g"
                     /product="KLTH0B04378p"
                     /transcript_id="XM_002551931.1"
                     /db_xref="GeneID:8290814"
     CDS             356395..357537
                     /locus_tag="KLTH0B04378g"
                     /note="similar to uniprot|P36083 Saccharomyces cerevisiae
                     YKL075C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B04378p"
                     /protein_id="XP_002551977.1"
                     /db_xref="GeneID:8290814"
                     /db_xref="UniProtKB/TrEMBL:C5DCM8"
                     /translation="MKESIGPTCRCSKCNSLLKASPKATAKKPIRYRFNFMKHMDLRQ
                     SNYRTITSISYLTEKYGEKKAENIARFVRCIHKQINSGVNRISDLQASSILPWTRVRL
                     FLLLVTLSQRGGSDYWMGKEGEMKEPARPSEPRERKPQDKSKPYGTLIEEIMRQNIND
                     NYREADHDENYVFSSIWANFMEGLINHFLEKVIIPSSERKVCQQLYKPMMKIISLYNE
                     YNELMEKSERNGFLPPNQEPPAIISSDEATSIEDGKLQTAQRLLWQARQDIPKTISKE
                     LTLLSEMYSTLSADEQDFELDEFVCSAEEYIELEYLPSLIEVLFANGGTLNFWKIMIV
                     LEPFFYYIEEVADEESPCYDGDSAKPDPRVVTLEKICEVAAEQEWI"
     gene            complement(<357622..>358890)
                     /locus_tag="KLTH0B04400g"
                     /db_xref="GeneID:8290815"
     mRNA            complement(<357622..>358890)
                     /locus_tag="KLTH0B04400g"
                     /product="KLTH0B04400p"
                     /transcript_id="XM_002551932.1"
                     /db_xref="GeneID:8290815"
     CDS             complement(357622..358890)
                     /locus_tag="KLTH0B04400g"
                     /note="similar to uniprot|P36081 Saccharomyces cerevisiae
                     YKL077W"
                     /codon_start=1
                     /product="KLTH0B04400p"
                     /protein_id="XP_002551978.1"
                     /db_xref="GeneID:8290815"
                     /db_xref="InterPro:IPR028000"
                     /db_xref="UniProtKB/TrEMBL:C5DCM9"
                     /translation="MSYPIIKFFIRNNNDFDLKIIPQRDFSEQNTMLVPQSIALLLLA
                     WLSAVDARRNVIKPKETTTTSEIPKPWLRTIYSGQKEVVTPTVIAGVTFSAKPLATTN
                     GLEPWISLDQFGSPKTKRPQIKGAKTKDARPDYSTYFKTVATRTLSYDELKAHNMEED
                     EVYEEEVFTDEDDTYVSLNPIIRCTPDRYFKKGPAGDISSEPFCTPKENKELKVDNTY
                     FVSWYTKFFQKPDTDETIENVQLHLFYVKESIKDKGLKKRDLKAAFFSSGWLKNVDGI
                     YPLELTADFLDGAYDRKVLLAIQPDNIRDDEFNPWEHYVLFRMIMGPRVAKTTKQQKA
                     LQDAGISDDTWYYVALSIPTVVVIACVAMYFFLYLNRSHRDIHNVKDFAINQRRRVLG
                     KFKDFKKYKKINNRPYSELPTHTKKTGKQN"
     gene            <358915..>359253
                     /locus_tag="KLTH0B04422g"
                     /db_xref="GeneID:8290816"
     mRNA            <358915..>359253
                     /locus_tag="KLTH0B04422g"
                     /product="KLTH0B04422p"
                     /transcript_id="XM_002551933.1"
                     /db_xref="GeneID:8290816"
     CDS             358915..359253
                     /locus_tag="KLTH0B04422g"
                     /note="similar to uniprot|Q04675 Saccharomyces cerevisiae
                     YMR059W SEN15 Subunit of the tRNA splicing endonuclease
                     which is composed of Sen2p Sen15p Sen34p and Sen54p"
                     /codon_start=1
                     /product="KLTH0B04422p"
                     /protein_id="XP_002551979.1"
                     /db_xref="GeneID:8290816"
                     /db_xref="GOA:C5DCN0"
                     /db_xref="InterPro:IPR006677"
                     /db_xref="InterPro:IPR018593"
                     /db_xref="UniProtKB/TrEMBL:C5DCN0"
                     /translation="MDNQHIIKLVRNNLVHQQLWDDVEEAKLEDTDAWVLRGLPPHKL
                     SNDDPQLDHEWILPIELSQYKPGKLTLELMDKIFSELKCRRVTLGIVNDDGTVVYYFI
                     YKGLHKPKRN"
     gene            complement(<359264..>360151)
                     /locus_tag="KLTH0B04444g"
                     /db_xref="GeneID:8290817"
     mRNA            complement(<359264..>360151)
                     /locus_tag="KLTH0B04444g"
                     /product="KLTH0B04444p"
                     /transcript_id="XM_002551934.1"
                     /db_xref="GeneID:8290817"
     CDS             complement(359264..360151)
                     /locus_tag="KLTH0B04444g"
                     /note="similar to uniprot|P50110 Saccharomyces cerevisiae
                     YMR060C SAM37 Component of the mitochondrial outer
                     membrane sorting and assembly machinery (SAM) complex
                     required for the sorting of some proteins to the outer
                     membrane after import by the TOM complex"
                     /codon_start=1
                     /product="KLTH0B04444p"
                     /protein_id="XP_002551980.1"
                     /db_xref="GeneID:8290817"
                     /db_xref="GOA:C5DCN1"
                     /db_xref="InterPro:IPR019564"
                     /db_xref="UniProtKB/TrEMBL:C5DCN1"
                     /translation="MKATVHLWGLNGKPSIVSPESVALFWLLNDTQNDRNVTIVFSNN
                     TDLSPNQELPLLIDGDKKLYGYANIARHFSAEETALEMALLQFTQDHICVLTQYQLYL
                     NKNNYDSFTRRVFAYLLEWPLWYNTPLKYRALARKRCETLGYFGHDDDPEQVEQPNAE
                     LDGLVQSKAFKLTNASKARGEELLKSARYNLQYMSRLNRHVVSWREARARLDKDSTAA
                     DFLLWANLFVQMELPDGQLVKEQLQTALGPEDYESIIKRLNDCSKSTSTLELRGPFFA
                     EKGNVVMSAYHALQRLVAA"
     gene            <360380..>362344
                     /locus_tag="KLTH0B04466g"
                     /db_xref="GeneID:8290818"
     mRNA            <360380..>362344
                     /locus_tag="KLTH0B04466g"
                     /product="KLTH0B04466p"
                     /transcript_id="XM_002551935.1"
                     /db_xref="GeneID:8290818"
     CDS             360380..362344
                     /locus_tag="KLTH0B04466g"
                     /note="similar to uniprot|P25298 Saccharomyces cerevisiae
                     YMR061W RNA14 Cleavage and polyadenylation factor I (CF I)
                     component involved in cleavage and polyadenylation of mRNA
                     3' ends bridges interaction between Rna15p and Hrp1p in
                     the CF I complex"
                     /codon_start=1
                     /product="KLTH0B04466p"
                     /protein_id="XP_002551981.1"
                     /db_xref="GeneID:8290818"
                     /db_xref="GOA:C5DCN2"
                     /db_xref="InterPro:IPR003107"
                     /db_xref="InterPro:IPR008847"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:C5DCN2"
                     /translation="MSATPEIVKNGSAGFIRPTKRQIRPEEDVEGRLRDVIEERPGDI
                     CTYLELARLLQSRDQQEEARGVFDQLHERFPLFSPLWTVEVGYDLERDEFSHAGSLLT
                     RCLSGTLENNDLGLWFMYLDFVRRKNNLITGGEEARGVVLKAFDAVATKCASWEPRSS
                     AFWNEYLSFLEHWKPVSKWEEQQRIDLTRSLYKRMLCIPFDGLERSWNKYTQWEQEVN
                     SLTARKFIGELSANYMKARSLYREWNNITKGIKRVLPSRLSQCSKQTIPQPGEYQVEQ
                     IHLWMDWIKWELQNKLDLPDEFHSQRVDYVYKQAIQHLLFSPEIWYNYSMYASPENAR
                     EILIQGLKASPGSTTLTFKLSEHFELQNEVEQMQKCFERCIDHLVLEYHIMSDEGQET
                     YSQRQKITFVYCIYMNAMKRVSGLSSARKVFGKCRKLKDLLTHEIYIENAYLEFHNNN
                     DHKTACKVLELGLKYFSSSGEYVNKYLDFLILINQDGLIKPLFESSLDRIIDLDELQR
                     IYKKVINYESKFGNLTNAYSIENRFFEKFPQLEKIEVFTDRYQVQNANLIKSLELTYL
                     PSDNDFRFGSFNETNGGLKRSRGLSQSGDSAAQKRHKSQDFVPENVLDLLRLLPKRQY
                     FKTAVLDAEKLTRYLIENVNIPSSDNGTAA"
     gene            complement(<362390..>363715)
                     /locus_tag="KLTH0B04488g"
                     /db_xref="GeneID:8290819"
     mRNA            complement(<362390..>363715)
                     /locus_tag="KLTH0B04488g"
                     /product="KLTH0B04488p"
                     /transcript_id="XM_002551936.1"
                     /db_xref="GeneID:8290819"
     CDS             complement(362390..363715)
                     /locus_tag="KLTH0B04488g"
                     /note="highly similar to uniprot|Q04728 Saccharomyces
                     cerevisiae YMR062C ECM40 Mitochondrial ornithine
                     acetyltransferase catalyzes the fifth step in arginine
                     biosynthesis also possesses acetylglutamate synthase
                     activity regenerates acetylglutamate while forming
                     ornithine"
                     /codon_start=1
                     /product="KLTH0B04488p"
                     /protein_id="XP_002551982.1"
                     /db_xref="GeneID:8290819"
                     /db_xref="GOA:C5DCN3"
                     /db_xref="InterPro:IPR002813"
                     /db_xref="InterPro:IPR016117"
                     /translation="MRVSSALLQKAAKTVDKYSLYVPKSGVFPKGFKVASLASGVKKN
                     GNRDLGIILNTNKSRPSNAAAVFTTNRFKAAPVLVSKQVLDGSSGEGVNAIVANSGCA
                     NAVTGELGMQDAQKVAGQVNAHIGKENSTLVMSTGVIGQRLQMDKISKGINTLFDQKQ
                     FGSDFNSWLNLAKSICTTDTFPKLISSKFQLSDGTEYTLTGISKGAGMICPNMATLLG
                     FIVTDLPIKASTLQAMLTAAVNRSFNCISVDGDMSTNDTICMLANGAVDTFVIDEASP
                     DFEQVKSQVTEFAKQLAQLVVRDGEGATKFVTVNVKNSANFKDARIIAETISNSMLVK
                     SALYGQDANWGRILCAIGYSKLENLASLDESKINVSFIATDNSSPRELKLIANGVPQF
                     DIDENRASEILALPDLEILVDMGTGSEECQFWTCDLSHEYVTINGDYRS"
     gene            complement(<364062..>365768)
                     /locus_tag="KLTH0B04510g"
                     /db_xref="GeneID:8290820"
     mRNA            complement(<364062..>365768)
                     /locus_tag="KLTH0B04510g"
                     /product="KLTH0B04510p"
                     /transcript_id="XM_002551937.1"
                     /db_xref="GeneID:8290820"
     CDS             complement(364062..365768)
                     /locus_tag="KLTH0B04510g"
                     /note="highly similar to uniprot|P39932 Saccharomyces
                     cerevisiae YDR536W STL1 Glycerol proton symporter of the
                     plasma membrane subject to glucose-induced inactivation
                     strongly but transiently induced when cells are subjected
                     to osmotic shock"
                     /codon_start=1
                     /product="KLTH0B04510p"
                     /protein_id="XP_002551983.1"
                     /db_xref="GeneID:8290820"
                     /db_xref="GOA:C5DCN4"
                     /db_xref="InterPro:IPR003663"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DCN4"
                     /translation="MPSRLSVNRTSTLGLNGRSLRLAITITSVIGFSLFGYDQGLMSG
                     LITGKEFNSEFPATGGDDRRTKLVQGAVTACYEIGCFFGSLFVMFRGEQIGRKPLVIL
                     GACLTIVGTVISTAAFGPHWGLGQFVVGRVCTGVGTGLNTSTIPVWQSEMSKPENRGI
                     LVNLEGSMIAVGTMIAYWIDFGLSYVDSSVQWRFPVAMQIFFALLLLAGIWELPDSPR
                     WLMSRGRRDDALHVLAKLDNLPEDDDAIIAEATVIQDAVNRFRHEKRSVKDLFTGGKT
                     QNLQRALVASSTQFFQQFTGCNAAIYYSTVLFQESIGLTGKLPLILGGVFATIYACFT
                     IPSFFLVETLGRRKLFMLGAAGQAISFTITFGCLTKDDTEVAKGAAVGLFLFICFFGM
                     SMLSLPWIYPPEIASMRVRSATNALSTCTNWLCNFAVVMFTPIFIMDTGYGCYLFFAV
                     MNYLYLPVIFFFYPETAGRSLEEIDIIFAKAHVDGTMPWRVAANLPKLSFSEIEDQAN
                     ALGLYEDDNEKQDLDLDEAADREDAIRQNSGVQGYTLFEKRENGAESGQPDGSSTSQK
                     SD"
     gene            <367438..>367770
                     /locus_tag="KLTH0B04532g"
                     /db_xref="GeneID:8290821"
     mRNA            <367438..>367770
                     /locus_tag="KLTH0B04532g"
                     /product="KLTH0B04532p"
                     /transcript_id="XM_002551938.1"
                     /db_xref="GeneID:8290821"
     CDS             367438..367770
                     /locus_tag="KLTH0B04532g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B04532p"
                     /protein_id="XP_002551984.1"
                     /db_xref="GeneID:8290821"
                     /db_xref="UniProtKB/TrEMBL:C5DCN5"
                     /translation="MDAAGRLCSLLSCPTRAAPAMKRSSPDDCVYVASKKCQMYTACS
                     GTDAFRAMLRTARRASRPAAPAAFEQECYYCSSRAPTAVCGACHESVCTVCSAGGTAT
                     CLNCRVAC"
     gene            <367962..>370022
                     /locus_tag="KLTH0B04554g"
                     /db_xref="GeneID:8290822"
     mRNA            <367962..>370022
                     /locus_tag="KLTH0B04554g"
                     /product="KLTH0B04554p"
                     /transcript_id="XM_002551939.1"
                     /db_xref="GeneID:8290822"
     CDS             367962..370022
                     /locus_tag="KLTH0B04554g"
                     /note="weakly similar to uniprot|P53309 Saccharomyces
                     cerevisiae YGR241C"
                     /codon_start=1
                     /product="KLTH0B04554p"
                     /protein_id="XP_002551985.1"
                     /db_xref="GeneID:8290822"
                     /db_xref="GOA:C5DCN6"
                     /db_xref="InterPro:IPR008942"
                     /db_xref="InterPro:IPR011417"
                     /db_xref="InterPro:IPR013809"
                     /db_xref="InterPro:IPR014712"
                     /db_xref="UniProtKB/TrEMBL:C5DCN6"
                     /translation="MTTYVKLVKGATKIKMAPPKAKYVDPILLGTADPHEFREIMNAL
                     DARVQDTAWTIVYKSLIVVHLMIREGEPLVTIKYLSKNQDFFSLKDIFHSKLSSGDLQ
                     ALRRYRDYLRTRCVEYANTGKDYVRENNSSLTTSAASDPKLSLSHVESLEAQISALIK
                     NRYSQYDLGNDLLLTAFRLLVQDLLVLYNSLNEGIITLLESFFELTHQDAERTLKLYK
                     RFVELTESVVKYLKTGKAVGLKIPVIKHITTKLIRSLEEHLKDDNNNHGQNFSSSDSK
                     TPAQRELEQIREQKRQLEEQMKTQQQMIISPTIPQQQTGYNPFAEGFSFEQPAAAQPI
                     ATQPTSNPFMAQAQVPQHTAQPLQYQQTQQAVQPLQYQQTQQTVQPLQYQQTQQTPAV
                     GQLQQVSTTGQFQQTPMAGQFQAAQHMAQQAPQQVPQQMSQQMPQADQYQQAQMQQQT
                     QVPQQTPQAFQYQHTQGPQQASPGEHFQPFQSLNPQTAQPSPQLQSASTGFFSSNTQV
                     TPSFTGAGFGGYYSPDTGAGAASGPGPAPAPVQTAMPTGSNNPFSMENIARSKDERER
                     VNPFSQTNQSPALNSSAAANPFDKPMQNHHTFGGLENMPTVSVFPQTRSQTTQLQQAQ
                     IQPQHTQLQFQQPQQAYGHPQQSSLNPYTQAQQNLQQQQQQQQQYGNLQYSRPGEGPN
                     LIDI"
     gene            <370504..>373431
                     /locus_tag="KLTH0B04576g"
                     /db_xref="GeneID:8290823"
     mRNA            <370504..>373431
                     /locus_tag="KLTH0B04576g"
                     /product="KLTH0B04576p"
                     /transcript_id="XM_002551940.1"
                     /db_xref="GeneID:8290823"
     CDS             370504..373431
                     /locus_tag="KLTH0B04576g"
                     /note="highly similar to uniprot|P16861 Saccharomyces
                     cerevisiae YGR240C PFK1 Alpha subunit of heterooctameric
                     phosphofructokinase involved in glycolysis indispensable
                     for anaerobic growth activated by fructose-2
                     6-bisphosphate and AMP mutation inhibits glucose induction
                     of cell cycle-related genes"
                     /codon_start=1
                     /product="KLTH0B04576p"
                     /protein_id="XP_002551986.1"
                     /db_xref="GeneID:8290823"
                     /db_xref="GOA:C5DCN7"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR009161"
                     /db_xref="InterPro:IPR015912"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="UniProtKB/TrEMBL:C5DCN7"
                     /translation="MTQETVYGVAFRSVATADESAYRSAIKFYHKLGFSTVKTYDKFR
                     GNKEAATSGTAQGSVKETWLESFKLSEVDSNGFRIPQQEATNHEQSDGALLKIRLVAH
                     QPLEAKNSRVTYYSASIDEVSKAFPDAKKLENGEYALNDPLGYELRLSGYVRAGDKKT
                     VDKEFFLDESKTPADYLKGQNLSPNQIPGATSTGIKKKIAVMTSGGDSPGMNSAVRAV
                     VRAGIYYGCDVFAVYEGYEGLLKGGDLLKKMEWKDVRGWLSEGGTLIGTARCMEFRER
                     WGRKQAAGNLISEGIDALVVCGGDGSLTGADLFRSEWPSLVEELVKDGKFTEKQVEPY
                     RNLKIVGLVGSIDNDMSGTDSTIGAYSALERICEMVDYIDATAKSHSRAFVVEVMGRH
                     CGWLALMAGIATGADYIFVPERAAPAGKWQEELKKVCQAHREKGRRNNTVIVAEGALD
                     NNLKPITSEQVKDALVELGLDTKITTLGHVQRGGTAVAHDRWLATLQGVDAVKAVLEM
                     TPETPSPLIGILENKIIRMPLMESVKLTKSVAEAIENKDFDKAISLRDTEFIELYENF
                     ISTTVKDDGSERLPEDQRLNIAIVHVGAPSAALNAATRAATLYCLSRGHKPSAILNGF
                     SGLIQTGEIKELSWIDVENWHNLGGSEIGTNRSVASEDMGSIAYHFQKNKFDGVIILG
                     GFEGFKSLKELRDARAQYPIFNIPMVLIPSTVSNNVPGTEYSLGVDTCLNTLVNYTDA
                     IKQSASATRRRVFVVEVQGGHSGYIASFTGLVTGAVSVYTPEDQIDLKSIREDLALLK
                     ENFRHDQGETRNGKLVIRNEQASSIYTTDLLADIIAEASSGKFGVRTAIPGHVQQGGV
                     PSSKDRVTGSRYAVKCVKFIEAWNRKNSDEQNEDFKILRFKYVNGVKEYTIQDEDASA
                     AIIAVNGSHISFKPIARLWEEETNVELRKGQEVHWEEFNKIGDILSGRLNLRKEVDAG
                     KSA"
     gene            complement(<373616..>375145)
                     /locus_tag="KLTH0B04598g"
                     /db_xref="GeneID:8290824"
     mRNA            complement(<373616..>375145)
                     /locus_tag="KLTH0B04598g"
                     /product="KLTH0B04598p"
                     /transcript_id="XM_002551941.1"
                     /db_xref="GeneID:8290824"
     CDS             complement(373616..375145)
                     /locus_tag="KLTH0B04598g"
                     /note="weakly similar to uniprot|Q04746 Saccharomyces
                     cerevisiae YMR065W KAR5 Protein required for nuclear
                     membrane fusion during karyogamy localizes to the membrane
                     with a soluble portion in the endoplasmic reticulum lumen
                     may form a complex with Jem1p and Kar2p expression of the
                     gene is regulated by pheromone"
                     /codon_start=1
                     /product="KLTH0B04598p"
                     /protein_id="XP_002551987.1"
                     /db_xref="GeneID:8290824"
                     /db_xref="InterPro:IPR007292"
                     /db_xref="UniProtKB/TrEMBL:C5DCN8"
                     /translation="MGASVIVVILWAFYFRLGNSDRLEIAGYKLLSLDDSDSLTDGLE
                     RIVELNFPLYKSSCAMNALRDFLPKCIKHGIDTIDPKQRVNAAIKLSFCEFQESGLDE
                     LPESCQKSTQDGLKKCLDEMKSSAQWWTTYSGNYQRLPTLCYESSLPFEKEQLLDVFL
                     NVTRMYANFNEVLDLKLQRRFEEYEAAAEKNLFKVERIFEEYFSDFDNSYSARKAMFF
                     QDFEHYQKDVLLAFDKNVKVVQREVGSFESDIWQEVIALKQYIQEMNAELNASGPRDQ
                     IKSLKVESLIQIQALRDSIRLASEDSISLLKSKDKSFNDFYSKTTEQLSKLDEALGNT
                     YMDALVVIQDLRGLVQNSITPLLREDIEKPLSQFSQNLAQNLEYLDENFCAKAELWVR
                     SFDGTFQRVHADLNLTAQEVLHINEDLGNFTTTFESHLKALNISVKVFSASMSSLARL
                     LRVVPPAARPFLAIALLRYCPTLLIRFFGSLFENVTQVSRVCAVLIALISGCALGFNL
                     T"
     gene            complement(<375653..>377353)
                     /locus_tag="KLTH0B04620g"
                     /db_xref="GeneID:8290825"
     mRNA            complement(<375653..>377353)
                     /locus_tag="KLTH0B04620g"
                     /product="KLTH0B04620p"
                     /transcript_id="XM_002551942.1"
                     /db_xref="GeneID:8290825"
     CDS             complement(375653..377353)
                     /locus_tag="KLTH0B04620g"
                     /note="weakly similar to uniprot|P32493 Saccharomyces
                     cerevisiae YMR064W AEP1 Protein required for expression of
                     the mitochondrial OLI1 gene encoding subunit 9 of F1-F0
                     ATP synthase"
                     /codon_start=1
                     /product="KLTH0B04620p"
                     /protein_id="XP_002551988.1"
                     /db_xref="GeneID:8290825"
                     /db_xref="GOA:C5DCN9"
                     /translation="MGSRIFSPRRLYSALSELKTETVIPKNPNKRTRDGSFRKFKRVA
                     PAIGDSMHPFYSPNIMERAILCASEIKPELLDGQPIVPAVIKQLKTLEPALVNTRWQP
                     QSTQGLNDWLEPFRKMRRKSSPLKLIENHEIDNVIRPSRIDSGRIPELRKFALMFEKE
                     DAGILSASTIGSLIDRLAADQEKAVFSEEVFLYILQHYCKSSQGIASVVDSITEFLHK
                     DIDDLKTAETLLAHVLMALRRNSIPLTPRATSAILKLIDSVSTRFHRPFCVVDFSPAV
                     VQMTTEFYVDSGFLKESKVLFTDMVNKERCPSAQLVEKYLGLIESVCGISTSDNDFLK
                     KFVYISNFRPIFQTTMTPRITEFLVSYCRHFDEILSLLVLVDHSKVKKQIWDLVLPQM
                     IRRVSLLTKDSAKNCCHLTVLYQKASRFYGMPLSTKVNKAFIIQYAVNGNFAMVARLL
                     SIIDSNAFPSFYASVLAAYDQSSAFSMEVPSSGAALKNKHQFMTSMIIPHYTEISFVG
                     RQLALKHADTEELLEQVLKAEIAIKGRGGKSLLPQVSLKAQDCKSNYIITEAEKCLQH
                     "
     gene            complement(<377498..>378223)
                     /locus_tag="KLTH0B04642g"
                     /db_xref="GeneID:8290826"
     mRNA            complement(<377498..>378223)
                     /locus_tag="KLTH0B04642g"
                     /product="KLTH0B04642p"
                     /transcript_id="XM_002551943.1"
                     /db_xref="GeneID:8290826"
     CDS             complement(377498..378223)
                     /locus_tag="KLTH0B04642g"
                     /note="weakly similar to uniprot|Q04734 Saccharomyces
                     cerevisiae YMR063W"
                     /codon_start=1
                     /product="KLTH0B04642p"
                     /protein_id="XP_002551989.1"
                     /db_xref="GeneID:8290826"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:C5DCP0"
                     /translation="MPSKSRSVIFVLLTLALIFQIFPTISIPVVDRIYLSTYNGRKFG
                     VFGWCTAKSSECTSPRIGYEILPLNGTTEVASLFLPSRAKRSISKLLIVHPISLFFTF
                     VLWTLALALNMHNFGQSRKILAGAVLWSLLTVLLSLLSFLVDILLFVPYLAWPGWLVL
                     VSTVFIAVASSMMCIIRRAVSLRKYEKLRNRDNVELVPLRFSNVNSNSSKPTASEGVS
                     DTQESAAWQHVAPDQPELVHRAV"
     gene            <378488..>380590
                     /locus_tag="KLTH0B04664g"
                     /db_xref="GeneID:8290827"
     mRNA            <378488..>380590
                     /locus_tag="KLTH0B04664g"
                     /product="KLTH0B04664p"
                     /transcript_id="XM_002551944.1"
                     /db_xref="GeneID:8290827"
     CDS             378488..380590
                     /locus_tag="KLTH0B04664g"
                     /note="similar to uniprot|P36009 Saccharomyces cerevisiae
                     YKL078W DHR2 Predominantly nucleolar DEAH-box RNA helicase
                     required for 18S rRNA synthesis"
                     /codon_start=1
                     /product="KLTH0B04664p"
                     /protein_id="XP_002551990.1"
                     /db_xref="GeneID:8290827"
                     /db_xref="GOA:C5DCP1"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR002464"
                     /db_xref="InterPro:IPR007502"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR011709"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCP1"
                     /translation="MSKGKKFRKIGKTSFQPPKNVVFSDKRSSADGSSDHEDGLTKSA
                     SKHDLAREAASLLKVRATLPVYKHKDSIMSHINKNQVTILIGETGSGKSTQIPQFLME
                     NFPEKTDKRIAVTQPRRVAAINLASRVAQEYGCRLGERVGYSVRFDNKSNARTKLKYL
                     TDGMLLREIMLDKNLSDYSCVIIDEAHERTILTDLILGFLKELINSSRQDLKVVVMSA
                     TLQAEKFSEFFGRAPILFVEGRKFPVQRSYLKAQCDDVVDAIIRCCVQLNQSEQMGDI
                     LCFMPGQEEIDKAVAILSKVGEHLGASVPRLVALPLYAALPPAEQAKVFAPVKGFKRK
                     VVFSTNLAETSVTISGVKFVVDSGLRKVKVWRHQLGLATLLTVPISKASASQRTGRAG
                     RESAGKCFRLYREQDYQKLPNQTEPEIARSEVTSPILMLKKVGVKDIVNWSWLENPGK
                     QAILMALQELFQLGALDDSGKITNKGQKMALLPLAPHLSSVLLKAHEDGCLLPVIDIV
                     SCLSVENLLINPSPEQRDEVNEKRFSIATRGSKYGDLVMLKEFYDAYMSLKSAAEKDD
                     WCKELCVSKRGFKNVVKIRAQLLSYMERLFKEKLSDNEDESDSFDIKAIVKCFLAGFA
                     KNTAIGMPDRSFRTSTTGETISVHPSSMLFMDRSCPAILYTEYVFTTKGYARNVSRLE
                     LSWLQEVAGISTVKVSAR"
     gene            <381618..>381932
                     /locus_tag="KLTH0B04686g"
                     /db_xref="GeneID:8290828"
     mRNA            <381618..>381932
                     /locus_tag="KLTH0B04686g"
                     /product="KLTH0B04686p"
                     /transcript_id="XM_002551945.1"
                     /db_xref="GeneID:8290828"
     CDS             381618..381932
                     /locus_tag="KLTH0B04686g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B04686p"
                     /protein_id="XP_002551991.1"
                     /db_xref="GeneID:8290828"
                     /db_xref="UniProtKB/TrEMBL:C5DCP2"
                     /translation="MRYAFYEEHAPQLRSSRTTIVSNEDTWLSYKDAILDNINAPEKS
                     QFENAYARELSRLESVGTWDATAPRPAHSLAPEAIIDTNFEFNTNSNGEKCCRVVQEG
                     VS"
     gene            <383780..>390259
                     /locus_tag="KLTH0B04708g"
                     /db_xref="GeneID:8290829"
     mRNA            <383780..>390259
                     /locus_tag="KLTH0B04708g"
                     /product="KLTH0B04708p"
                     /transcript_id="XM_002551946.1"
                     /db_xref="GeneID:8290829"
     CDS             383780..390259
                     /locus_tag="KLTH0B04708g"
                     /note="highly similar to uniprot|Q12680 Saccharomyces
                     cerevisiae YDL171C GLT1 NAD()-dependent glutamate synthase
                     (GOGAT) synthesizes glutamate from glutamine and
                     alpha-ketoglutarate with Gln1p forms the secondary pathway
                     for glutamate biosynthesis from ammonia expression
                     regulated by nitrogen source"
                     /codon_start=1
                     /product="KLTH0B04708p"
                     /protein_id="XP_002551992.1"
                     /db_xref="GeneID:8290829"
                     /db_xref="GOA:C5DCP3"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR002489"
                     /db_xref="InterPro:IPR002932"
                     /db_xref="InterPro:IPR006005"
                     /db_xref="InterPro:IPR006982"
                     /db_xref="InterPro:IPR009051"
                     /db_xref="InterPro:IPR012220"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR023753"
                     /db_xref="InterPro:IPR028261"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DCP3"
                     /translation="MLRSDEFDPLQEAYDGGMPLDTRRMHSDDSDINGFGASSKDSQF
                     WADAIPGKQGLYDPEYERDACGVGFVANIKGAQSHKIVSDARYLLCNMTHRGAVSSGG
                     NGDGAGILVGIPHEFMKREFRLDSGIEIPAAGQYATGNFFFKKDAPETLEASKRTFES
                     LAESLGLLVLGWRSVPRDSSILGAVALSREPAIFQPLVVLQEAHHEQQPISAQDFREK
                     FDVKFQTQLYILRKQASSAIGLQNWFYACSLNPRTIVYKGQLTPTQVYQYYHDLTNAH
                     FESHMALVHSRFSTNTFPSWDRAQPLRWIAHNGEINTLRGNKNWMRAREGVMASETFG
                     EQLDKLYPIIEEGGSDSAALDNVLELLVINGALSLPEAIMMMVPEAYHKDMDSNLKAW
                     FDWSACLMEPWDGPALLTFTDGRYCGAMLDRNGLRPCRYYITSDDRVICASEVGVIPV
                     DNSLVVQKGKLKPGDMLLVDTDLGEMVDTKKLKSTFSKKRDYKSWLSKLIKLEDLLVK
                     TQKYIPDSFLSDRHASLKAQQDPRLLAMGYTFEQVSMVLIPMALGSKEALGSMGNDAP
                     LACLNENPVLIYDYFRQLFAQVTNPPIDPIREANVMSLECYVGPQGNLLEVHPSQCDR
                     LLLHSPILQWREFEAIKNIEKAHPAWSVADIDITFEKSQGLLGYTSTIERITHQASEA
                     IEQGKRIIMISDRRMGPDRVPLSSLIAVGAIHHHLIRNKQRSQVALILETGEAREVHH
                     FCVLLGYGCDGIFPYLAMETLVRMNQEDLVRNVENDDIDIDDTTLLENYKHAIDGGIL
                     KVMSKMGISTLASYKGAQIFEALGVDNTVVDLCFAGTASRIQGVTFEYIAQDAFSMHE
                     RGFPSRFTISKSVNLPESGEYHWRDGGAKHINDPTAIASLQDSVRNKNSNAWEMYVKK
                     EMESIRDCTLRGLLELDFENSESIPLEQVEPWTEIARRFATGAMSYGSISMEAHSTLA
                     VAMNRLGAKSNCGEGGEDAERSIVHSNGDTMRSAIKQVASARFGVTSHYLSDADEIQI
                     KIAQGAKPGEGGELPAHKVSPDIAKTRHSTPYVGLISPPPHHDIYSIEDLKQLIYDLK
                     CSNPRAGISVKLVSEVGVGIVASGVAKAKADHILVSGHDGGTGASRWTGIKYAGLPWE
                     LGLAETHQTLVLNDLRRNVVVQTDGQLRTGFDIAVAVLLGAESFTLATVPLIAMGCIM
                     LRKCHLNACAVGIATQDPLLREKFKGQPEHVINFFYYLIQDLRKIMAKLGFRTIDEMV
                     GHSEKLRKRENVNTKAINIDLSPILTPAHVIRPGVATKFTKKQDHRLHTRLDNKLIDE
                     AEITLDRGLPVNIDATIINTDRALGSTLSYRISKKFGEEGLPQDTVVVNIEGSAGQSF
                     GAFLASGITFILDGDANDYVGKGLSGGRLIIRPPPDSRFKSDENVILGNTCFYGATSG
                     TAFISGVAGERFCVRNSGATIVVEKIKGNNAFEYMTGGRAVVLSQMESLNAFSGATGG
                     IAYCLTSDYDDFVGKINTESVELQGLIDPVEIAFVKNLIQEHYNYTKSELAARILGNF
                     NHYLKNFVKVIPTDYKKVLEKDAEEKAKLKQKNTANFLKKFNSGTDLKSDVTNGEVDA
                     IREAKKKAVRNISHKATLAEPKVQDLEDAVNDIEQLEKNGEKIQKTRGFMLYKLRHEK
                     YRHASARTKDWKELSACVTKKDAKYQTARCMDCGVPFCTSDTGCPISNVIPKFNELVF
                     KNQWKLALDKLLETNNFPEFTGRVCPAPCQGSCTLGIIDDPVGIKSIERLIIDNGFKE
                     GWIQPCPPEVRTGRNIAIIGSGPAGLACADQLNRAGHSVTVYERADRCGGLLMYGIPN
                     MKLDKKIVQRRVDLMAAEGVEFVTSVEIGKDITVEQLKAQNDAVVYAIGSTIPRDLRI
                     PGRDLKNIDFAMSLLTANTKALLSKDLETIRQQISGKKVIVIGGGDTGNDCLGTSVRH
                     GAASVINFELLPQPPNERASDNPWPQWPRVMRVDYGHAEVKAHYGRDPREYCILSKEF
                     IGNEEGEVKAIRTVRVEWKRSESGVWQMVEVPGSEEIYEADVVLLSMGFVGPELFEDP
                     SVVKTKRGTINTVSDASYSVDDGKVFAAGDCRRGQSLIVWAIQEGRKCATSVDSFLMG
                     STSLPGNGGIVKRDYRLLEELASTVEA"
     gene            complement(<390460..>390954)
                     /locus_tag="KLTH0B04730g"
                     /db_xref="GeneID:8290830"
     mRNA            complement(<390460..>390954)
                     /locus_tag="KLTH0B04730g"
                     /product="KLTH0B04730p"
                     /transcript_id="XM_002551947.1"
                     /db_xref="GeneID:8290830"
     CDS             complement(390460..390954)
                     /locus_tag="KLTH0B04730g"
                     /note="some similarities with uniprot|Q6Q543 Saccharomyces
                     cerevisiae YDL173W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B04730p"
                     /protein_id="XP_002551993.1"
                     /db_xref="GeneID:8290830"
                     /db_xref="InterPro:IPR022024"
                     /db_xref="UniProtKB/TrEMBL:C5DCP4"
                     /translation="MGSSFNISTGRGGAGNMVVSSEKPSPKIIPQGSQTPNILQPVFS
                     TGRGGAGNMYKNVDTKLTRKAQDVDEISIAPEDDVIKAVESPLSLDQGRSAHSGDAQK
                     GGLRPKKSRSEHPQTVSIGRGGAGNILSPSNSRKSERGSKKSGKSGKQSKPGLWSKVK
                     GFFA"
     gene            <391353..>392171
                     /locus_tag="KLTH0B04752g"
                     /db_xref="GeneID:8290831"
     mRNA            <391353..>392171
                     /locus_tag="KLTH0B04752g"
                     /product="KLTH0B04752p"
                     /transcript_id="XM_002551948.1"
                     /db_xref="GeneID:8290831"
     CDS             391353..392171
                     /locus_tag="KLTH0B04752g"
                     /note="similar to uniprot|Q05775 Saccharomyces cerevisiae
                     YLR192C HCR1 Dual function protein involved in translation
                     initiation as a substoichiometric component of eukaryotic
                     translation initiation factor 3 (eIF3) and required for
                     processing of 20S pre-rRNA binds to eIF3 subunits Rpg1p
                     and Prt1p and 18S rRNA"
                     /codon_start=1
                     /product="KLTH0B04752p"
                     /protein_id="XP_002551994.1"
                     /db_xref="GeneID:8290831"
                     /db_xref="GOA:C5DCP5"
                     /db_xref="InterPro:IPR013906"
                     /db_xref="InterPro:IPR023194"
                     /db_xref="UniProtKB/TrEMBL:C5DCP5"
                     /translation="MSWDDEDFDLPSSAKNEPVLASWDDEFAETNDDDDAVLESWDAE
                     PAAASAKKPTAPAKKPAAKKDKKDAAASKPLLEIDTLDESTRRELLRKAEVDSDLNNA
                     ADLFGGLGVAEEHPRARALRKQQEEEALTRPAALTKDTPLDTHPLFQAESKKEYQELR
                     KALAAAITPLNERSALNYSSGLAIDLIRDVANPMSTESIRQTIATLNVLMKDKERQER
                     LARLAKVKGGTATGGAGKKKAKATRANLGGAFKKDQEFDLETPAFDDFGEDDFM"
     gene            <392485..>394206
                     /locus_tag="KLTH0B04774g"
                     /db_xref="GeneID:8290832"
     mRNA            <392485..>394206
                     /locus_tag="KLTH0B04774g"
                     /product="KLTH0B04774p"
                     /transcript_id="XM_002551949.1"
                     /db_xref="GeneID:8290832"
     CDS             392485..394206
                     /locus_tag="KLTH0B04774g"
                     /note="similar to uniprot|P32891 Saccharomyces cerevisiae
                     YDL174C DLD1 D-lactate dehydrogenase oxidizes D-lactate to
                     pyruvate transcription is heme-dependent repressed by
                     glucose and derepressed in ethanol or lactate located in
                     the mitochondrial inner membrane"
                     /codon_start=1
                     /product="KLTH0B04774p"
                     /protein_id="XP_002551995.1"
                     /db_xref="GeneID:8290832"
                     /db_xref="GOA:C5DCP6"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="InterPro:IPR016164"
                     /db_xref="InterPro:IPR016166"
                     /db_xref="InterPro:IPR016167"
                     /db_xref="InterPro:IPR016169"
                     /db_xref="InterPro:IPR016171"
                     /db_xref="UniProtKB/TrEMBL:C5DCP6"
                     /translation="MWRTGFSRSSQAWRRACTQYGRRWQSSKAWGSGASHRFAQRNSR
                     MARVSVLAAGMAAVAGAGAASWNASVQNDEFSSTTRLDELQSPQYCHDADKFAEAVEK
                     LKKLLNNDEECFSVSKSDLDAHSDTYFNTHHATPEQRPRIVLYPHNTEEVSEVLKICH
                     EYAIPVVPFSGGTSLEGHFLPTRIGCTVTLDLSKYMNKIKKLNKTDLDVEVQAGVPWE
                     DLNDFLNEKGLLFGCDPGPGAQIGGCVANSCSGTKAYRYGTMKENVVNLTAVLADGTV
                     IKTKRRPRKSSAGYNLNGLLIGSEGTLAVVTEATIKCHVRPAFENVAVGSFPTIADAA
                     ACTSRIIQEGIQLNAMELLDDNMMRIVNKSGATYKTDWIEAPTLFFKVGGRNKKIIAE
                     LIHEVDRIAQHHGCHKFEFAKDDDERLELWEARKVALWSVINDGKSRDPDVNVWTTDV
                     AVPLSQFANVIGATKKDMDASGLQNAIVGHAGDGNFHTFLLYNDKEREKAGRLVDSMV
                     KRAIDAEGTCTGEHGVGMGKRGYLLEELGDAPVDFMRRLKLAADPKRILNPDKIFKID
                     PEDKEGH"
     gene            <394777..>395400
                     /locus_tag="KLTH0B04796g"
                     /db_xref="GeneID:8290833"
     mRNA            <394777..>395400
                     /locus_tag="KLTH0B04796g"
                     /product="KLTH0B04796p"
                     /transcript_id="XM_002551950.1"
                     /db_xref="GeneID:8290833"
     CDS             394777..395400
                     /locus_tag="KLTH0B04796g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B04796p"
                     /protein_id="XP_002551996.1"
                     /db_xref="GeneID:8290833"
                     /db_xref="UniProtKB/TrEMBL:C5DCP7"
                     /translation="MLRSTASHALRIPSRLVATPAVYSSASRVCALHSSARVPKSLGE
                     KVRSTLSDLNKKVGEAAASGIDKAQEASHTVEEKSHTAAEATKHGLEQLNKKTGQAAA
                     SGIDKAQNMAQEAGEKAQELKKRDLTQEAKGKAQELKDSDLAQEAKDKAQDLKEGAQE
                     KAGEAKGKAQELKHEGKGKAQELKHEAKGKAHEGAAKAKETAREYKD"
     gene            complement(<395490..>396632)
                     /locus_tag="KLTH0B04818g"
                     /db_xref="GeneID:8290834"
     mRNA            complement(<395490..>396632)
                     /locus_tag="KLTH0B04818g"
                     /product="KLTH0B04818p"
                     /transcript_id="XM_002551951.1"
                     /db_xref="GeneID:8290834"
     CDS             complement(395490..396632)
                     /locus_tag="KLTH0B04818g"
                     /note="weakly similar to uniprot|P80667 Saccharomyces
                     cerevisiae YLR191W PEX13 Integral peroxisomal membrane
                     receptor"
                     /codon_start=1
                     /product="KLTH0B04818p"
                     /protein_id="XP_002551997.1"
                     /db_xref="GeneID:8290834"
                     /db_xref="GOA:C5DCP8"
                     /db_xref="InterPro:IPR001452"
                     /db_xref="InterPro:IPR007223"
                     /db_xref="UniProtKB/TrEMBL:C5DCP8"
                     /translation="MSTSVKQPRPKPWEAQGGQNTPMDDGAMITAGEAQGTRGEGAKA
                     DGNAAPEPPQKPAALGPENGVGARSGLGNAGTFLGSGGPYSSGYGGSLYGGGMGSMYS
                     GGYNSMYGGGYGSMYGGGYGSMMGGGYGAGGMYGMNNNGAQTLAESTQATFQLIEGLI
                     GAVAGFAQMLEATYMATHNSFFTMVSMAEQISSLKEMVGSFFGIFAAMKMLKRLLYKV
                     TNGRAGLAPARAAAGSKSPLVQEFAKFGDASAQAKRRRRMSWKPLLVFVAAVVGFPLL
                     LRKFIAKLSEIQQRRLGAGAVGAGAGGTLDPRNLEFARAVYDFTPENPQVEAALRKGD
                     LMAVISKQDPLGNASEWWQVRTKKGDVGYVPSNYVELIRRTRSESS"
     gene            396900..396972
                     /locus_tag="KLTH0B04840r"
                     /db_xref="GeneID:8290835"
     tRNA            396900..396972
                     /locus_tag="KLTH0B04840r"
                     /product="tRNA-Ala"
                     /note="tRNA-Ala (AGC) cove score=70.00"
                     /db_xref="GeneID:8290835"
     gene            complement(<397225..>398769)
                     /locus_tag="KLTH0B04862g"
                     /db_xref="GeneID:8290836"
     mRNA            complement(<397225..>398769)
                     /locus_tag="KLTH0B04862g"
                     /product="KLTH0B04862p"
                     /transcript_id="XM_002551952.1"
                     /db_xref="GeneID:8290836"
     CDS             complement(397225..398769)
                     /locus_tag="KLTH0B04862g"
                     /note="some similarities with uniprot|Q06324 Saccharomyces
                     cerevisiae YLR190W MMR1 Phosphorylated protein of the
                     mitochondrial outer membrane localizes only to
                     mitochondria of the bud interacts with Myo2p to mediate
                     mitochondrial distribution to buds mRNA is targeted to the
                     bud via the transport system involving She2p"
                     /codon_start=1
                     /product="KLTH0B04862p"
                     /protein_id="XP_002551998.1"
                     /db_xref="GeneID:8290836"
                     /db_xref="InterPro:IPR013712"
                     /db_xref="UniProtKB/TrEMBL:C5DCP9"
                     /translation="MNTPPMGAEKLTPKMSPTMLHLDDSLAPLANPSFMYLDESKSNY
                     PAMYRTSLSKLTERGRSGRGRTVEAKTPTKLLRSNSPIRAMLNNPPKMLKPEYIGISK
                     LLNNNNSSRVGSAVTPSMILTSSKLNFGNTKKASSEEVRQPTQTQEAKKQVVAPPPTP
                     TPVPQTEEPALPQATTASQQMPPPSAQPRTQKHPEPAVHSHHGEKVPQPKQRHHSQML
                     SHKDSRGSKHARGLSSTSTAISGSTACELRTEHAAALPTPGSVEEIATKTPGYRFPST
                     TSTASSSSTFDLKEFPEALNLNFEVPNDKEEFVLATQSKRSSYISSIGSANEDDLNGW
                     FAQYAEDRQVSTLSMGDAQKEKALQTEHFSLRVKQLELQIAELRLQNEEMRHNITAHR
                     TIQDRCMFEALHDVQREKENTYKEMDRKMKQLEKQINNYRKVIQKLTNSTKTAPVSKP
                     RIPMLDALALDEISETRSSDGEEDEHVDDATIISELNPDERSASASQSPRKRPAGFNL
                     SLTFEK"
     gene            <400193..>401914
                     /locus_tag="KLTH0B04884g"
                     /db_xref="GeneID:8290837"
     mRNA            <400193..>401914
                     /locus_tag="KLTH0B04884g"
                     /product="KLTH0B04884p"
                     /transcript_id="XM_002551953.1"
                     /db_xref="GeneID:8290837"
     CDS             400193..401914
                     /locus_tag="KLTH0B04884g"
                     /note="highly similar to uniprot|P00927 Saccharomyces
                     cerevisiae YER086W ILV1 Threonine deaminase catalyzes the
                     first step in isoleucine biosynthesis expression is under
                     general amino acid control ILV1 locus exhibits highly
                     positioned nucleosomes whose organization is independent
                     of known ILV1 regulation"
                     /codon_start=1
                     /product="KLTH0B04884p"
                     /protein_id="XP_002551999.1"
                     /db_xref="GeneID:8290837"
                     /db_xref="GOA:C5DCQ0"
                     /db_xref="InterPro:IPR000634"
                     /db_xref="InterPro:IPR001721"
                     /db_xref="InterPro:IPR001926"
                     /db_xref="InterPro:IPR005787"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ0"
                     /translation="MASKISSQELKMSSTLLTRTRPALVSRFLLRYQSSAVANLQKLH
                     AKLNPDELLPDSTPDYVRLILRSSVYDVIEESPITRGVGLSSRLNTNVQLKREDLLPV
                     FSFKLRGAYNMMAKLSEAQKNQGVIACSAGNHAQGVAFASRHLNIPAIIVMPVNTPSI
                     KYQNVSRLGGQVVLYGNDFDEAKTECTRISEERGLTNIPPFDHPYVIAGQGTVAMEIL
                     RQVHNAAKIGAVFVPVGGGGLVAGVAAYLKRIAPHIKIIGVETYDSATLKTSLEAGTR
                     TPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDEICAAVKDIFEDTRSIVEP
                     SGALAVAGLKKYVTQVHPDVDHSKKTYVPILSGANMNFDRLRFVSERAVLGEGKEVFM
                     LVTIPDVPGSFKQLQRVIHPRAVTEFSYRYNEHRHSSASDVPKAYIYTSFSVVDREKE
                     IKQVLQQLHGLGFDAVDISDNEMAKSHGRYLVGGASKVPNEKIVSFEFPERPGALTKF
                     LDGMSDSWNLTLFHYRNHGSDVGKVLAGVSVSAEDNEGFQKFLDDLGYKYQDETNNMV
                     YQKFLKF"
     gene            <402179..>403885
                     /locus_tag="KLTH0B04906g"
                     /db_xref="GeneID:8290838"
     mRNA            <402179..>403885
                     /locus_tag="KLTH0B04906g"
                     /product="KLTH0B04906p"
                     /transcript_id="XM_002551954.1"
                     /db_xref="GeneID:8290838"
     CDS             402179..403885
                     /locus_tag="KLTH0B04906g"
                     /note="similar to uniprot|P39965 Saccharomyces cerevisiae
                     YER087W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B04906p"
                     /protein_id="XP_002552000.1"
                     /db_xref="GeneID:8290838"
                     /db_xref="GOA:C5DCQ1"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002316"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR004500"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ1"
                     /translation="MRPCLKTIVRNVHVYQTKSLTGDAVKASSTHNLLQSLGYIKQTQ
                     SGLVHWLPLGLRTLNKITNIIKHRMETDGKAEEVSLSLLSPKSLWVHTNRWDNGELFK
                     LKDSKGSDYCLAPTCEEEITSLIGSYVTSYKDLPMTVYQVGRKYRDEKRPRGGLLRGR
                     EFLMKDAYSFDASKEEAVRTFESMNHTYDLIFKDLGVPFVSAWADSGDIGGDMSKEYH
                     YTHESGEDTVMACDSCGHISNVEKCSSFPVEDNQYSGDVSVRYALSEDRDTLVCLYYP
                     QNRVLNWNLVKAALDGDVDSSLRDTSNEKVLELFRANKSEDEMMLASVLRVMDCRLNS
                     RSNYPDFPLNQYLKSNFSQLSDASIVDAEAGELCGSCEEGHLSSKRSIEVGHTFFLGQ
                     KYSEPLNAKFSTRENTEEYCEMGCYGIGVSRLVGAIAHVTRDDAGLRWPRAVAPYEIS
                     ICAAKQDELVAEVEGLLSSWGREVWVNRDEKAGLGRKIAASHSLGIPVCVIVGKKSWP
                     CVEIEVRAPLVGERWRAELAQHGEAWGWTVQESAPVGGAAHHRVRKEHLKDVVGVILT
                     DM"
     gene            complement(<403949..>404218)
                     /locus_tag="KLTH0B04928g"
                     /db_xref="GeneID:8290839"
     mRNA            complement(<403949..>404218)
                     /locus_tag="KLTH0B04928g"
                     /product="KLTH0B04928p"
                     /transcript_id="XM_002551955.1"
                     /db_xref="GeneID:8290839"
     CDS             complement(403949..404218)
                     /locus_tag="KLTH0B04928g"
                     /note="highly similar to uniprot|P52871 Saccharomyces
                     cerevisiae YER019C-A SBH2 Ssh1p-Sss1p-Sbh2p complex
                     component involved in protein translocation into the
                     endoplasmic reticulum homologous to Sbh1p"
                     /codon_start=1
                     /product="KLTH0B04928p"
                     /protein_id="XP_002552001.1"
                     /db_xref="GeneID:8290839"
                     /db_xref="InterPro:IPR016482"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ2"
                     /translation="MSTPTPPGGQRTLQKRRQAQSVKEKQQKQTPASTRQAGFGGSSN
                     SVLKLYTDEANGLRVDPLVVLFLAVGFIFSVVALHVVAKVTGKLF"
     gene            <405537..>407279
                     /locus_tag="KLTH0B04950g"
                     /db_xref="GeneID:8290840"
     mRNA            <405537..>407279
                     /locus_tag="KLTH0B04950g"
                     /product="KLTH0B04950p"
                     /transcript_id="XM_002551956.1"
                     /db_xref="GeneID:8290840"
     CDS             405537..407279
                     /locus_tag="KLTH0B04950g"
                     /note="some similarities with uniprot|P34217 Saccharomyces
                     cerevisiae YBL051C PIN4 Protein involved in G2/M phase
                     progression and response to DNA damage interacts with
                     Rad53p contains an RNA recognition motif a nuclear
                     localization signal and several SQ/TQ cluster domains
                     hyperphosphorylated in response to DNA damage"
                     /codon_start=1
                     /product="KLTH0B04950p"
                     /protein_id="XP_002552002.1"
                     /db_xref="GeneID:8290840"
                     /db_xref="GOA:C5DCQ3"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ3"
                     /translation="MSDMPAATLQEPLMGNSAAMGGSVFAPRSPEDDVIPTAIVIKNI
                     PFAIKKEQLLEVIAKMDLPLPYAFNYHFDNGVFRGLAFANFATTDETTQVVHSLNGKE
                     IGGRKLRVEYKKMLPQAERERIEREKREKRGQLEEQHRATSALSLHSLNKSPNVASGP
                     AAAAGSNANTNETAGGAAAGSAAASTSGPTQSASQALSNPASSQMFNDFGSSGGANAT
                     GGPINSVLSSQPAMSSQPLLSAQNTATSMVLPPALPVGSSERYYAPLPASNNLPLPPQ
                     QLDFNDPDTLELYSQLLLFKDREKAYHELAYPVGLSASHKRVINVLCSFLGLVEVYDP
                     SFIIIRRKVLDHAALQSHLQQEGQLSLMQPLQPSSTGGSGMSRSHSYTSLLQAHATAA
                     AAAVNSVGGQSQHIPPPSQSPLLQPTAIHQMESQHQQQQSLLRQQATQTPSSSILQNR
                     IPTGYATKHTTPSGMNNPLLRNAGVSPTTGQVQPNTVQRMPSFYSQAPSTPNLSDNRY
                     GSTQNLVPQHTNGSVHSNYSVHSFHDPSAADPQNHAMMYSSVSQLGIGPELEGDLSRS
                     LSGLDLQGKKNLWG"
     gene            <408153..>409235
                     /locus_tag="KLTH0B04972g"
                     /db_xref="GeneID:8290841"
     mRNA            <408153..>409235
                     /locus_tag="KLTH0B04972g"
                     /product="KLTH0B04972p"
                     /transcript_id="XM_002551957.1"
                     /db_xref="GeneID:8290841"
     CDS             408153..409235
                     /locus_tag="KLTH0B04972g"
                     /note="highly similar to uniprot|Q04894 Saccharomyces
                     cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
                     dehydrogenase family member with broad substrate
                     specificity may be involved in fusel alcohol synthesis or
                     in aldehyde tolerance"
                     /codon_start=1
                     /product="KLTH0B04972p"
                     /protein_id="XP_002552003.1"
                     /db_xref="GeneID:8290841"
                     /db_xref="GOA:C5DCQ4"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR002328"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ4"
                     /translation="MSYPEKFQGIAVQDHNDWTHPKKISYEPKKFDDYDVDVEIEACG
                     ICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGVGAQVSSCLD
                     CDRCNSDFEPYCAEFITTYSQPYPDGYVSQGGYASHIRAHEHFVIPIPEKIPTHLAAP
                     LLCGGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIFAKALGAEVYAISRSSAKKED
                     AMKLGADHFIATKEEPDWEKKYASTLDLVIVCASSLTEINLEQLIKTMRIKGRIISIC
                     VPKETEELNLKPFQLSGITIGNSQLGSRKELIQLLQLVADKDLKIWVETLPISEESVH
                     DAFVRMEKGDVRYRFTLTDFDKEFRN"
     gene            <409558..>411780
                     /locus_tag="KLTH0B04994g"
                     /db_xref="GeneID:8290842"
     mRNA            <409558..>411780
                     /locus_tag="KLTH0B04994g"
                     /product="KLTH0B04994p"
                     /transcript_id="XM_002551958.1"
                     /db_xref="GeneID:8290842"
     CDS             409558..411780
                     /locus_tag="KLTH0B04994g"
                     /note="some similarities with uniprot|P34218 Saccharomyces
                     cerevisiae YBL052C SAS3 Histone acetyltransferase
                     catalytic subunit of NuA3 complex that acetylates histone
                     H3 involved in transcriptional silencing homolog of the
                     mammalian MOZ proto-oncogene sas3 gcn5 double mutation
                     confers lethality"
                     /codon_start=1
                     /product="KLTH0B04994p"
                     /protein_id="XP_002552004.1"
                     /db_xref="GeneID:8290842"
                     /db_xref="GOA:C5DCQ5"
                     /db_xref="InterPro:IPR002717"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ5"
                     /translation="MGSKDVNSQRHQRLLRNIEITDNVHAVTANEIARNPDGYARQTR
                     AKLAYHPRDEKTELQVKPNLQWSLPDDAKEANALSSHVEFIKVDPVRGTFNKHIVKLR
                     YDPRKLLSFDNLINNAAPDPQKYHVDFEIREPETLFNRIDNECSKPYRCAIGDRRDYS
                     TQRTTPSLKDREFFQSLLHKAAPASYYNGNLLLAFNEAEEREITNPKKNKSRKAPSKI
                     EYIYFRDHEIKTWYTAPYPEEFNKNKILYICEYCLKYMNSRYVIHRHQLKCSLRHPPG
                     NEIYREGNISIWEVDGRENVIYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEREDTG
                     EESQFHFVGYFSKEKLTSTDYNLSCILTLPIYQRKGYGHFLVDFSYLLTRREYKWGTP
                     EKPLSDLGLLSYRNFWKTKICEVLGELKEEINHAEKKGEILHCSIEDLSNLTGMIPTD
                     VVFGLEQIGALHYYKGESKLQFAIKIDNWSLIDEVNNARKSKGYRALVPEKLVWKPMI
                     FGPSCGINAMGTMIETTTGAARSTATGQQNGIDTFKNSVSVLVNFLRDDIEDPRSMEA
                     ICQQKIHDQQGRHFDTSKINLMTLAFNAPVSRRLKNSASSLVSVPNRYDDNETNNNTF
                     SAPNGGADLGIVDPELLEETEQIDEEDEDNDLNETLADGDTIGDEEVKFSSTSEDEEE
                     DEDEEIPGRGVSSSQGRFSRTRSGRAINSHRVIDSDEHEEEHIATRRLRSMDPLLKNL
                     "
     gene            complement(<412037..>413824)
                     /locus_tag="KLTH0B05016g"
                     /db_xref="GeneID:8290843"
     mRNA            complement(<412037..>413824)
                     /locus_tag="KLTH0B05016g"
                     /product="KLTH0B05016p"
                     /transcript_id="XM_002551959.1"
                     /db_xref="GeneID:8290843"
     CDS             complement(412037..413824)
                     /locus_tag="KLTH0B05016g"
                     /note="some similarities with uniprot|P40059 Saccharomyces
                     cerevisiae YER088C DOT6 Protein of unknown function
                     involved in telomeric gene silencing and filamentation"
                     /codon_start=1
                     /product="KLTH0B05016p"
                     /protein_id="XP_002552005.1"
                     /db_xref="GeneID:8290843"
                     /db_xref="GOA:C5DCQ6"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ6"
                     /translation="MTTSKSAVSLAGAGGGLVAQSKNPSSWDPQDDVLLRHLKEIKKL
                     GWKDIAQYFKNRTPNACQFRWRRLKSGNLKTAGRPGEAPAVADAVGVAPAAGTQPAAA
                     TPQAGAAAAAAVPHDLGQPVHPALLAATAAPASEAYPPRALSQPALGPLPNAGTLSAV
                     PAPSPAPHQPAVAAFPLRPTLTGATLANAQSRHSLQPAPGAGKFAKPRSYSHTMAPPS
                     GFAMASASAPFSAAASVVTSNSTGHVPTIDVNESQDENLGLIPKVLVRSRRSSVAQQS
                     LLPSSSTPNLSLALHTTLTTSKLRKNSFSSRPRRSSFNMAPPDRVFSTPSRRSSVVQA
                     PSSIASISRRESFNSSNSRRGSAIQTRRESFAHSTLDRRESVSNYTDIPKAPLQNFAP
                     ANASSLHQATYPTEMKDWSLDEDKLLSGRQENHLSMDELSILLPHRSEQEIQWRIGAL
                     DKSTYSSSSDSPLDSPERSLTEDIAVDEEGGEAVDDASRNPSQTPFNIKKEVSPSLSA
                     SSGSNDREHSPVFSPRPVNRDQSPTTFDSSFRPNIVVNKSVGGSSYNCSPGLDGHRNP
                     SFPPAAEPMAPGSHGAQLPSLNSIFKNIL"
     gene            <415138..>416868
                     /locus_tag="KLTH0B05038g"
                     /db_xref="GeneID:8290844"
     mRNA            join(<415138..415176,415852..>416868)
                     /locus_tag="KLTH0B05038g"
                     /product="KLTH0B05038p"
                     /transcript_id="XM_002551960.1"
                     /db_xref="GeneID:8290844"
     CDS             join(415138..415176,415852..416868)
                     /locus_tag="KLTH0B05038g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B05038p"
                     /protein_id="XP_002552006.1"
                     /db_xref="GeneID:8290844"
                     /db_xref="InterPro:IPR027806"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ7"
                     /translation="MPLSMIEALSCSALTGFCKSDFDRVVEALKIPSYIGAYSFDAFE
                     CFFIFIARLKSGCTYTVLTSLCGREASTISRIITFVTCYLFHIASPCLSVTNASWLAD
                     RLANIDQSLLSSSRSISNSRIVGFIDGTHVKIARPHGNARLECVAYSGHKKTHTLKYQ
                     AVTTPDGICIDLAGPFAGSQHDSFLFTNSGLYRRLKPALKVGGIQYRIFGDPAYRSSD
                     LLTVGYKGQNLTNGQKEYNTILSGSRVSIEWFFGEVKNNFQIFNILGRLKVGGVRFCG
                     AYFTIAVFLTNLKHCLEGSQGSKYFNISPPRFEEYMNGLKFPQYFDGFLIDVNGTSSF
                     FSKQYEHLSFDRLGNIL"
     gene            complement(<416976..>418274)
                     /locus_tag="KLTH0B05060g"
                     /db_xref="GeneID:8290845"
     mRNA            complement(<416976..>418274)
                     /locus_tag="KLTH0B05060g"
                     /product="KLTH0B05060p"
                     /transcript_id="XM_002551961.1"
                     /db_xref="GeneID:8290845"
     CDS             complement(416976..418274)
                     /locus_tag="KLTH0B05060g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B05060p"
                     /protein_id="XP_002552007.1"
                     /db_xref="GeneID:8290845"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ8"
                     /translation="MESGKRQSINSPARPAPREISCSETLLNDGDDDAQANSTEIDNH
                     DMETGRDVSPSPRNLVGTTSHDEMQQEQLYLEYFHSAIITEELGLIKHLKRAHGKMIK
                     AIQELIRVKGYRSADSGKEYRFKWTDNATYYLLKYCLEIGPFYGFEHLKRPSLTKLEQ
                     SSLISLKWSCVWYDLLMTLEFENSIIPTESQIKSKCRYLLDNAHPKLFAVTTGDERNP
                     FSFTGVDKVDNNLEMLTRLKNDAEQRKVEIQKLETDRQNNKRTLGQMLCSNSIPSVTE
                     GLSNSDSEEPSSIDDINQPNSITMRRNKRMGRLLDFKEIAQYSLSNSALVGDLQETLK
                     ELIEAAAVEERKYKDKEQQRKDQELALKQKKLEISLQHNQRMLELELERQKREQFDHD
                     AKKIDTLVKMMDRAKSLEGDKSPSSEALQKLLHNFVSRYT"
     STS             418154..419790
                     /standard_name="SHGC-59513"
                     /db_xref="UniSTS:27740"
     gene            complement(<419442..>420332)
                     /locus_tag="KLTH0B05082g"
                     /db_xref="GeneID:8290846"
     mRNA            complement(<419442..>420332)
                     /locus_tag="KLTH0B05082g"
                     /product="KLTH0B05082p"
                     /transcript_id="XM_002551962.1"
                     /db_xref="GeneID:8290846"
     CDS             complement(419442..420332)
                     /locus_tag="KLTH0B05082g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B05082p"
                     /protein_id="XP_002552008.1"
                     /db_xref="GeneID:8290846"
                     /db_xref="InterPro:IPR015168"
                     /db_xref="UniProtKB/TrEMBL:C5DCQ9"
                     /translation="MALKVGFIPEHFATPLCFAKTVGFFEDQGVEAELIPYPSGSGHL
                     IQSLNAGELDIAIGLTEAFVRGIADTEPGQKPQYQIAGTYVKSPLEWCVSTGANRDDL
                     QDLKALDGRRIGVSRIGSGSHVMSYVMALQLDFTKPFADFPVLDNFDNLRAAVNSGDA
                     DAFMWEYYTSKKYLDSGEIKMLGHVESPWPSWVVVKRVDLDLGVFGRFVFAINSGIDY
                     FNKNPDEAVRFITENFGYSEEDAASWFKTVKFHDNCGDINDLHGVVTGTLHILGTAGV
                     LQNKDEVVIEENLRVGTLTG"
     gene            <420999..>423680
                     /locus_tag="KLTH0B05104g"
                     /db_xref="GeneID:8290847"
     mRNA            <420999..>423680
                     /locus_tag="KLTH0B05104g"
                     /product="KLTH0B05104p"
                     /transcript_id="XM_002551963.1"
                     /db_xref="GeneID:8290847"
     CDS             420999..423680
                     /locus_tag="KLTH0B05104g"
                     /note="similar to uniprot|P53550 Saccharomyces cerevisiae
                     YNL118C DCP2 Protein required for the decapping of mRNAs
                     functions to allow the production of active Dcp1p contains
                     a pyrophosphatase MutT motif and several alpha- helical
                     leucine-rich motifs"
                     /codon_start=1
                     /product="KLTH0B05104p"
                     /protein_id="XP_002552009.1"
                     /db_xref="GeneID:8290847"
                     /db_xref="GOA:C5DCR0"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="InterPro:IPR007722"
                     /db_xref="InterPro:IPR015797"
                     /db_xref="InterPro:IPR020084"
                     /db_xref="UniProtKB/TrEMBL:C5DCR0"
                     /translation="MSLPLRRPLESVTSLDRVLEDLIVRFIINCPPEDFSSVERELFH
                     VEEATWFYTDFVKLMNPKMPNMKIKSFAQHVIKLCPMVWKWDVRAEQALQKFSQYKRS
                     IPVRGAAIFNRSLTKLLLVKGIESESWSFPRGKISKDEGDVDCCIREVLEEIGFDISD
                     YIDEDQFIERTIAGKNYKIFLVSGVPEDFDFQPQVRNEIEKIQWHDFKKLSRNNGNKQ
                     HVKIYLVNTLMRPLAMWVKSHRQIDNDDKLKAHVETQLKLLLGIKKEETPDPGRELLN
                     MLQSSVAAPQEALAAAPQSPSELPPSSKSSQDSTPATNAAPPMKSPPPQLHHNFPFML
                     FQPFAPFPFMAGAGMQTGGPVPGLDTSSSNSVQTQPPPTPSMNTLAKPTVAEEEEEEE
                     EQQQQQRDSQQFQLLEPPRPQSTTSKQLLDLLNRKSSEKAEPTEQQTTKPKFKILKRG
                     ESLTPTPSAPQNDNEADSKALLNLLKKPQEPSITRETEDAQPTTMIEKPIATPLEDLP
                     HEEEASLHFANTHSAAAASESEYEDFESSSEEEDIGNDEEEAKASSLKGEGNFGQKFE
                     HTSTNPNVGYGHDQTRISGPMQGLKEQSSGAADVPHKDSSNLSEQSTGGTFITQSSKS
                     QTKPKIKLLKRGESLKDMIFTNGNKTLETSEASHVVKTTSHEGESNELLKLLKKDAIS
                     STADFTNAEAAIHRDSTSARRGTEGSSPLSTTVNQHVTPGQQPISSALTGSDDAKDLL
                     NILHRKNQASQSYQLQSTPEIQQALCTVDTSRGNSSMAAGDFLNMLPNGSSVSSPTAA
                     GNFLPGMEAQFRNPYYNQYPTSSGVPIPPQFPVQPPYAQSPPQNQNSSQQLLGMLKNP
                     HAGIAASPAVNSASTSDTPFVSEKGASHELLSLLQRR"
     gene            complement(<423735..>425168)
                     /locus_tag="KLTH0B05126g"
                     /db_xref="GeneID:8290848"
     mRNA            complement(<423735..>425168)
                     /locus_tag="KLTH0B05126g"
                     /product="KLTH0B05126p"
                     /transcript_id="XM_002551964.1"
                     /db_xref="GeneID:8290848"
     CDS             complement(423735..425168)
                     /locus_tag="KLTH0B05126g"
                     /note="similar to uniprot|P53923 Saccharomyces cerevisiae
                     YNL119W NCS2 Protein with a role in urmylation and in
                     invasive and pseudohyphal growth inhibits replication of
                     Brome mosaic virus in S. cerevisiae which is a model
                     system for studying replication of positive- strand RNA
                     viruses in their natural hosts"
                     /codon_start=1
                     /product="KLTH0B05126p"
                     /protein_id="XP_002552010.1"
                     /db_xref="GeneID:8290848"
                     /db_xref="GOA:C5DCR1"
                     /db_xref="InterPro:IPR019407"
                     /db_xref="UniProtKB/TrEMBL:C5DCR1"
                     /translation="MGINQLCKRCKTAEAAVVSRKEPFCIACFRKFVSLKQRKQMMSD
                     QYFQDIFKVMYPDKKKTAEEAERLNQGSRILVPLSFGSSSIVMLDVLNDTLTEQREMH
                     RGKTGFRIDVLVCYLKDDLEELKRKAEALMTVKLRDNKNSVKVHLVDIESSMNSPDFT
                     RIHLQDSTYMVRNASVSANEAQSVKELLSSCSNRSAREDLLNIIKTAIIKRFGVQGGY
                     KAILWGHSTTRLADEIMSLVVKGRASQIANALNDSEEDFEYGEPLRNLHPMRDILLSE
                     IDAYCFVSDLTQYLHKYKPQDTLLVNKIPVAPDAQPPRAKLTKNMTINELARQYFDGI
                     EGSYSNVISTVVRTGAKLDDPENSLKSKVRCGICNNTVFCDGSHWLRNITVTSSHPIE
                     DAEEEAMFRAWSASEQGKVRGEYLKLTSEMEISGHEFPVCYGCILTLGEVKHKSLIWP
                     SSQSNSVESVIEDFIISDESDSEHEGH"
     gene            <426037..>426372
                     /locus_tag="KLTH0B05148g"
                     /db_xref="GeneID:8290849"
     mRNA            <426037..>426372
                     /locus_tag="KLTH0B05148g"
                     /product="KLTH0B05148p"
                     /transcript_id="XM_002551965.1"
                     /db_xref="GeneID:8290849"
     CDS             426037..426372
                     /locus_tag="KLTH0B05148g"
                     /note="similar to uniprot|P38824 Saccharomyces cerevisiae
                     YHR116W COX23 Mitochondrial intermembrane space protein
                     that functions in mitochondrial copper homeostasis
                     essential for functional cytochrome oxidase expression
                     homologous to Cox17p"
                     /codon_start=1
                     /product="KLTH0B05148p"
                     /protein_id="XP_002552011.1"
                     /db_xref="GeneID:8290849"
                     /db_xref="InterPro:IPR009069"
                     /db_xref="InterPro:IPR027179"
                     /db_xref="UniProtKB/TrEMBL:C5DCR2"
                     /translation="MEKEPKTAPAENADPQLQVDKTKVDYAPKNTESGSFKFYPDNPE
                     SSFNKYRFAAKDASQFYDPCQESSKMSMKCLELNNYDRSMCQEYFDAYRECKKQWLQA
                     RRRNRSQWE"
     gene            <427608..>429389
                     /locus_tag="KLTH0B05170g"
                     /db_xref="GeneID:8290850"
     mRNA            <427608..>429389
                     /locus_tag="KLTH0B05170g"
                     /product="KLTH0B05170p"
                     /transcript_id="XM_002551966.1"
                     /db_xref="GeneID:8290850"
     CDS             427608..429389
                     /locus_tag="KLTH0B05170g"
                     /note="similar to uniprot|P07213 Saccharomyces cerevisiae
                     YNL121C TOM70 Translocase of Outer Mitochondrial membrane
                     70 kDa mitochondrial specialized import receptor of the
                     outer membrane"
                     /codon_start=1
                     /product="KLTH0B05170p"
                     /protein_id="XP_002552012.1"
                     /db_xref="GeneID:8290850"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="UniProtKB/TrEMBL:C5DCR3"
                     /translation="MSSDNSFGQFVARNKTAIVASVAAGATAVGAYYYYQQLQRQPAN
                     KKEPESESKSSKKKKKTKKKAPGPSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKG
                     NEFFKNKKYDEAIQYYSWAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPD
                     YSKCLLRRASANESLGNFADAMFDLSAVSLYGDFSGASIEPLLERNMNKQSMLVLKEK
                     LEKQQEYKLPSNTSLASFFGIFQPETTFENYDDNSEADKYLLEGLTNLYKRTADGYET
                     ADLSFAKARDAFKVLLEQNPEDADLKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVE
                     YFPRPNTYIYMALIMADKGQATEYFDNFEKALKLDPSCAAVYYHRGQMYFITQQFEQA
                     GKDFEKAKELSESNIFPYIQLACLTYREGKFDDSETLFSEARRKFPTAPEVPNFYAET
                     LSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGKATLLSREPSVENFVEATQLFE
                     KACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADLARSFDEKLQATTFAEATKI
                     QKKIRADPVVSAKIEETLAAYRAQGMI"
     gene            complement(<429511..>429930)
                     /locus_tag="KLTH0B05192g"
                     /db_xref="GeneID:8290851"
     mRNA            complement(<429511..>429930)
                     /locus_tag="KLTH0B05192g"
                     /product="KLTH0B05192p"
                     /transcript_id="XM_002551967.1"
                     /db_xref="GeneID:8290851"
     CDS             complement(429511..429930)
                     /locus_tag="KLTH0B05192g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B05192p"
                     /protein_id="XP_002552013.1"
                     /db_xref="GeneID:8290851"
                     /db_xref="UniProtKB/TrEMBL:C5DCR4"
                     /translation="MSFELQILNDVLDWARAPGGPAGDYIHPSHVSLWSYPREKAFQV
                     HEGNNNPSSARYGFDSPYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEA
                     SAEDDFFHLQKDIGVRERSFKKPRGYACKNCCMYSHI"
     gene            <430231..>430506
                     /locus_tag="KLTH0B05214g"
                     /db_xref="GeneID:8290852"
     mRNA            <430231..>430506
                     /locus_tag="KLTH0B05214g"
                     /product="KLTH0B05214p"
                     /transcript_id="XM_002551968.1"
                     /db_xref="GeneID:8290852"
     CDS             430231..430506
                     /locus_tag="KLTH0B05214g"
                     /note="some similarities with uniprot|P53921 Saccharomyces
                     cerevisiae YNL122C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B05214p"
                     /protein_id="XP_002552014.1"
                     /db_xref="GeneID:8290852"
                     /db_xref="GOA:C5DCR5"
                     /db_xref="InterPro:IPR021137"
                     /db_xref="UniProtKB/TrEMBL:C5DCR5"
                     /translation="MLSNLMRSIMSYGRQITQLQQPFMMQTRNLMKTHKGTAKRWRKT
                     STSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKHLKRLLPYN"
     gene            complement(<430626..>433568)
                     /locus_tag="KLTH0B05236g"
                     /db_xref="GeneID:8290853"
     mRNA            complement(<430626..>433568)
                     /locus_tag="KLTH0B05236g"
                     /product="KLTH0B05236p"
                     /transcript_id="XM_002551969.1"
                     /db_xref="GeneID:8290853"
     CDS             complement(430626..433568)
                     /locus_tag="KLTH0B05236g"
                     /note="highly similar to uniprot|P53920 Saccharomyces
                     cerevisiae YNL123W shows protein sequence similarity to
                     the mammalian Omi/HtrA2 family of serine proteases"
                     /codon_start=1
                     /product="KLTH0B05236p"
                     /protein_id="XP_002552015.1"
                     /db_xref="GeneID:8290853"
                     /db_xref="GOA:C5DCR6"
                     /db_xref="InterPro:IPR001478"
                     /db_xref="InterPro:IPR001940"
                     /db_xref="InterPro:IPR009003"
                     /db_xref="InterPro:IPR025926"
                     /db_xref="UniProtKB/TrEMBL:C5DCR6"
                     /translation="MSLNAKRTHSELSDSECNGRTKLQAANGGHFDSSDEEVSFVEEE
                     IVEEPINNAQWQTTISKVVSSVVSIHFSQVAPFDCDSALVSEATGFVVDSELGIILTN
                     RHVVGAGPFVGYAVFDNHEECDVIPIYRDPVHDFGFLKFDPKNIKYMQVCALELKPSL
                     AKVGSEIRVIGNDAGEKLSILAGFISRIDRNAPDYGELTYNDFNTEYIQAAASASGGS
                     SGSPVVNIDGHAVALQAGGSTEASTDFFLPVNRILRALNCIRAKKAVTRGTIQTQWIL
                     RPYDECRRLGLTPDREADARKQFPDRIGLLVAETVLREGPGDNKIKEGDTLISINGEL
                     IASFIQVDDILDRSVGQTIELLIQRGGKDIKVSCEVGDLHAITPSSYLEVCGATFNEL
                     SYQMARFYAIPVRGVFLSSASGSFNFDSKEKVGWIVDAIDNQETPTLETFIEVMKKVP
                     DRKRVTVRYHHLTDQHSPHVASVYIDRHWCSEFRIYERNDTTGIWDYKNVADPLPPLP
                     EVSHEAKFIDLSIDNKQLAKLSRSLVMVSSISPIPLDSLSAEPRKASGLVVDANQGYV
                     VVSRRVIPHDCLDVFVTIADSVILPAEVTFLHPTQNYAVVKYDPALVLAPVETPKLSF
                     ARMKRGDKAHFIGYTHNNRLVSSDTKVTDISSLSVPSNLIPRYRATNLEAIGIDCNVS
                     SRCNSGILADDDGTVRALWLSFLGEIQDGKEKVYLMGLDMADLKSVIDLLKEGKKPRI
                     NIVDAGFGSISVAQARIRGVPEEWISKMEQESENRLQFMNVTRVSFTNEKDKLYPGDV
                     ILCVGGKLVKEMRDLDGIVTSGEGANEEQVLEFKLVRNGKIVDLSVKTREINETSHFA
                     IFAGCILQAPHHAVLQAMMDIPSSVYCTFRGQSSPATQYGIAATNFITHINEIETPDL
                     DTFVKVVKTIPDNTYCKIRLVTFDNVPFAISLKTNYHYFPTAELKKDPSSGKWIENEL
                     NKTDARSD"
     gene            complement(<433847..>435127)
                     /locus_tag="KLTH0B05258g"
                     /db_xref="GeneID:8290854"
     mRNA            complement(<433847..>435127)
                     /locus_tag="KLTH0B05258g"
                     /product="KLTH0B05258p"
                     /transcript_id="XM_002551970.1"
                     /db_xref="GeneID:8290854"
     CDS             complement(433847..435127)
                     /locus_tag="KLTH0B05258g"
                     /note="similar to uniprot|P38826 Saccharomyces cerevisiae
                     YHR118C ORC6 Subunit of the origin recognition complex
                     which directs DNA replication by binding to replication
                     origins and is also involved in transcriptional silencing
                     may be phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="KLTH0B05258p"
                     /protein_id="XP_002552016.1"
                     /db_xref="GeneID:8290854"
                     /db_xref="GOA:C5DCR7"
                     /db_xref="InterPro:IPR008721"
                     /db_xref="InterPro:IPR016811"
                     /db_xref="UniProtKB/TrEMBL:C5DCR7"
                     /translation="MSTQQVRRCVCDILSIEFDDPKNDWSQGRLKKLQTTTSTLYNVS
                     LSKVMLKQHEETARGHLCAFIAAEKLSEKYEPDLRYRRDKIPLEPRQATKLLDILKSS
                     ILTSSPVKSIGWSPSPVKQRSPVKNGGRFTAMDPKEMRKQLFGTPTKANLPPKALENQ
                     QTASPEPATEDEANKIRTTRRKLTFEVEDAEDERDLTLASRKVNSASSGEGEVREGTR
                     YAEVENSSMPVTPRKRSASASAKTPSPKKRRIPDRGDAPNSARACLLYKKYYKMTAAE
                     IVELCNHFEIPSDLAYRILDQFFEHATYLVFPFQLVCGLILNCCQVIFNEKRRKDPRV
                     NEYLYQKMSLLMKTNDVTEIKESMRIVRELIDGEKWYRNLKVQYDYFDGVVYEEAIAI
                     RLGNMLQRATNIATDEQFEIWKHNIITDISLRDG"
     gene            <435558..>438518
                     /locus_tag="KLTH0B05280g"
                     /db_xref="GeneID:8290855"
     mRNA            <435558..>438518
                     /locus_tag="KLTH0B05280g"
                     /product="KLTH0B05280p"
                     /transcript_id="XM_002551971.1"
                     /db_xref="GeneID:8290855"
     CDS             435558..438518
                     /locus_tag="KLTH0B05280g"
                     /note="similar to uniprot|P38827 Saccharomyces cerevisiae
                     YHR119W SET1 Histone methyltransferase subunit of the
                     COMPASS complex which methylates histone H3 on lysine 4
                     and is required in transcriptional silencing near
                     telomeres contains a SET domain"
                     /codon_start=1
                     /product="KLTH0B05280p"
                     /protein_id="XP_002552017.1"
                     /db_xref="GeneID:8290855"
                     /db_xref="GOA:C5DCR8"
                     /db_xref="InterPro:IPR001214"
                     /db_xref="InterPro:IPR003616"
                     /db_xref="InterPro:IPR017111"
                     /db_xref="InterPro:IPR024636"
                     /db_xref="InterPro:IPR024657"
                     /db_xref="UniProtKB/TrEMBL:C5DCR8"
                     /translation="MSDYYGRGYDSPYQRYSRGHNGRRAGRRHGGRPPKRESHQYGYS
                     RRDEYLHGETYFPPSSRMSKPVNAVVEPLRPKPQLRFNNDSFREKYHYFDPVSEKLLH
                     RDEMKSWASEKLPKTGYVIVQDQSKDKTRAVMKPRCPDQKAVDPRSQSSPSPESGVYR
                     KRRNQLVSLPRLVYDKHSVGPPPPNEIVVYPVFRDHSSAVQDIAIKNYFSTFGEISHF
                     QSFNDPISALPLYVYVVRYTGPPGNLDAPFRAAYKAAKTFENSHYFVSGFKFAVSINR
                     ANYSQKIVDGFIQDNIKQAAKIKKEVERQNSQKQISSGPQAKRLPRDLERVVNGRPSL
                     LVLKRFISIHGLTVEDFKIKLAKYKFSRVLNHSTGIYIVFNDISDARACMFVENDVLA
                     MPSKRRRTPVKVRFSLIESQPSIVATVKRDGLRDQKKTYASEEQLLETAADLIIDELG
                     RALDRDIKRRVIGPLVFDSLNPANYPAITAKKDEEEERKSEQRRVAAEQKQDQQSKSA
                     SFDIFNLYGARFRKKNYIKSQIGEQSEPEYESKLKFSSSLKDSGQEKPMAHLLNESSR
                     SNTPLAAENFKSDDEQAQSAVEDDEDEEGFSDVSELPEKKIKTGSSEATTPETESNKY
                     VLNSSRIQELLRIPEKYRPDASEEPKTIYPQDDFDSYEFSSVSLGDFQRAVKDEEDFE
                     TLKNILNPPSSALSSNEEYILHSLVHEVSTEAEERHKVSKLQTSANEVPFDESLRSSA
                     GSFKAGGFKKIPDKLKNCYLPHRRKLHQPLNTVYNHQDTPEAVTDVHRNESEKLDMDA
                     HAQEVSSSRVNRAINRRFQQDIEAQKAMIGSESELLTLNQLTKRKKPVTFARSAIHNW
                     GLYALEPIAAKEMIIEYVGEILRQPVAEMRERTYLKSGIGSSYLFRVDESTVIDATKK
                     GGIARFINHCCDPSCTAKIIRVGGRKRIVIYALRDIAANEELTYDYKFERETDDEERL
                     PCFCGAPTCKGFLN"
     gene            <438719..>441667
                     /locus_tag="KLTH0B05302g"
                     /db_xref="GeneID:8290856"
     mRNA            <438719..>441667
                     /locus_tag="KLTH0B05302g"
                     /product="KLTH0B05302p"
                     /transcript_id="XM_002551972.1"
                     /db_xref="GeneID:8290856"
     CDS             438719..441667
                     /locus_tag="KLTH0B05302g"
                     /note="similar to uniprot|P25846 Saccharomyces cerevisiae
                     YHR120W MSH1 DNA-binding protein of the mitochondria
                     involved in repair of mitochondrial DNA has ATPase
                     activity and binds to DNA mismatches has homology to E.
                     coli MutS transcription is induced during meiosis"
                     /codon_start=1
                     /product="KLTH0B05302p"
                     /protein_id="XP_002552018.1"
                     /db_xref="GeneID:8290856"
                     /db_xref="GOA:C5DCR9"
                     /db_xref="InterPro:IPR000432"
                     /db_xref="InterPro:IPR007695"
                     /db_xref="InterPro:IPR007696"
                     /db_xref="InterPro:IPR007860"
                     /db_xref="InterPro:IPR016151"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCR9"
                     /translation="MGRFLSYTKRLSIPNAGILGYCAARPKTGSLLSHLSGNIHQERR
                     CFSSVPSTEKLTVPIEHGPGTANADASRLNIELGLPLDNKSIKRSNRGNRTIKNSLPP
                     SLQYVRDTMDKYKDFVVLTQMGSFYELYFEHADIYAPKLNLTLTSREYAHGKVSFAGF
                     PVQQVNRHLKVLVKELGYSVAIADQFKRTSAASNESNRFLRRVTRIVTPGTFLDEAFE
                     NLQENTYLLSIEFPESCVQKLVDINMKVGLCWCDISTGEIFVQQTLLKDTISAVARIG
                     PREILLDEELFSFKLEEGEWYPEFVELKRFFIKYQKMPSNHRSMNTFRYLFNSGYLEG
                     DFFRLENVLHDFSQKEVAALRNMLLYIEEHLPDTAVNLQEPQRQLTNSLMQIDSRSCS
                     ALEITSTMRANTKKGSLLSAIKRTVTPSGSRLLSQWLSAPSLDTAEIKRRQQLVTLFR
                     NNHELTELLIRTLKQTYDMPRILQKFSFGKGDATELLQLSHSLQKAEFIGKSIKAKCR
                     TKQGVLGNILSSVISPLEYDKQLIGRVLSSLDEDQLMKFTMLQSESESELCEKDQNLE
                     KKDVDAFGESSLWVIRPGAGTRISELHGKHQELLKRRRELCNRFESTISDSVQVKGVQ
                     LRLRHTGEYGLYISATSTNIKLLCSLVKDGMLFRGSPLKILQKSSQSCWLDHRLWTEL
                     GQELEYIVMKIKREENIVISSFKKEFIKKSFSIRRVSQVLDYLDVLTSFAKLSTEKNL
                     SCPVVDTSSDLDIKSGRHIVVEDGLLSKSLQKFTSNDCRLEASNLWVITGPNMGGKST
                     FLRQIAIIVIMAQIGSYVPCESAKIGVVDKIFSRIGSADDLYNQMSTFMVEMTETGYI
                     LKGATKRSLAILDEIGRGTSGKEGISLAYAALKYLVDRNQCRSLFATHFGQELKTLVD
                     NHCDEAVRKKISYYRSGVYDTGGDDFCYDHSLTPGICNNSDAIRVAMRAGFPKEALDN
                     ARKALKLSDT"
     gene            complement(<441709..>443148)
                     /locus_tag="KLTH0B05324g"
                     /db_xref="GeneID:8290857"
     mRNA            complement(<441709..>443148)
                     /locus_tag="KLTH0B05324g"
                     /product="KLTH0B05324p"
                     /transcript_id="XM_002551973.1"
                     /db_xref="GeneID:8290857"
     CDS             complement(441709..443148)
                     /locus_tag="KLTH0B05324g"
                     /note="some similarities with uniprot|P53919 Saccharomyces
                     cerevisiae YNL124W"
                     /codon_start=1
                     /product="KLTH0B05324p"
                     /protein_id="XP_002552019.1"
                     /db_xref="GeneID:8290857"
                     /db_xref="GOA:C5DCS0"
                     /db_xref="InterPro:IPR007504"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="UniProtKB/TrEMBL:C5DCS0"
                     /translation="MCVDTFSKALLNPEEKPTGIEDNVDVGEISSDEEAENVTHSAEA
                     TAAVEESERTSSGESSMLNGAHEVSKSQVSEELPSLDAGEGSSSSEDEDSDDSSSSSS
                     KEEGFLIDGLDEEDEEGDTVHGPIKSKNELNEEPIFEIPEDFELGPDTPIREIGFIKS
                     AFDYNIIVQSVSSAEQRVLKENSLLCLEDRQILGPLCEVFGPLQSPFYRVLLPKSKNE
                     QFEALRSKAGAKVFYVAPEAHWLDTFELKRMRGTDASNGFDEELPEDEQEFSDDEKEA
                     EFKKLKKNSRKRKNENATNVGPIPSKKSVNSAHSKPKPRQVASAAFEYASSSSSYKPR
                     NERQHETSRSTSAISQSQGSYPQQQHVPTPQPQYASQQTFGYPQQVYASHQMYSPPPQ
                     PAVQQFGNPFTHPYSQYPQMLPPQHLMPHPQHLPQHPQGQFPGSYPYTQAQSPPQQPV
                     AAQTQNMDQVLQLQQILMNQQRQHQNQSQ"
     gene            complement(<443928..>446447)
                     /locus_tag="KLTH0B05346g"
                     /db_xref="GeneID:8290858"
     mRNA            complement(<443928..>446447)
                     /locus_tag="KLTH0B05346g"
                     /product="KLTH0B05346p"
                     /transcript_id="XM_002551974.1"
                     /db_xref="GeneID:8290858"
     CDS             complement(443928..446447)
                     /locus_tag="KLTH0B05346g"
                     /note="similar to uniprot|P53540 Saccharomyces cerevisiae
                     YNL126W SPC98 Component of the microtubule- nucleating
                     Tub4p (gamma-tubulin) complex interacts with Spc110p at
                     the spindle pole body (SPB) inner plaque and with Spc72p
                     at the SPB outer plaque"
                     /codon_start=1
                     /product="KLTH0B05346p"
                     /protein_id="XP_002552020.1"
                     /db_xref="GeneID:8290858"
                     /db_xref="GOA:C5DCS1"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="InterPro:IPR015697"
                     /db_xref="UniProtKB/TrEMBL:C5DCS1"
                     /translation="MELENEVSLVISELVSTSLPLALLRPLIKDIIAILNSPAASGEG
                     VSMILKKYRGLADIGQENLPKWQKLENVLRLIASSSSSEEALAYVRFVRTVLDEAPQR
                     SPFNGPAPPLSFNSLEKHDSIMTPVKNTLAYAESFENIDRYSDRRSILSSAYRGNLRE
                     TKNTTSLASLSNPYYSGVPSEEEILKSVPYTLLATTSHLFKFDKGSVHIPDNVPNGES
                     GILHMLFEVALLYQYLQKRVEDYKASGTLSPLKTAFIAHINTQLHHYMSTVNTLSKNP
                     QIQSLRALYIEIHHFIFEFRIYHSFITNLQSLRGDQLLSQMHNLKNHGDVLVKEISTS
                     AYQSLATLYYEYVINWLTRGQLEAHQEFFVEVVPSSQHNATALQYSAEKVPSFLPKLT
                     ADEIFMIGKTRVFLERDCKEIQWVNDSSQKFSSIYRSLNGEGSTEFQSVVHSHYVEVI
                     SFCRKALEEKYAFSGVLGLLKNVLLMGKGDFIDQMIQNSSEFLQEPSVSLPSYKLTRC
                     LQESIKKSSLKKFLQKPYLNSIVNGIDARVLEMGSGSIGWDVFTLDYLPAKPLTFVLD
                     FNHNGGRKEYLRLFNFLWRIKKNNFFFQEQWLRNNSLMRDFKRLRRNQPLVRDVMKKM
                     DKINTLKHNVQHFNRKIEAYCFQSIIDKNFRNLQKKLSMEKPGSETQVNVTVLKSGLK
                     VASGILRPQSQLLHQLGVKRESSSCHNMQYTIDELKEMHDHYLQAMLGHELLDSSNKH
                     KKLGTFTNQHYPSSLIVILGEIFEFILQYSELNELVHELLIQLSLQNEDGISALLSRL
                     NELLGKVVSRYRWIQKTCYYFIKDLKADGDTELFSVSRILR"
     gene            complement(<446569..>449364)
                     /locus_tag="KLTH0B05368g"
                     /db_xref="GeneID:8290859"
     mRNA            complement(<446569..>449364)
                     /locus_tag="KLTH0B05368g"
                     /product="KLTH0B05368p"
                     /transcript_id="XM_002551975.1"
                     /db_xref="GeneID:8290859"
     CDS             complement(446569..449364)
                     /locus_tag="KLTH0B05368g"
                     /note="similar to uniprot|P53917 Saccharomyces cerevisiae
                     YNL127W FAR11 Protein involved in G1 cell cycle arrest in
                     response to pheromone in a pathway different from the
                     Far1p-dependent pathway interacts with Far3p Far7p Far8p
                     Far9p and Far10p"
                     /codon_start=1
                     /product="KLTH0B05368p"
                     /protein_id="XP_002552021.1"
                     /db_xref="GeneID:8290859"
                     /db_xref="InterPro:IPR012486"
                     /db_xref="InterPro:IPR021819"
                     /db_xref="UniProtKB/TrEMBL:C5DCS2"
                     /translation="MLRPAGCEVTKIRPAMPEGVKTRSPLIRSISSKDLRRKGGRRNG
                     YLSPENSSNKDANDSSSEAEEHLLQDLDNILYKKLHLGETSPNGGSVRGSPISSSPPN
                     THDHSDDDQENNALDQDAEEEAENEDFANVDEIDGPISPSSSSGSLKDLAKANVNKGT
                     DQTLNNDIDYNLPVDKEFQNQLNKRAEEIEKDGSIFQSSRTTLEWSIQDFYSLYDELP
                     DWFCSVDYNMLGDAKRCFEKSFSPTRFTVEHSYAASVLEQLTSDLQNCNNEASCTLSL
                     AYICMGTFGNKKSLIEHIKAIKNNNFLLVPHLSVLLKSFKKFASHCREGKSHLKHYTN
                     LFFNCSTILFFLVNVLVESKAKGQCVTETEAAIEEIYREEILEFVVKYIEYWRWNSRL
                     SMRIRIVIILFHRLLLLQFGDMQYFEEVKEYVHKKHNIKKRENGPGALAISPLDYQAF
                     REDVTSRFPTFVPPESDIPASFDNSNSLSQFLEIPRPKSKSTLNSNLSAPECHIATPV
                     PSPCSSPTSQMRGSKSRKSFQTNLAYPSLYPCDDTDGSDPLSSRIRAPGCGEGETQIP
                     FSVLEATDILHKNVEIKLSTRQLWHERELFMKQERGWGSTHESPSEFLYHYNNENNGE
                     ARTMVRIEEFYKKCLPSLSSIAYVLLQTMESNLNNRTYVRDDTKDESSGLQTAPQLEI
                     IRSKEIVLKSSCSSLYLLMKWLKLSHILKFEQFCVILHDYKLIGIVTSLLNTYTDKYQ
                     ERVFGNVLQPTHSFWKACSSYNADSYDISTNKTVLSHENLDLRFLNTVVYLLRLLSKV
                     TGCKTQRLKELPLAIGTLLKTFYQIFNLDIYQPILKITQELTPFKNKKWKSEHMDLIS
                     GVYLYRRLKLSDNWVTGKDITGELNDACGQEIALRALLQFYNFLHYKPSIEHLGYHDK
                     SDFSFFSKEAEILTSVH"
     gene            <449461..>449811
                     /locus_tag="KLTH0B05390g"
                     /db_xref="GeneID:8290860"
     mRNA            <449461..>449811
                     /locus_tag="KLTH0B05390g"
                     /product="KLTH0B05390p"
                     /transcript_id="XM_002551976.1"
                     /db_xref="GeneID:8290860"
     CDS             449461..449811
                     /locus_tag="KLTH0B05390g"
                     /note="some similarities with uniprot|P38828 Saccharomyces
                     cerevisiae YHR121W LSM12 Protein containing an Lsm domain
                     and an AD domain may bind RNA and have a role in RNA
                     processing"
                     /codon_start=1
                     /product="KLTH0B05390p"
                     /protein_id="XP_002552022.1"
                     /db_xref="GeneID:8290860"
                     /db_xref="UniProtKB/TrEMBL:C5DCS3"
                     /translation="MSISLEHILGFKVKVTNVLDVASAGNIYSYNSSNNTITLQLTKS
                     AHHAQQFKVIRLSFIKSLEVIGERPTKNSFRKDSMKPIEIRIENVREALQNKVQQAQG
                     ATAAIQEHIVTASK"
     gene            complement(<449900..>451240)
                     /locus_tag="KLTH0B05412g"
                     /db_xref="GeneID:8290861"
     mRNA            complement(<449900..>451240)
                     /locus_tag="KLTH0B05412g"
                     /product="KLTH0B05412p"
                     /transcript_id="XM_002551977.1"
                     /db_xref="GeneID:8290861"
     CDS             complement(449900..451240)
                     /locus_tag="KLTH0B05412g"
                     /note="similar to uniprot|P53916 Saccharomyces cerevisiae
                     YNL128W"
                     /codon_start=1
                     /product="KLTH0B05412p"
                     /protein_id="XP_002552023.1"
                     /db_xref="GeneID:8290861"
                     /db_xref="GOA:C5DCS4"
                     /db_xref="InterPro:IPR000340"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR020422"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="InterPro:IPR029023"
                     /db_xref="UniProtKB/TrEMBL:C5DCS4"
                     /translation="MPFSLQAFTPENILRSVYSSPIKVHKNDLGFSLDLSYITRELIV
                     CSYPVIKYPQLLYRNSLKDLISYLNLHHGAGNWKIYNFKAEKGASDYSDEDLVTALFE
                     LSNFCEKASASAGPLLSTIYDPTKSPCKEGHDSASTQSLSSTRESLLERVGHYIQRYG
                     WLDHSPPPFTLLQEILDDMHEYLIQDSSRVVLLHCKLGKGRSGSVVVAYLMKYMRCSL
                     REGREIFVNNRFKVGLTQGVTISSQLRYLGYHERFLQADHPSNWSKILSELTRAQFMI
                     NSFEIIHLLSAAPVKLESKTYTMSIKIQIYNRNRDGLIDVFDTNNKEQSIDSKPHSNL
                     NRVSVGQRITESDIRISFGLRHKGSAFIDNVTQLTSISHFWINLYWETLACSRSESTD
                     HYTLDKLANEQSRCRDRKNFAMFSIKWAELDGMKGLQSKGFKLFETFTLRWQLL"
     gene            complement(<451373..>452164)
                     /locus_tag="KLTH0B05434g"
                     /db_xref="GeneID:8290862"
     mRNA            complement(join(<451373..452032,452105..>452164))
                     /locus_tag="KLTH0B05434g"
                     /product="KLTH0B05434p"
                     /transcript_id="XM_002551978.1"
                     /db_xref="GeneID:8290862"
     CDS             complement(join(451373..452032,452105..452164))
                     /locus_tag="KLTH0B05434g"
                     /note="similar to uniprot|P53915 Saccharomyces cerevisiae
                     YNL129W NRK1 Nicotinamide riboside kinase catalyzes the
                     synthesis of nicotinamide nucleotide (NMN) from
                     nicotinamide riboside involved in a salvage pathway for
                     NAD biosynthesis"
                     /codon_start=1
                     /product="KLTH0B05434p"
                     /protein_id="XP_002552024.1"
                     /db_xref="GeneID:8290862"
                     /db_xref="GOA:C5DCS5"
                     /db_xref="InterPro:IPR026681"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCS5"
                     /translation="MESPQVLLVGISGCSSSGKTTLAKLSAELLPTAVLIHQDDFFKH
                     DEDIPFNDKYQIRDWDSPEALDMNLFGKELDHIKKTGSVSTTLIHNNNHDNSGAAEVR
                     PETQKEVKTKFAKAFEGTNTKVVFVDGFMMFNDQNIKSKFDLKLLVRAPYGTLKKRRA
                     ARSGYQTLDSFWIDPPYYFDEFVYSSYARSHSQLFEDGNVEGVLKKGSGILDFINDDS
                     TDINDALLWVCNCVVSMAQKK"
     gene            <454571..>455239
                     /locus_tag="KLTH0B05456g"
                     /db_xref="GeneID:8290863"
     mRNA            <454571..>455239
                     /locus_tag="KLTH0B05456g"
                     /product="KLTH0B05456p"
                     /transcript_id="XM_002551979.1"
                     /db_xref="GeneID:8290863"
     CDS             454571..455239
                     /locus_tag="KLTH0B05456g"
                     /note="similar to uniprot|P38829 Saccharomyces cerevisiae
                     YHR122W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0B05456p"
                     /protein_id="XP_002552025.1"
                     /db_xref="GeneID:8290863"
                     /db_xref="InterPro:IPR002744"
                     /db_xref="UniProtKB/TrEMBL:C5DCS6"
                     /translation="MSEFINENPDILDENLLPSRKEEEGDAFQDEALNTVNLLRRKRL
                     LKIHQTTACKVYRNVELIDRLKAQEMALDQVPDLTASETEESDEGEPEDPIDAQEIYD
                     MIAHISDPEHPLTLGQLAVVNLPDIEVSESNDKSKISEVLVKITPTITHCSLATLIGL
                     GIRVRLERSLPSRYRITILLKEGSHQSENQVNKQLNDKERVAAACENDQLLGVVSKML
                     STCK"
     gene            <455601..>456638
                     /locus_tag="KLTH0B05478g"
                     /db_xref="GeneID:8290864"
     mRNA            <455601..>456638
                     /locus_tag="KLTH0B05478g"
                     /product="KLTH0B05478p"
                     /transcript_id="XM_002551980.1"
                     /db_xref="GeneID:8290864"
     CDS             455601..456638
                     /locus_tag="KLTH0B05478g"
                     /note="similar to uniprot|P17898 Saccharomyces cerevisiae
                     YNL130C CPT1 and similar to uniprot|P22140 Saccharomyces
                     cerevisiae YHR123w EPT1"
                     /codon_start=1
                     /product="KLTH0B05478p"
                     /protein_id="XP_002552026.1"
                     /db_xref="GeneID:8290864"
                     /db_xref="GOA:C5DCS7"
                     /db_xref="InterPro:IPR000462"
                     /db_xref="InterPro:IPR014472"
                     /db_xref="UniProtKB/TrEMBL:C5DCS7"
                     /translation="MAPNLVTLSGLGFIIINVLTVLYYDPTLSEESPRWTYFSYALGL
                     FLYQTFDACDGQHARRTGQSGPLGELFDHCIDSLNTSLSMIVFASAVGSGMRFMTLMS
                     QFAILCNFYLSTWEEYHTHKLFLSEFSGPVEGILIIVAAFILTGIYGPQKLWHTLLGE
                     LTLWGHTYRIESIHAVYAFCSVGLVFNILSARRNVVEHYKKVSDSTQEAVDDVRKATK
                     GLVPFFVYFGTVFVLVLIDPEIISLPFILSVGLTMAFTVGRIIVSHLTKQSFPMINPP
                     MLTPTIQLLIRILMVHVIGYDQSSVLTALNWFGFGLTMGIHLMFITEVIYEFTTYLDI
                     YVLSIKHPKTA"
     gene            complement(<456831..>457268)
                     /locus_tag="KLTH0B05500g"
                     /db_xref="GeneID:8290865"
     mRNA            complement(<456831..>457268)
                     /locus_tag="KLTH0B05500g"
                     /product="KLTH0B05500p"
                     /transcript_id="XM_002551981.1"
                     /db_xref="GeneID:8290865"
     CDS             complement(456831..457268)
                     /locus_tag="KLTH0B05500g"
                     /note="similar to uniprot|P49334 Saccharomyces cerevisiae
                     YNL131W TOM22 Translocase of Outer Mitochondrial membrane
                     Mitochondrial import receptor complex protein"
                     /codon_start=1
                     /product="KLTH0B05500p"
                     /protein_id="XP_002552027.1"
                     /db_xref="GeneID:8290865"
                     /db_xref="GOA:C5DCS8"
                     /db_xref="InterPro:IPR005683"
                     /db_xref="UniProtKB/TrEMBL:C5DCS8"
                     /translation="MVELTEVREENISFEEEKVPSSSFSRQDTTAEHESSDEFSSDDE
                     YDEEETFLERLVALKDIIPPRQRQTISNVFNVTVSAVRNTFSKSGNVAWAVTTSALLL
                     GVPLSLSILAEQQLIEMEKSFDLQKDANEILVQGDATPAPAIA"
     gene            complement(<457520..>460687)
                     /locus_tag="KLTH0B05522g"
                     /db_xref="GeneID:8290866"
     mRNA            complement(<457520..>460687)
                     /locus_tag="KLTH0B05522g"
                     /product="KLTH0B05522p"
                     /transcript_id="XM_002551982.1"
                     /db_xref="GeneID:8290866"
     CDS             complement(457520..460687)
                     /locus_tag="KLTH0B05522g"
                     /note="highly similar to uniprot|P53914 Saccharomyces
                     cerevisiae YNL132W KRE33 Essential protein of unknown
                     function heterozygous mutant shows haploinsufficiency in
                     K1 killer toxin resistance"
                     /codon_start=1
                     /product="KLTH0B05522p"
                     /protein_id="XP_002552028.1"
                     /db_xref="GeneID:8290866"
                     /db_xref="GOA:C5DCS9"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR007807"
                     /db_xref="InterPro:IPR013562"
                     /db_xref="InterPro:IPR027992"
                     /db_xref="UniProtKB/TrEMBL:C5DCS9"
                     /translation="MAKKAIDSRIPSLIRNGAQTKQRSFFVIVGDKARNQLPNLHYLM
                     MSADLKMNKSVLWAYKKKLLGFTSHRKKREAKIKKEIKRGTREVNEQDPFETFISNQN
                     IRYVYYKETEKILGNTYGMCILQDFEALTPNLLARTVETVEGGGIVVILLKSMTSLKQ
                     LYTMTMDIHSRYRTEAHSDVVARFNERFILSLGSNENCLVVDDELNVLPISGGKNVQP
                     LPPKDEDEIPPRQQELIELKESLEDVQPAGSLVALSKTVNQAQAILNFIDAISEKNLN
                     STVALTAGRGRGKSAALGIAIAAAVSHGYSNIFVTSPSPENLKTLFEFIFKGFDALGY
                     QEHMDYDIIQSTNPSFNKAIVRVDIKKSHRQTIQYIVPNDSHVLGQAELVVIDEAAAI
                     PLPVVKNLLGPYLVFMASTINGYEGTGRSLSLKLIQQLRDQANSSGRETSETMVVSRD
                     NKKQDFHASGRSLKEVVLDEPIRYAPGDPVEKWLNKLLCLDVTLIKNPRFAARGTPHP
                     SECNLFVVNRDTLFSYHPVSETFLEKMMALYVASHYKNSPNDLQLMSDAPAHQLFVLL
                     PPINPKDGGRIPDPLVVIQVALEGEISRDSVKSSLSRGQRAGGDLIPWLISQQFQDEE
                     FPSLSGARVVRVATNPEYSSMGYGSRAIELLRDYYEGKFADLNENSKPASHELKRVND
                     QELSKTNLLKDEVKLRDAKTLPPLLLKLSEQPPHFLHYLGVSYGLTSSLHKFWKKNKF
                     VPVYLRQTANDLTGEHTCVMLNVLEGRESHWLSEYANDFHKRFLSLLSYEFRKFSAVQ
                     ALNVIESVKKANGLSGNAENKHAARPLTKEDIDQVLSPFDLKRLDSYANNLLDYHVIV
                     DLLPLLSSLYFSGRMGSSVNLSSVQSAILLAVGLQRKSVDDVSKELNLPFNQAIAMFA
                     KIIRKFSIYFREVVSQSIERSMPEAKDDNIAEMNGEEVTALDASSVMEKMDDDLEKAG
                     TRALTAMQEKQKELINSLNLDKYAIDDNAEEWAQSKKDLDKAAKKNGTVAVKSNKKRK
                     TENAEDIFNAEMSAVKKSSKKKPKK"
     gene            <461312..>463489
                     /locus_tag="KLTH0B05544g"
                     /db_xref="GeneID:8290867"
     mRNA            <461312..>463489
                     /locus_tag="KLTH0B05544g"
                     /product="KLTH0B05544p"
                     /transcript_id="XM_002551983.1"
                     /db_xref="GeneID:8290867"
     CDS             461312..463489
                     /locus_tag="KLTH0B05544g"
                     /note="similar to uniprot|P38830 Saccharomyces cerevisiae
                     YHR124W NDT80 Meiosis-specific transcription factor
                     required for exit from pachytene and for full meiotic
                     recombination activates middle sporulation genes competes
                     with Sum1p for binding to promoters containing middle
                     sporulation elements (MSE)"
                     /codon_start=1
                     /product="KLTH0B05544p"
                     /protein_id="XP_002552029.1"
                     /db_xref="GeneID:8290867"
                     /db_xref="GOA:C5DCT0"
                     /db_xref="InterPro:IPR008967"
                     /db_xref="InterPro:IPR024061"
                     /db_xref="UniProtKB/TrEMBL:C5DCT0"
                     /translation="MPDDANEETIQEFAYSLNAEDGLKDIAGGEVHDDLNEAIVENDS
                     RGKVENSGGSERSAQQRRTGKRRKAHGRMRNFVYNQESSSSRPHCRGVLSAKEKSENN
                     VETITHEDGSTSNYFDKRRLKIAPRSTLQFKIGPSFETVGRYCQVLGHRDKRPVNFML
                     RPRIDRGFDHIEDEWIGYKRNYFTLVTSFEVESLELPEFLNQSFEVDGVSGASSPLRP
                     KYFAVRLMAVCDEDESQVSLVQHTAKRDKGPQFEPPILALVPATLPSHQIIREASNVR
                     NESKMKKYDSLFFFYRNTDAQEFAPESVVHSYPKDRIKKVARYERVQFSSSINAKKQP
                     NQCKHFKLRVVLGCVVDGQHLNQDSFCAYQGLDCLVENGTGTFVPILEMETPPLVIRG
                     RSPSNYSAALATPSPKRAKACQNSISATRNSGPGKGVPTCGPLTRGTPRAVFKASEFQ
                     DSNEDGMQKRRGATKPLSFSSSNLKPSASVKTPDSNMPKKTPSSLTFSEKRLDMQTMS
                     SIEAVMMRHLPHILERGSVVEGLDLLSKHCSDSSYTIGMRDIELTPFLLGTPQDFGGH
                     HSTSGFESDVFGLGMSPEPAHPHSPSNACTIRETTKQLRPLRERKLNNKPASMDITFS
                     GKPSSTNNDEATECTFSENSYQFHATINAKSSRGTANVPRSVEPNPMDISFRLNMGTD
                     SASMPRPISNTGLASRRMLTASGKPSDIFGASELFDEPSFYRH"
     gene            complement(463528..463620)
                     /locus_tag="KLTH0B05566r"
                     /db_xref="GeneID:8290868"
     tRNA            complement(join(463528..463563,463584..463620))
                     /locus_tag="KLTH0B05566r"
                     /product="tRNA-Phe"
                     /note="tRNA-Phe (GAA) cove"
                     /db_xref="GeneID:8290868"
     gene            <463936..>464478
                     /locus_tag="KLTH0B05588g"
                     /db_xref="GeneID:8290869"
     mRNA            <463936..>464478
                     /locus_tag="KLTH0B05588g"
                     /product="KLTH0B05588p"
                     /transcript_id="XM_002551984.1"
                     /db_xref="GeneID:8290869"
     CDS             463936..464478
                     /locus_tag="KLTH0B05588g"
                     /note="weakly similar to uniprot|P53913 Saccharomyces
                     cerevisiae YNL133C FYV6 Protein of unknown function
                     required for survival upon exposure to K1 killer toxin
                     proposed to regulate double-strand break repair via
                     non-homologous end-joining"
                     /codon_start=1
                     /product="KLTH0B05588p"
                     /protein_id="XP_002552030.1"
                     /db_xref="GeneID:8290869"
                     /db_xref="UniProtKB/TrEMBL:C5DCT1"
                     /translation="MSTRQENDLQSSRFVKEGNADIELQRQRERQESAKLDTDFRTKE
                     RLTLQDQLRLNAITKQEEFSSLVKDRNSFNRLSKQDVEFYESLQRRAQLENQSLEEFL
                     EKNTREYDKKKAQVLAHESGRPESVPTRVQVPAKITKKRSMPSKNGIKGVIKKKKSKS
                     NHEVPENRDHSKVETSKGSN"
     gene            <464789..>465904
                     /locus_tag="KLTH0B05610g"
                     /db_xref="GeneID:8290870"
     mRNA            <464789..>465904
                     /locus_tag="KLTH0B05610g"
                     /product="KLTH0B05610p"
                     /transcript_id="XM_002551985.1"
                     /db_xref="GeneID:8290870"
     CDS             464789..465904
                     /locus_tag="KLTH0B05610g"
                     /note="similar to uniprot|P53912 Saccharomyces cerevisiae
                     YNL134C"
                     /codon_start=1
                     /product="KLTH0B05610p"
                     /protein_id="XP_002552031.1"
                     /db_xref="GeneID:8290870"
                     /db_xref="GOA:C5DCT2"
                     /db_xref="InterPro:IPR002085"
                     /db_xref="InterPro:IPR011032"
                     /db_xref="InterPro:IPR013149"
                     /db_xref="InterPro:IPR013154"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DCT2"
                     /translation="MSVPKTMRAVVVDGDKAVVKRDVPVPKIFGTQMLVEIKAVAGNP
                     TDWKHVDFHIAPQGSILGCDVAGVVKELGPDVDKTRFAVGDTITGIVHGGSVKFPQNG
                     GFADYALVDSVLSYKLKLNPTKQATISHGSVESFEAAASLPVSLLTAGVVLDLHLGNK
                     LVWEPKTPQHDFPVVLWGGATGVGLWLIQLAKQLNAYSKIVVVASKKHEEHLCHLGAD
                     EVFDYHDSDVIDQIKAKYGGFRHLVDCVATPETFQQTYSLASDSADAIVMTLMMYSEK
                     DIPEPERKSNVKVDWALLYLVSGSEVPFGKMTVPARPEYRTAVAEFIKFSEGRVLDGR
                     LIHPRIKVYEGGLDVVPQIMDDVKNGMNSGEKLVAKL"
     gene            complement(<466200..>466475)
                     /locus_tag="KLTH0B05632g"
                     /db_xref="GeneID:8290871"
     mRNA            complement(<466200..>466475)
                     /locus_tag="KLTH0B05632g"
                     /product="KLTH0B05632p"
                     /transcript_id="XM_002551986.1"
                     /db_xref="GeneID:8290871"
     CDS             complement(466200..466475)
                     /locus_tag="KLTH0B05632g"
                     /note="similar to uniprot|P43497 Saccharomyces cerevisiae
                     YKL096W-A CWP2 major constituent of the cell wall
                     containing GPI-anchor, plays a role in stabilizing the
                     cell wall, low pH resistance protein"
                     /codon_start=1
                     /product="KLTH0B05632p"
                     /protein_id="XP_002552032.1"
                     /db_xref="GeneID:8290871"
                     /db_xref="GOA:C5DCT3"
                     /db_xref="InterPro:IPR000420"
                     /db_xref="UniProtKB/TrEMBL:C5DCT3"
                     /translation="MQFSTVAFAAASVAVVSAASTVQAISQIGDGQIQATTSAPATEP
                     TTAPTTTASWTSSGNATIPTQTENGAAAMGSGFVAMAGLAAAGALLI"
     gene            <467957..>468301
                     /locus_tag="KLTH0B05654g"
                     /db_xref="GeneID:8290872"
     mRNA            <467957..>468301
                     /locus_tag="KLTH0B05654g"
                     /product="KLTH0B05654p"
                     /transcript_id="XM_002551987.1"
                     /db_xref="GeneID:8290872"
     CDS             467957..468301
                     /locus_tag="KLTH0B05654g"
                     /note="highly similar to uniprot|P20081 Saccharomyces
                     cerevisiae YNL135C FPR1 Peptidyl-prolyl cis-trans
                     isomerase (PPIase) binds to the drugs FK506 and rapamycin
                     also binds to the nonhistone chromatin binding protein
                     Hmo1p and may regulate its assembly or function"
                     /codon_start=1
                     /product="KLTH0B05654p"
                     /protein_id="XP_002552033.1"
                     /db_xref="GeneID:8290872"
                     /db_xref="GOA:C5DCT4"
                     /db_xref="InterPro:IPR001179"
                     /db_xref="InterPro:IPR023566"
                     /db_xref="UniProtKB/TrEMBL:C5DCT4"
                     /translation="MSETIEGNVKIDRLSPGDGKTFPKTGDLVTIHYTGTLENGQKFD
                     SSVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNA
                     TLVFDVELLKVN"
     gene            complement(<468367..>469491)
                     /locus_tag="KLTH0B05676g"
                     /db_xref="GeneID:8290873"
     mRNA            complement(<468367..>469491)
                     /locus_tag="KLTH0B05676g"
                     /product="KLTH0B05676p"
                     /transcript_id="XM_002551988.1"
                     /db_xref="GeneID:8290873"
     CDS             complement(468367..469491)
                     /locus_tag="KLTH0B05676g"
                     /note="some similarities with uniprot|P53911 Saccharomyces
                     cerevisiae YNL136W EAF7 Subunit of the NuA4 histone
                     acetyltransferase complex which acetylates the N-terminal
                     tails of histones H4 and H2A"
                     /codon_start=1
                     /product="KLTH0B05676p"
                     /protein_id="XP_002552034.1"
                     /db_xref="GeneID:8290873"
                     /db_xref="GOA:C5DCT5"
                     /db_xref="InterPro:IPR012423"
                     /db_xref="UniProtKB/TrEMBL:C5DCT5"
                     /translation="MSEPWSIEDDIRLFRWITEFKPAGMHKHFHMINILERMNKPELF
                     PVVLLFDKQKSESKGLFTREELWAKLSKHYDLDMLDKVEDDHTGKEAGEAASVLPLSL
                     RRVTKQQREFHLPWDEYGELILENAQGAMEEEQEEFENPEQSEISKERGETAESEELQ
                     GDTARKEEEAAEENMVADEKEHDEEPEPKPQDEELSERVPRRVTRSAAVAKPAGRITR
                     SHGPADQASGVDGHESAPSEEPTNGETPVTGEEKEEDSAMGDLDGEKDKDKDESAQGA
                     ETPAEGEPAEAEEPEQPPSKRTRTTRSQPREAPAPAPASTAPAAGSASESRSARLGGA
                     KESVSPPSETEPAEDAEQAAKAPPAKRSSSRVANRRRARR"
     gene            <469761..>471203
                     /locus_tag="KLTH0B05698g"
                     /db_xref="GeneID:8290874"
     mRNA            <469761..>471203
                     /locus_tag="KLTH0B05698g"
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /transcript_id="XM_002551989.1"
                     /db_xref="GeneID:8290874"
     CDS             469761..471203
                     /locus_tag="KLTH0B05698g"
                     /note="similar to uniprot|P27929 Saccharomyces cerevisiae
                     YNL137C NAM9 Mitochondrial ribosomal component of the
                     small subunit"
                     /codon_start=1
                     /product="mitochondrial 37S ribosomal protein NAM9"
                     /protein_id="XP_002552035.1"
                     /db_xref="GeneID:8290874"
                     /db_xref="GOA:C5DCT6"
                     /db_xref="InterPro:IPR002942"
                     /db_xref="InterPro:IPR018079"
                     /db_xref="InterPro:IPR022801"
                     /db_xref="UniProtKB/TrEMBL:C5DCT6"
                     /translation="MPRKAVLLKSLARGRIRSSFNKYNLFNLYKKGDVDFRSKTLYQQ
                     KWTAKQETRAYHGEHMTEGRWQTTFTPKLDSVAQLDASLKGGEIDQTPILLQTFAVLE
                     KRLDFALFRAMFASSVRQARQFILHGNVFVNGIKITQPGYPLKAGDVFNVKPEKVLQA
                     LGAKKPSLSEALKIDKLQIAVWNKYVKAIKENPREEWKRKQEKFRAMDDSNPKKQEYM
                     EFVRNYNKSLTAQMESEIKSATKEAILGKAVLAGSSAADPENPLVEEFLTHFYDDKAL
                     ATKAVECFNELRNTKLIQPDAASKSVAELTEFARTLTNLTEELKNSMSDSSKKSLRAA
                     KNIVSELLTSQDSVIRKLYESKKGSEETLSIPYDPLWAKRIQGHKPIDIKELAEDESK
                     ASQLINLPWQKGLYGRQDPSKPYFTPWKPRPFLAPFAILPHHIEVSFKTCHAVYLRDP
                     VARPGQSEVISPFGLPVHERAYMYYVRNGK"
     gene            complement(<471311..>472903)
                     /locus_tag="KLTH0B05720g"
                     /db_xref="GeneID:8290875"
     mRNA            complement(<471311..>472903)
                     /locus_tag="KLTH0B05720g"
                     /product="KLTH0B05720p"
                     /transcript_id="XM_002551990.1"
                     /db_xref="GeneID:8290875"
     CDS             complement(471311..472903)
                     /locus_tag="KLTH0B05720g"
                     /note="similar to uniprot|P17555 Saccharomyces cerevisiae
                     YNL138W SRV2 Adenylyl cyclase-associated protein
                     N-terminal domain appears to be involved in cellular
                     responsiveness to RAS"
                     /codon_start=1
                     /product="KLTH0B05720p"
                     /protein_id="XP_002552036.1"
                     /db_xref="GeneID:8290875"
                     /db_xref="GOA:C5DCT7"
                     /db_xref="InterPro:IPR001837"
                     /db_xref="InterPro:IPR006599"
                     /db_xref="InterPro:IPR013912"
                     /db_xref="InterPro:IPR013992"
                     /db_xref="InterPro:IPR016098"
                     /db_xref="InterPro:IPR017901"
                     /db_xref="InterPro:IPR018106"
                     /db_xref="InterPro:IPR028417"
                     /db_xref="InterPro:IPR028419"
                     /db_xref="UniProtKB/TrEMBL:C5DCT7"
                     /translation="MSDPSNFAIQGFNLSKLLKRLEDATARLEDVTLYQEGYIQTKLE
                     DLSVRGSSNEVEQKKTDHVTVEIPKSLPEKAEEQTEEESASVKGFRSIIDSRIEPLYQ
                     LSEKIDPVVAKSIKHLQGAFEAQLSFLRVVSLSKKPDFGSESFIKALQPLNEQIMAIG
                     ELKDENRQSKYFAYLNSVAEGAPLLSWIGVETPMSLIGDFKDAAQFWTNRILKDFKEL
                     DPSSVEWVKGFLAIFDDLKSYVKEYHTTGPSWNNASGIEFAEAVAKIEGQSSKAVPSS
                     TAPNASQGSGAPPPPPPPPAPPASVFEAQADKSENAGISAVFDELNQGENITKSLKKV
                     DKSQQTHKNPALRASSATPSARTPPPKPKKPTTLKTKKPARKELVGNKWFIEGYENVE
                     TPITIEVNKDESVYIGNCSNVFVKIEGKVNAVSVSETERCNVVLESSVSGMDIIKSVK
                     FAVQVEQSLPQISIDKSDDGTIYLSKESLNAEIFTSCTTSVNVNLPIGEEGDFVEFPV
                     PEQLKHSFADGKLKTTVYEHAG"
     gene            <473057..>473707
                     /locus_tag="KLTH0B05742g"
                     /db_xref="GeneID:8290876"
     mRNA            <473057..>473707
                     /locus_tag="KLTH0B05742g"
                     /product="KLTH0B05742p"
                     /transcript_id="XM_002551991.1"
                     /db_xref="GeneID:8290876"
     CDS             473057..473707
                     /locus_tag="KLTH0B05742g"
                     /note="weakly similar to uniprot|P38833 Saccharomyces
                     cerevisiae YHR127W (H)igh copy (S)uppressor of (N)34
                     dominant negative allele of SEC4"
                     /codon_start=1
                     /product="KLTH0B05742p"
                     /protein_id="XP_002552037.1"
                     /db_xref="GeneID:8290876"
                     /db_xref="UniProtKB/TrEMBL:C5DCT8"
                     /translation="MAVKRSARDKSHAKQQNSRGKSGQNNFKGKSLLERLTLPYDTKK
                     HVNARASSEKPGLRVVDGKLLSANDVGVLLRDAAKRTDAKKKPMKPRQGLKTTVRRTE
                     RVVRRREPARASVPVPKPYGKDLHLSVSGHSSDARFLRIRNLPLGSNSQVLTTLVENV
                     TGAKVSKSSLVDLPSGSVTAELWLGNANNKLLADVRRQLDGANVDGRVVSVEISST"
     gene            complement(<473754..>474109)
                     /locus_tag="KLTH0B05764g"
                     /db_xref="GeneID:8290877"
     mRNA            complement(join(<473754..474041,474107..>474109))
                     /locus_tag="KLTH0B05764g"
                     /product="KLTH0B05764p"
                     /transcript_id="XM_002551992.1"
                     /db_xref="GeneID:8290877"
     CDS             complement(join(473754..474041,474107..474109))
                     /locus_tag="KLTH0B05764g"
                     /note="similar to uniprot|P0C074 Saccharomyces cerevisiae
                     YNL138W-A RCP10"
                     /codon_start=1
                     /product="KLTH0B05764p"
                     /protein_id="XP_002552038.1"
                     /db_xref="GeneID:8290877"
                     /db_xref="InterPro:IPR009846"
                     /db_xref="UniProtKB/TrEMBL:C5DCT9"
                     /translation="MSDKHRQKQLFQAMKQKHLGLGTEATTTEEWMTHVHRDTYYSLA
                     SHSSMLEYLALSQGDSSKRVTELRLIEKMCGGLSSKRARGENRAEIPFKQTK"
     gene            <474183..>479222
                     /locus_tag="KLTH0B05786g"
                     /db_xref="GeneID:8290878"
     mRNA            <474183..>479222
                     /locus_tag="KLTH0B05786g"
                     /product="KLTH0B05786p"
                     /transcript_id="XM_002551993.1"
                     /db_xref="GeneID:8290878"
     CDS             474183..479222
                     /locus_tag="KLTH0B05786g"
                     /note="similar to uniprot|P53552 Saccharomyces cerevisiae
                     YNL139C RLR1 Required for LacZ RNA expression from certain
                     plasmids suppressor of the Transcriptional (T) defect of
                     Hpr1 (H) by Overexpression (O) plays a role in
                     transcription elongation by RNA polymerase II Involved in
                     transcription"
                     /codon_start=1
                     /product="KLTH0B05786p"
                     /protein_id="XP_002552039.1"
                     /db_xref="GeneID:8290878"
                     /db_xref="InterPro:IPR021418"
                     /db_xref="InterPro:IPR021726"
                     /db_xref="UniProtKB/TrEMBL:C5DCU0"
                     /translation="MHLFSNRAYQTFPNSTASLQTVIMSALCSRINALSNAHSSIFQE
                     GLQLAQIEDQNWELFTQEVINNLKSSSDQADKKNRVQSVLYEIVLLSSESNTQRPLDS
                     EKVLQLIKDMHAVEGAKTARLLSSLINSFPEKSEKLVEIMVSLDFMESELCTYITDDK
                     LLERTAKFTVKERALFRKSLLDTRYIIQKYNLLSEHPIGFSELITLLVIAYSDPTSAE
                     RARSYWQEACSIVGKYSLDPLRALDVILMVSSRYITKGYPFLLEFLKESDYWPATEAN
                     HTSFDNLHIGGNMTASQLLSMHLNDTKVDVTFYDMTCLLVRANFVSFSSIFENLGPNE
                     DQIQKFADQYFSDMEEDSMKGVLNPLAMAAALVDDSEESENPAPADSQKESDQEEELS
                     DEEKQARKMREQEEILGSGKMFFMQRLLAHGIFTPFFSAFGRYQRFLLTSPELLKLYL
                     KLFDHIITPIYETTAFFNSAKQSTAGKQNFSATHTALPPFDKKNSSEFYFSGRMQELP
                     QVNNVEQLIKVSHEWLSILGPHVAYDPVIVSKLCRIGLKDIERSSRNPDTLSIWLDFT
                     RKFIFVSLPLLTDNLVVINEVFVLLQSFDFEKRYFLYNEMISKTSQDNVFVKAKWNES
                     SREAKSALKSLSNDNIGEKGRFVAKLISKNPLSTLEPVMNQLENYDKVSDLVVETSLY
                     YSPYAYDVLQYAIILRLASGRQALQENGVYVTMWVQRLAFFIASLAKHSPKMDIGNII
                     QLVVKKLHKGDMVGVTVIKELTSRVSGVKSINDLSPKQLVMLNSGQPLQESARSIIRD
                     TRGENKGPALRLLSVFIKQQSLSEVIILLYRMQSSMVDTDLHYKVLSSRIDEISLLLW
                     SFIDMSKYFLGFEKFSRNIASFDQLVNHYGVSIEWAFLIWRDHYDTCASEGTEAEREF
                     RETIEKPNFVPTEFQNGSRTLFTDFWRLSLYDLCFEKDLYDEEKHQLERSMQQLKLGK
                     KKREISKMLENVMSSRIAHQRAHNKCVERLRGQPMDIEQLKAPEVLKPFLQYCLIPRV
                     LFSPSDALYAVSFLWEAFASSGSLDVFENMVSARILNALLFSSTSLEASNLGLFFATL
                     LEKFEILRKSNKLSNDDLKRIYVIQTIIVDDVIDLISEKNYMSIRNGIEFMKYLSTVF
                     PVVKVHILQVIQAIEKLISIDEREDIQLPSNALIGHLKARLKDSLKLEDFYQMSEEDK
                     KIYRVDEKEEIAQYERAILEEQEEAKLKQISEREIEDSKKSMNEQRLKVDDDEHSRTA
                     YGARIRKEPLLPMHEVLNEMTDVLKCLETTGTSYLNRHIRNRSVLTELRQIEQGTARR
                     PREYKARLAELFEAYFMNLTSSPNNEKFKQCLNDVIKACRSITNPHTIEKSQPGRRQP
                     AIAYDDEAVPRAQASKRAGAKATTEETKRTSRYEGSTETKLQKTISRPHQSEKEPQDD
                     NSGSNAQRGARSQNSGPSNRTGSRYDPTSSSRPQDNGIQKKAQSPILRGHSQNANPVD
                     RGVPRSNAPVARGKVSSARGTPGSATSEKELSSRNAPPLDDRARPLKFQSSEKPTPKP
                     AASFGSRYEASPNQIQIGERRKIGGSNQEVIKRSRDESPSSYPSKRARQESDQGRDKF
                     EGRSFGRRDTNYRDRYSGKQNDATSERRTDKYSSTLSSRLRGQDYRQNKANQTNQGGQ
                     TPKAPESRYRK"
     gene            <479404..>480567
                     /locus_tag="KLTH0B05808g"
                     /db_xref="GeneID:8290879"
     mRNA            <479404..>480567
                     /locus_tag="KLTH0B05808g"
                     /product="KLTH0B05808p"
                     /transcript_id="XM_002551994.1"
                     /db_xref="GeneID:8290879"
     CDS             479404..480567
                     /locus_tag="KLTH0B05808g"
                     /note="weakly similar to uniprot|P53901 Saccharomyces
                     cerevisiae YNL152W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0B05808p"
                     /protein_id="XP_002552040.1"
                     /db_xref="GeneID:8290879"
                     /db_xref="InterPro:IPR000008"
                     /db_xref="UniProtKB/TrEMBL:C5DCU1"
                     /translation="MSTVSASAFGGANGLLEVYVSRARDLPNLRKLDKQSPFVRLRIS
                     HMTETSDVAFRGGQTPKFDYYAKFDLTPDVKPALAVEVFDDRSPPKLIGQCAVDLTPA
                     LYKDPEDGHDDWFPLSFGSEEAGEIYLELTFHPLIPTSRLQRHRNDGISAFEESLASR
                     PPPPLPAKLPSFQLEKRHDEVTHNNTYSHASNLSQTLLSEPERISFGQSVSSKRMPNL
                     DVSVASNSTFASQATNETHESHATVATSGTTEPLFAKLKQLKEKWNSIKNPGKDQQDH
                     DKKVDLEALQKVVGVEPEEFNQDERGFRRVTDVSTQASKLVTQPPLPRLPDQSSRRTS
                     IESRALPTSRPNSCINETSPKLPPLPRSPSSRPDLRTRTAPNSPVRRKPPPKW"
     gene            complement(<480876..>481574)
                     /locus_tag="KLTH0B05830g"
                     /db_xref="GeneID:8290880"
     mRNA            complement(<480876..>481574)
                     /locus_tag="KLTH0B05830g"
                     /product="KLTH0B05830p"
                     /transcript_id="XM_002551995.1"
                     /db_xref="GeneID:8290880"
     CDS             complement(480876..481574)
                     /locus_tag="KLTH0B05830g"
                     /note="similar to uniprot|P17890 Saccharomyces cerevisiae
                     YNL151C RPC31 RNA polymerase III subunit C31 contains
                     HMG-like C-terminal domain"
                     /codon_start=1
                     /product="KLTH0B05830p"
                     /protein_id="XP_002552041.1"
                     /db_xref="GeneID:8290880"
                     /db_xref="InterPro:IPR016264"
                     /db_xref="InterPro:IPR024661"
                     /db_xref="UniProtKB/TrEMBL:C5DCU2"
                     /translation="MSFQRGGREGNSFAKNLPFGLSYSDVGVNENTELPSIPLPVNGL
                     VTSKERITSLKYMNFIKAVKEGPFYTGSMSLTIDGTGKQKQLVDEDGINDGIERYSDR
                     YLKKRKIGVSIDEHPFHLEFFPDELYQVMGINKKKLLALSNLNRQDDVFTGSAKDDDA
                     EGLSMLEKLKGLAEDEDETANADGKDDAHEAEDLDDDFGDSDEDDDYNAEKYFDDGDD
                     DAENEDDYGDEPAF"
     gene            complement(<481757..>482137)
                     /locus_tag="KLTH0B05852g"
                     /db_xref="GeneID:8290881"
     mRNA            complement(<481757..>482137)
                     /locus_tag="KLTH0B05852g"
                     /product="KLTH0B05852p"
                     /transcript_id="XM_002551996.1"
                     /db_xref="GeneID:8290881"
     CDS             complement(481757..482137)
                     /locus_tag="KLTH0B05852g"
                     /note="weakly similar to uniprot|P53903 Saccharomyces
                     cerevisiae YNL149C Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0B05852p"
                     /protein_id="XP_002552042.1"
                     /db_xref="GeneID:8290881"
                     /db_xref="InterPro:IPR011431"
                     /db_xref="InterPro:IPR016809"
                     /db_xref="UniProtKB/TrEMBL:C5DCU3"
                     /translation="MDFFDRAYQNLYDTFAGIDAAHAIRLVIIVGGYLLFRNLTQKHL
                     AKKQLEQKLRKSEEAKAAEKQKELIADPQDEETIQDNAFGWGNKTRKRVKRQEKILEE
                     RLQELEKLQGSQDDDKDIEDLLED"
     gene            complement(<482270..>483013)
                     /locus_tag="KLTH0B05874g"
                     /db_xref="GeneID:8290882"
     mRNA            complement(<482270..>483013)
                     /locus_tag="KLTH0B05874g"
                     /product="KLTH0B05874p"
                     /transcript_id="XM_002551997.1"
                     /db_xref="GeneID:8290882"
     CDS             complement(482270..483013)
                     /locus_tag="KLTH0B05874g"
                     /note="similar to uniprot|P53904 Saccharomyces cerevisiae
                     YNL148C ALF1 alpha-tubulin foldin protein implicated in
                     folding of alpha tubulin cofactor B"
                     /codon_start=1
                     /product="KLTH0B05874p"
                     /protein_id="XP_002552043.1"
                     /db_xref="GeneID:8290882"
                     /db_xref="InterPro:IPR000626"
                     /db_xref="InterPro:IPR000938"
                     /db_xref="UniProtKB/TrEMBL:C5DCU4"
                     /translation="MPQIQISSPLCSIVRELSPQWSWPQLCDKLSEITGVLPSDMQIN
                     VIFKDRTSLLINAPLTEQKPLSSLLSKNAVELQVNDSNASSLANELARDFTEGEQSSE
                     QTYHLPEEDYQRRQDSVLQWKKDLQLGKFNPEYQARLQKDCEEQQSRAEELTINERCS
                     VSTPNLPERRGWLRFVGSLTPLMDEPGIWCGVEFDEPVGKNDGSFKGRYFFGPVRPKY
                     GAFVKPSTVKTSAKFSPLLDDIEFSDSEI"
     gene            <483135..>483587
                     /locus_tag="KLTH0B05896g"
                     /db_xref="GeneID:8290883"
     mRNA            join(<483135..483146,483264..>483587)
                     /locus_tag="KLTH0B05896g"
                     /product="KLTH0B05896p"
                     /transcript_id="XM_002551998.1"
                     /db_xref="GeneID:8290883"
     CDS             join(483135..483146,483264..483587)
                     /locus_tag="KLTH0B05896g"
                     /note="highly similar to uniprot|P53905 Saccharomyces
                     cerevisiae YNL147W LSM7 Component of small nuclear
                     ribonucleoprotein complexes involved in RNA processing
                     splicing and decay"
                     /codon_start=1
                     /product="KLTH0B05896p"
                     /protein_id="XP_002552044.1"
                     /db_xref="GeneID:8290883"
                     /db_xref="InterPro:IPR001163"
                     /db_xref="InterPro:IPR006649"
                     /db_xref="InterPro:IPR010920"
                     /db_xref="InterPro:IPR017132"
                     /db_xref="UniProtKB/TrEMBL:C5DCU5"
                     /translation="MSEVQQSKRKFEGPKREAIVNLSKYADNKIRVKLAGGRLVVGVL
                     KGYDQLMNLVLDETVEHLRDPEDDTVILEGQTRELGLVVIRGTMLLTLSPMDGSEIIS
                     NPHGPEEEF"
     gene            <484444..>485094
                     /locus_tag="KLTH0B05918g"
                     /db_xref="GeneID:8290884"
     mRNA            <484444..>485094
                     /locus_tag="KLTH0B05918g"
                     /product="KLTH0B05918p"
                     /transcript_id="XM_002551999.1"
                     /db_xref="GeneID:8290884"
     CDS             484444..485094
                     /locus_tag="KLTH0B05918g"
                     /note="highly similar to uniprot|P18562 Saccharomyces
                     cerevisiae YHR128W FUR1 Uracil phosphoribosyltransferase
                     synthesizes UMP from uracil involved in the pyrimidine
                     salvage pathway"
                     /codon_start=1
                     /product="KLTH0B05918p"
                     /protein_id="XP_002552045.1"
                     /db_xref="GeneID:8290884"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DCU6"
                     /translation="MSTEPFKNVIMLPQTNQLTGLYTIIRDQNTKRPDFIFYADRIIR
                     LLVEEGLNHLPVQPRTVETSTNQKYEGVSFLGKICGVSIVRAGESMEQGLRECCRSVR
                     IGKILIQRDEETAQPKLFFEKLPEDIAERYVFLLDPMLATGGSAAMATEVLIKRGVKP
                     ERIFFLNLICSKEGVDYYHSKFPGVKIVTGAVDPCLDENKYLVPGLGDFGDRYYCL"
     gene            complement(<485135..>486286)
                     /locus_tag="KLTH0B05940g"
                     /db_xref="GeneID:8290885"
     mRNA            complement(<485135..>486286)
                     /locus_tag="KLTH0B05940g"
                     /product="KLTH0B05940p"
                     /transcript_id="XM_002552000.1"
                     /db_xref="GeneID:8290885"
     CDS             complement(485135..486286)
                     /locus_tag="KLTH0B05940g"
                     /note="similar to uniprot|P38696 Saccharomyces cerevisiae
                     YHR129C ARP1 Actin-related protein of the dynactin complex
                     required for spindle orientation and nuclear migration
                     putative ortholog of mammalian centractin"
                     /codon_start=1
                     /product="KLTH0B05940p"
                     /protein_id="XP_002552046.1"
                     /db_xref="GeneID:8290885"
                     /db_xref="InterPro:IPR004000"
                     /db_xref="InterPro:IPR020902"
                     /db_xref="UniProtKB/TrEMBL:C5DCU7"
                     /translation="MSGSHGLYNQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKY
                     NKVMAGGLASDSQLIGNEAQKMRGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLA
                     NIEEHPMLITEAPLNPMKNRNKMCEMLFETFGSPAVYVSIQAVLALYAGGRTTGCVID
                     CGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREIVRM
                     IKEKACFVATDVGNEEQNYEGANSAELETRFKLPDGKILTLGAEKFRAPEVLFQPHLI
                     GSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFGDRLLSEIRKTSEPNT
                     KIKIFAPPERKYSTWIGGSILAGLSTFEKLWVTRAEWQENPQCIHSRFM"
     gene            complement(<486413..>488239)
                     /locus_tag="KLTH0B05962g"
                     /db_xref="GeneID:8290886"
     mRNA            complement(<486413..>488239)
                     /locus_tag="KLTH0B05962g"
                     /product="KLTH0B05962p"
                     /transcript_id="XM_002552001.1"
                     /db_xref="GeneID:8290886"
     CDS             complement(486413..488239)
                     /locus_tag="KLTH0B05962g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B05962p"
                     /protein_id="XP_002552047.1"
                     /db_xref="GeneID:8290886"
                     /db_xref="GOA:C5DCU8"
                     /db_xref="InterPro:IPR000315"
                     /db_xref="InterPro:IPR018553"
                     /db_xref="UniProtKB/TrEMBL:C5DCU8"
                     /translation="MSSKRTLKQILDSEYVEGSDEEADGISNAETAADVDDNEEEVDR
                     SFCIDCKDMKTEIICKDCEEHFCVVCFDMIHRSGRRKKHEYVKVSLQPEELPANEQEQ
                     QALQNSNNVVSEQNPLAGDGAEPGVTQGVNSLDLKMLAMLAKHARFIPMRLAPEERHL
                     LRLLEAALNVSEYTDRVDIISYKSKAKRIVEQLKEMCSVLCGLVIASNLRTGQKLLEM
                     KNFSDNAAWFQDVFEIGRRYKIMNPEKMRDTYGKLCYMIMDSRLPQIEEHMEFHLFKP
                     LSTVHSFLSSKPEDRGQALKIFEDKLILYATSQISPVGKSRPEINRLIKQKEAAIEKL
                     ASKYSSRYFSKDDIRQVLYSIGDYNAYINMNRRPIMRMLERLEAFNNPTIATQYPIGI
                     QYGRGGARLTHDHARQMHYVQQSLTLWSVIQREMIHLWYIADQDLYNPNEYRLASTGQ
                     GLNRIKACPMLYREMHNILSECRSKCDAWVGSSVVHLGDDAVPNALFFLDKYTQVPNI
                     LIPFDQALMKINELVDNDPKLLEYIEGEYGSTDGLKLTILQDAFAHMFDGSGADNFYM
                     SGSCIDGRLTSAWNHTNMISKKKYYKIFLMTGFIGFNGQDGF"
     gene            complement(<489699..>491867)
                     /locus_tag="KLTH0B05984g"
                     /db_xref="GeneID:8290887"
     mRNA            complement(<489699..>491867)
                     /locus_tag="KLTH0B05984g"
                     /product="KLTH0B05984p"
                     /transcript_id="XM_002552002.1"
                     /db_xref="GeneID:8290887"
     CDS             complement(489699..491867)
                     /locus_tag="KLTH0B05984g"
                     /note="similar to uniprot|P38835 Saccharomyces cerevisiae
                     YHR131C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B05984p"
                     /protein_id="XP_002552048.1"
                     /db_xref="GeneID:8290887"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="UniProtKB/TrEMBL:C5DCU9"
                     /translation="MSEVANARKSKYIKHTSIGKTKSACSSTSISSTEGTGKIFEAID
                     KPLKDPMVKVKKSKSDPGRGAEKAGASEEDIFAWIDPQPAKPPSYKSANPNRRITYPV
                     YETQDSGVLPAYSPSVEEVTVVSMKMEWLDPYNCSPSRSWKNFIMEINSTQLNFYLID
                     PSLTRNIKNYCNGKSHFGGESVDPDIEYEGHHSIFNSLASKGTYQFNKADQESISQRI
                     TKDKAKYLTNNRLFRTYSLQFAKFGIPTDYSRKTFVLRLRCETEQFMLSFSHVDDMIM
                     WSMYLSIGIGVALDLDFRELPTYRTVPRRRRRRRRKRTNALTSSGGNDRSGSDRRSFS
                     NSSTRNGVLELHYPYKKRPNSMSNPDSHSNSSSRRGSNESIKSRLKSFFGSDKKAPCP
                     SFRGPYPRALSTVGLNAVTEDEEEEQVPSTSASASNSPQKTEIPVRPSLEQRSKSLGT
                     LQSSSNADDYFGFNHRGEDARDIAVTTPGSPGSPGSEVSIGGATIASGELQLQSGYHN
                     NVGLQNDLDELQQVIYEHNGEEGEETEDSPTFGNTDNDDEGEEEDDDDIDSLHPHTAT
                     AATSIYQEEGIFHDSEDDYYYVVDRGDAFRRRASSVTSNLSSIPYGSCEVKWHPPRKE
                     MSRRRYIRDSLRCIRPLPEDEEWLGKVLICPTQAPAYETNNPPISGYILGGGKPGKSK
                     APKFRNFKTDKGVILNKCKNHFVKPYIVGPVGFLKTNARC"
     gene            complement(<492629..>493867)
                     /locus_tag="KLTH0B06006g"
                     /db_xref="GeneID:8290888"
     mRNA            complement(<492629..>493867)
                     /locus_tag="KLTH0B06006g"
                     /product="KLTH0B06006p"
                     /transcript_id="XM_002552003.1"
                     /db_xref="GeneID:8290888"
     CDS             complement(492629..493867)
                     /locus_tag="KLTH0B06006g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B06006p"
                     /protein_id="XP_002552049.1"
                     /db_xref="GeneID:8290888"
                     /db_xref="GOA:C5DCV0"
                     /db_xref="InterPro:IPR006035"
                     /db_xref="InterPro:IPR020855"
                     /db_xref="InterPro:IPR023696"
                     /db_xref="UniProtKB/TrEMBL:C5DCV0"
                     /translation="MLMRSVLFSLACANAVLASGTTVLEEDLEQMWGQDWPFSGIQTF
                     AHLPHEKCLMNRSLDFDIGVIGIPFDTAVTYRPGARFGPQAIRKSSQRQTSMRGFNFR
                     AGINPYQDWAKVLDCGDVPVTPMDNNLALQMMGAAYHNLLNRNSTLKQAELPPRFATL
                     GGDHSIILPILRQLHKIYGPISVIHFDSHLDTWAPSKYPSYWHSNNSDFTHGSMLWIA
                     KQEGLLSENSNVHAGLRTRLSGVGWDDYEEDKETGFHRIECDEILDIGVRGIARKILD
                     IVPKDKPVYISVDIDVLDPSAAPGTGTVEVGGLLTRELISIIRQLDGLSLIGADVVEV
                     SPAYDQSDITSTAASQIVYELITNMVKKGPLDPAMIQANKNSEMDQGDKPQNLAENEY
                     QSLGEGARQNFMESLLQGRV"
     gene            complement(<494230..>495027)
                     /locus_tag="KLTH0B06028g"
                     /db_xref="GeneID:8290889"
     mRNA            complement(<494230..>495027)
                     /locus_tag="KLTH0B06028g"
                     /product="KLTH0B06028p"
                     /transcript_id="XM_002552004.1"
                     /db_xref="GeneID:8290889"
     CDS             complement(494230..495027)
                     /locus_tag="KLTH0B06028g"
                     /note="some similarities with uniprot|P53895 Saccharomyces
                     cerevisiae YNL159C ASI2 Predicted membrane protein genetic
                     interactions suggest a role in negative regulation of
                     amino acid uptake"
                     /codon_start=1
                     /product="KLTH0B06028p"
                     /protein_id="XP_002552050.1"
                     /db_xref="GeneID:8290889"
                     /db_xref="UniProtKB/TrEMBL:C5DCV1"
                     /translation="MTFFMLQKDNANCFKDLDQVLQIKTKSKVKTSCESKKECQGQPI
                     EEKMSEDLMHSLQNQNRQQRRAAAMRANPPFRVRVGPRHRQENPFRWPPGVQRRQYLR
                     LFLQNLLILDHLLMMVLFPFSVYNVLKILLTEVTFSNSDFVTDIASYCKFSSILSEDG
                     RSVILFKSGFGLLGKFHNIIVYYSAPLFAWLSSNSSVSSFVMRTYTLVVKFTAVVLYT
                     LYGVSASTYVCFATFFFSLCLLMTCFRRYKGVAKIVGQLYRTTSGIF"
     gene            <495028..>495585
                     /locus_tag="KLTH0B06050g"
                     /db_xref="GeneID:8290890"
     mRNA            <495028..>495585
                     /locus_tag="KLTH0B06050g"
                     /product="KLTH0B06050p"
                     /transcript_id="XM_002552005.1"
                     /db_xref="GeneID:8290890"
     CDS             495028..495585
                     /locus_tag="KLTH0B06050g"
                     /note="weakly similar to uniprot|P53896 Saccharomyces
                     cerevisiae YNL158W Essential protein of unknown function
                     green fluorescent protein (GFP)-fusion protein localizes
                     to the nuclear periphery"
                     /codon_start=1
                     /product="KLTH0B06050p"
                     /protein_id="XP_002552051.1"
                     /db_xref="GeneID:8290890"
                     /db_xref="InterPro:IPR019433"
                     /db_xref="UniProtKB/TrEMBL:C5DCV2"
                     /translation="MRIVPFFAALAFYICFSLANTESIVFKVPDTFSPAPQPIADENE
                     PLISLEGTNRALKTFDAPVDSQFDIELRDLSPGDTFFAKICWTAVDPIDITSLGYSIK
                     PDYTARGGHWQDAPLRFFLSFEAKSNSYPLFSKPTVPINISVSAMRMGVPVDLHATII
                     FMTLLTGLIFIINRHYKLYNRFKNV"
     gene            complement(<495614..>496924)
                     /locus_tag="KLTH0B06072g"
                     /db_xref="GeneID:8290891"
     mRNA            complement(<495614..>496924)
                     /locus_tag="KLTH0B06072g"
                     /product="KLTH0B06072p"
                     /transcript_id="XM_002552006.1"
                     /db_xref="GeneID:8290891"
     CDS             complement(495614..496924)
                     /locus_tag="KLTH0B06072g"
                     /note="similar to uniprot|P38836 Saccharomyces cerevisiae
                     YHR132C"
                     /codon_start=1
                     /product="KLTH0B06072p"
                     /protein_id="XP_002552052.1"
                     /db_xref="GeneID:8290891"
                     /db_xref="GOA:C5DCV3"
                     /db_xref="InterPro:IPR000834"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:C5DCV3"
                     /translation="MRAASAFLACLVAICSASRDYSGYKVCRFHTNNVTEVKTKIGQY
                     HAGSIDIWTRSSQFVDVQLPGDVADHLKECEVIIDDLNKTVKETYPVDQLEGAEKLQI
                     FQQSPQLNEPAPVTMKRQDIFFDQFRDLDTIYAWLDLMQLTFPELVKIELVGQTFEGR
                     EMKALHISAGNHNLNPDKKTIIITGGIHAREWVGVSTACYFIYQLLTGYGTNKKETKY
                     LNHLDFLIVPVFNPDGYVYTWSHDRLWRKNRQQTYFPRCFGIDIDHSFDFHWTGTQDF
                     PCSEDYSGESPFEALESESWNNYINESKSEYTIHGYLDLHSYSQEVLYPYAYSCDALP
                     RDFENLLELSWGLAKAIRRKSGKKYNVLSSCEDRGSDLKPGLGSGSALDYMYHHRAHW
                     GIQLKLRDTGNHGFLLPPKYIVPVGKESYAALKYFCDFILNPEL"
     gene            <497336..>497725
                     /locus_tag="KLTH0B06094g"
                     /db_xref="GeneID:8290892"
     mRNA            <497336..>497725
                     /locus_tag="KLTH0B06094g"
                     /product="KLTH0B06094p"
                     /transcript_id="XM_002552007.1"
                     /db_xref="GeneID:8290892"
     CDS             497336..497725
                     /locus_tag="KLTH0B06094g"
                     /note="highly similar to uniprot|Q9P305 Saccharomyces
                     cerevisiae YHR132W-A Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B06094p"
                     /protein_id="XP_002552053.1"
                     /db_xref="GeneID:8290892"
                     /db_xref="InterPro:IPR006760"
                     /db_xref="UniProtKB/TrEMBL:C5DCV4"
                     /translation="MSKGNDLSPTSSNVDVKEGVDASKLTPQEAKLLKMYGRLPSKKD
                     LFKHKLQERKYFDSGDYALNKAGVKSDDLQSDSIGNNHLPVTNPSGLRESIIKRRLSS
                     SAGSVDAHDLRRQGSISSGPPPRSPNK"
     gene            complement(<497825..>498613)
                     /locus_tag="KLTH0B06116g"
                     /db_xref="GeneID:8290893"
     mRNA            complement(<497825..>498613)
                     /locus_tag="KLTH0B06116g"
                     /product="KLTH0B06116p"
                     /transcript_id="XM_002552008.1"
                     /db_xref="GeneID:8290893"
     CDS             complement(497825..498613)
                     /locus_tag="KLTH0B06116g"
                     /note="similar to uniprot|P53898 Saccharomyces cerevisiae
                     YNL156C NSG2 Protein of unknown function potential homolog
                     of mammalian Insig 1"
                     /codon_start=1
                     /product="KLTH0B06116p"
                     /protein_id="XP_002552054.1"
                     /db_xref="GeneID:8290893"
                     /db_xref="InterPro:IPR025929"
                     /db_xref="UniProtKB/TrEMBL:C5DCV5"
                     /translation="MARKKAQMANGNYSVSSESISNLTRPQLYGIYDADITHSEDAEV
                     YEEAKKSVGKFPEDMIKRSGAHGQRSMLQRATHILFSLTFLGVAGISYNELSKQLHDN
                     HELHEEFASRPLALGVEICRTLSFGVVPTWMAYALEGVLFGALLPLMDTLWGSPVRTT
                     TFTSFLRSTNAMLGVAFGIRKIEWSSSLQASGAWFLLNIVLWMFFDGTPSMLLGCLGI
                     GTIASVTSYRDVTEFSQMLYFMDFYFLGLLLFGKLGRYLYGHRA"
     gene            <498882..>499577
                     /locus_tag="KLTH0B06138g"
                     /db_xref="GeneID:8290894"
     mRNA            <498882..>499577
                     /locus_tag="KLTH0B06138g"
                     /product="KLTH0B06138p"
                     /transcript_id="XM_002552009.1"
                     /db_xref="GeneID:8290894"
     CDS             498882..499577
                     /locus_tag="KLTH0B06138g"
                     /note="similar to uniprot|P38838 Saccharomyces cerevisiae
                     YHR134W WSS1 weak suppressor of smt3"
                     /codon_start=1
                     /product="KLTH0B06138p"
                     /protein_id="XP_002552055.1"
                     /db_xref="GeneID:8290894"
                     /db_xref="InterPro:IPR013536"
                     /db_xref="UniProtKB/TrEMBL:C5DCV6"
                     /translation="MTTQKNVHIGSLAVMQKKPNKDYALSILKDIAHRVSYLMREHKF
                     KVDQLVEFYPKNKRLLGMNVNRGAKIMLRLRQPFNEEEFLPREDILGTMLHELTHNVY
                     GPHNALFYKKLDELTARTWVIESQGLYDGFIGRGRKLGVKPAGRTPPRRLGTSGGHSV
                     GSIKSASEMAALAAQKRAFDAQWCASSSSTATPKPQDLQVIEIDSDGGEFTGRPKVKP
                     ERKPEPIEVIDLT"
     gene            <499948..>500733
                     /locus_tag="KLTH0B06160g"
                     /db_xref="GeneID:8290895"
     mRNA            <499948..>500733
                     /locus_tag="KLTH0B06160g"
                     /product="KLTH0B06160p"
                     /transcript_id="XM_002552010.1"
                     /db_xref="GeneID:8290895"
     CDS             499948..500733
                     /locus_tag="KLTH0B06160g"
                     /note="similar to uniprot|P53899 Saccharomyces cerevisiae
                     YNL155W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B06160p"
                     /protein_id="XP_002552056.1"
                     /db_xref="GeneID:8290895"
                     /db_xref="GOA:C5DCV7"
                     /db_xref="InterPro:IPR000058"
                     /db_xref="UniProtKB/TrEMBL:C5DCV7"
                     /translation="MTNVETGMLDVGTHCTFCRQLDFLPFHCKQCGGDFCSSHRSRTS
                     HRCASEQQQNSEQEPQSGSVSPVRNANGEYFATLLPEKGHIRVKQAEQNAQRPHRASD
                     RSVKDRLEASGNKSALEKLKSFFGRRSNSRAANPSKKGPANRLIQLAKLKQSAKGDPK
                     IPMANRVYAFCFVIDAKDENVRHELFVNKIWPVGRALDYIANQLAVQNLNNSVQASVN
                     EKLFLYRDCDGVPAPLDTSCRVAAIIHDADTLYLVRGEQLPTV"
     gene            <500939..>502024
                     /locus_tag="KLTH0B06182g"
                     /db_xref="GeneID:8290896"
     mRNA            <500939..>502024
                     /locus_tag="KLTH0B06182g"
                     /product="KLTH0B06182p"
                     /transcript_id="XM_002552011.1"
                     /db_xref="GeneID:8290896"
     CDS             500939..502024
                     /locus_tag="KLTH0B06182g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|Q12068 Saccharomyces
                     cerevisiae YOL151W GRE2"
                     /codon_start=1
                     /product="KLTH0B06182p"
                     /protein_id="XP_002552057.1"
                     /db_xref="GeneID:8290896"
                     /db_xref="GOA:C5DCV8"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DCV8"
                     /translation="MDEKVLVTGCNGFVALHVLDILLSEKFHVIGTVRTPEKANRVKE
                     SFKKLYPYANLEVEIVADITKKDAFDKIFQKYSDIQHVIHTAANVTFGNGGDRKETYL
                     IPATEGTKNILESTYSLGKNVKKFVMTSSLASIMDRKHFGDPNFVHTESTWNPITWEE
                     AENDDGNAYCASKKLSERLAWDFVKKHEKDIKFSLTTVCPPMIMGPQVFEWSLANETL
                     NTSAEKVNSALKTTPDSKGPFDSSNGLSCDVRDVALLHMLPLRNEALAGQRLFPLNGT
                     SLKQHNYEDARYTLQRILEILNKQFPEVRGKISAGADKSTLKTPDDLLYYNNDLTTKL
                     TGVEFKPFEVTVHDAAKQILDYRAAHK"
     gene            complement(<502282..>503778)
                     /locus_tag="KLTH0B06204g"
                     /db_xref="GeneID:8290897"
     mRNA            complement(<502282..>503778)
                     /locus_tag="KLTH0B06204g"
                     /product="KLTH0B06204p"
                     /transcript_id="XM_002552012.1"
                     /db_xref="GeneID:8290897"
     CDS             complement(502282..503778)
                     /locus_tag="KLTH0B06204g"
                     /note="some similarities with uniprot|P23292 Saccharomyces
                     cerevisiae YNL154C YCK2 membrane-bound casein kinase I
                     homolog"
                     /codon_start=1
                     /product="KLTH0B06204p"
                     /protein_id="XP_002552058.1"
                     /db_xref="GeneID:8290897"
                     /db_xref="GOA:C5DCV9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DCV9"
                     /translation="MNGASASASQHVLGSSASSTARDDSTIVGLHYRIGKKIGEGSFG
                     VLFEGTNMINGVPVAIKFEPRKSEAPQLKDEYRTYKILAGTPGIPQAYYFGQEGLHNI
                     LVIDLLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIG
                     RPGTPDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRR
                     DDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRVTNVYDLAQGLPVQFGRY
                     LEVVRSLAFEETPDYEGYRKLFLSILDDMDNQADGEYDWMKLNGGRGWDLNINKKPNL
                     HGYGHPNPPNDKNRRHRNKYAQGQGMDPQQQLRYQQQQLLHQQQQQQQQQQQQQQQQQ
                     QQQQQQRQQQLQSQQQISQQQRLDPTSYEAYQQQTQQKYAQQQQKLQQQSRVHSYNQH
                     APQQQPNLYGAQQPPTVKQHAQPPNKVAATDGKSVSSGKGFFSKLGCC"
     gene            <505357..>506424
                     /locus_tag="KLTH0B06226g"
                     /db_xref="GeneID:8290898"
     mRNA            <505357..>506424
                     /locus_tag="KLTH0B06226g"
                     /product="KLTH0B06226p"
                     /transcript_id="XM_002552013.1"
                     /db_xref="GeneID:8290898"
     CDS             505357..506424
                     /locus_tag="KLTH0B06226g"
                     /note="similar to uniprot|P53909 Saccharomyces cerevisiae
                     YNL141W AAH1 Adenine deaminase (adenine aminohydrolase)
                     involved in purine salvage and nitrogen catabolism"
                     /codon_start=1
                     /product="KLTH0B06226p"
                     /protein_id="XP_002552059.1"
                     /db_xref="GeneID:8290898"
                     /db_xref="GOA:C5DCW0"
                     /db_xref="InterPro:IPR001365"
                     /db_xref="InterPro:IPR006330"
                     /db_xref="InterPro:IPR006650"
                     /db_xref="InterPro:IPR028892"
                     /db_xref="UniProtKB/TrEMBL:C5DCW0"
                     /translation="MPEYECTSVMREFLHELPKCEHHVHLEGTLEPDLLYPLALRNNV
                     TLPNQFPKTVEELEKRYVMFRDLQDFLDFYYIGCEVLLQEEDFFDLAWAYFKRAHAQG
                     LRHAEVFFDPQSHTPRGVAIETVVAGFKRACQKALDELQVTSKLIMCLLRHLPVEECK
                     ATLESSRVLFETQQLHGLGLDSAEQPFPPELFTECYELARQFHPDVKLTAHAGEEGSA
                     KYVSNALDLLQVTRIDHGVRSVEDPELVARLARDKTMLTICPLSSLKLQVVKDISDLP
                     LTQLLEAGVPFSINSDDPAYFGGYILDNYVAVQKKFNWDAATWAKVARQAIEGSWCDG
                     KRKDELLTMLAAVVDKYSALI"
     gene            complement(<506590..>507123)
                     /locus_tag="KLTH0B06248g"
                     /db_xref="GeneID:8290899"
     mRNA            complement(<506590..>507123)
                     /locus_tag="KLTH0B06248g"
                     /product="KLTH0B06248p"
                     /transcript_id="XM_002552014.1"
                     /db_xref="GeneID:8290899"
     CDS             complement(506590..507123)
                     /locus_tag="KLTH0B06248g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B06248p"
                     /protein_id="XP_002552060.1"
                     /db_xref="GeneID:8290899"
                     /db_xref="UniProtKB/TrEMBL:C5DCW1"
                     /translation="MTSFGTYRTMEDPELLFQFSTPLVGSSRTLPTGISAGEPSSRWP
                     GFDASPRAAAADDEERDGDAATLQGSGASICDEAATLYSHTVKRDTPAESGARSEAPW
                     VNAAAIGSGYAPHPLKSGTASVYRSNAALLSRFNNALSKSFSSDQLHQIERMVDEFWL
                     RESALTEDMFEDSSDEE"
     gene            <508642..>510219
                     /locus_tag="KLTH0B06270g"
                     /db_xref="GeneID:8290900"
     mRNA            <508642..>510219
                     /locus_tag="KLTH0B06270g"
                     /product="KLTH0B06270p"
                     /transcript_id="XM_002552015.1"
                     /db_xref="GeneID:8290900"
     CDS             508642..510219
                     /locus_tag="KLTH0B06270g"
                     /note="similar to uniprot|P38840 Saccharomyces cerevisiae
                     YHR137W ARO9 Aromatic aminotransferase catalyzes the first
                     step of tryptophan phenylalanine and tyrosine catabolism"
                     /codon_start=1
                     /product="KLTH0B06270p"
                     /protein_id="XP_002552061.1"
                     /db_xref="GeneID:8290900"
                     /db_xref="GOA:C5DCW2"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DCW2"
                     /translation="MQALEEHYKPFLSSRVEARKFSPFWSQNLPEGLKPHPKPIDLGP
                     GLPHEGFFPIESMHLNVVEEPFQHTSAGTKSHKLHKPAPEGSKHFEERAFVTEKLSSD
                     SAVDVWRYEPNSPEVIPLSQGLQYTETAGMKQLLDFCRGFVSYAHPPAYNEWDVTLAN
                     GSSDATFKIIETLCDSSVTVLVEEFTFSPTLAIITAAGGTTVPLKLDITADPDVQGIN
                     VEYLTDLLDNWSQGPNAHLSKPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHDFII
                     IEDDPYGYLRYPFYDRKNPDYNPYALHEYTAKDYCEKVLSKSFITMDTSGRVLRCETF
                     SKVFCPGLRLSFIAGNKYLIKKIVDFAEVSSRAPSGLSQLIVNNVIQKWAKSYSSPQE
                     AWLVWVMKVAGHYTHRRNMFVQALEATEAFSEGLFSLAQTSAGMFLAVEINFDHFAKS
                     LSITERSKAMQRLSSISIEEGVGIIQGINMAADRKYSLARSFFLRLTFAFAADVEELQ
                     EAADRLGKSVKRLAAEL"
     gene            <510493..>510947
                     /locus_tag="KLTH0B06292g"
                     /db_xref="GeneID:8290901"
     mRNA            join(<510493..510501,510567..>510947)
                     /locus_tag="KLTH0B06292g"
                     /product="KLTH0B06292p"
                     /transcript_id="XM_002552016.1"
                     /db_xref="GeneID:8290901"
     CDS             join(510493..510501,510567..510947)
                     /locus_tag="KLTH0B06292g"
                     /note="similar to uniprot|P53900 Saccharomyces cerevisiae
                     YNL153C GIM3 Subunit of the heterohexameric cochaperone
                     prefoldin complex which binds specifically to cytosolic
                     chaperonin"
                     /codon_start=1
                     /product="KLTH0B06292p"
                     /protein_id="XP_002552062.1"
                     /db_xref="GeneID:8290901"
                     /db_xref="GOA:C5DCW3"
                     /db_xref="InterPro:IPR002777"
                     /db_xref="InterPro:IPR009053"
                     /db_xref="InterPro:IPR016661"
                     /db_xref="UniProtKB/TrEMBL:C5DCW3"
                     /translation="MDLLPEGKKNTVQVLYEDQQKINEFSKLIMRKDAINQELAHYKQ
                     EKGYLDDVSLEIELIDEDEQIQYRIGEAFVFMKQSEVVEQLEKDAEALDQKIEELEDA
                     DSEISSRTSELKTVLYAKFGDNINLER"
     gene            complement(<511087..>511500)
                     /locus_tag="KLTH0B06314g"
                     /db_xref="GeneID:8290902"
     mRNA            complement(join(<511087..511370,511440..>511500))
                     /locus_tag="KLTH0B06314g"
                     /product="KLTH0B06314p"
                     /transcript_id="XM_002552017.1"
                     /db_xref="GeneID:8290902"
     CDS             complement(join(511087..511370,511440..511500))
                     /locus_tag="KLTH0B06314g"
                     /note="similar to uniprot|P38841 Saccharomyces cerevisiae
                     YHR138C Homologous to PBI2"
                     /codon_start=1
                     /product="KLTH0B06314p"
                     /protein_id="XP_002552063.1"
                     /db_xref="GeneID:8290902"
                     /db_xref="InterPro:IPR009020"
                     /db_xref="UniProtKB/TrEMBL:C5DCW4"
                     /translation="MRLLVIITACLSAMAYAATANNVKSYILTLDDNQPALAGKIQDL
                     KSFVQQVGGKITHEYSLIKGFSLQLPADDSSDILQKIESFGEKLSCKLNLEQDQEVHT
                     FKGPEPFEASAE"
     gene            complement(<511768..>513249)
                     /locus_tag="KLTH0B06336g"
                     /db_xref="GeneID:8290903"
     mRNA            complement(<511768..>513249)
                     /locus_tag="KLTH0B06336g"
                     /product="KLTH0B06336p"
                     /transcript_id="XM_002552018.1"
                     /db_xref="GeneID:8290903"
     CDS             complement(511768..513249)
                     /locus_tag="KLTH0B06336g"
                     /note="similar to uniprot|P41948 Saccharomyces cerevisiae
                     YNL142W MEP2 Ammonium permease involved in regulation of
                     pseudohyphal growth belongs to a ubiquitous family of
                     cytoplasmic membrane proteins that transport only ammonium
                     (NH4) expression is under the nitrogen catabolite
                     repression regulation"
                     /codon_start=1
                     /product="KLTH0B06336p"
                     /protein_id="XP_002552064.1"
                     /db_xref="GeneID:8290903"
                     /db_xref="GOA:C5DCW5"
                     /db_xref="InterPro:IPR001905"
                     /db_xref="InterPro:IPR018047"
                     /db_xref="InterPro:IPR024041"
                     /db_xref="InterPro:IPR029020"
                     /db_xref="UniProtKB/TrEMBL:C5DCW5"
                     /translation="MSVNLTGTPTGTGTGGDSLTTDLNTQFQAADMVWIGTSAALVWI
                     MVPGIGLLYSGLSRKKHALSLLWASIMTVSVVSFQWFWWGYSLVFSHSTRGNGFIGTL
                     QFFGFKDVLGAPSSVSSVPDILFAFFQGMFAMVTGILMVGGACERARLFPMMVFLFLW
                     ITIVYCPIACWTWNAEGWLAALGALDYAGGGPVHICSGHGALIYALILGKRNDPIAKS
                     GTPKYKPHSVTSVVLGTVFLWFGWFGFNGGSAGNSTIRAWYSCVSTNLAASCAGLTWM
                     FIDYFRFGRKWTTVGLCSGAIAGLVGITPAAGFVPVWASVIIGIVTGAGCNFAVDLKN
                     LLRIDDGLDVYALHGVGGAIGSVLTGIFAADYVNATAGDEMAPIDGGWINHHWKQVGY
                     QLAAICSVIAWTCVVTSILLLVMDRIPFLRLRLRPEEEEMGTDGAQIGEFTYAEEEMY
                     IPEPIRSHNTANVPQPAAIDDHIGENHTDSTDLTGHPTEKVVV"
     gene            complement(<513940..>514731)
                     /locus_tag="KLTH0B06358g"
                     /db_xref="GeneID:8290904"
     mRNA            complement(<513940..>514731)
                     /locus_tag="KLTH0B06358g"
                     /product="KLTH0B06358p"
                     /transcript_id="XM_002552019.1"
                     /db_xref="GeneID:8290904"
     CDS             complement(513940..514731)
                     /locus_tag="KLTH0B06358g"
                     /note="weakly similar to uniprot|P38842 Saccharomyces
                     cerevisiae YHR140W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B06358p"
                     /protein_id="XP_002552065.1"
                     /db_xref="GeneID:8290904"
                     /db_xref="GOA:C5DCW6"
                     /db_xref="InterPro:IPR006838"
                     /db_xref="UniProtKB/TrEMBL:C5DCW6"
                     /translation="MRLPRQPQPQYKKTAPAGGAGLDRPAYAVVHSRDYDFDSTTMRA
                     NGRTMTCAALNALCLCTSTWGLWRATEVRLPASLAGAGHRQFLTILAVVATIITNVAN
                     LGALAAGGARARRAARQVALPVALVVETVVAVVYWPLRLFALPLIMHDVKDGSRMPLA
                     VSVDCAVHLAPVVLLGADYALVEQRPFEMSLGRAWVVVTALGLGYRRYLETMVDRAGG
                     AAYPYPFLDVAEPYQSGIFVVVTTAAWAVFWGYKKVHAGRASGRT"
     gene            <515228..>516265
                     /locus_tag="KLTH0B06380g"
                     /db_xref="GeneID:8290905"
     mRNA            <515228..>516265
                     /locus_tag="KLTH0B06380g"
                     /product="KLTH0B06380p"
                     /transcript_id="XM_002552020.1"
                     /db_xref="GeneID:8290905"
     CDS             515228..516265
                     /locus_tag="KLTH0B06380g"
                     /note="similar to uniprot|P38616 Saccharomyces cerevisiae
                     YNL160W YGP1 may be involved in cellular adaptations prior
                     to stationary phase YGP1 encodes gp37 a glycoprotein
                     synthesized in response to nutrient limitation which is
                     homologous to the sporulation-specific SPS100 gene"
                     /codon_start=1
                     /product="KLTH0B06380p"
                     /protein_id="XP_002552066.1"
                     /db_xref="GeneID:8290905"
                     /db_xref="GOA:C5DCW7"
                     /db_xref="InterPro:IPR006034"
                     /db_xref="InterPro:IPR027473"
                     /db_xref="UniProtKB/TrEMBL:C5DCW7"
                     /translation="MRASLILSAICAAGAASPIAAVGDDTTYVVEAGPASLTPWNVWP
                     SWSNASNVSNYSNLSNATAQVAAPKLEVIVTGGQYTMSNWSSEVHVTRLFNQSTLNAT
                     QLARVAQSVEGALDGGEYTGVVVLGAGRALEALGFYLSVVVDTPENVVVASALEDGVA
                     TAWSAWSWFRGALVVDGGVIYSGAAYSPSAPGWGALGSVIAGAPRYWFTPAWPTLLAP
                     WGSLRVNFTNFTDIVPAPAANATNSSSSMTVPVVFDGYYDPSIVSSLSTAIAGLVVVS
                     SGNSTASDLTSSNIPVVFTSDDGATILPEDVPAGAIAGGDLSPLKAQLLLSIALSKDV
                     KETSSLQQLFA"
     gene            complement(<516622..>517707)
                     /locus_tag="KLTH0B06402g"
                     /db_xref="GeneID:8290906"
     mRNA            complement(<516622..>517707)
                     /locus_tag="KLTH0B06402g"
                     /product="KLTH0B06402p"
                     /transcript_id="XM_002552021.1"
                     /db_xref="GeneID:8290906"
     CDS             complement(516622..517707)
                     /locus_tag="KLTH0B06402g"
                     /note="similar to uniprot|P53183 Saccharomyces cerevisiae
                     YGL039W and similar to uniprot|Q12068 Saccharomyces
                     cerevisiae YOL151W GRE2 NADPH-dependent methylglyoxal
                     reductase"
                     /codon_start=1
                     /product="KLTH0B06402p"
                     /protein_id="XP_002552067.1"
                     /db_xref="GeneID:8290906"
                     /db_xref="GOA:C5DCW8"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DCW8"
                     /translation="MDEKVLVTGASGYIAMHIINILQSERYHVIATVGTPEDANKIAY
                     SFEHYYPYAVLDVVVVEDVAAEDAFEEVFEQHPDIQHVIHTAPPALLGQGKTNEEAYL
                     VPTREGTKNVLESIRKRGHNVKRVVVTSSFSALMDLDNAANPQCVITEKSWNPVTWEV
                     AKDKESKAYAASKKIAEQLVWKFYEDNKDCVPYTLTTVNPPYVFGPHVFEWELGRAEW
                     NTTALFIKKALEMSADEQGPFAKPRGICCDVRDAALLHILPLRNAALAGHRLFPVNGT
                     GIKQNSYEDGKFNMQRIVDVLNARFPELQGKIPQGLPTENQQYMGQLTRYNNDNTCEL
                     TGMEFKSFETTVVDATRQIMRFQERHT"
     gene            complement(<518184..>520328)
                     /locus_tag="KLTH0B06424g"
                     /db_xref="GeneID:8290907"
     mRNA            complement(<518184..>520328)
                     /locus_tag="KLTH0B06424g"
                     /product="KLTH0B06424p"
                     /transcript_id="XM_002552022.1"
                     /db_xref="GeneID:8290907"
     CDS             complement(518184..520328)
                     /locus_tag="KLTH0B06424g"
                     /note="similar to uniprot|P53894 Saccharomyces cerevisiae
                     YNL161W CBK1 Protein kinase involved in cell wall
                     biosynthesis required for efficient apical growth proper
                     mating projection morphology bipolar bud site selection in
                     diploid cells and cell separation"
                     /codon_start=1
                     /product="KLTH0B06424p"
                     /protein_id="XP_002552068.1"
                     /db_xref="GeneID:8290907"
                     /db_xref="GOA:C5DCW9"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR000961"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011993"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DCW9"
                     /translation="MFGGVNNSYGKPGATYSPGAGKNDSYQSPNRYSAASNGSHNTGS
                     GMARPPAAAFSSNYLREQGSHQSLQDHLQKEVPMRGTSPIHGGFTDVPNLNYPSTPTN
                     STGFLSAQNPPVLSTPPTSNFGTAQSTYNHNNNSQSNLRNNVFSNPHVSPGQYSLGSD
                     YGAESHTLQSPHAQQQFTPVPPAQSSPVRSLRGVTQPQPLMDQQQRPQNPANPVSNYM
                     YFERRPDLLSKSTQDKAATVKLKIENFYQSSVNYAIERNQRRVELESQLVSQDWSDER
                     KSRQLSTLGKKESQFLRLRRTRLSLEDFQTVKVIGKGAFGEVRLVQKRDTGKIYAMKT
                     LLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTM
                     LIRWQIFTEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLST
                     GFHKTHDSNYYKKLLQQDEVNAASGNLQKPQMGIAAGNDTSNGSNRNTMFVDAIHLTM
                     TNRQQIQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWP
                     PFCSETPQETYRKIMNFEQALQFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIK
                     NHPFFRGVDWNTIRQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAARQREQMM
                     KQGVTGSASKEDLPFIGYTYSRFDYLTRKNAL"
     gene            complement(<520647..>521302)
                     /locus_tag="KLTH0B06446g"
                     /db_xref="GeneID:8290908"
     mRNA            complement(join(<520647..520963,521299..>521302))
                     /locus_tag="KLTH0B06446g"
                     /product="60S ribosomal protein L42"
                     /transcript_id="XM_002552023.1"
                     /db_xref="GeneID:8290908"
     CDS             complement(join(520647..520963,521299..521302))
                     /locus_tag="KLTH0B06446g"
                     /note="highly similar to uniprot|P02405 Saccharomyces
                     cerevisiae YHR141C RPL42B and highly similar to
                     uniprot|P02405 Saccharomyces cerevisiae YNL162W RPL42A
                     Proteins component of the large (60S) ribosomal subunit"
                     /codon_start=1
                     /product="60S ribosomal protein L42"
                     /protein_id="XP_002552069.1"
                     /db_xref="GeneID:8290908"
                     /db_xref="GOA:C5DCX0"
                     /db_xref="InterPro:IPR000552"
                     /db_xref="InterPro:IPR011332"
                     /db_xref="UniProtKB/TrEMBL:C5DCX0"
                     /translation="MVNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYD
                     RKQRGFGGQTRPIFHKKAKVTKKVVLRLECVVCKTRAQLALKRCKHFELGGEKKQKGQ
                     ALQF"
     gene            <522154..>523107
                     /locus_tag="KLTH0B06468g"
                     /db_xref="GeneID:8290909"
     mRNA            <522154..>523107
                     /locus_tag="KLTH0B06468g"
                     /product="KLTH0B06468p"
                     /transcript_id="XM_002552024.1"
                     /db_xref="GeneID:8290909"
     CDS             522154..523107
                     /locus_tag="KLTH0B06468g"
                     /note="similar to uniprot|P38843 Saccharomyces cerevisiae
                     YHR142W CHS7"
                     /codon_start=1
                     /product="KLTH0B06468p"
                     /protein_id="XP_002552070.1"
                     /db_xref="GeneID:8290909"
                     /db_xref="InterPro:IPR022057"
                     /db_xref="UniProtKB/TrEMBL:C5DCX1"
                     /translation="MGFGDFRSICSKTPLPLCSVIKSSKHLVLGAHQKVEDFDTKDFR
                     TGVLPKCYARSIDVANTVVFQIGNAFVNIGALGVIMFMIYSTRQKYTAIGRSEYGFFF
                     ELCLALICFTLVVDCGVSPPGSDSYPYFVAVQIAFAGACCWTMAVLGFLGFRFWEDGT
                     RKSMALVRGMAFIGFIINFLVAVFSFKAWKAVDSYAESNTTGLFVVMYLLNAIAIFLY
                     IVCQLIVSLFVINNLWAAGAVLLGLFFLVAGQVITYAFSDAICVGVKHYLDGLFFGSL
                     CNIFALMMVYKNWDMTTDDDLEFSVSVNKGNELGFMSDFNF"
     gene            complement(<523220..>523429)
                     /locus_tag="KLTH0B06490g"
                     /db_xref="GeneID:8290910"
     mRNA            complement(<523220..>523429)
                     /locus_tag="KLTH0B06490g"
                     /product="KLTH0B06490p"
                     /transcript_id="XM_002552025.1"
                     /db_xref="GeneID:8290910"
     CDS             complement(523220..523429)
                     /locus_tag="KLTH0B06490g"
                     /note="similar to uniprot|Q3E7A8 Saccharomyces cerevisiae
                     YNL162W-A Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B06490p"
                     /protein_id="XP_002552071.1"
                     /db_xref="GeneID:8290910"
                     /db_xref="UniProtKB/TrEMBL:C5DCX2"
                     /translation="MSEKSCPQCGEELKKCLIQQNYSLIICPNEGCCYPFNEREAIDN
                     IVYTKDAEILNAAKRRLEEEEQQKR"
     gene            <523580..>526882
                     /locus_tag="KLTH0B06512g"
                     /db_xref="GeneID:8290911"
     mRNA            <523580..>526882
                     /locus_tag="KLTH0B06512g"
                     /product="KLTH0B06512p"
                     /transcript_id="XM_002552026.1"
                     /db_xref="GeneID:8290911"
     CDS             523580..526882
                     /locus_tag="KLTH0B06512g"
                     /note="similar to uniprot|P53893 Saccharomyces cerevisiae
                     YNL163C"
                     /codon_start=1
                     /product="KLTH0B06512p"
                     /protein_id="XP_002552072.1"
                     /db_xref="GeneID:8290911"
                     /db_xref="GOA:C5DCX3"
                     /db_xref="InterPro:IPR000640"
                     /db_xref="InterPro:IPR000795"
                     /db_xref="InterPro:IPR004161"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR009000"
                     /db_xref="InterPro:IPR009022"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCX3"
                     /translation="MSRVGPETSKRLQKDPSCIRNICILAHVDHGKTSLSDSLLASNG
                     IISQKLAGKVRFLDSRPDEQLRGITMESSAISLYFRVLRKQEGKDEPLVNEHIINLID
                     SPGHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTITVLRQCWIEKLKPVLVLNKIDR
                     LVTELQLTPQEAYVHLNKIIEQVNSIIGSFFNGQRLLDDLSWREQLENNTNAEFVEKD
                     DTDIYFKPENNNVVFTSAVDGWGFNIGQIAKFYESKLGAKRENLQKVLWGDFYIDPKT
                     KKFINSKGLKGRTLKPLFVSLILDNIWKIYNNVLVERNADVLEKITQTLNIKVSQRDL
                     RSKDLKNLLRTIMGQWLPVSTSILLTVIEKVPSPLESQSEKMEIIIGNAPGSDLIDKG
                     LYKSMESCDKDGPVCAYVSKMLSIPKEELPINNGKPLSQGELMERSRAAREQALKAAK
                     AAELAESLSRTNASKDEGRGFYERAQETVATPQLGTANHSADNTTSKPSETDTFKIVN
                     EPAQEFDLGLDLGDEDYEDEDDINLEPEFSPAVIDPNDPLSSMFEYEEEDPFETNNEA
                     ELEEDDAGDFEESDEVMIGFARLYSGTLKVGQKVSVLGPKYDPRFPADHIEQVEITDL
                     FIFMGKELVPLTECPPGNIVGIGGLAGKILKNGTIVDPQVQGANLAGVNLHVTPIVRV
                     ALEPTNPTQMGRLARGLKLLDQADPCVQTYVEDTGEHILCTAGELHLERCLKDLRERF
                     AGIGITSSKPAIPYKETFLSTSDMNPPKNAELGRGVCQRYLGEYAFKFRSAPLPENIT
                     QYLTEQEANIKSLVEEKQQSNESSEFSKNLKNLFTEAAAKNKIWDQCNSCISAFGPKR
                     AGPNILIAENVLSGQKDGEETSDTFEYKSSIINGFELAVSGGPLAKEPVSGMCVIVED
                     IHKMSQEEIDQLEVQNYQAEVPNFSGRLITTARDIIHSTFLDWSPRIMWAMYSCEIQA
                     SVEVLGKVYAVVQQRRGKIVSEEMKEGIPLFQIEAQIPVVEAFGFSEDIRKKTSGAAQ
                     PQLVFAGFECIDLDPFWVPTTEEELEELGDTADKENIARKHMNMIRRRKGLFVDEKIV
                     QNAEKQRTLKRN"
     gene            <527044..>527943
                     /locus_tag="KLTH0B06534g"
                     /db_xref="GeneID:8290912"
     mRNA            <527044..>527943
                     /locus_tag="KLTH0B06534g"
                     /product="KLTH0B06534p"
                     /transcript_id="XM_002552027.1"
                     /db_xref="GeneID:8290912"
     CDS             527044..527943
                     /locus_tag="KLTH0B06534g"
                     /note="weakly similar to uniprot|P53892 Saccharomyces
                     cerevisiae YNL164C IBD2 Component of the BUB2-dependent
                     spindle checkpoint pathway interacts with Bfa1p and
                     functions upstream of Bub2p and Bfa1p"
                     /codon_start=1
                     /product="KLTH0B06534p"
                     /protein_id="XP_002552073.1"
                     /db_xref="GeneID:8290912"
                     /db_xref="GOA:C5DCX4"
                     /db_xref="InterPro:IPR026231"
                     /db_xref="UniProtKB/TrEMBL:C5DCX4"
                     /translation="MCPSNNTSIEVVSKDGPVDFNVMMQEGVKALTKVLADHLQDHPD
                     YLKQQSMKLVFNNDIDKSGENGEAAGTSEEDAKQITATKSAGDEEIEEADLRNKSNYH
                     MCKEMSPQTHKLSSLYSPSKNKQSPSIAQPSEFDCEEGELVFDYGEQDLMSLPGEFGD
                     SIKKMVASSMAQDPSGRHSNINIDLDVDDTLSDNNDSPEPNSFSDQPSQKQHGHQKHR
                     RCRHGGDSNREHEFEYPHHPKVTPDFASLITYDQPLCMFCEYYFVFGEPPKNMIKWFQ
                     RTGGRDTSAHCRSYQRHSNSTQH"
     gene            <528699..>529601
                     /locus_tag="KLTH0B06556g"
                     /db_xref="GeneID:8290913"
     mRNA            <528699..>529601
                     /locus_tag="KLTH0B06556g"
                     /product="KLTH0B06556p"
                     /transcript_id="XM_002552028.1"
                     /db_xref="GeneID:8290913"
     CDS             528699..529601
                     /locus_tag="KLTH0B06556g"
                     /note="some similarities with uniprot|P38844 Saccharomyces
                     cerevisiae YHR143W DSE2 daughter-specific expression
                     protein 2"
                     /codon_start=1
                     /product="KLTH0B06556p"
                     /protein_id="XP_002552074.1"
                     /db_xref="GeneID:8290913"
                     /db_xref="InterPro:IPR026225"
                     /db_xref="UniProtKB/TrEMBL:C5DCX5"
                     /translation="MQFKLSTIATALTFLSSMVCADSNVRYITSDGVVYSFAVITSTI
                     KPATTYVTTRYYTTTEVVPVTLSNQVVSSSTKAVTKTSTLEVVSSTAPAESSSLTPES
                     TSTLSSSQQPDTTSSQSQSSNTRSTLSTAIQSSSAASASSTFSLISSSIPASSSPRST
                     FVSSTDVSSSVSSATYSASSASSSSSSSAIASSTSSAFSSTSNTPGISSSSASATSAS
                     SASKSSSTITKSSPSVTSIASSTLSLEGEAFTTEYDEDGSCTVYYEDDDDYYTTVYLT
                     DSSQSVDAYTTYTSTRTVYETIST"
     gene            complement(<529673..>530818)
                     /locus_tag="KLTH0B06578g"
                     /db_xref="GeneID:8290914"
     mRNA            complement(<529673..>530818)
                     /locus_tag="KLTH0B06578g"
                     /product="KLTH0B06578p"
                     /transcript_id="XM_002552029.1"
                     /db_xref="GeneID:8290914"
     CDS             complement(529673..530818)
                     /locus_tag="KLTH0B06578g"
                     /note="similar to uniprot|P53891 Saccharomyces cerevisiae
                     YNL165W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B06578p"
                     /protein_id="XP_002552075.1"
                     /db_xref="GeneID:8290914"
                     /db_xref="UniProtKB/TrEMBL:C5DCX6"
                     /translation="MDRVRNLVRRSNGSRANRENNASVLRDPVASDSDQATLVESKRS
                     DERRSHNEEGVTLQRRNSETSTIGDLRVSGFVNRCPLFHDLRHIVFASTVMGKGFYAF
                     PSIESFQKFRENKRRLDELHDEQALGFPLFHAVPVNVFRTIIKRSLPMMKIYRFVLVD
                     TSVPGEAEKYQENETCTLMAQLGATCVYKLEFCQVYQRIHTNTSFVEYKFTFRIDNRP
                     ENNLFSMRMVNHVHRRDTDSRINDLNLRWLGTSGLASPFGSGTFQLAVLDDGIASYLD
                     ELPGSSREQLGRAADQPRSPWQMPVWATYSDGKATFIPKKRTLRVADFKIKELAQCCQ
                     GLQDVPWDTLVLTCMCMVLHDLEARKDRRSMNVTAGNDMALASFSFM"
     gene            <531018..>532247
                     /locus_tag="KLTH0B06600g"
                     /db_xref="GeneID:8290915"
     mRNA            <531018..>532247
                     /locus_tag="KLTH0B06600g"
                     /product="KLTH0B06600p"
                     /transcript_id="XM_002552030.1"
                     /db_xref="GeneID:8290915"
     CDS             531018..532247
                     /locus_tag="KLTH0B06600g"
                     /note="weakly similar to uniprot|P53890 Saccharomyces
                     cerevisiae YNL166C BNI5 Protein involved in organization
                     of septins at the mother-bud neck may interact directly
                     with the Cdc11p septin localizes to bud neck in a
                     septin-dependent manner"
                     /codon_start=1
                     /product="KLTH0B06600p"
                     /protein_id="XP_002552076.1"
                     /db_xref="GeneID:8290915"
                     /db_xref="UniProtKB/TrEMBL:C5DCX7"
                     /translation="MDQETLRKRMSQIELEIDEMNQVIDENLQLAEPHGDEPPEHEKK
                     KRWDSGTSKDPETGPEEPETQQVIEAELFLRSATRPVPPSIPAATELGKEQRTKPALE
                     NEPTHSEHMNQPPAERVPLEQTPSDGGVSLAPSQYVDAPEAVPAQSSSKSEAAPADIG
                     LRETQPLNGISSRQAGSVGSAGSPRESQPSTETAETPSSEVDREQPDEHLQPPSEEFT
                     TTASRGFKAASREDARKEMPQQSTLGNNEPQEASAGMSFDENSPSTQSSAGSKQPVSP
                     DSTQSSPQLNLPKTRNPAFPGKRATSNPNPFRVVSVTSKQTEDVSPAQKLQTRHDYLA
                     RKCIKLQREIQYLSDLRDRGAVAPEDARKINSALEKLQEYLDLKTKERYEIGVLLSRQ
                     LRREIDRGENGQFWVGH"
     gene            <532482..>532694
                     /locus_tag="KLTH0B06622g"
                     /db_xref="GeneID:8290916"
     mRNA            <532482..>532694
                     /locus_tag="KLTH0B06622g"
                     /product="KLTH0B06622p"
                     /transcript_id="XM_002552031.1"
                     /db_xref="GeneID:8290916"
     CDS             532482..532694
                     /locus_tag="KLTH0B06622g"
                     /note="highly similar to uniprot|P40422 Saccharomyces
                     cerevisiae YHR143W-A RPC10 RNA polymerase subunit
                     ABC10-alpha common to RNA polymerases I II and III"
                     /codon_start=1
                     /product="KLTH0B06622p"
                     /protein_id="XP_002552077.1"
                     /db_xref="GeneID:8290916"
                     /db_xref="GOA:C5DCX8"
                     /db_xref="InterPro:IPR006591"
                     /db_xref="InterPro:IPR029040"
                     /db_xref="UniProtKB/TrEMBL:C5DCX8"
                     /translation="MSREGFQIPTNLDAAAAGTAAARTATLKYICAECSSKLSLSRTD
                     PVRCKDCGHRILLKARTKRMVQFEAR"
     mobile_element  complement(533009..535201)
                     /note="DNA transposon of KLTH part of the newly discovered
                     ROVER DNA transposon family of the
                     Kluyveromyces:degenerate copy"
                     /mobile_element_type="transposon"
     gene            <537899..>538249
                     /locus_tag="KLTH0B06688g"
                     /db_xref="GeneID:8290917"
     mRNA            <537899..>538249
                     /locus_tag="KLTH0B06688g"
                     /product="KLTH0B06688p"
                     /transcript_id="XM_002552032.1"
                     /db_xref="GeneID:8290917"
     CDS             537899..538249
                     /locus_tag="KLTH0B06688g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B06688p"
                     /protein_id="XP_002552078.1"
                     /db_xref="GeneID:8290917"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DCX9"
                     /translation="MVSPVITIFRIVLAMALSNLFLGFVLFSPLRDNGLGASDLMDLW
                     TTIAAVEPRGDTRGWDRIASYINEYLITNGAPGRLAQFYDGEDCIQRFKKRYSASLLK
                     KKRRGGGKFEDLRS"
     gene            <538970..>540142
                     /locus_tag="KLTH0B06710g"
                     /db_xref="GeneID:8290918"
     mRNA            <538970..>540142
                     /locus_tag="KLTH0B06710g"
                     /product="KLTH0B06710p"
                     /transcript_id="XM_002552033.1"
                     /db_xref="GeneID:8290918"
     CDS             538970..540142
                     /locus_tag="KLTH0B06710g"
                     /note="weakly similar to uniprot|P38723 Saccharomyces
                     cerevisiae YHL048W COS8 Nuclear membrane protein member of
                     a family of conserved often subtelomerically-encoded
                     proteins regulation suggests a potential role in the
                     unfolded protein response"
                     /codon_start=1
                     /product="KLTH0B06710p"
                     /protein_id="XP_002552079.1"
                     /db_xref="GeneID:8290918"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DCY0"
                     /translation="MRGTFKEDPEAHELRNPKTHYRNKASWELAQMATGLSIPKWMSS
                     GLIICMFIAAHDVYYERAPARSWHRQQLYNVLLSSFAMLFESPYQKIKRTIKLQMEQL
                     CREVLEGNPGMQIEQWDLVAQRLNDFLHAEGHWPVTNPLFDGHMCHSLFRKLVVHPVN
                     KKLLATRVQRATVDAREGELSTRTSAASEPAKDTIACYESGMREWWARNAKPEKQEGI
                     DVACRKLPKEVVWSKVGWQFSVAMAALVQTRAFIPISFLSFIGLGTVYSIDTIFRLTP
                     VVLSNVFWGIILSPALRDTDVNARDLMELWATIVAVEPRGDTSEWDRVASHMNKYLVT
                     ASAAGRAAQFYDGENCMQRFKKWYSASLLPKEGQVDARFEDLQPYIEAAMDAASED"
     gene            <541428..>543518
                     /locus_tag="KLTH0B06732g"
                     /db_xref="GeneID:8290919"
     mRNA            <541428..>543518
                     /locus_tag="KLTH0B06732g"
                     /product="KLTH0B06732p"
                     /transcript_id="XM_002552034.1"
                     /db_xref="GeneID:8290919"
     CDS             541428..543518
                     /locus_tag="KLTH0B06732g"
                     /note="some similarities with uniprot|Q02100 Saccharomyces
                     cerevisiae YNL167C SKO1 Basic leucine zipper (bZIP)
                     transcription factor of the ATF/CREB family that forms a
                     complex with Tup1p and Ssn6p to both activate and repress
                     transcription cytosolic and nuclear protein involved in
                     the osmotic and oxidative stress responses"
                     /codon_start=1
                     /product="KLTH0B06732p"
                     /protein_id="XP_002552080.1"
                     /db_xref="GeneID:8290919"
                     /db_xref="GOA:C5DCY1"
                     /db_xref="InterPro:IPR004827"
                     /db_xref="InterPro:IPR020956"
                     /db_xref="UniProtKB/TrEMBL:C5DCY1"
                     /translation="MNECQTGTALQRKCHAHSYWLRHTLALITRSSSPTGQLGTYCSA
                     KHVPASTVLSSSARTDYRVAPERAQLSATRSSLPAARAQETVAATYRQAQPVTSPSAM
                     RASDPPANDASLVSSFDLEPNPFEQSFASSDKPHGAGGAGVAGHQQVQRARQQSQSQS
                     QSQPQSQPQSQPQLQGQSQQPTPSQPTLPSVHSAQSAASAQPKLPVIPTTPGGSRRLP
                     PLLLANPAPAPATATTAVTATNALATPSAPQHGASAGGSQQAPQVPQASAGSATPGFF
                     INLSKTGLTPNESGLRTGLTPGILTAAAPPHPPPPVSLPSGQFTPGLSSLLGLPLGQQ
                     PGQQQQAAQQPQQPQQTQQVSQQPAQQQQQQQQQQQQQQQQQQQQQQLPPHPAMSWSH
                     SSSTAVSSDPSTTSSQNVKPRNNTSSSSSSSLAQDGTSALSLSEPAQKRQKLSSALPA
                     KKPKNSEPSPLDVKDEQERKRKEFLERNRVAASKFRKRKKEYIKKIESDLQFYEAEYD
                     DLSQCMDKLCGISKQTINSSLVGMLKQALLRHDVTSSLTVCNHIEQVLLQTKYVQRGG
                     RNPRREEEEKRRMESPDADINSDSTYPRRASLATASTDGYHTSQLQPHQLQSHIRPDA
                     GPQLSAADHATGTINNLPLVINGNTLLGLGDIQDPSHNAGAGTVTMSRPTSLTSLQPE
                     NNRSVPLHEYPNSN"
     gene            <543748..>544752
                     /locus_tag="KLTH0B06754g"
                     /db_xref="GeneID:8290920"
     mRNA            <543748..>544752
                     /locus_tag="KLTH0B06754g"
                     /product="KLTH0B06754p"
                     /transcript_id="XM_002552035.1"
                     /db_xref="GeneID:8290920"
     CDS             543748..544752
                     /locus_tag="KLTH0B06754g"
                     /note="similar to uniprot|P53889 Saccharomyces cerevisiae
                     YNL168C FMP41 The authentic non-tagged protein was
                     localized to mitochondria"
                     /codon_start=1
                     /product="KLTH0B06754p"
                     /protein_id="XP_002552081.1"
                     /db_xref="GeneID:8290920"
                     /db_xref="GOA:C5DCY2"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="UniProtKB/TrEMBL:C5DCY2"
                     /translation="MFKVFYILILWFYCFTCFRCAPIRPVGTGRWRLGILRGCTYLGI
                     FSRLFGSSHKGSLTTTHQQKLGKGCHQSKMDYSYLKAARKIVCIGRNYAAHVKELNNP
                     FPKQPFFFLKPSSSIVTPHDKQAPQETRQHAECSYRGLNADGTNPGAIMIPEGVKVHH
                     EVELALIIGDYISNASPSAFGPKELRRAISGIALSLDLTARNVQDEAKRKGLPWSIGK
                     GFDTFLPMSKFIPEARLGKNLDLQDAFRLKCTVNSITRQDGTTGLMLTPLHTIVQHIS
                     TMMSLEPGDIILTGTPAGVGELKPGDSVYSELFFNGEPLVNMQFDCVKRPGPYVYRET
                     "
     gene            complement(<544782..>545789)
                     /locus_tag="KLTH0B06776g"
                     /db_xref="GeneID:8290921"
     mRNA            complement(<544782..>545789)
                     /locus_tag="KLTH0B06776g"
                     /product="KLTH0B06776p"
                     /transcript_id="XM_002552036.1"
                     /db_xref="GeneID:8290921"
     CDS             complement(544782..545789)
                     /locus_tag="KLTH0B06776g"
                     /note="similar to uniprot|P06773 Saccharomyces cerevisiae
                     YHR144C DCD1 Deaminase required for dCTP and dTTP
                     synthesis expression is cell cycle regulated"
                     /codon_start=1
                     /product="KLTH0B06776p"
                     /protein_id="XP_002552082.1"
                     /db_xref="GeneID:8290921"
                     /db_xref="GOA:C5DCY3"
                     /db_xref="InterPro:IPR002125"
                     /db_xref="InterPro:IPR015517"
                     /db_xref="InterPro:IPR016192"
                     /db_xref="InterPro:IPR016193"
                     /db_xref="UniProtKB/TrEMBL:C5DCY3"
                     /translation="MLLYVSETAGSGAWRLVEVLEKKFGFKRCFAEGGSVDLVVEEAT
                     ARFTENWILSGELGLEELQKLEKRPFFAHITIDAALKLRVAGFGVEKNAGTGPATGAD
                     ATAGTEASVGSQLQALIEHTEQQLERNPSLPLVLGRADIKFYVRTRDKLEFDCLAQEL
                     DRHLREINQGRDVRVPYHNTTPLRPDWDTYFMKLATLAASRSNCMKRRVGCVIVRDCR
                     VIATGYNGTPRHLVNCHSGGCPRCNNGDAQLHACLCLHAEENALLEAGRDRVGPNAIL
                     YCDTCPCLTCSVKIVQTGIREVVYSQSYRMDEASFKVLQEGGVLVRQFSVLESPRYTV
                     L"
     gene            <546016..>547554
                     /locus_tag="KLTH0B06798g"
                     /db_xref="GeneID:8290922"
     mRNA            <546016..>547554
                     /locus_tag="KLTH0B06798g"
                     /product="KLTH0B06798p"
                     /transcript_id="XM_002552037.1"
                     /db_xref="GeneID:8290922"
     CDS             546016..547554
                     /locus_tag="KLTH0B06798g"
                     /note="similar to uniprot|P39006 Saccharomyces cerevisiae
                     YNL169C PSD1 Phosphatidylserine decarboxylase of the
                     mitochondrial inner membrane converts phosphatidylserine
                     to phosphatidylethanolamine"
                     /codon_start=1
                     /product="KLTH0B06798p"
                     /protein_id="XP_002552083.1"
                     /db_xref="GeneID:8290922"
                     /db_xref="GOA:C5DCY4"
                     /db_xref="InterPro:IPR003817"
                     /db_xref="UniProtKB/TrEMBL:C5DCY4"
                     /translation="MMNVKLGIMKGGTGMKSRLGMYKLGGAAGTRIRNRTASLWNRRF
                     YSSRANHMLRISGYDRQVVVKLVVVTGVTLVLGSLLLNFAEREPEADEGHEGDEVDEN
                     GARKRGPKIKIFNNNWLFFWYSTLPLNAMSRLWGQVNSLTLPVWMRPWSFKLYAAMFG
                     ANLDEMEDPVLEHYQNLSEFFYRGIRPETRPVAPGDDVVVCPSDGKVLQLGVIDAHTG
                     DIEQVKGMTYSVREFLGTHAHPQMTRSESHDSIKNSATADKDHIEFARINNIPYTFND
                     MIGETPGEDSSHLQKIKYTSEGDKSLPDASPSRPKIMKLLSQLSTHYISKMSDMKPEN
                     NKLFFAVIYLAPGDYHHYHSPVNWVCKLRRHFPGELFSVAPYFQRNFPNLFILNERVA
                     LLGHWKYGFFSMTPVGATNVGSIKLNFDKELVTNEKRNRRTKPHTCYEATYENTSSIL
                     GGVPLVKGEEMGGFMLGSTVVLCFEAPSDFNFDIKVGQAVKMGQPLGKTSQTAQESLG
                     DGQE"
     gene            complement(<547625..>552751)
                     /locus_tag="KLTH0B06820g"
                     /db_xref="GeneID:8290923"
     mRNA            complement(<547625..>552751)
                     /locus_tag="KLTH0B06820g"
                     /product="KLTH0B06820p"
                     /transcript_id="XM_002552038.1"
                     /db_xref="GeneID:8290923"
     CDS             complement(547625..552751)
                     /locus_tag="KLTH0B06820g"
                     /note="similar to uniprot|P53886 Saccharomyces cerevisiae
                     YNL172W APC1 Largest subunit of the Anaphase- Promoting
                     Complex/Cyclosome (APC/C) which is a ubiquitin- protein
                     ligase required for degradation of anaphase inhibitors
                     including mitotic cyclins during the metaphase/anaphase
                     transition"
                     /codon_start=1
                     /product="KLTH0B06820p"
                     /protein_id="XP_002552084.1"
                     /db_xref="GeneID:8290923"
                     /db_xref="GOA:C5DCY5"
                     /db_xref="InterPro:IPR024990"
                     /db_xref="UniProtKB/TrEMBL:C5DCY5"
                     /translation="MPKIPSVFLQNSKHGEVWVFDTRIVEWRLGGKCLRKLEFGGEKV
                     LNAGFVDFESVKECLVVVLEDRAHVYYVGKGDFSIVSFPFSVSKAFFHVNGVLLERKL
                     EEENAVGSKSPFAATKHRFITLSDPLNLFGSLVISSNLPEQQDSKATILHFPRAWDDH
                     VSVLHDCNAKTLYFYNCKILAPARASGSSSSSKSHNHESAPYPANSRKKSYASLAGDA
                     ATYGKTSASNKRMLSNEHGSLASSSSSVPHATNAHPNNTATLSTELTNNLRKISIMNR
                     RSASATMGIDLDQPSQTTGPSQSHPGVDYMKRSASATLDRMGSGSALDITPSNSSQFS
                     QELFDHAVLTKDVVLTRISQTPLSIDISPNTHVESCRFEDKEAIILHDPDSQWGKIWI
                     FDLNSSMTESMKFKAFNNTPIALTKIIDIKWSLIRNYCIHNSKLLPGYLMLLSSSGEE
                     ITLYNPFLNLTSNPMLIPSREHERALYFSRENLVITSEKASPVNLAILPQIEAVKHCF
                     TAIRYLCDSFTYNYILLLWQVARSSVGEKQAACADFTALKLALLSLLQLERCPVNIKA
                     HMEHIRQSPIFDARFDGARFLPKIVMGMHLISEEYKLNLLQKQNVEMLEGILYLLTTL
                     MKWPRLWKEFYGANEKEDTSFEYKLSNRHFAHPLDEPPSILKSLYSVSDESTIPITPF
                     ITFSRLLEDGSSVDHIITPRTNKILQLFESLDAIKFSQSNLLDIMNSLNIDSYELETY
                     PLGVFAPLKRVLKSVENHVSEVNTGSDFTLIDRPDLQKNQEVLKSVQCDTTQTRKPLQ
                     PLVSLGPKGRENSKLQGCQPRSIRTIIDDILCLTENQPSDNLSGTNINEEVGEGQVLK
                     RNASLIFSEDRRFFDVVELLLYNIPHKLAVLINEKSYTRALKKKRLFSQILALRTFTS
                     GIGWGAVAFSTEKPLATQKWPQPKMNLHCIFTDKTTVTVDPKECDPSLLSWGEFHGGV
                     SSGLRISRKSTGITGSWITFTKPPELNAQHGGFLLGLGLNGHLKNLEEWHVYNYLSPK
                     QTHTSIGLMLGMSASLRGTMDLKLTKVLSVHIVALLPHGSSDLNVNYRVQTAGLIGVG
                     LLYQNSQHRRMSDMLFAEVSSFVSIDEEAVPDEGYRLAAGIALGLVNIGAGAKAAEAQ
                     FKKMAHAETYTSDEDDEDSEFAEFRANNGNLDPKIINGLMNIVNSVHDTEESWMPANS
                     QIGAVVALMLIYLKTNNRTVAEKLAPSSEEINLKARPYTRPELYMYREWAHHMILWDH
                     IASNTEWLFKGINIACALQVNTDFLPIYYCIAGRALALGLKFASSGNSEARDNILALV
                     DKLLPLYQCPIDARLDFQLTIKAINVLLNVLLVSVSMIMSGTGDLAVFRRVKFLHETV
                     SGKNSDLFRTPLRKRQQKRNHTEDEMSVDLTEEPEDGVQAEGNDLGEELEEEEANSTI
                     NEELESDDASDESRRYKDEENHFGKFMATSLSLGFLFLGSGQYAFKVSKLENLAYLIM
                     SVLPTYMCPYYLQETKHFWSMAVEYRSLLVCDSRTGASLNKVPVDVTFKGSKSSNTFS
                     TLKMVSPCLLPDVRLIRSIKILSPDYYPVSLDFRSDEDRINFFNNGCVLYVPPREDDG
                     NGWQQNQEAADKSCEVRQILKKKVMSLSSPSASTSKSKCTDDILKHLGLANQESLEIE
                     NEVLKLKENQDPLLDENLMMSCQNQSKSYHLELWRRRHKF"
     gene            complement(552939..553048)
                     /locus_tag="KLTH0B06842r"
                     /db_xref="GeneID:8290924"
     tRNA            complement(join(552939..552974,553013..553048))
                     /locus_tag="KLTH0B06842r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove"
                     /db_xref="GeneID:8290924"
     gene            <554835..>557513
                     /locus_tag="KLTH0B06864g"
                     /db_xref="GeneID:8290925"
     mRNA            <554835..>557513
                     /locus_tag="KLTH0B06864g"
                     /product="KLTH0B06864p"
                     /transcript_id="XM_002552039.1"
                     /db_xref="GeneID:8290925"
     CDS             554835..557513
                     /locus_tag="KLTH0B06864g"
                     /note="weakly similar to uniprot|P38845 Saccharomyces
                     cerevisiae YHR146W CRP1 Protein that binds to cruciform
                     DNA structures"
                     /codon_start=1
                     /product="KLTH0B06864p"
                     /protein_id="XP_002552085.1"
                     /db_xref="GeneID:8290925"
                     /db_xref="InterPro:IPR014756"
                     /db_xref="UniProtKB/TrEMBL:C5DCY6"
                     /translation="MAEYTFRWPEGPQDVILTGDFDNWSGSLPLVKSPRGDFAITMPI
                     PPSSKNKFHFKFIVDGQWMVSDNYDVDHSSEGIENNFLVVSSLPTPSSNKAAAAGGKI
                     PEIGLNLVAPEVAAPVLGTQAPQKAQPAPRSNKKSKKKRIQIKRRIRRNKKTGERTVL
                     SEERSELKSGTDDETYETEETATATNTSREDTPLSTDLDPLVNPTQRQNEFSSTVMPS
                     TENRQTTLGEPGIAIVKDAAQIKEFSEIRDVDADELNERLNRELAEKQNREASTVEET
                     PAEKETEPLKSADEGVHVSPPEFPVVEKNISPPEFPVVEKDLSSPAVKGGEEESSSKA
                     PVAAFAAIPTGDHDVASESPVPESPTLKEESAPATLAAGKKDVKPLEASAAEEKGPKP
                     ALASGKQPVVAALPAPEKDTSSSKALVPENDDSSTRALAGDVSPAEVAAIATSPSALP
                     VAEKEVEPSSAVSEEISTPLVSQKAAYADSTSGVALASEDKEDGSEAPAAAGIFAVEQ
                     KSFIPAAAGAGAVATTVAAVGAVEALPEEKDSSLKGNAFASSLDPIQGKSQKLFERDV
                     SEEEPSTAGATKDTIDTFEAIEAPQQKGVAPIAVAEVDTVQDHSKKMPSNEFGTQPID
                     ENAKPSKVVQEETIVAAPVTGLDESHPDTAEHVHAEKDFTETPIAEPKTGSGASQKSK
                     VTSPANDYDIVVVEGELGKLPAKSSAADASAAISEAPASHEKPADVVEGVPKESELVP
                     KESADAFESNVSSSEQKVNVVEEIGVITSPEQEAELIRKTLDPKASSPGETEELLIVE
                     GDIPPSQIAEYQEASEAAAAKAMANQNPEEAVVREEPSTNAAPKEPVKETSNVAHAKK
                     ASPVKQKPAASSTSKPAEKEKKKKKGLFSKIKKIFH"
     gene            <557856..>559046
                     /locus_tag="KLTH0B06886g"
                     /db_xref="GeneID:8290926"
     mRNA            <557856..>559046
                     /locus_tag="KLTH0B06886g"
                     /product="KLTH0B06886p"
                     /transcript_id="XM_002552040.1"
                     /db_xref="GeneID:8290926"
     CDS             557856..559046
                     /locus_tag="KLTH0B06886g"
                     /note="similar to uniprot|P53883 Saccharomyces cerevisiae
                     YNL175C"
                     /codon_start=1
                     /product="KLTH0B06886p"
                     /protein_id="XP_002552086.1"
                     /db_xref="GeneID:8290926"
                     /db_xref="GOA:C5DCY7"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DCY7"
                     /translation="MASNNKSEEVVDKVEDKSAKEQEIEKALQDQTKKRKAEDEIEID
                     LNQTVPLSKKQKRLLRRGKVTLEELNEKFNLDPSSVKEYQKEIEGKTQSEKKEGVEEG
                     EEEVQEDASSASQKAKKDKKFGVWIGNLTFDTSKEDLCRFFIAKTKELDPDSRVEESD
                     ILRVNLPLAQNDGKQVKNKGFAHMNFRTQKQMDAVIALSESHLNGRNMLIKNSASFDG
                     RPDKNDLISMSKNPPSRILFVGNLSFDTTDELLKKHFQHCGEIVKIRMATFQDTGKCK
                     GFAFVDFKNEEGPTNALKDKTCRRIAGRPLRMEFGEDRSKRQVKRRVPQASETLSSTS
                     GPSLREEPSTSAPPIRERKPVKKHREPSYKDKNNRLKSSVALASAPRASAAIVPSQGK
                     KITF"
     gene            <559697..>560776
                     /locus_tag="KLTH0B06908g"
                     /db_xref="GeneID:8290927"
     mRNA            <559697..>560776
                     /locus_tag="KLTH0B06908g"
                     /product="KLTH0B06908p"
                     /transcript_id="XM_002552041.1"
                     /db_xref="GeneID:8290927"
     CDS             559697..560776
                     /locus_tag="KLTH0B06908g"
                     /note="weakly similar to uniprot|P53882 Saccharomyces
                     cerevisiae YNL176C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B06908p"
                     /protein_id="XP_002552087.1"
                     /db_xref="GeneID:8290927"
                     /db_xref="UniProtKB/TrEMBL:C5DCY8"
                     /translation="MLFNATIVSFSSRSRVGTSSSSTQSSSEKEPQTSSSVWSSLELS
                     TLESTSTQTIVSTSASITAVEPSATMLTSSDDSITTTTSDTSLPAATSSLPSSSVPAG
                     KTAVVYTRSYVFTASSTTFGTKLPMTTVMATKKAATFSAPTAAVTTDLSFYQNWLSGT
                     LGSTSSSSSGSLSKTHRNTIIGSVVGSVCGFLLVLGFLWFVLCRRRKNRASQSRSFSH
                     EIGTRLDYPVAPPRPSQTQVPEDDEAFLKSKYKSLGRKLPLWHKSESHPTRGGTAEAE
                     SAQGEPKGNPFQDEFDFQRRLSRPPAPPPVPPRDVPNLSHFADDSDASSSSSENSVND
                     SSSSIQLTRPARAARSTQSFLHEVL"
     gene            <560847..>561848
                     /locus_tag="KLTH0B06930g"
                     /db_xref="GeneID:8290928"
     mRNA            <560847..>561848
                     /locus_tag="KLTH0B06930g"
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /transcript_id="XM_002552042.1"
                     /db_xref="GeneID:8290928"
     CDS             560847..561848
                     /locus_tag="KLTH0B06930g"
                     /note="similar to uniprot|P53881 Saccharomyces cerevisiae
                     YNL177C MRPL22 Mitochondrial ribosomal protein of the
                     large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL22"
                     /protein_id="XP_002552088.1"
                     /db_xref="GeneID:8290928"
                     /db_xref="GOA:C5DCY9"
                     /db_xref="InterPro:IPR001063"
                     /db_xref="InterPro:IPR005727"
                     /db_xref="UniProtKB/TrEMBL:C5DCY9"
                     /translation="MIIKIFEDTSSQPWIAKAGKSRRDKLRGSLNMFPRPLLQCGRFS
                     PAVWLRRGFQSSVPALNNGSNGSLFGSITEATEAQNEDPNRISNRLTAASSVAESQES
                     DPKETVTVQNDKLLQSFIQRSQPAASAPQLLLSPLKRRIYEENCKMNGGFYKKDSVVT
                     LTGEDGKKLKYKLNLSREEMEALEPSIYVKSYRIKSSMKKTTQLLRLLGGLDAKVALT
                     QCHFSNKKVARDVAEVLTRGMADAEKLGLKADNLYIAQIWTGSDGYWQKRIDIKARGR
                     NGVITHPYVHVRCILKTKDVTQRRLAYEQMLKQQRSKPWVQLRDQPVRGAMGGVYKW"
     gene            complement(<561932..>562537)
                     /locus_tag="KLTH0B06952g"
                     /db_xref="GeneID:8290929"
     mRNA            complement(<561932..>562537)
                     /locus_tag="KLTH0B06952g"
                     /product="KLTH0B06952p"
                     /transcript_id="XM_002552043.1"
                     /db_xref="GeneID:8290929"
     CDS             complement(561932..562537)
                     /locus_tag="KLTH0B06952g"
                     /note="similar to uniprot|Q02774 Saccharomyces cerevisiae
                     YDL212W SHR3 Endoplasmic reticulum packaging chaperone
                     required for incorporation of amino acid permeases into
                     COPII coated vesicles for transport to the cell surface"
                     /codon_start=1
                     /product="KLTH0B06952p"
                     /protein_id="XP_002552089.1"
                     /db_xref="GeneID:8290929"
                     /db_xref="InterPro:IPR013248"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ0"
                     /translation="MKLTYKDICTIGTGLILIGTSFIMGVFFANQTYDYHILFNTDLK
                     PSHFENSLRHYQTLYYTAPPVLYALGAVVSLGLIGCLIKVYKPNPDLKIFEYATLVMY
                     VIGVCMFITNIKTGIESSVSSNWGEVTENQGLAVIASSNVILLVIFIGVLVLQAGLWY
                     SHWEYQQRLEQFYAEEAKTAAAVTPTGETKPAKKTEAKKQK"
     gene            complement(<562821..>563567)
                     /locus_tag="KLTH0B06974g"
                     /db_xref="GeneID:8290930"
     mRNA            complement(<562821..>563567)
                     /locus_tag="KLTH0B06974g"
                     /product="40S ribosomal protein S3"
                     /transcript_id="XM_002552044.1"
                     /db_xref="GeneID:8290930"
     CDS             complement(562821..563567)
                     /locus_tag="KLTH0B06974g"
                     /note="highly similar to uniprot|P05750 Saccharomyces
                     cerevisiae YNL178W RPS3 Protein component of the small
                     (40S) ribosomal subunit"
                     /codon_start=1
                     /product="40S ribosomal protein S3"
                     /protein_id="XP_002552090.1"
                     /db_xref="GeneID:8290930"
                     /db_xref="GOA:C5DCZ1"
                     /db_xref="InterPro:IPR001351"
                     /db_xref="InterPro:IPR004044"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR005703"
                     /db_xref="InterPro:IPR009019"
                     /db_xref="InterPro:IPR018280"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ1"
                     /translation="MVAVISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPT
                     KTEVIIRATRTQDVLGENGRRINELTLLVQKRFKYQAGSIVLYAERVQDRGLSAVAQA
                     ESMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVISGKLRAARAKSMKFADGFLIHS
                     GQPVADFIDTATRHVLLRQGVLGIKVKIMRDPARNRVGPKALPDAVKILEPKEEEYVE
                     SPSVKDYRPAPQAQEAPEAQEAQAPAPVEA"
     gene            <565363..>566142
                     /locus_tag="KLTH0B06996g"
                     /db_xref="GeneID:8290931"
     mRNA            <565363..>566142
                     /locus_tag="KLTH0B06996g"
                     /product="KLTH0B06996p"
                     /transcript_id="XM_002552045.1"
                     /db_xref="GeneID:8290931"
     CDS             565363..566142
                     /locus_tag="KLTH0B06996g"
                     /note="weakly similar to uniprot|P53879 Saccharomyces
                     cerevisiae YNL180C RHO5 Non-essential small GTPase of the
                     Rho/Rac subfamily of Ras-like proteins likely involved in
                     protein kinase C (Pkc1p)-dependent signal transduction
                     pathway that controls cell integrity"
                     /codon_start=1
                     /product="KLTH0B06996p"
                     /protein_id="XP_002552091.1"
                     /db_xref="GeneID:8290931"
                     /db_xref="GOA:C5DCZ2"
                     /db_xref="InterPro:IPR001806"
                     /db_xref="InterPro:IPR003578"
                     /db_xref="InterPro:IPR005225"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ2"
                     /translation="MRSVKCVIVGDGAVGKTSLLISYTTNTFPQDYIPTVFDNYTTTI
                     ALNDGKSIEPQVFRLNLWDTAGQEEYDRLRPLSYPQTDIFLLCFSINEPNSFMNVKDK
                     WFPEIRHNTNYDNLELFRVCGKYPILLVGTKADLRDDEHEQDRLAEVNSDFVSRAEID
                     QCISQCGFMGYVECSAATQVGVAEVFERAVQCVIIEPERLLNQSKQRESTIDHPTNNQ
                     SNTAASSGAGAGTAGSSSNWNAPGSNPMKKRKKKSQKCTIL"
     gene            complement(<566364..>567581)
                     /locus_tag="KLTH0B07018g"
                     /db_xref="GeneID:8290932"
     mRNA            complement(<566364..>567581)
                     /locus_tag="KLTH0B07018g"
                     /product="KLTH0B07018p"
                     /transcript_id="XM_002552046.1"
                     /db_xref="GeneID:8290932"
     CDS             complement(566364..567581)
                     /locus_tag="KLTH0B07018g"
                     /note="similar to uniprot|P53878 Saccharomyces cerevisiae
                     YNL181W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0B07018p"
                     /protein_id="XP_002552092.1"
                     /db_xref="GeneID:8290932"
                     /db_xref="GOA:C5DCZ3"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ3"
                     /translation="MPVNIITAGLIEGFDTLPFYRQIKAIAPYAAGVIAVKLWSRGAK
                     NTWERNLNGKVYILTGATTQGMGTSVALEMAQKGAQLIILTRVVDEWSTEWVEDLRQR
                     TGNELIYLEQCDLSDLYEVRKFATKWLDNSPPRRLDGVVVMSGNLQPAGLVPGWSHGT
                     RKSSKDGLELQIATNFAGVFHLLNLLTPSFKAQPPDRDVRIIVTTCMLQAIGEVQVDD
                     PLWEDVKYDRPLKFFGSSKLQLSLCMLELQRRILSSTTKDGRSGKNVTVVLAQPGVMR
                     STSLRQLISNGSVFVLVFIYSILLYPLLWLLTKSGYRGAQSILYALTTPELEEINWVD
                     EQVKYVVNCSMAKFARKEFADKELQEKLYETTEAKILEVEKKMAVKRNLSKKNTKNDA
                     KGRTKDAKGNRKD"
     gene            <567756..>569276
                     /locus_tag="KLTH0B07040g"
                     /db_xref="GeneID:8290933"
     mRNA            <567756..>569276
                     /locus_tag="KLTH0B07040g"
                     /product="KLTH0B07040p"
                     /transcript_id="XM_002552047.1"
                     /db_xref="GeneID:8290933"
     CDS             567756..569276
                     /locus_tag="KLTH0B07040g"
                     /note="similar to uniprot|P53877 Saccharomyces cerevisiae
                     YNL182C IPI3 Protein required for cell viability
                     computational analysis of large-scale protein- protein
                     interaction data suggests a possible role in assembly of
                     the ribosomal large subunit"
                     /codon_start=1
                     /product="KLTH0B07040p"
                     /protein_id="XP_002552093.1"
                     /db_xref="GeneID:8290933"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ4"
                     /translation="MDEQLIFSTNTTCTVGSLHSPNQTNLKQCSNEFRNGSCLVGSKY
                     LLVAQARKALINVYRIEGSGKRESVEQRLPLPETVNCLEVVENNAEQNGNSQLPYLLL
                     ASTSSGKLYVWEMASGNLLTVKAMAHYQAITKIRSIIQGKYVITSGADARIMIWQTVD
                     LVSQQDPKPLFTLHDHTLAVTDFEVSNAHSSQLSGKLFTVSHDMTMRCYDLNMDVFDK
                     PQLLTTFTFPFPLECITLDPADRACYVGGAQGVYALPFYYPIGDRKVANLLSSDSSNI
                     LSCVEQQPGDKNADLFTMGKVALAKITNAQTSQLACSLEGSLLVVGDSLGKCTVMDVY
                     SKQPVKEIQAIVANETAGEVTSIILNPVNVDNSNSLLGDGKTQSGFKIPNLQKNVFAR
                     EGLHDILFQIEDLQDSKVAPLDDFEAYLDQVAAEEGTFAQLGNVVSTVKVMSESEGAN
                     RNPENPDTAQRPADDGELLTMKATVGQLTGAYKELREMYDKLFQEHESLRSTLGEN"
     gene            complement(<569322..>569627)
                     /locus_tag="KLTH0B07062g"
                     /db_xref="GeneID:8290934"
     mRNA            complement(<569322..>569627)
                     /locus_tag="KLTH0B07062g"
                     /product="KLTH0B07062p"
                     /transcript_id="XM_002552048.1"
                     /db_xref="GeneID:8290934"
     CDS             complement(569322..569627)
                     /locus_tag="KLTH0B07062g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B07062p"
                     /protein_id="XP_002552094.1"
                     /db_xref="GeneID:8290934"
                     /db_xref="InterPro:IPR013957"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ5"
                     /translation="MSSQSSPSKEASKPAAASPENPSAEKQKVESKPKGLQPASNESQ
                     PQPADVASLMGFASFGTTKQKKVQGKGSGGKRVEKTAAKSSRKYRQYVNRKSKKLVQ"
     gene            <569812..>570441
                     /locus_tag="KLTH0B07084g"
                     /db_xref="GeneID:8290935"
     mRNA            <569812..>570441
                     /locus_tag="KLTH0B07084g"
                     /product="KLTH0B07084p"
                     /transcript_id="XM_002552049.1"
                     /db_xref="GeneID:8290935"
     CDS             569812..570441
                     /locus_tag="KLTH0B07084g"
                     /note="some similarities with uniprot|Q07623 Saccharomyces
                     cerevisiae YDL213C"
                     /codon_start=1
                     /product="KLTH0B07084p"
                     /protein_id="XP_002552095.1"
                     /db_xref="GeneID:8290935"
                     /db_xref="GOA:C5DCZ6"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ6"
                     /translation="MVDEKKLTKKQLKAQQFRKTKEEREDDKIVKRKLEESEEAKPAE
                     DEAPRKKRKTRRGKGGKGKKGNRFIVFVGNLPKDTSKTELQAHFKSSSPDEIRMRPDK
                     NIAFLEFDADKDQKNIQSRMDVALLQHKTEMKGRRINVELTVGGGGNSQARLEKLKNK
                     NLKLDDERKERTTKMIQDSKNKTAKSASAGTANVEASGGIHPDRLKLIK"
     gene            <571005..>573260
                     /locus_tag="KLTH0B07106g"
                     /db_xref="GeneID:8290936"
     mRNA            <571005..>573260
                     /locus_tag="KLTH0B07106g"
                     /product="KLTH0B07106p"
                     /transcript_id="XM_002552050.1"
                     /db_xref="GeneID:8290936"
     CDS             571005..573260
                     /locus_tag="KLTH0B07106g"
                     /note="similar to uniprot|P22211 Saccharomyces cerevisiae
                     YNL183C NPR1 Protein kinase that stabilizes several plasma
                     membrane amino acid transporters by antagonizing their
                     ubiquitin-mediated degradation"
                     /codon_start=1
                     /product="KLTH0B07106p"
                     /protein_id="XP_002552096.1"
                     /db_xref="GeneID:8290936"
                     /db_xref="GOA:C5DCZ7"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ7"
                     /translation="MSSLTKLLQEKRKNEGGLSSGLAQTRSQMSSAGTAAGTSGGTGS
                     AASEELSSSVGSNVLMNQEAFSSSFFNANSAHTAALSESYKDRDRPAPLTIESRGGNA
                     RLSSQGFQPGSQPGPQSGPRPVPSLSSSIPYSVPNSNANGSSGSNAAGGAGSGGFHSS
                     NGSGVSSASSSWLESPGVMPSNVSAIDSNVISSPKVDTVEPRFVISKQKFQKASMDNA
                     ANSYSNAQNGSISRSSSISSQLGNLFFTKNGKELSSSQNSQSRDIPTNSAQSAAYGSS
                     IPKPMRARRSSLYGSSRQPSNSYQDTFIGSPSSLHEQPPNQYMPRSRHSSIADLKRFF
                     KKGQSVNMSVSPGTPPVSSGGNISSHNSNASSFGPGSYSSNNGDTIYTSSASSTLPYS
                     KRYTKTGEVLGAGAGGSVRLVKRLQDNKVFAVKEFRTKFESEAKRDYVKKITSEYCIG
                     TTLRHPNIIETVEIVYDNNRILQVMEYCDYDLFAIVMSNKMSYEEICCCFKQILTGVQ
                     YLHSMGLAHRDLKLDNCVINKQGVVKLIDFGAAAVFSYPFSKTLVESSGIVGSDPYLA
                     PEVCIFSKYDPRPVDVWSIAIIFACMVLKKFPWKIPKLKDNSFKLFCSGRNCDSLSAL
                     VTRTPDPPSYDSATNTDENDKPKAEAPVSNNPANPENPNIGPQRLLHSLPEESQHIIG
                     RMVELAPACRVSIDDIMKDPWVESIDVCEVVEEGYSTKVVSGVDHKHTQVDQSEAHIA
                     GLEKKKKKQNR"
     gene            <573530..>574060
                     /locus_tag="KLTH0B07128g"
                     /db_xref="GeneID:8290937"
     mRNA            <573530..>574060
                     /locus_tag="KLTH0B07128g"
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /transcript_id="XM_002552051.1"
                     /db_xref="GeneID:8290937"
     CDS             573530..574060
                     /locus_tag="KLTH0B07128g"
                     /note="highly similar to uniprot|P53875 Saccharomyces
                     cerevisiae YNL185C MRPL19 Mitochondrial ribosomal protein
                     of the large subunit"
                     /codon_start=1
                     /product="mitochondrial 54S ribosomal protein YmL19"
                     /protein_id="XP_002552097.1"
                     /db_xref="GeneID:8290937"
                     /db_xref="GOA:C5DCZ8"
                     /db_xref="InterPro:IPR000911"
                     /db_xref="InterPro:IPR006519"
                     /db_xref="InterPro:IPR020783"
                     /db_xref="InterPro:IPR020784"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ8"
                     /translation="MPVNIKKNFKRLGYRIPIDLKKHRAKIMSKPLKNIIVKLIVGAG
                     QAAPSPPVGPALGSKGIKAIDFCKEFNARTASYQPGTPVPVLITIKPDRSFAFEMKSP
                     PTGFLLLKSLGKDKGMGQPDVKSPAGTLGELSLKHIYEIAKIKKSDGRHASLGMESIV
                     KSVVGVAKSMGINVVP"
     gene            complement(<574195..>576465)
                     /locus_tag="KLTH0B07150g"
                     /db_xref="GeneID:8290938"
     mRNA            complement(<574195..>576465)
                     /locus_tag="KLTH0B07150g"
                     /product="KLTH0B07150p"
                     /transcript_id="XM_002552052.1"
                     /db_xref="GeneID:8290938"
     CDS             complement(574195..576465)
                     /locus_tag="KLTH0B07150g"
                     /note="some similarities with uniprot|P53874 Saccharomyces
                     cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
                     deubiquitinates ubiquitin-protein moieties may regulate
                     silencing by acting on Sir4p involved in
                     posttranscriptionally regulating Gap1p and possibly other
                     transporters primarily located in the nucleus"
                     /codon_start=1
                     /product="KLTH0B07150p"
                     /protein_id="XP_002552098.1"
                     /db_xref="GeneID:8290938"
                     /db_xref="GOA:C5DCZ9"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="UniProtKB/TrEMBL:C5DCZ9"
                     /translation="MQEHDAVKPLVERLLAQPLQFKPATAPDSVEGKPVSCVVIGSSR
                     PAAHHPTRRDGTNADASGRTQGDGRKANGTSGNANGRRPVPKNFSEALQMYTARKQIP
                     SDVELSDGKYQSSSDGEGAGEDVVDAPDAAGAQSESGESSDSAAEEFHEAHEYVEDGS
                     SDPGSGADAVASTGEDLGEDLGEDLGEDLGEDLGEDLGEDVGEGLGEDLGEDPEEGAK
                     ENAGNSKPETDADEREASLGSVSDQDDQDEEDADFQDDGTEDSELEGPDGNITDSEKA
                     GLMREAQEYAEMASLADARKKTEPAGEDNGNAEEESAHEENEEELKHKQPSSKRASPT
                     PPTVLSDMDRFYQFNEKANDRGANNSTRILKNWGPQLSTMKPKGLLNHGVTCYTNAAV
                     QALIHIPAIQHYLFDVLRGEYKSTISPNSVTQVLAETSKRMWSTDASKNQFINPKKLI
                     GRLEDINCMMSEWQQEDSHEYFMSLISRLQEDSVPRGHKLTESILYDIFGGMLRQEVT
                     CKSCGEVSKTEQPIYDISLHLKGKKNSDSADTAKNSSDFEEEPQRRFSIEKSIRDFFN
                     PELIKVDKANKEGYVCEKCHKTTNASKHNFILRAPETLLVHLKKFRFNGTSSSKLKQA
                     VSYPMFLDVTEFCENSKTTLPVKYQLISVVVHEGRSLTSGHYIAHCKQPDGSWSTYDD
                     EYINKISERQMLKEPGAYYLVYTRLTPRSVPLPQGPSVSSSSAAAATNRAEGTPKSSS
                     KRKKSKNKNKKRCYNK"
     gene            <578663..>581806
                     /locus_tag="KLTH0B07172g"
                     /db_xref="GeneID:8290939"
     mRNA            <578663..>581806
                     /locus_tag="KLTH0B07172g"
                     /product="KLTH0B07172p"
                     /transcript_id="XM_002552053.1"
                     /db_xref="GeneID:8290939"
     CDS             578663..581806
                     /locus_tag="KLTH0B07172g"
                     /note="similar to uniprot|P33327 Saccharomyces cerevisiae
                     YDL215C GDH2 NAD()-dependent glutamate dehydrogenase
                     degrades glutamate to ammonia and alpha- ketoglutarate
                     expression sensitive to nitrogen catabolite repression and
                     intracellular ammonia levels"
                     /codon_start=1
                     /product="KLTH0B07172p"
                     /protein_id="XP_002552099.1"
                     /db_xref="GeneID:8290939"
                     /db_xref="GOA:C5DD00"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR016210"
                     /db_xref="InterPro:IPR028971"
                     /db_xref="UniProtKB/TrEMBL:C5DD00"
                     /translation="MLSSQNSKVPDISSLSISSISDYHNFDFPGKDAQREAVLDLVDQ
                     QGFIPDDVVEHEVEWFYDALGIDDLFFSKESPEMIANIIHTLYASKVESFAKLKIAGD
                     SAASVEDGSSPSNFTVKNQVVTETHSVFMETGNDLDKEIDSMLLDNPTQRYRLISYTA
                     ESALKLTFVYRTVFAAEDQSGAELAPEQLCHGDIDSISDLTMSQVTSKENKKLYGLIM
                     NQMRQREGPVIKTLHSVADQDEVRIVVGFKRGTTKSYYAALSSLLHYYHLKPSKIYME
                     TFTNDVMIYSLYLKQSQQSESVLNSLPMSIMQIEREASLLYAIPSNFFQDLYQQRSFS
                     PQEAIYAHISAIFINNFINRLGDDYQNLVAQISVSGANKNNNSAQEVLASLKKKLRNE
                     TYTQQMIIDVLHKYKSIVSKLYKNFAQVHYVSSSSSKFGKTLSYQRLSKLEPFKDDNE
                     FELYLNKFIPNDSPDMLVLKTLNLFNKSILKTNFFITRKVAISFRLNPALIMPEVEFP
                     ETPFGIFFVVGNTFKAFHIRFRDIARGGIRIVCSKTQDIYEVNSKMAIDENYQLASTQ
                     QRKNKDIPEGGSKGVILLNPTLTSPEQTFVAFSQYVDAIIDILIQDPLKEKYVDLLGQ
                     EEILFFGPDEGTAGFVDWATSHAKSRGCPWWKSFLTGKSASMGGIPHDDYGMTSLSVR
                     AFVNGLYETLGLQEKTIHKFQTGGPDGDLGSNEILLSSSNEQYVALVDGSGVLCDPSG
                     LDMAELKRLANERKMVTSYDKSKLKHHGFFVSVDEVDIILPNGVIVANGTTFRNRFHL
                     EIFNFVDKVDLFVPCGGRPNSIDINVLHFYVDEKTSRCKIPYIVEGANLFITQPAKIA
                     LENHGCILFKDASTNKGGVTSSSMEVQASLALNDADFINKFIGKEPQQRTPLYAAYVE
                     EVQDRIQKNARAEFNQLWQLNQSTGTPISELSNVLSQTINKVNDELINSNELWVNDLK
                     LRNFLLLKKIIPKLLIDVAGPTSVLENIPVSYLKALLSSYLSSTYVYSYGIDVNIGKF
                     LEYIGELKREAEDFALA"
     gene            <582064..>583302
                     /locus_tag="KLTH0B07194g"
                     /db_xref="GeneID:8290940"
     mRNA            <582064..>583302
                     /locus_tag="KLTH0B07194g"
                     /product="KLTH0B07194p"
                     /transcript_id="XM_002552054.1"
                     /db_xref="GeneID:8290940"
     CDS             582064..583302
                     /locus_tag="KLTH0B07194g"
                     /note="weakly similar to uniprot|Q12468 Saccharomyces
                     cerevisiae YDL216C RRI1 subunit of COP9 signalosome (CSN)
                     COP9 signalosome"
                     /codon_start=1
                     /product="KLTH0B07194p"
                     /protein_id="XP_002552100.1"
                     /db_xref="GeneID:8290940"
                     /db_xref="InterPro:IPR000555"
                     /db_xref="UniProtKB/TrEMBL:C5DD01"
                     /translation="MRYSLETCRDLRARAHLVSQQLKDIEEGHGSMILGEREDCIDQP
                     KSLGDLIRKQVGVDVREESEQKHNSRHFKRVMLSNMASYKILQHALKGGDVEIMGMLV
                     GSTDRDSIIVFDCYPLPVEGTETRVNAQLESYEYMVQYMNEVYDSCSHPKNIVGWYHS
                     HPGYGCWLSGIDVQTQELNQTFQDPYIAVVVDPKKSAEDKRLSIGAFRTLNEDEIPEN
                     VDQYGDSRYGHHSHKYYELEVKIFTSIFDTTLEQLQLRFDISASETPESSMVLEQLLE
                     SVRNWNNFRKLTNPNQFLVQNSRQSDFSVQDHEVDMGAEFSSFSRRSSRASSVTSSKD
                     ESTGSDVDMISNAIVGDYSTESSLPPASLAQPGMVTSEVEVPQVRSFEREYYLYKTNL
                     SLIKLKEYERLRYFKDTFTL"
     gene            complement(<583297..>584565)
                     /locus_tag="KLTH0B07216g"
                     /db_xref="GeneID:8290941"
     mRNA            complement(<583297..>584565)
                     /locus_tag="KLTH0B07216g"
                     /product="KLTH0B07216p"
                     /transcript_id="XM_002552055.1"
                     /db_xref="GeneID:8290941"
     CDS             complement(583297..584565)
                     /locus_tag="KLTH0B07216g"
                     /note="similar to uniprot|P53873 Saccharomyces cerevisiae
                     YNL187W Non-essential protein with putative leucine-rich
                     nuclear export signal (NES) sequence that fits the
                     consensus sequence recognized by Crm1p"
                     /codon_start=1
                     /product="KLTH0B07216p"
                     /protein_id="XP_002552101.1"
                     /db_xref="GeneID:8290941"
                     /db_xref="GOA:C5DD02"
                     /db_xref="InterPro:IPR011047"
                     /db_xref="InterPro:IPR015943"
                     /translation="MNRVRKVYDTLDTFDGRDVLQSWKREGSRWLDQVENSTYQFPEL
                     ESSNYERTKGRVPTEHIDLRSPIICTKLSWSQDGTSLVAVFNDYGVRQYLLPEEEGTG
                     LVPFKRFFRAQPAVDCCIHPEYSLFNDSDACNVMLASSRDLPIQLLSLSPHAREHRPL
                     FSYSVVNAENERFETMFSLSFSHYSGFLAGTSRNKVVAYDLNYKSPIWSSDGYGKPLR
                     GTSARRAIISCFDSPSDSESVLRYAGTYRCDIYGIDLRTKELNFLANKQTLELKENSA
                     GVAELLFSVNKHYLYVIKRNSQTIDVLDARSSFAKINELYLSFRIGSQKIIATLDLIN
                     GLLIGTHDGKILQWASNMVEFGGLLPRTPEGPAKDSAVSKVFDTSYAGSRINILASSP
                     SNPHLIAGSFSPDKFEADHTAKSGLFVVDL"
     gene            <584739..>585329
                     /locus_tag="KLTH0B07238g"
                     /db_xref="GeneID:8290942"
     mRNA            <584739..>585329
                     /locus_tag="KLTH0B07238g"
                     /product="KLTH0B07238p"
                     /transcript_id="XM_002552056.1"
                     /db_xref="GeneID:8290942"
     CDS             584739..585329
                     /locus_tag="KLTH0B07238g"
                     /note="highly similar to uniprot|Q12328 Saccharomyces
                     cerevisiae YDL217C TIM22 Mitochondrial inner membrane
                     protein involved in import of proteins of the ADP/ATP
                     carrier (AAC) family"
                     /codon_start=1
                     /product="KLTH0B07238p"
                     /protein_id="XP_002552102.1"
                     /db_xref="GeneID:8290942"
                     /db_xref="GOA:C5DD03"
                     /db_xref="InterPro:IPR003397"
                     /db_xref="UniProtKB/TrEMBL:C5DD03"
                     /translation="MVYRGFGLEQVSPPPNKPFNEMTPEEQGEHGAQMMVNFMTSCPG
                     KTAISGVTGFALGGVFGLFMASMAYDTPLHTPTVPGESQLPSNVKHISDLPFKQQVKL
                     QFADMGKRAYSSAKNFGYIGMIYSGVECVIESLRAKNDIYNGVTAGCLTGGGLAYKSG
                     PSAALMGCAGFAAFSTAIDLYMRQENGTPPKNDFDE"
     gene            complement(<585375..>586334)
                     /locus_tag="KLTH0B07260g"
                     /db_xref="GeneID:8290943"
     mRNA            complement(<585375..>586334)
                     /locus_tag="KLTH0B07260g"
                     /product="KLTH0B07260p"
                     /transcript_id="XM_002552057.1"
                     /db_xref="GeneID:8290943"
     CDS             complement(585375..586334)
                     /locus_tag="KLTH0B07260g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B07260p"
                     /protein_id="XP_002552103.1"
                     /db_xref="GeneID:8290943"
                     /db_xref="UniProtKB/TrEMBL:C5DD04"
                     /translation="MSPPGINQSNLPSREYRIASESRIARINELYNRSQRQQKHRDSI
                     ISDNSTSVPYIQDEDDCQPLAYLAPNRVRRAPVAPPDSETIKPAPVKNPFRPKPTEER
                     PFSEDDVERELQFTPKLMSRRSIVSSRTPSHGTPLRREGPEDIVPDTPVQLPIWFSKQ
                     VVPDFNNTNRAARRREAFKELKQKLGKPLPLGYLSDFQDEASRSTKKNVEERRKRMLS
                     SKGRDISWHDTRSLSDESSGIHSPHTSASSGDFIAGELSATSTDDGFHQNISEGLRTN
                     SEKLDQIMVLLETRKKAASKRECLAWIFCIIVLIALNLYLSNL"
     gene            complement(<586628..>588358)
                     /locus_tag="KLTH0B07282g"
                     /db_xref="GeneID:8290944"
     mRNA            complement(<586628..>588358)
                     /locus_tag="KLTH0B07282g"
                     /product="KLTH0B07282p"
                     /transcript_id="XM_002552058.1"
                     /db_xref="GeneID:8290944"
     CDS             complement(586628..588358)
                     /locus_tag="KLTH0B07282g"
                     /note="highly similar to uniprot|Q02821 Saccharomyces
                     cerevisiae YNL189W SRP1 karyopherin alpha homolog of 60
                     kDa"
                     /codon_start=1
                     /product="KLTH0B07282p"
                     /protein_id="XP_002552104.1"
                     /db_xref="GeneID:8290944"
                     /db_xref="GOA:C5DD05"
                     /db_xref="InterPro:IPR000225"
                     /db_xref="InterPro:IPR002652"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR024931"
                     /db_xref="UniProtKB/TrEMBL:C5DD05"
                     /translation="MMEPNPSGTVRLQQLSASYKRTRSLSETLRPATQAMDSDSSSTN
                     KFVPEYRRTNFKNKGRFSADELRRRRDTQQVELRKAKRDEALAKRRNFAAPPDGADSE
                     DEDEAASTADQQFYQQLQQELPQMIQQINSTDLQEQLNATVKFRQILSREHRPPIDTV
                     IQSGVVPNLVNFMNENQPEMLQLEAAWALTNIASGSSDQTKVVVEAGAVPLFIQLLYS
                     GSIEVKEQAIWALGNVAGDSTGYRDYVLSCGAMQPILALFDLSKTSLIRTATWTLSNL
                     CRGKKPQPDWGVVSQSLPTLAKLIYSMDTETLVDACWAISYLSDGPANNIQAVIDARI
                     PKRLVELLNHQSTLVQTPALRAVGNIVTGNDLQTQVVINCGVLGALRNLLSSTKESIR
                     KEACWTISNITAGNTDQIQAAIDANLIPALVKLLETADYKTKKEACWAISNASSGGLQ
                     KPEIIRYLVSQGSIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLHINENA
                     DYIERAGGVDKIFNCQQNENEKIYEKAFNIIEQYFGEDEDALDESMAPQTAGNTFGFG
                     SNVNQQFNFN"
     gene            complement(<588958..>589548)
                     /locus_tag="KLTH0B07304g"
                     /db_xref="GeneID:8290945"
     mRNA            complement(<588958..>589548)
                     /locus_tag="KLTH0B07304g"
                     /product="KLTH0B07304p"
                     /transcript_id="XM_002552059.1"
                     /db_xref="GeneID:8290945"
     CDS             complement(588958..589548)
                     /locus_tag="KLTH0B07304g"
                     /note="similar to uniprot|P53872 Saccharomyces cerevisiae
                     YNL190W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B07304p"
                     /protein_id="XP_002552105.1"
                     /db_xref="GeneID:8290945"
                     /db_xref="UniProtKB/TrEMBL:C5DD06"
                     /translation="MKVTSLTVGTIAAVSAVASASRGQKQHGDGKTTTITTTTGTHKW
                     GKFNHTSRTHAPKETGTHKWGKFNHTSRTHAPKETGTHKWGKFNHTSRTHAPKETGTH
                     KWGKFNHTSRTHAPKETGTHKWGKFNHTSRTHAPKETGTHKWGRFNKTHNPTSTVIAK
                     NVAANAAAPAAGFDAAHKVLGMTVGSAALVGALMLL"
     gene            complement(<591369..>592292)
                     /locus_tag="KLTH0B07326g"
                     /db_xref="GeneID:8290946"
     mRNA            complement(<591369..>592292)
                     /locus_tag="KLTH0B07326g"
                     /product="KLTH0B07326p"
                     /transcript_id="XM_002552060.1"
                     /db_xref="GeneID:8290946"
     CDS             complement(591369..592292)
                     /locus_tag="KLTH0B07326g"
                     /note="weakly similar to uniprot|Q7LGR3 Saccharomyces
                     cerevisiae YDL218W"
                     /codon_start=1
                     /product="KLTH0B07326p"
                     /protein_id="XP_002552106.1"
                     /db_xref="GeneID:8290946"
                     /db_xref="GOA:C5DD07"
                     /db_xref="InterPro:IPR008253"
                     /db_xref="UniProtKB/TrEMBL:C5DD07"
                     /translation="MLISLRALQFISSVIALGLLAYVLKGYSYHGSHKTNFGLAVAAI
                     SVFYLMLLSLLGVLLHKLLLPGLYLLFEIIITILWLCAFVVLAKTHGSRACGLQTTST
                     YNPNYGSTSSFMSSGGRYDPYTSQYTTDSHMRPCRSAKASIAFAGLCTVLFMISTLII
                     GLNVIRPIMQRGGGQRAMWTPYHNAGYKLNPWTGLRLSETNRSDLEGTGPHHNDAEGG
                     AGVHDQHTYSTGDSTYNGTNREKLGETDHRRNASGATEMGQDATNTGNAGALPQENVN
                     TTYHRTERIVTDTSPHPITETNRAQQTQGRM"
     gene            complement(<593005..>594142)
                     /locus_tag="KLTH0B07348g"
                     /db_xref="GeneID:8290947"
     mRNA            complement(join(<593005..594050,594118..>594142))
                     /locus_tag="KLTH0B07348g"
                     /product="KLTH0B07348p"
                     /transcript_id="XM_002552061.1"
                     /db_xref="GeneID:8290947"
     CDS             complement(join(593005..594050,594118..594142))
                     /locus_tag="KLTH0B07348g"
                     /note="highly similar to uniprot|P53871 Saccharomyces
                     cerevisiae YNL191W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B07348p"
                     /protein_id="XP_002552107.1"
                     /db_xref="GeneID:8290947"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR026869"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DD08"
                     /translation="MCRFLIFKGKEPIRLSHLLTRPAHSIIKQSFDSRLRVDMRRPIN
                     GDGFGVAYYPLDQELSEDGPCLFKAITPAWNNQNLETLAEKTKSDLVFAHVRASTYGV
                     LSETNCHPFTYHNITFMHNGGIGNFTKIKRRLLAHIGDEYFNLIQGSTDSECAFALFL
                     DTLEKMGSNPSESTGHFGHTTLRNCMLRTIEIIKDWTKEANGNDPDAEPSILNFAVTD
                     GTDVVVSRYITSRKYQGASLHFSCGSSFVEYAPGEYRMERLDRNQDVVMVASEPLTFE
                     RGDWITVPTNTILTIKNQTVLLHPIIDEYFQENPLYARNSSLAERKGLMGAVPVSKPT
                     DKNVPPLEREGRSRPQTSRLVA"
     gene            complement(<594459..>594969)
                     /locus_tag="KLTH0B07370g"
                     /db_xref="GeneID:8290948"
     mRNA            complement(join(<594459..594846,594905..>594969))
                     /locus_tag="KLTH0B07370g"
                     /product="KLTH0B07370p"
                     /transcript_id="XM_002552062.1"
                     /db_xref="GeneID:8290948"
     CDS             complement(join(594459..594846,594905..594969))
                     /locus_tag="KLTH0B07370g"
                     /note="highly similar to uniprot|Q07648 Saccharomyces
                     cerevisiae YDL219W DTD1 D-Tyr-tRNA(Tyr) deacylase
                     functions in protein translation may affect nonsense
                     suppression via alteration of the protein synthesis
                     machinery ubiquitous among eukaryotes"
                     /codon_start=1
                     /product="KLTH0B07370p"
                     /protein_id="XP_002552108.1"
                     /db_xref="GeneID:8290948"
                     /db_xref="GOA:C5DD09"
                     /db_xref="InterPro:IPR003732"
                     /db_xref="InterPro:IPR023509"
                     /db_xref="UniProtKB/TrEMBL:C5DD09"
                     /translation="MRVVLQKVSKAAVTVDSEVVSAIKEGYMLLVGISVHDTIEDAEK
                     ISRKVLNLRIFEDENGAFWKKNVKEAGGQILSISQFTLQAVTKKGTKPDFHLAQKGPI
                     AKGLYDEFLGLLRKDMGDENVKDGVFGAMMSCELVNEGPVTIVLDTKE"
     gene            complement(<595129..>598293)
                     /locus_tag="KLTH0B07392g"
                     /db_xref="GeneID:8290949"
     mRNA            complement(<595129..>598293)
                     /locus_tag="KLTH0B07392g"
                     /product="KLTH0B07392p"
                     /transcript_id="XM_002552063.1"
                     /db_xref="GeneID:8290949"
     CDS             complement(595129..598293)
                     /locus_tag="KLTH0B07392g"
                     /note="similar to uniprot|P08004 Saccharomyces cerevisiae
                     YNL192W CHS1 Chitin synthase I requires activation from
                     zymogenic form in order to catalyze the transfer of
                     N-acetylglucosamine (GlcNAc) to chitin required for
                     repairing the chitin septum during cytokinesis
                     transcription activated by mating factor"
                     /codon_start=1
                     /product="KLTH0B07392p"
                     /protein_id="XP_002552109.1"
                     /db_xref="GeneID:8290949"
                     /db_xref="GOA:C5DD10"
                     /db_xref="InterPro:IPR004834"
                     /db_xref="InterPro:IPR004835"
                     /db_xref="InterPro:IPR013616"
                     /db_xref="InterPro:IPR029044"
                     /db_xref="UniProtKB/TrEMBL:C5DD10"
                     /translation="MSYRYNHGYGNDQTNNGENPFMSSRGERSDQSYEEDQREQEYKD
                     FVKQYPTTYQAQQTTPYNTSSGVFQGNSQQNSEPYPPHDGHQLPQSYNVPTINVYQAP
                     QTIPFAPNTVAPMTSMNHETSNDQIYHMDYEPRNSSANSSTGAEYYPQETQPILDHRR
                     PPPAPQPDFLSSNLNSSSVFYDYDPEDPVGFVDQNGDDYQINTFYNNENEMANPYSSA
                     FNLGDYADNVDSGDEYSNTNYDDRQERDLGEYSYDNDANTLAKIRSSTNLLEDGASGD
                     VLMNSAEKLGDNSSASSHNRPSRRLTTVRKFKLSMGNFIFDCPISEHLISQYVRAVDD
                     PEKLSNEFKFMRYQAVTCEPEMFQSNNFTLRQLKYGLPRQTELMIVITMYNEDDVLLA
                     RTLKGVMDNIRHFTKKTNSSTWGPDAWKKIVVCIVSDGRSKINERSLALMSALGCYQD
                     GFAKGEINDKKVIAHVYEHTSKVNIRGIRDGKVDLLCGENTVPIQLLFCLKENNQKKI
                     NSHRWALEAFAEVLQPTVINLLDAGTMPGKDSIYELWREFKDPQVGGACGEIKTDLGR
                     GYKKLLNPLVASQNFEYKLSNILDKTTESNFGFISVLPGAFSAYRFEAIRGEPLRKYF
                     LGDDLNARLFMTNMYLAEDRILCFEVVTKKDSNWTLKYSRSSYGSTDVPEKIPEFILQ
                     RRRWMNGAFFAALYSFLHFYKIWSSGHSFIRKLMLNLQFVYLFLSTLISWFSLSSFFL
                     VFRILTMSIAVSNNDQKVFRVLSVLFLWLYGVSILITFILSLGNKPKGTSKFYLSTFI
                     FFAILMVYMIFCSIFMSVHSIRNIIDNGNVTFVSLMKQETFRDLIVSMGSTYCLYLLS
                     SVIYLQPMHMLTSFVQYLLLSPSYINVLNIYAFCNVHDISWGTKGFVAKPLGKIHSKE
                     DGTVKLEIPVSAREIDANFNKHREILMSEAPEEGQEEVSFEEKKTNYYAMVRSLVIIL
                     WVISNFIIVAVVLETGGIGQYESLDKMQSSTSTETTVSILPQRSTVYFSVILWLVAFM
                     AAFRFIGCCLYVVQRFFRKLRFGK"
     gene            complement(<598488..>599999)
                     /locus_tag="KLTH0B07414g"
                     /db_xref="GeneID:8290950"
     mRNA            complement(<598488..>599999)
                     /locus_tag="KLTH0B07414g"
                     /product="KLTH0B07414p"
                     /transcript_id="XM_002552064.1"
                     /db_xref="GeneID:8290950"
     CDS             complement(598488..599999)
                     /locus_tag="KLTH0B07414g"
                     /note="similar to uniprot|P53870 Saccharomyces cerevisiae
                     YNL193W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B07414p"
                     /protein_id="XP_002552110.1"
                     /db_xref="GeneID:8290950"
                     /db_xref="UniProtKB/TrEMBL:C5DD11"
                     /translation="MRRNVSKKHVLTTEEDFYVDATSKEEQAERWALSDIKKTIGQYM
                     AAVNAYEQGLHAPDRTEIGSYHIYYNQTRLLLKLHTDFIACDGINILQYVNIRDLGDV
                     SPLFLPLDSIIDRFEFAITKFGDLCSWDLFFNLLTCYLSILEESQEELTGEVLLKIFE
                     RFVELAQNLIQLHLRELETWDVSFENKDDDFQSMDLSQQSFDSTTGKGIKEVHDTSTA
                     EYVEMQDEITHLTLVETLSVCFRFVSTLMEILGEAAHGKRATINPIQSNYLGDAALQF
                     TSQLKLFASEIDRSKVGNEIMELDLAMSLVQGLEIAISADYDSLQRFIEESGENLDKL
                     MICIDILRLCLTNQNSTFSQKWSFCSEIGRLLSRVESQLVQKRLDIMSGHLKGLENEL
                     SPTVFKLCDVMITRSDNELLRWTMKESESGSSSNQNASKTSEILLKNAGVLLKNATAI
                     AQKPCGFREYVSDKLKRNYIYKQAAERLEFINTGKITGVIEDLVSEHPFFAKR"
     gene            <600260..>603043
                     /locus_tag="KLTH0B07436g"
                     /db_xref="GeneID:8290951"
     mRNA            <600260..>603043
                     /locus_tag="KLTH0B07436g"
                     /product="KLTH0B07436p"
                     /transcript_id="XM_002552065.1"
                     /db_xref="GeneID:8290951"
     CDS             600260..603043
                     /locus_tag="KLTH0B07436g"
                     /note="some similarities with uniprot|P32797 Saccharomyces
                     cerevisiae YDL220C CDC13 Single stranded DNA- binding
                     protein found at TG1-3 telomere G-tails regulates telomere
                     replication through recruitment of specific sub- complexes
                     but the essential function is telomere capping"
                     /codon_start=1
                     /product="KLTH0B07436p"
                     /protein_id="XP_002552111.1"
                     /db_xref="GeneID:8290951"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="UniProtKB/TrEMBL:C5DD12"
                     /translation="MNSNLPSGLKYICDPLELKGFFSEGEVLRQDIEFVSVLTSIDFN
                     PKSRCLFQFSNFRPGESVSPDYTCKITCNNVETLNLTKLTLSLVSQQFDLDFPDLNDA
                     EGFYMKDIHLEKLCFVCCKGTFVTCDNKGGIFLQGLRIIDIHSSLFDPTKRDERSSIS
                     ETVRVIFDNLVKLNDNSKAQFKFVKLQNYDTAMRKYIQSRQESMLSLKEKNPLFGLLK
                     PRADHDSQNDFDSQLPDPDSNLDNAIFYGHRIPSESLDSQTPNLVSSEIIEEGQSPSV
                     AGAAGTPAALSGSNKPSSYQGSGSLSISQISPPRETEYVRLSRDFETSAIESNKRSAV
                     VTSDQEIRDDSSLDDDILEFSLSTHSVDKNELSQTSRGSQPTSKRQRIQMLGNISQKD
                     PNSYMFHASLDEPLIISGVVFGLRINDAASSPSIALYIHAGSLQNESVSANLYPYKNC
                     TEVLAYASDSIELNSKLFPAENSAEMLEALRWYVEDKKVELKVKKSSILLADGYFTFA
                     WTLVSVKTAGDAPKLSTSQTSHTPRSSQIVGSSQEASQDSLDPLKTFGEISISGNEVE
                     FIRTFALLVSAKTFGSKMHKFVFTDFTSHPKNKLSAFDSFLGSYTNRLPQDMAFPFVI
                     YNDHFREFTTRLQRHTGYNFNQLYSGNDNNLSNRGIVCRLSLKVKLYSGGIDGIIRRC
                     EPIVVTKRLPKDEERHITEFYDRAIREIPQIVLLNNFDSYKTFFPIAMFRGLVVLDTS
                     DAQNQHRTPPSSQPALGALQPLPQRPPPKLHIELEHFTVNRHMEIPVLYGLDATDSSH
                     LFELRAKVVAAIRTGELLAFYVTNDWISQDMLDPTRVLRVEIPGRSNMDYFFGTYASQ
                     ETRPDLAARDAQLGTMIGETFTFRLVTFAVPVSPSRFLRTWCPVECTIQELSYELAAR
                     RGQAAARVKLEDS"
     gene            <603685..>604638
                     /locus_tag="KLTH0B07480g"
                     /db_xref="GeneID:8290952"
     mRNA            <603685..>604638
                     /locus_tag="KLTH0B07480g"
                     /product="KLTH0B07480p"
                     /transcript_id="XM_002552066.1"
                     /db_xref="GeneID:8290952"
     CDS             603685..604638
                     /locus_tag="KLTH0B07480g"
                     /note="similar to uniprot|Q07651 Saccharomyces cerevisiae
                     YDL222C FMP45 The authentic non-tagged protein was
                     localized to the mitochondria cell cortex protein not
                     required for growth on nonfermentable carbon sources
                     required for viability in stationary phase"
                     /codon_start=1
                     /product="KLTH0B07480p"
                     /protein_id="XP_002552112.1"
                     /db_xref="GeneID:8290952"
                     /db_xref="InterPro:IPR009571"
                     /db_xref="UniProtKB/TrEMBL:C5DD13"
                     /translation="MDRKGFFNNSLSRLNSKSNLASNNQRSENMRFKQSVTFVFLVLL
                     LGAGLLSFLAILGGARNTGVLRNLYWLEANTSGFGNAPATTRWYNYEWCGYEGGSAQD
                     CSSRRPAQPFSPRDNFGASDAMPATFVNNRKTYYYLSRVAWAMLLVGLVFIVMAIVPL
                     LATVFAASTWVASLSTVWLWSALFFVTLAACLYTGCYVKARNAFADNGRRAKLGSKNF
                     AFIWTSVALLLICALWSTITTAVFGINKVRSNRRDSHGYDSYEGDKATTMDTYGDSDH
                     PASSPTKFKYFKRIRRYQAPAAPPATMATNYDEENIPAAPR"
     gene            <604448..>607777
                     /locus_tag="KLTH0B07502g"
                     /db_xref="GeneID:8290953"
     mRNA            join(<604448..604460,604791..>607777)
                     /locus_tag="KLTH0B07502g"
                     /product="KLTH0B07502p"
                     /transcript_id="XM_002552067.1"
                     /db_xref="GeneID:8290953"
     CDS             join(604448..604460,604791..607777)
                     /locus_tag="KLTH0B07502g"
                     /note="weakly similar to uniprot|Q07653 Saccharomyces
                     cerevisiae YDL223C HBT1"
                     /codon_start=1
                     /product="KLTH0B07502p"
                     /protein_id="XP_002552113.1"
                     /db_xref="GeneID:8290953"
                     /db_xref="UniProtKB/TrEMBL:C5DD14"
                     /translation="MVMIRNSHKDESSTTQDYESSRQNVSAQGNTSTTATRDTSSGSS
                     NNPFAPQRAVRGIKAFDVGSEHNSTTQEHSSQTQEYGSHQSQHSQRQAPVSSSSGGNG
                     QPSDDSSRGAQQPHFHRADAPVAGVPGVRNHQSGPSLEESSHSQGHGGFLSSTGHHER
                     HEQGSTHQAKSQEIYGHQSGAPSTSAQGNDDSLRGFQHTSGHQHGTEQAVLGTAPVSH
                     SKHTTGVTSGANLEQETGARNPQQGHTSNESAGHDTNRPSDNSYSKSTETRAPQTGPR
                     TTEKGTSFSTTLPIGALGQERSTSSPTNPTESSDQHKRGVFRLKSSKSGTETSGKESE
                     GRKNSEGRKNSLIQEAIGLKNKINEQRKHLGRKNSSGESGQKTSSTGTASGAPEPGIR
                     HTQDRDSSLSSSNREHKPSIPGSFTTEPESGGQSYGTQFSGTTAAAGESRTSGTADTS
                     RHQRQGLSEPQEISETEGRPHAHTQKQSLPAHYISANEVTGPGAQIIAAPSGGQKQQP
                     GNEQEQLLGSEQHRLLSSHQDRQTGGERGQHLASEHSQHLGSEHNRQLGSEHAQPTHH
                     HQNLGTEHNRSSGRDTSRGHEMGKVESGLTGIPERSHDVGADVPQGEGLNLSRDEKAG
                     YEEYNPSGKGSMDAEARRRSSLAESNDSYNERNRTKSRSMSLGTGPTAGVSKTQSDQS
                     NSPTSPTEGNKEPSTLTGTIKDAWDAVTGKRHTSESEPQQKQAKESTGKRSSDVENEG
                     FSSRQNENNTGIGGKPLTRSGGEYATGVGESHLTHERPEKPSSAMKGSRSTKPEGETH
                     GYSQRKNQGESANKHLGDLEGRKTKENRSSGSHHDDVDPKTRSSETSHPQMETRYERH
                     TTTSPSQSPQEGIQRYEEENVYAKEVVNMPSLVDPSQPTYGSGDRNRTSTSETTSYVT
                     HGSQGKRNVSVGSAGGHEQMTEPSQMPVEKNEHSYEERIPRSERERFDKLKEEHIENR
                     NKNEPHLQPAKAAASAAYPPKTQQGAT"
     gene            <608293..>608811
                     /locus_tag="KLTH0B07524g"
                     /db_xref="GeneID:8290954"
     mRNA            <608293..>608811
                     /locus_tag="KLTH0B07524g"
                     /product="KLTH0B07524p"
                     /transcript_id="XM_002552068.1"
                     /db_xref="GeneID:8290954"
     CDS             608293..608811
                     /locus_tag="KLTH0B07524g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B07524p"
                     /protein_id="XP_002552114.1"
                     /db_xref="GeneID:8290954"
                     /db_xref="UniProtKB/TrEMBL:C5DD15"
                     /translation="MHHNKDKSSEARFSYLQLAVGPIKGSAAKERQQGNLTSDGQKRE
                     EHNATEQASIRDGKQASGLEPNREGRRKVQAWGGSKSKKTRSQEFMFKEIRKDPADSS
                     ILVDPNSDKLESAQAQLQLLFDDLAGDREGSAARQQSTIAKMQTDFNKIQHCEIDPRE
                     LDSAPSYSSARY"
     gene            <609954..>611873
                     /locus_tag="KLTH0B07546g"
                     /db_xref="GeneID:8290955"
     mRNA            <609954..>611873
                     /locus_tag="KLTH0B07546g"
                     /product="KLTH0B07546p"
                     /transcript_id="XM_002552069.1"
                     /db_xref="GeneID:8290955"
     CDS             609954..611873
                     /locus_tag="KLTH0B07546g"
                     /note="some similarities with Saccharomyces cerevisiae
                     YDL224C WHI4 and to uniprot|P34761 Saccharomyces
                     cerevisiae YNL197C WHI3"
                     /codon_start=1
                     /product="KLTH0B07546p"
                     /protein_id="XP_002552115.1"
                     /db_xref="GeneID:8290955"
                     /db_xref="GOA:C5DD16"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/TrEMBL:C5DD16"
                     /translation="MSVVNSTSPLDNSGFSLHRGFSTSSENLGGIGTPGNSSPAHQGS
                     LGIAGSSSSNNSPLHLATMLNNLALTGSASQGNSSSSGQGPFLLRLKNVPQDITLREC
                     YAIFALAHGVNTVELARQPSDINNFDKICEVVARFDSLHLVSQYATILDSKPHIFGPA
                     FPYKPQVEVLDELTQQHIPFDKSLSPRHQLHTLPQPNLQHSQTLDQRQHPQPQPPSLQ
                     QRSQQQQPQQPQQQQQQQQQQQQQQQQQQQQQQQQPNAFQLPGSSNVVSPPQSASSAK
                     RPGLYGQRSRFSFSDSFNADSSQQSQGTNQDIASAPFKSQDVGKSFLLMENDEINESI
                     WGSNGGVPSSISGLATTSQPPTPSMEWGPPQRRQSSSFFSSVNTGTVPANELASMHIA
                     SAIPHQMGSALQQHPNLPYGLVGQGSTSTATTATDLTIAPNSQNQQPPQSQIISGTQQ
                     QQETQANNGTPKASAQRSSTSKSSQPNVNASQKTPSSTSISSSGGISQVDLSLLARVP
                     PPANPADQNPPCNTLYVGNLPPDATEHELRQLFSTQKGFRRLSFRNKNTNGNGHGPMC
                     FVEFEDVAHATRALAELYGRQLPRSGTSHNNKGGIRLSFSKNPLGVRGPNSRRSGNGG
                     SVSNGNYSYATAFSK"
     gene            complement(<612453..>614087)
                     /locus_tag="KLTH0B07568g"
                     /db_xref="GeneID:8290956"
     mRNA            complement(<612453..>614087)
                     /locus_tag="KLTH0B07568g"
                     /product="KLTH0B07568p"
                     /transcript_id="XM_002552070.1"
                     /db_xref="GeneID:8290956"
     CDS             complement(612453..614087)
                     /locus_tag="KLTH0B07568g"
                     /note="similar to uniprot|Q07657 Saccharomyces cerevisiae
                     YDL225W SHS1 Component of the septin ring of the
                     mother-bud neck that is required for cytokinesis septins
                     recruit proteins to the neck and can act as a barrier to
                     diffusion at the membrane and they comprise the 10nm
                     filaments seen with EM"
                     /codon_start=1
                     /product="KLTH0B07568p"
                     /protein_id="XP_002552116.1"
                     /db_xref="GeneID:8290956"
                     /db_xref="GOA:C5DD17"
                     /db_xref="InterPro:IPR000038"
                     /db_xref="InterPro:IPR016491"
                     /db_xref="InterPro:IPR025662"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DD17"
                     /translation="MYRRKKEHKRGINYSLMLVGDSGTGKTTFANNLLESPIFPHRFA
                     MDAPQLAFNPRVQIAKPTMVVSYNSKNGIPSHMAQFDASREHFEPGITITSTSVEIAT
                     GAEQPPSRSSMSSEASSSAQSNSHSQDKISFNLVKTHGLGENLDNTMCFDEITAFLEQ
                     QFDQVLAEETRVKRNPRFEDTRVHVTLYFIPPTGHGLREMDVEMIKRLSRYTNVLPII
                     SRADSFTPEELIKFKRQIMDDVERFHVPVYKFEVDPEEDDIETIEENQALAMMQPFAI
                     MCSDEKNENGEYVRLYPWGEMRVDDDSISDLRVLKNVLFGSHFQEFKDTTQNFLYENY
                     RAEKLSSVSEWDMDKEKGESSKRDSAAPSLSNFASLITTGQFKSTNSLAMPPQSETPT
                     TPDSKEISQGVSDSPALRQMSQSIRRGNEEIIQNIKNSPRTSTPGSPDKSKLRNISET
                     VPYVLKHERIIAKQQKLEELEAQSAKELQKRIQDLEKRAAELKLREKLLRQQHLNSSN
                     TSLNSRQSAQQSMAPQSKLKKEESVTDLASIVSGKA"
     gene            <615240..>616430
                     /locus_tag="KLTH0B07590g"
                     /db_xref="GeneID:8290957"
     mRNA            <615240..>616430
                     /locus_tag="KLTH0B07590g"
                     /product="KLTH0B07590p"
                     /transcript_id="XM_002552071.1"
                     /db_xref="GeneID:8290957"
     CDS             615240..616430
                     /locus_tag="KLTH0B07590g"
                     /note="weakly similar to uniprot|Q01722 Saccharomyces
                     cerevisiae YNL199C GCR2 Transcriptional activator of genes
                     involved in glycolysis functions and interacts with Gcr1p"
                     /codon_start=1
                     /product="KLTH0B07590p"
                     /protein_id="XP_002552117.1"
                     /db_xref="GeneID:8290957"
                     /db_xref="UniProtKB/TrEMBL:C5DD18"
                     /translation="MSYVRRDSSGSVTSAGIMHHQSKLDVFIIKAHRLLSNGAAINGD
                     DVSLVNTGSSSSSPQGGAGAAGGTGAGSAAASGASPQQDLALFQRLSQLYNATISTSL
                     LDDNSTSPKSAIELYQRFQQILKELELSYDVSPYGKYFRRLENGMWQIRDDSELVSDQ
                     LWQLVSVSISTVYDAKTGQMLNQTRRRVNSMATSSKNSPSEVIDHTLPQQLQKRLQKL
                     QQDNKHNYYTTPASPSLAVAPNSNGSGNANGGANGMANGMVNGTTNGIGIGIGTGAGA
                     VNRSSSSGSTPLGKRKYVGIGTPDEDAVEELLQLATKKPRTDLPTIDEDIPQQTLPSR
                     ALTSKEADLYDRLLREKDDRVKQLEADLESQRQETLWLRKMLLEDLACIRSMLHKKAS
                     PGRS"
     gene            <617509..>618234
                     /locus_tag="KLTH0B07612g"
                     /db_xref="GeneID:8290958"
     mRNA            <617509..>618234
                     /locus_tag="KLTH0B07612g"
                     /product="KLTH0B07612p"
                     /transcript_id="XM_002552072.1"
                     /db_xref="GeneID:8290958"
     CDS             617509..618234
                     /locus_tag="KLTH0B07612g"
                     /note="highly similar to uniprot|P40165 Saccharomyces
                     cerevisiae YNL200C"
                     /codon_start=1
                     /product="KLTH0B07612p"
                     /protein_id="XP_002552118.1"
                     /db_xref="GeneID:8290958"
                     /db_xref="GOA:C5DD19"
                     /db_xref="InterPro:IPR004443"
                     /db_xref="UniProtKB/TrEMBL:C5DD19"
                     /translation="MALRTISSQLAAQLDKELMGPEVGFTLEQLMELAGLSVAQAVVK
                     EFPYSETRKSQVLVIAGPGNNGGDGLVCARHLALSGFQPVVYYPKRTTKTPFYAQLVN
                     QLKFFKVPVLGAGDNWAQYLDHTKTLCVVDAIFGFSFKPPVREPFGSILQQLRHAQQN
                     LPIVSVDIPTGWDVDEGPADSDCIIPSVLVSLTVPKPCAAKIDTCETHHYVGGRFIPR
                     DFALKYGFEPFPYENLDQVLRLH"
     gene            <618664..>621033
                     /locus_tag="KLTH0B07634g"
                     /db_xref="GeneID:8290959"
     mRNA            <618664..>621033
                     /locus_tag="KLTH0B07634g"
                     /product="KLTH0B07634p"
                     /transcript_id="XM_002552073.1"
                     /db_xref="GeneID:8290959"
     CDS             618664..621033
                     /locus_tag="KLTH0B07634g"
                     /note="similar to uniprot|P40164 Saccharomyces cerevisiae
                     YNL201C PSY2 Nuclear protein of unknown function deletion
                     results in sensitivity to anticancer drugs oxaliplatin and
                     cisplatin but not mitomycin C deletion is synthetically
                     lethal with a chitin synthase (CHS1) null mutant"
                     /codon_start=1
                     /product="KLTH0B07634p"
                     /protein_id="XP_002552119.1"
                     /db_xref="GeneID:8290959"
                     /db_xref="InterPro:IPR006887"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DD20"
                     /translation="MNGVRQDELRETESKRVKVYILEQNEWKDTGTGFCIGKVDKEER
                     QAEQNAPPEDALAAYLVVNDEEAPEKTLLWSKLEGNIEYQRQEETLIVWKDLSGQDIA
                     LSFEESTGCDALCDFIIKIQKSSENNISLVAVRSNDDGMGSVHEIITGPVNLPCNDAE
                     QDEKQLMEALKILNENTAFEYLRSETMEFVLKSNYVATLIKLFEKAEAGHKLRELLLL
                     SNILKTLTLYNQRELLEQMVGDEYIMGVVGILEYDTEFPTSKANHREYLLHSGPHFKE
                     VVPLNSDDMKRIIKKTYRLQFFKDVVLVRFLDEHSFNIISDIILDLQTCIINFIQDET
                     FLPKLIALYTAASPDTPIETKRDGIRMLHQCVQITKNLEHSEKSRFFKALVRAGLFKI
                     FDFAFGQETDSGIRILATDMVISIIEHDILLINSVQNELINQPEGLDQEQQHSHKQPA
                     ENGNCTVSSDVSLLAILSKILLTDKSLGLKEQVVQALNTLLHPEGCMGMDPDYNDSGG
                     VDMMMNFNDARSNGMNEENLIDNMNFQMTDYFNNFYTQVAPQLFAPLITNSLSTPDDD
                     VLLIYLVKLINFVSTEHNRRLSREFIMENNILKNIAKLLDPQRMLQLRLTVVRCLKSI
                     VCLNDEFYHRYLISENLYAPVMDLLRENLHEDNLANSSILDFFKIVSSQCMQALELKA
                     SDKRNFIMLNKHLVKNYRDILLEVDYVPFTKDMIRMYDEGEGQLRESVTESTSMVYAK
                     EGKRTFSETLETTKVSTSEETTTFKKAMEKITSAPPQSFIKEDVLGTEF"
     gene            complement(<621077..>621979)
                     /locus_tag="KLTH0B07656g"
                     /db_xref="GeneID:8290960"
     mRNA            complement(<621077..>621979)
                     /locus_tag="KLTH0B07656g"
                     /product="KLTH0B07656p"
                     /transcript_id="XM_002552074.1"
                     /db_xref="GeneID:8290960"
     CDS             complement(621077..621979)
                     /locus_tag="KLTH0B07656g"
                     /note="highly similar to uniprot|P32573 Saccharomyces
                     cerevisiae YNL202W SPS19 late sporulation specific gene
                     which may function during spore wall formation peroxisomal
                     2 4-dienoyl-CoA reductase"
                     /codon_start=1
                     /product="KLTH0B07656p"
                     /protein_id="XP_002552120.1"
                     /db_xref="GeneID:8290960"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DD21"
                     /translation="MPNSLGDSFVKDGPWKADLFQGKVAFVTGGAGTICRVQTEALVL
                     LGCKAAIVGRNPEKTLEAAREISKLSPRRDSTENDSVGGDSVLAIHSVDVREIGQLEQ
                     AVARTVERFGRIDFVIAGAAGNFIAPFSQLSANAFKSVVSIDLLGSFNTAKACLAELK
                     KNKGAILFVSATFHYYGVPFQSHVGAAKAGVDALSNALAVELGVSGIRSNCIAPGVIE
                     GTEGVSRLTGNVSEEQIRSKIPLQRFGTTRDIAETTVYLFSDAAKYVTGTVHIVDGGM
                     WHLGTHFGRDLYPQNLLTEENAKL"
     gene            <622309..>623451
                     /locus_tag="KLTH0B07678g"
                     /db_xref="GeneID:8290961"
     mRNA            <622309..>623451
                     /locus_tag="KLTH0B07678g"
                     /product="KLTH0B07678p"
                     /transcript_id="XM_002552075.1"
                     /db_xref="GeneID:8290961"
     CDS             622309..623451
                     /locus_tag="KLTH0B07678g"
                     /note="similar to uniprot|P35197 Saccharomyces cerevisiae
                     YDL226C GCS1 ADP-ribosylation factor GTPase activating
                     protein"
                     /codon_start=1
                     /product="KLTH0B07678p"
                     /protein_id="XP_002552121.1"
                     /db_xref="GeneID:8290961"
                     /db_xref="GOA:C5DD22"
                     /db_xref="InterPro:IPR001164"
                     /db_xref="UniProtKB/TrEMBL:C5DD22"
                     /translation="MSGEWKVNPDNRRRLLQLQKIGSNKKCVDCEAPNPQWASPKFGI
                     FICLECAGIHRGLGVHISFVRSITMDQFKPEELERMEKGGNEPFSDYLASHGVDLKLP
                     PKVKYDNPIAADYKDKLTASVEGTEWQEPDRSDFDPASLSDTGSAVSGSNKGASIDAS
                     AAGSALGAGAALGPKASDGTPLGSRRGSPQIPDSQREKNEAYFAELGKKNQSKSDTLP
                     PSQGGKYQGFGNTPANPQKKDLNSSMATLSLGNLQKDPLGTFSKGWSLFSSAITKSME
                     EVNESMIKPGVQQIQSKELSEEAKRAAAQFGQKFQETSTYGYQAFSNFTKNLQEQYQQ
                     GPATDSQFTKLFDSISQEREQQVKDSATGASGAKAKKSEEDEWDEF"
     gene            <623851..>625155
                     /locus_tag="KLTH0B07700g"
                     /db_xref="GeneID:8290962"
     mRNA            <623851..>625155
                     /locus_tag="KLTH0B07700g"
                     /product="KLTH0B07700p"
                     /transcript_id="XM_002552076.1"
                     /db_xref="GeneID:8290962"
     CDS             623851..625155
                     /locus_tag="KLTH0B07700g"
                     /note="weakly similar to uniprot|P40161 Saccharomyces
                     cerevisiae YNL206C RTT106 Regulator of Ty1 Transposition -
                     same phenotype as RTT101 - RTT105 disruption causes
                     increase in Ty1 transposition. Isolated from the same
                     screen as the other named RTT genes."
                     /codon_start=1
                     /product="KLTH0B07700p"
                     /protein_id="XP_002552122.1"
                     /db_xref="GeneID:8290962"
                     /db_xref="InterPro:IPR013719"
                     /db_xref="UniProtKB/TrEMBL:C5DD23"
                     /translation="MATNFLDNIPQDLSKRIKTVCERDGSALKIFEDLYNYARQDPEL
                     RKKPKGEEFLSEVPQDAVIFQLKDVSVLTPFRKKLNLVISVSPVTGKPALSLSKDMIP
                     QLSITQLNTSVKFATFLPFPEKKNMAYLFIRYVPEGDPAANEYVLVTLNKDATVKQFQ
                     AAGLLNSESAEFSSCVEYIRKQAILVGFRISDPFSATSGAAPSFHVEAHRGTKEGTLY
                     FLPDHVLFGFKKPILLFSSQEIESITYSSITRLTFNVTLITKSGDKFEFSMIDQNEYT
                     LIDDYVKRKQVIDNSMSEENKAKSAHKDQNAAEHASLLEEAAQQLKGEGNVGDIPLES
                     DDEEADVDFEGDSNLSDGSDSGSGSDQEDQEDEEENSGSAAEEKTEETAVPENENRPQ
                     THDIALATGEEEEEEEEIAENEQGEEEEEQYEDEEDSGVEYD"
     gene            complement(<625231..>626517)
                     /locus_tag="KLTH0B07722g"
                     /db_xref="GeneID:8290963"
     mRNA            complement(<625231..>626517)
                     /locus_tag="KLTH0B07722g"
                     /product="KLTH0B07722p"
                     /transcript_id="XM_002552077.1"
                     /db_xref="GeneID:8290963"
     CDS             complement(625231..626517)
                     /locus_tag="KLTH0B07722g"
                     /note="similar to uniprot|P40160 Saccharomyces cerevisiae
                     YNL207W RIO2 Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0B07722p"
                     /protein_id="XP_002552123.1"
                     /db_xref="GeneID:8290963"
                     /db_xref="GOA:C5DD24"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR015285"
                     /db_xref="InterPro:IPR018934"
                     /db_xref="UniProtKB/TrEMBL:C5DD24"
                     /translation="MKLDISNMRYMTAEDFRVLQAVEQGSRNHEVVPTQMIHQISGMR
                     SQSGTNRSIGDLAKLKLVSRMRNIKYDGFRLTYNGFDYLGLRAMLSRDTIYSVGNVIG
                     VGKESDVYRVSAKDGSARVLKIHRLGRTSFTTVKNNRDYLKRNQSGSWMFLSRLAANK
                     EYQFMSLLHSKGFTVPEPFDNSRHMILMELIDGYPMRNMRLHKNLPKLYSDLMLFIVK
                     LANHGLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIR
                     RFFKKKLKFEPRVDESMLDVDGFGDGYKYPYPVFERDVKRCDNLDELVQASGFSKKHP
                     GDRRWEEAAEQMRKEVSEQDVVEGDPNDLLEAEESSEGYSEGYSDDEYYSSEEEEESE
                     EGEDSLEEENERIVEALSSGVANLKMDKLGNYVLED"
     gene            complement(<628224..>630065)
                     /locus_tag="KLTH0B07744g"
                     /db_xref="GeneID:8290964"
     mRNA            complement(<628224..>630065)
                     /locus_tag="KLTH0B07744g"
                     /product="KLTH0B07744p"
                     /transcript_id="XM_002552078.1"
                     /db_xref="GeneID:8290964"
     CDS             complement(628224..630065)
                     /locus_tag="KLTH0B07744g"
                     /note="highly similar to uniprot|P40150 Saccharomyces
                     cerevisiae YNL209W SSB2 Ribosome-associated molecular
                     chaperone heat shock protein of HSP70 family proposed to
                     be involved in the folding of newly synthesized
                     polypeptide chains homolog of SSB1"
                     /codon_start=1
                     /product="KLTH0B07744p"
                     /protein_id="XP_002552124.1"
                     /db_xref="GeneID:8290964"
                     /db_xref="GOA:C5DD25"
                     /db_xref="InterPro:IPR013126"
                     /db_xref="InterPro:IPR018181"
                     /db_xref="InterPro:IPR029047"
                     /db_xref="InterPro:IPR029048"
                     /db_xref="UniProtKB/TrEMBL:C5DD25"
                     /translation="MAEGVFAGAVGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFV
                     AFTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDVNDA
                     PMIEVEYLGETKTFSPQEISSMVLTKMKETAEAKIGKKVEKAVITVPAYFNDAQRQAT
                     KDAGAISGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGG
                     VYTVKSTSGNTHLGGQDFDTNMLDHFKAEFKKKTGLDISNDARALRRLRTAAERAKRT
                     LSSVTQTTIEVDSLFEGEDFETSITRARFEDINAALFKSTLEPVEQVLKDAKIAKSQI
                     DEVVLVGGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQGAILTGQSTSEDT
                     KDLLLLDVAPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGE
                     RVNCSENTLLGEFDLKGIPPLPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITIS
                     NAVGRLSSDEIEKMVNQAEEFKAADEAFAKKHEARQRLESYVSSVEQTVTDPVLSSKM
                     KRGAKSKIESALSDAMAALEIEDSSADDLRKAEVGLKRVVTKAMSTR"
     gene            complement(<630469..>631470)
                     /locus_tag="KLTH0B07766g"
                     /db_xref="GeneID:8290965"
     mRNA            complement(<630469..>631470)
                     /locus_tag="KLTH0B07766g"
                     /product="KLTH0B07766p"
                     /transcript_id="XM_002552079.1"
                     /db_xref="GeneID:8290965"
     CDS             complement(630469..631470)
                     /locus_tag="KLTH0B07766g"
                     /note="some similarities with uniprot|P16523 Saccharomyces
                     cerevisiae YNL210W MER1 Protein with RNA- binding motifs
                     required for meiosis-specific mRNA splicing required for
                     chromosome pairing and meiotic recombination"
                     /codon_start=1
                     /product="KLTH0B07766p"
                     /protein_id="XP_002552125.1"
                     /db_xref="GeneID:8290965"
                     /db_xref="GOA:C5DD26"
                     /db_xref="InterPro:IPR004087"
                     /db_xref="InterPro:IPR004088"
                     /db_xref="UniProtKB/TrEMBL:C5DD26"
                     /translation="MDVCLEPPTVHQDQEAWQSYSLDQGEVGDPSTPRTAGSRAAAKG
                     VLKGPVSRDSNEKEASQGTVSRLEQVFRGARDSVSVRVACTVRADAPRARFLVSRLRV
                     RSFLEALALAGGGRERRLTGTLTITADSYHSATVECPLDVELLTSVVGDAPVCMLLPR
                     ELVHVIRSGGLELRSQVRALSARAITLESIKSAPVFADLASLAAHSFYKCPHAPFCPI
                     PARATPRCISATLVAPAACSRAPSEITTHTVRLNKPEITFLIGRQGARIEQLRLQSRA
                     VIKILPIPARLSANQLANPACIEQCLSITGDIESVARAVCLVGALLETFRQAPRHVR"
     gene            complement(<631704..>632702)
                     /locus_tag="KLTH0B07788g"
                     /db_xref="GeneID:8290966"
     mRNA            complement(<631704..>632702)
                     /locus_tag="KLTH0B07788g"
                     /product="KLTH0B07788p"
                     /transcript_id="XM_002552080.1"
                     /db_xref="GeneID:8290966"
     CDS             complement(631704..632702)
                     /locus_tag="KLTH0B07788g"
                     /note="similar to uniprot|P25044 Saccharomyces cerevisiae
                     YDL230W PTP1 Phosphotyrosine-specific protein phosphatase
                     that dephosphorylates a broad range of substrates in vivo
                     including Fpr3p localized to the cytoplasm and the
                     mitochondria"
                     /codon_start=1
                     /product="KLTH0B07788p"
                     /protein_id="XP_002552126.1"
                     /db_xref="GeneID:8290966"
                     /db_xref="GOA:C5DD27"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR016130"
                     /db_xref="InterPro:IPR029021"
                     /db_xref="UniProtKB/TrEMBL:C5DD27"
                     /translation="MASETVPWYLKQSAQELVSKFRFIQHQEDLRLRDATLNPAKSRW
                     SLGSSVDESNDDRNRYVNIMPYERNRVKLRTQAGNDYINASYVKVQVPGQSVRPGHYI
                     ATQGPTQNSWPQFWQMCYQQCTGSDIVIAMVTPLVEGGRQKCFEYWPHDAAAPLKIPR
                     TQSSSCSASGPESSCTTFDVDLEVHFQCSERENDYTLSTLELAPADPAFPKKTVHHFY
                     FDRWRDMSKPDEIVPILKLSRHAHSLNSSENPMVVHCSAGVGRTGTFITLDHLFHDTL
                     DFTAAQPVQDYSHDLVEQIVLQLRTQRLKMVQMVDQFLFIYHAARYVFDLARTRDQ"
     gene            <632854..>636033
                     /locus_tag="KLTH0B07810g"
                     /db_xref="GeneID:8290967"
     mRNA            <632854..>636033
                     /locus_tag="KLTH0B07810g"
                     /product="KLTH0B07810p"
                     /transcript_id="XM_002552081.1"
                     /db_xref="GeneID:8290967"
     CDS             632854..636033
                     /locus_tag="KLTH0B07810g"
                     /note="similar to uniprot|Q07660 Saccharomyces cerevisiae
                     YDL231C BRE4 Zinc finger protein containing five
                     transmembrane domains null mutant exhibits strongly
                     fragmented vacuoles and sensitivity to brefeldin A a drug
                     which is known to affect intracellular transport"
                     /codon_start=1
                     /product="KLTH0B07810p"
                     /protein_id="XP_002552127.1"
                     /db_xref="GeneID:8290967"
                     /db_xref="InterPro:IPR018823"
                     /db_xref="InterPro:IPR023244"
                     /db_xref="UniProtKB/TrEMBL:C5DD28"
                     /translation="MVDSKVSKGSYKHKSFLSLKELGQSSKNKGPPSSRTSLSQLKLN
                     LLADGKHWEILEDYGLEELRDGFFDPIFTRHENVVPSEEDSDSAVSKTAGRLTVASWV
                     AHNLEGLKQSWQPMLKFWLAFFIAVCICLIHPSGSWLGHRFRYFMPVAVLIHHPARNI
                     GVQLEITLWSITGAAFGMGWSALAWYISVATRPTANHQGGILFASMFLAVFLSTWLRS
                     SKQRLLYFSLSYGIAICFLHTVDLVNAKSMLDWKLYWDFGIPYLFGLLISMVVCAAVF
                     PHSGQSEIISRFSTSINNIKQLLVTFLELDECGNTDRHHLLQKEIGTSIDFDVSEGMR
                     EFLNQLTITRISEESLLSFRNSITIAAAPLRSMPTDHKLLTKLELQDFYEAYQDKHKE
                     GQTVDKSHGDTHMPVSGNATPLPKSNNFVGLGGHTNSELFTSMLRSTFSSSLLSLLVE
                     MIALLETIESGLDNFANGKLFDNENLGIEEKLKSHISKLIRRIYNIDVCYKEFTKSNL
                     FCKELLSDSQAIDSFLFLRYLRQSAKNLIPVATCVVEMSANLRWRVELPHYPWRRALN
                     RLPHRCSIDQGAKSLLHYFETKSDVDDLFEQLYNSYTSRHKVSAEGPEKGKIRATVRA
                     IDHKDFSLHTTSHPLRYKLWLLSTEITSYESRWALKIAIVMTFFALPAWLPQSNRWYQ
                     EYQCWWAPLSFLLLSNRRHSGNWPSMGRRLASALLGIFWGWCSNQARHFGSPYVVATF
                     AGLLCAVLSFNFFANNHTKSSFTGLLCFVVIALEPYSKRSSLNTAFIWKNTWVTGVAL
                     LCGILLSIPINWILWSFTARHELRISISSLLAHISQSYQSVTDRYLYRDADDAPTELT
                     LKYSSIREVRLSQSLIAVKRLLQKAREEPNYIFEFKADLYEQLLDACEYLLEKMVEAR
                     LSGQHFEVWDQDSNSEISRALLSLRRDSVASVIFIFYMLSNCFLSKNRIPMYLPNVIM
                     SRKKLYDFISKFESNFASRSSTAVSNSESSDSEIKEHDTNPSSDDYEKSHWTQIHGMA
                     FARAFTDIAEVVQKLANLSREILGEEDCC"
     gene            <636698..>636958
                     /locus_tag="KLTH0B07832g"
                     /db_xref="GeneID:8290968"
     mRNA            <636698..>636958
                     /locus_tag="KLTH0B07832g"
                     /product="KLTH0B07832p"
                     /transcript_id="XM_002552082.1"
                     /db_xref="GeneID:8290968"
     CDS             636698..636958
                     /locus_tag="KLTH0B07832g"
                     /note="similar to uniprot|P53869 Saccharomyces cerevisiae
                     YNL211C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B07832p"
                     /protein_id="XP_002552128.1"
                     /db_xref="GeneID:8290968"
                     /db_xref="InterPro:IPR020301"
                     /db_xref="UniProtKB/TrEMBL:C5DD29"
                     /translation="MMRGSPRSIEEFLYRTLMNSEGFHRFVRRIYYKVNGLEEPMSGR
                     PAAHVEQVFRPTRLQKFKAYRILFWDEMRAVVGLNRRFNRHL"
     gene            complement(<637131..>639578)
                     /locus_tag="KLTH0B07854g"
                     /db_xref="GeneID:8290969"
     mRNA            complement(<637131..>639578)
                     /locus_tag="KLTH0B07854g"
                     /product="KLTH0B07854p"
                     /transcript_id="XM_002552083.1"
                     /db_xref="GeneID:8290969"
     CDS             complement(637131..639578)
                     /locus_tag="KLTH0B07854g"
                     /note="similar to uniprot|P40157 Saccharomyces cerevisiae
                     YNL212W VID27 Vacuole import and degradation"
                     /codon_start=1
                     /product="KLTH0B07854p"
                     /protein_id="XP_002552129.1"
                     /db_xref="GeneID:8290969"
                     /db_xref="InterPro:IPR013863"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="UniProtKB/TrEMBL:C5DD30"
                     /translation="MNIIKKIMDSGSKPELVSIPAGQFFLLRPESSPKSTLECLYNDA
                     TLAIRESGSHRFELVVRKEVDDTELTSGDGGEDFEDDGLSVLSGQSKKEEEWSFNLDK
                     SLHFRKSWSEQGEVAFVWRNTKGDAGEKFQFVVNSEIPLTDVGHFLHTVNVCEYEHKF
                     KKQPSTATRENLRQFEFSHRHDEEAISDEDGDENDENNEDSQLGSKMGLLDLGNSSSE
                     SDDGFDSQEFEDAKDNFGSPKHPKQSVKVPNPPSAKTLLREHAALLVYDPTQQQFSLQ
                     DPDCGVSILDHGKFEYWLQINGKVLELGVDLTPLVNPFFQEETLCFIFNYSYETITLS
                     YMLKFSDEATFSEFQQQWSKSLWEALNKQKWSAISEKEQRCISNANRDVDKELSLFLQ
                     DDDDSSSADSEESDENDEEEEEEEAEREIQSDVDSFDEDKKEEEYRSSTTLSGNKSLT
                     VSYKNDRSFVVRGDKIGVFKVDDENNEVNFVTAINNVSSLKGRNFEPENPMLYTEDRA
                     MIVQDKENPSLVFKMDLERGKVVEEWSAGGKDVLKYSHSKKFDQLTNEQTFLGVSGKS
                     VFRLDPRISGANKLVTEQNKDYATNNKFSSLGTTQEGFLAVGSEKGEIRLFDKIGLRA
                     KTLIPALGEPINHICNSADGKWLLATCDSSLLLIDLTIKEGKNAGSVGFVKSFSKEEM
                     PNIFVLKIHPKTAAYMRTSAKQPIKFTKAYFNTGLNQKEQTIVTSTGPFAITWSLKKV
                     LKGEKMSYRIKRYNSMVMEDNFRYGSDKNVILALKDNVKMAKKTGFKEPSKEMTRQNN
                     WNEFLELSEKAAKRRNQ"
     gene            <639886..>640557
                     /locus_tag="KLTH0B07876g"
                     /db_xref="GeneID:8290970"
     mRNA            <639886..>640557
                     /locus_tag="KLTH0B07876g"
                     /product="KLTH0B07876p"
                     /transcript_id="XM_002552084.1"
                     /db_xref="GeneID:8290970"
     CDS             639886..640557
                     /locus_tag="KLTH0B07876g"
                     /note="weakly similar to uniprot|P40156 Saccharomyces
                     cerevisiae YNL213C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B07876p"
                     /protein_id="XP_002552130.1"
                     /db_xref="GeneID:8290970"
                     /db_xref="GOA:C5DD31"
                     /db_xref="InterPro:IPR010487"
                     /translation="MKPVLQGALAWIYAGYKTASRGHLLPYTRHQKFHSSSLISEQAK
                     RAKDLIKLVNSSSLSNSESQSLDWRSDLKVPEWKRQKLALKDKFKGQQWNPKKKLSRE
                     QMENVRLLKRHFPETSATELSERFQVSPEVIRRILKSKWQPNEEEQLQLQTRWKRRSE
                     RVNEILGSPEHQKLPPKKLVLGSGRTDTDLQVKSVRRTAVKAGRNSSSPKGKQKLNLL
                     SKLIS"
     gene            complement(<640619..>641242)
                     /locus_tag="KLTH0B07898g"
                     /db_xref="GeneID:8290971"
     mRNA            complement(<640619..>641242)
                     /locus_tag="KLTH0B07898g"
                     /product="KLTH0B07898p"
                     /transcript_id="XM_002552085.1"
                     /db_xref="GeneID:8290971"
     CDS             complement(640619..641242)
                     /locus_tag="KLTH0B07898g"
                     /note="similar to uniprot|P40155 Saccharomyces cerevisiae
                     YNL214W PEX17 Peroxisomal membrane protein component of
                     the peroxisomal translocation machinery required for
                     peroxisome biogenesis binds Pex14p"
                     /codon_start=1
                     /product="KLTH0B07898p"
                     /protein_id="XP_002552131.1"
                     /db_xref="GeneID:8290971"
                     /db_xref="UniProtKB/TrEMBL:C5DD32"
                     /translation="MNHKGYSGIEWPSEATIRERAKKNNTVDFVQRVFYNAGVVVSLV
                     YVIIVSIIEPLLRSQFNQRLQLSADMLIRVRKFVSLLEQRLKSTSISAIGFNEKVDPE
                     SCVSTIERCTQTEELLESSGVEEKATEWTKIIARLRYAREMLSRANEGKNDNNASGRI
                     TPLKFQAQSLSAYISSLDTRDETFRNHKNSVQAIRDMKGWVINGRVR"
     gene            complement(<641583..>643160)
                     /locus_tag="KLTH0B07920g"
                     /db_xref="GeneID:8290972"
     mRNA            complement(<641583..>643160)
                     /locus_tag="KLTH0B07920g"
                     /product="KLTH0B07920p"
                     /transcript_id="XM_002552086.1"
                     /db_xref="GeneID:8290972"
     CDS             complement(641583..643160)
                     /locus_tag="KLTH0B07920g"
                     /note="weakly similar to uniprot|Q07684 Saccharomyces
                     cerevisiae YDL233W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B07920p"
                     /protein_id="XP_002552132.1"
                     /db_xref="GeneID:8290972"
                     /db_xref="InterPro:IPR029005"
                     /db_xref="UniProtKB/TrEMBL:C5DD33"
                     /translation="MNSQQPHQGSQHMYGYQAPLRKQVPNFTPGVNMGQMMMGPQVNA
                     HMGQQQPELGLHPTARQGHVQYSGAQISVPQPRKQQQQVQPQSQSNDLSNSTSAIPSP
                     FATSMPTPTGPASAPPMNMHVGAPVSGAAQMPGATRSAGPVSATASTANHISGPGLTP
                     ASPQVGAMPSNQFYPVASAYQPVSKRHIASNMIPYPIRKYLSNMAILRLHEIINLVNV
                     STDRVDDFGYWQRFTNDLFTPYGILRYSTQGGEETRQFEFTTPIIPLICNSLGSVGIV
                     RLEMIPQQLRAQVLSNGTIFFDCPRCTTTFYYPDGSYMTNFSQVKGIFDSNLKIEWVE
                     ISSYSFVPGIEWSSLERLISSEPVCHEIFKDLSNSRKKPESTEDPKNQEPARNQDPKV
                     PDNFSAITKLRSQFGVFHNISSFGIQESFMRALQVSDAISYLKNLKVYQKVHNLQSPL
                     TSLESFVASSQAEKASSMAPGAPFKYGNSSSPAATPSNPRPKVPNSSKPRPKKRRQSD
                     LSPLSTGDRGLQGFGQI"
     gene            complement(<643482..>644171)
                     /locus_tag="KLTH0B07942g"
                     /db_xref="GeneID:8290973"
     mRNA            complement(<643482..>644171)
                     /locus_tag="KLTH0B07942g"
                     /product="KLTH0B07942p"
                     /transcript_id="XM_002552087.1"
                     /db_xref="GeneID:8290973"
     CDS             complement(643482..644171)
                     /locus_tag="KLTH0B07942g"
                     /note="some similarities with uniprot|P40154 Saccharomyces
                     cerevisiae YNL215W IES2 Protein that associates with the
                     INO80 chromatin remodeling complex under low-salt
                     conditions"
                     /codon_start=1
                     /product="KLTH0B07942p"
                     /protein_id="XP_002552133.1"
                     /db_xref="GeneID:8290973"
                     /db_xref="GOA:C5DD34"
                     /db_xref="InterPro:IPR006880"
                     /db_xref="InterPro:IPR029523"
                     /db_xref="UniProtKB/TrEMBL:C5DD34"
                     /translation="MDSDLSSVGSEDEIYEETPEVAEEELIGSEPEDDEYQYTPDDYE
                     EDEETGQRSKSGSRSSRRAATNEPRASNRKRAPTDEFEEPGSSPAKRARRNGAIDLQN
                     LDDDDDDDDDTSSASQQKLNSRNKMISELMDNTSRRSSKLTDQELQLRRAENARKRKN
                     LSEKKLEEEKQDTINKLLRRRAGKSRAAMPAAQEQENDAANYVKPRRAYNAQGLVRTL
                     RKKDVDIYATY"
     gene            <644343..>646580
                     /locus_tag="KLTH0B07964g"
                     /db_xref="GeneID:8290974"
     mRNA            <644343..>646580
                     /locus_tag="KLTH0B07964g"
                     /product="KLTH0B07964p"
                     /transcript_id="XM_002552088.1"
                     /db_xref="GeneID:8290974"
     CDS             644343..646580
                     /locus_tag="KLTH0B07964g"
                     /note="similar to uniprot|P48365 Saccharomyces cerevisiae
                     YDL234C GYP7 GTPase-activating protein for yeast Rab
                     family members including: Ypt7p (most effective) Ypt1p
                     Ypt31p and Ypt32p (in vitro) involved in vesicle mediated
                     protein trafficking"
                     /codon_start=1
                     /product="KLTH0B07964p"
                     /protein_id="XP_002552134.1"
                     /db_xref="GeneID:8290974"
                     /db_xref="GOA:C5DD35"
                     /db_xref="InterPro:IPR000195"
                     /db_xref="UniProtKB/TrEMBL:C5DD35"
                     /translation="MSTELLFCKSKVYVHCSKKAEDNIAGFLLITRDAQQPSLEATLS
                     WIPERELSKLQLNELNRADGNTAKLAKIKKELILQAQYAAWAFCIKINSIYSIQFRAP
                     SPSGWWYGSIAINSKNSHDQGSIPILFFHDKECASTQAKQKALNKSFDPFSGTDVYWG
                     ASDFRDAIMQLVDFKQTLVDPTVWLVNATLDDLRNFSPQDKKVEAEASTKDSTSPKFW
                     DMLDQARWNVMSKFADFTSKSTNKVVNIWSQHPLVQFVDKHNNNPYVKKIMTNPKVQE
                     IQDDFDSARIYLAKWALGVKEQAEKYQTANGLDDTYRRLLFNELGSDGEDVKLTDEEL
                     NIAMQRSHPLTRQKWDSFFDSEGRLLMTVQEVKDYIFHGGVADMELRKDVWLFLLEVY
                     PWDSSLEERQVLTQTLRESYRANYKSKWEYRQPHSDEDEESYWHDQVLRVEKDVKRND
                     RDLSLYKYNTETGEAPASPQQDFDQGAEQVDSDVWTVKNPHLQSLRSILLSYNIYNND
                     LGYVQGMCDLLSPIYYILQDEELSFWAFVNFMRRMERNFLRDQSGIRDQMMALTDLCQ
                     LMLPKMSAHLAKCDSSNLFFCFRMLIVWFKREFEFEDVCSIWEVFLTDFYSSQFQLFF
                     MLAVLQKNSAPVMNNLDQFDQVLKFFNELKGTMDWSDLMIRSELLFVKFKKIMDTLER
                     RAELAEYTLLTSDGSVINESSAAASEQNALATQTSLITENLKQLMSKKIVIKREPARN
                     KHSIR"
     gene            complement(<646727..>648892)
                     /locus_tag="KLTH0B07986g"
                     /db_xref="GeneID:8290975"
     mRNA            complement(<646727..>648892)
                     /locus_tag="KLTH0B07986g"
                     /product="KLTH0B07986p"
                     /transcript_id="XM_002552089.1"
                     /db_xref="GeneID:8290975"
     CDS             complement(646727..648892)
                     /locus_tag="KLTH0B07986g"
                     /note="similar to uniprot|P11938 Saccharomyces cerevisiae
                     YNL216W RAP1 DNA-binding protein involved in either
                     activation or repression of transcription depending on
                     binding site context also binds telomere sequences and
                     plays a role in telomeric position effect (silencing) and
                     telomere structure"
                     /codon_start=1
                     /product="KLTH0B07986p"
                     /protein_id="XP_002552135.1"
                     /db_xref="GeneID:8290975"
                     /db_xref="GOA:C5DD36"
                     /db_xref="InterPro:IPR001005"
                     /db_xref="InterPro:IPR001357"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR015280"
                     /db_xref="InterPro:IPR017930"
                     /db_xref="InterPro:IPR021661"
                     /db_xref="UniProtKB/TrEMBL:C5DD36"
                     /translation="MSQQDDFETPSTNAFEDALEHQSQHYEDGKPDTRSDKDASGKDE
                     GAGSGGDDQQDIFQDLGFFIAHDESRQELEQLVSGHGGTVLSELPSGKSNKEFVVSTI
                     NASDLPTVTPTYIKTCCENNVLMKVQPFLVPYNEFRAVIDTQLQNESGEKPTAPADDA
                     SETAEQPVESPSTKPGEDKRPDADTPQPSETNGGPMASVTAESNAGSEDQGAGARRES
                     VDSAKNSISGDESDVVKTPVAPSPPSARQPAASHNKSSFTEEEDEFILDVVRKNPTRR
                     TTHTLFDEISHYVPKHTGNSIRHRYRVYLAKRLNFVYQVDSTGKLVRDDNGDLIKTTV
                     LPKSLKNKFTASEDYALSVEVKKQFYRDIYQMDPDTGESLIKDINAPDGNLKGSFGAG
                     SDERQNPGPSFKDFRVGERRGPVPREFFKKYADENPNHTENAWRDRFRKFLLTFGIDR
                     YIEYYENEIAQSRVPQAMKNMTNRPKRPGVPTPGNYNSFAKKVKTLSQQQQQQAAAII
                     AANGGAIDPAALAFAIPEGDFLDEETLNFISGLRRDLSKIESAGGAAFAYPQEIAESI
                     RNDFTNEEAQFDEIDPDKIPFPPALVTNELFMPQFFHFGSTREFLDKINEVISRDYEP
                     SQAEKLVQDLCDDVGVRKTFSTSILTALSGDLMVFPRYFLCMFHFGSNPPMNIPGIWT
                     REDDEMLRSGEESNIKKLTQKHGAGRIEMRKRFIASDLV"
     gene            complement(<649859..>650608)
                     /locus_tag="KLTH0B08008g"
                     /db_xref="GeneID:8290976"
     mRNA            complement(<649859..>650608)
                     /locus_tag="KLTH0B08008g"
                     /product="KLTH0B08008p"
                     /transcript_id="XM_002552090.1"
                     /db_xref="GeneID:8290976"
     CDS             complement(649859..650608)
                     /locus_tag="KLTH0B08008g"
                     /note="weakly similar to uniprot|P40152 Saccharomyces
                     cerevisiae YNL217W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B08008p"
                     /protein_id="XP_002552136.1"
                     /db_xref="GeneID:8290976"
                     /db_xref="GOA:C5DD37"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR029052"
                     /db_xref="UniProtKB/TrEMBL:C5DD37"
                     /translation="MFEEFAKLMAKVNAKDENTHVVLLGDFTSKGPQSRAVVDYMREH
                     QDSTHCILGNHEVNVMFAYLNHVGLEQRLSSGHARWRPLEFSSESYIPPRGQVNRMHR
                     DVARELGEERLDWVAKHCPAELAIEFGPQTLVAVHAGLDPDLSREDVPKVKDITTMKY
                     MLPEDHSKTSKFKFKHSRRWYKFWDGQHAPRNTTVFYGHDSSNGLTLRKRTKGLDSAC
                     VSGGQLSALEVVYRDGEYQEFLHQVECREMR"
     gene            <652379..>652795
                     /locus_tag="KLTH0B08030g"
                     /db_xref="GeneID:8290977"
     mRNA            <652379..>652795
                     /locus_tag="KLTH0B08030g"
                     /product="KLTH0B08030p"
                     /transcript_id="XM_002552091.1"
                     /db_xref="GeneID:8290977"
     CDS             652379..652795
                     /locus_tag="KLTH0B08030g"
                     /note="similar to uniprot|Q07688 Saccharomyces cerevisiae
                     YDL235C YPD1 Phosphorelay intermediate protein
                     phosphorylated by the plasma membrane sensor Sln1p in
                     response to osmotic stress and then in turn phosphorylates
                     the response regulators Ssk1p in the cytosol and Skn7p in
                     the nucleus"
                     /codon_start=1
                     /product="KLTH0B08030p"
                     /protein_id="XP_002552137.1"
                     /db_xref="GeneID:8290977"
                     /db_xref="GOA:C5DD38"
                     /db_xref="InterPro:IPR008207"
                     /db_xref="UniProtKB/TrEMBL:C5DD38"
                     /translation="MNTVPIPAGVINWNTLNEIVSMDEDSPDFSKNLIIQYLEQANTT
                     FDQIEQELQGNCDLEQLASLGHFLRGSSAALGLQRISWACERIQNLGRKREGGVEGQQ
                     LPDSHYAQLITNALQCARNEFKAAKAELSAFYKSEL"
     gene            complement(<652928..>654538)
                     /locus_tag="KLTH0B08052g"
                     /db_xref="GeneID:8290978"
     mRNA            complement(<652928..>654538)
                     /locus_tag="KLTH0B08052g"
                     /product="KLTH0B08052p"
                     /transcript_id="XM_002552092.1"
                     /db_xref="GeneID:8290978"
     CDS             complement(652928..654538)
                     /locus_tag="KLTH0B08052g"
                     /note="similar to uniprot|P40151 Saccharomyces cerevisiae
                     YNL218W MGS1 Protein with DNA-dependent ATPase and ssDNA
                     annealing activities involved in maintenance of genome
                     interacts functionally with DNA polymerase delta homolog
                     of human Werner helicase interacting protein (WHIP)"
                     /codon_start=1
                     /product="KLTH0B08052p"
                     /protein_id="XP_002552138.1"
                     /db_xref="GeneID:8290978"
                     /db_xref="GOA:C5DD39"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR021886"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DD39"
                     /translation="MNTSKSEQLISCPVCNLKVKYSAINSHLDKCTGDGKTSKKEPTL
                     SSFLKGKRKQASDEPEIIEVEEKVKKPKSQPSKGENADVRNLQKIAHQPLSEKLRPKE
                     LAEYVGQQHIISSEHGVLYKFVQQGIIPSMILWGPPGVGKTSLARLLTKAVNQSHANG
                     VTYTLIQTSATKATAQELRKIFENSRREFSLTKRITVVFIDEIHRFNKGQQDLLLPHV
                     EAGDIVLIGATTENPSFQLNNALMSRCQIFVLTKLSTDEMCLVLSRGIAMLNKCRHLI
                     WKVNHPLKLDRSVLEFVVDISMGDTRRALNLLEMIEVSTRDDAKELKEEDIREIINGN
                     STELRTYYDRQGENHYDTISAFHKSVRGSDENAALYYLARMLQGGEDPLYIARRMIRI
                     ASEDIGVLDNSLLPLAVAAHDAVMKVGLPEADLALAQCSVALARAPKSVQLYRAWKQV
                     NAKLRENQNSFASCGIPMHLRNAPTKLMAELGYARDYKYNPDFENGEVAQDYFPDEVI
                     AACDRQELKFMAGLHLGSQKDPEIAKQP"
     gene            complement(<654730..>655731)
                     /locus_tag="KLTH0B08074g"
                     /db_xref="GeneID:8290979"
     mRNA            complement(<654730..>655731)
                     /locus_tag="KLTH0B08074g"
                     /product="KLTH0B08074p"
                     /transcript_id="XM_002552093.1"
                     /db_xref="GeneID:8290979"
     CDS             complement(654730..655731)
                     /locus_tag="KLTH0B08074g"
                     /note="similar to uniprot|P19881 Saccharomyces cerevisiae
                     YDL236W PHO13 Alkaline phosphatase specific for
                     p-nitrophenyl phosphate involved in dephosphorylation of
                     histone II-A and casein"
                     /codon_start=1
                     /product="KLTH0B08074p"
                     /protein_id="XP_002552139.1"
                     /db_xref="GeneID:8290979"
                     /db_xref="GOA:C5DD40"
                     /db_xref="InterPro:IPR006349"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="InterPro:IPR023214"
                     /db_xref="InterPro:IPR023215"
                     /db_xref="UniProtKB/TrEMBL:C5DD40"
                     /translation="MKTKYLFQSADCTRYLQKRANTIKKMTQTNSPVKVNSKEVAQEL
                     LDQYDTFLFDCDGVLWLGSHLLPHINETLEMLLSRGKKLYFVTNNSTKSRAAYTKKFA
                     SYGIKVTEDQIFTSGYASALYVRDTLKLTPGKDKVWVFGEAGITEELKLMGIESLGCN
                     DPRLDEPFDISSSPFLKNGLDPDVKCVIAGLDTKINYHRLAVTLQYLQQPDVKFVATN
                     IDSTYPSKGHILPGAGSMIECVAFSSGREPAACGKPNPNMLNAIVSSKKIDRSKCCMV
                     GDRLNTDMRFGIEGKLGGTLLVLTGIETEEKALDSTGDHPLPKYYAEKLGDLYELTK"
     gene            <655912..>657567
                     /locus_tag="KLTH0B08096g"
                     /db_xref="GeneID:8290980"
     mRNA            <655912..>657567
                     /locus_tag="KLTH0B08096g"
                     /product="KLTH0B08096p"
                     /transcript_id="XM_002552094.1"
                     /db_xref="GeneID:8290980"
     CDS             655912..657567
                     /locus_tag="KLTH0B08096g"
                     /note="similar to uniprot|P53868 Saccharomyces cerevisiae
                     YNL219C ALG9 catalyzes the transfer of mannose from
                     Dol-P-Man to lipid-linked oligosaccharides
                     mannosyltransferase"
                     /codon_start=1
                     /product="KLTH0B08096p"
                     /protein_id="XP_002552140.1"
                     /db_xref="GeneID:8290980"
                     /db_xref="GOA:C5DD41"
                     /db_xref="InterPro:IPR005599"
                     /db_xref="UniProtKB/TrEMBL:C5DD41"
                     /translation="MNSNWTSVILFGAFVACRFYLQPTYSLISDCDETFNYWEPLNFL
                     LRGFGKQTWEYSPEYSIRSWAFLIPLYSVLNPSMRILEAFHLPMFNLFYIARFFLGLF
                     SLVMEWLFFEEIKSTLSTQTATFWLFFQVFNPGWFHASVELLPSSFAMISLLGSLKFT
                     LRYLSTGAQDAFVKALLFNFVGGILGWPFVMILSVPLVVHYIFSHRILNTLKAGISAA
                     SRLAVVTAVVFAVDSMFYGKFTPVAWNIVMYNVIGANEKSGPNIFGVEPWYYYIFSLL
                     LNIPLPVLLGSIVGLSNLRLWPVWGALATWLTVFLLQPHKEERFLYPIYGFVTLASSV
                     GFSSFWRKWSGSKLTRNTVFLILLCSTASQALLRMFALVQNYKAPLDVYSHLPEASGP
                     QTVCVGREWFHFPASMFLPDNYRLGFVPSGFDGLLPGDFKETDSILNSIRDKPVGMNN
                     QNLFDSSKLVVTEQCDYFVDFMLHSDNEKDAFDPTNLPQGWKKLYSALFVDAPESKFF
                     GRALLLPEGLTRLIPQQLQSRWSKIYQVKYLEYCIFERHREEV"
     gene            complement(<657626..>658930)
                     /locus_tag="KLTH0B08118g"
                     /db_xref="GeneID:8290981"
     mRNA            complement(<657626..>658930)
                     /locus_tag="KLTH0B08118g"
                     /product="KLTH0B08118p"
                     /transcript_id="XM_002552095.1"
                     /db_xref="GeneID:8290981"
     CDS             complement(657626..658930)
                     /locus_tag="KLTH0B08118g"
                     /note="highly similar to uniprot|P80210 Saccharomyces
                     cerevisiae YNL220W ADE12 Adenylosuccinate synthase
                     catalyzes the first committed step in the 'de novo'
                     biosynthesis of adenosine"
                     /codon_start=1
                     /product="KLTH0B08118p"
                     /protein_id="XP_002552141.1"
                     /db_xref="GeneID:8290981"
                     /db_xref="GOA:C5DD42"
                     /db_xref="InterPro:IPR001114"
                     /db_xref="InterPro:IPR018220"
                     /db_xref="InterPro:IPR027417"
                     /translation="MVNVVLGSQWGDEGKGKLVDLLVGKYDIVARAAGGNNAGHTIVV
                     KGVKYDFHMLPSGLVNPNCQNLIGNGVVMHVPSFFAELEQLEAKGLTDARERLFISSR
                     AHLVFDFHQRTDKLREAELSGASTDGKNIGTTGKGIGPTYATKASRSGLRVHHLVNDE
                     PGAWEEFETKYRRLVQTRQQRYGDFEYDADAELARYKKYREELKPFVVDSVVFMHNAI
                     RDNKKILVEGANALMLDIDFGTYPYVTSSNTGIGGVCTGLGLPPRVIDEVYGVVKAYT
                     TRVGEGPFPTEQLNESGEKLQNIGAEFGVTTGRKRRCGWLDLVVLKYSTLINGYTSLN
                     ITKLDVLDTFKEIPVGVSYTLRGKKLDLFPEDLNVLGKVDVEYVTLPGWEQDITKITE
                     YEDLPENAKKYLKFIEDFVGVPIEWVGTGPARESMVYKQVSK"
     gene            complement(<659691..>661397)
                     /locus_tag="KLTH0B08140g"
                     /db_xref="GeneID:8290982"
     mRNA            complement(<659691..>661397)
                     /locus_tag="KLTH0B08140g"
                     /product="KLTH0B08140p"
                     /transcript_id="XM_002552096.1"
                     /db_xref="GeneID:8290982"
     CDS             complement(659691..661397)
                     /locus_tag="KLTH0B08140g"
                     /note="similar to uniprot|P32837 Saccharomyces cerevisiae
                     YDL210W UGA4 Permease that serves as a gamma-
                     aminobutyrate (GABA) transport protein involved in the
                     utilization of GABA as a nitrogen source catalyzes the
                     transport of putrescine and delta-aminolevulinic acid
                     (ALA) localized to the vacuolar membrane"
                     /codon_start=1
                     /product="KLTH0B08140p"
                     /protein_id="XP_002552142.1"
                     /db_xref="GeneID:8290982"
                     /db_xref="GOA:C5DD43"
                     /db_xref="InterPro:IPR002293"
                     /db_xref="UniProtKB/TrEMBL:C5DD43"
                     /translation="MEKAQAVANSTDVSSSLEQAVGDIHQIGSLRTITSKRAGEVNFI
                     DAKRAHGDAELLAEIGYKQELNRHFSTVQVFGVAFSIMGLLPSIASVLAIGMPGGMVS
                     LVWGWFIAGIFILAVGCGMSELASAIPTSGGLYYYTYYYAPQKYKAFFSFVIGYSNSL
                     ALVSGLCSITYGLAEEILSIVVVSKDGDFTITNGKTYGVFVAGIAATTVVTSIATVAV
                     SKLQTVSILANVGLIVLFFIVLPIGVANTKGLDFNDGSFIFGKWLNETTWPDGWQFML
                     AGLQPAIWTIGAFDSCIHMSEEAKNATKAVPLGIISSISVCWILGFLICIVMAACMGP
                     DIDAILGSSFGSPLPQILYNALGKKWTIAIMTLIAACQFLMGCSILTAISRQIWAFAR
                     DDGLMFSKYIKVVNKKLSSPLRATWFGAVCALVIGLLCLIGGTASNALFSLGIGGNYL
                     AWMAPNLLRMTTGKDLFRPGAFYMGKTWSPIVNWTAIVFQIFILIMIMFPAESKGITP
                     DAMNYTVVICGGVWIGSMIYFFVYKKKAFNGPKSNLSDDEYVDAVGQDVIDQILSHQK
                     SG"
     gene            <661997..>664531
                     /locus_tag="KLTH0B08162g"
                     /db_xref="GeneID:8290983"
     mRNA            <661997..>664531
                     /locus_tag="KLTH0B08162g"
                     /product="KLTH0B08162p"
                     /transcript_id="XM_002552097.1"
                     /db_xref="GeneID:8290983"
     CDS             661997..664531
                     /locus_tag="KLTH0B08162g"
                     /note="similar to uniprot|P41812 Saccharomyces cerevisiae
                     YNL221C POP1 Subunit of both RNase MRP which cleaves
                     pre-rRNA and nuclear RNase P which cleaves tRNA precursors
                     to generate mature 5' ends binds to the RPR1 RNA subunit
                     in Rnase P"
                     /codon_start=1
                     /product="KLTH0B08162p"
                     /protein_id="XP_002552143.1"
                     /db_xref="GeneID:8290983"
                     /db_xref="GOA:C5DD44"
                     /db_xref="InterPro:IPR009723"
                     /db_xref="InterPro:IPR012590"
                     /db_xref="UniProtKB/TrEMBL:C5DD44"
                     /translation="MSGKKPRSQNQLYRRRKVQDARNIRTEALKSGAQASQELSESGG
                     MMRVPEFMASREFEVKQLQVAMHKSKSASSTRVFQSLPRKLRRRTASHNVKRIPKRLR
                     NRALREMQKSDQAVTRGTEKPSRQRRSGLTAKQLYKARMTVKLLRLAARSKSMKLALP
                     AQVTGSQTKLRQRIRALQKTLRAEAKPGTAQLRNNQMGSYDCTGIGKLAPRPVGRIKY
                     MKRQRVFTWLPTHVWNAKRSHMLKRWGYQMPWSPTQKCFKLTHRIGGNTAASDGALCC
                     DSSYMGTMIVASADTEALRLLAHQLTNKRATLPKYRVSGHWFEGLIYDENAEAVGPGE
                     ILWISSNKLLLRLHPAIYSRVFEQISLANSEKKFVIQDCRFSIGSITLSGGKSLNALS
                     QVLRSTTASKSYNQFKTVAYVTDTNVLPQRTVFAFEAIDPRHLSNPRALPKANINAND
                     VLKLQAEYPREEIAEVLEKLCNPDKREMSYKNQQTLKQLAYRRRMLLESTARTNAIPH
                     DSKEDPFIPIAIFKRPKQESWVVLLPWFWLLPLWYQLNRVSRVYHMGLRQLQQLSFEQ
                     RRLYFPDDYPFTQAGYDENSTFKRLSQEALWKRKPAGKRVNFDKISGIHTENPVRFPG
                     EIGDPFSCDWRLLQVLRNGIDFLRTRDQGPIRMYDPKRTSQFDELNMRKLMYVNDIID
                     LYSDVQDKKLTPSALPISIFTKSVKGANSGCPQYGNSPRMQIVTTPLQVAAVSCVLQE
                     QGHPKDFARVYAIPAQDMDYWLSIVNIKARSNGKRDHDTAQPTPGVQDLIGFVTSGTF
                     HLGDGRGACTAFIAAQEACKSPNEYVLIRNVGTNVYRVAKWEQIAL"
     gene            664746..665234
                     /gene="SNR19"
                     /locus_tag="KLTH0B08184r"
                     /db_xref="GeneID:8290984"
     ncRNA           664746..665234
                     /ncRNA_class="snRNA"
                     /gene="SNR19"
                     /locus_tag="KLTH0B08184r"
                     /product="U1 RNA"
                     /note="SNR19 (U1 RNA)"
                     /transcript_id="XR_002432177.1"
                     /db_xref="GeneID:8290984"
     gene            complement(<665390..>666679)
                     /locus_tag="KLTH0B08206g"
                     /db_xref="GeneID:8291089"
     mRNA            complement(<665390..>666679)
                     /locus_tag="KLTH0B08206g"
                     /product="KLTH0B08206p"
                     /transcript_id="XM_002552098.1"
                     /db_xref="GeneID:8291089"
     CDS             complement(665390..666679)
                     /locus_tag="KLTH0B08206g"
                     /note="similar to uniprot|Q6B312 Saccharomyces cerevisiae
                     YDL237W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B08206p"
                     /protein_id="XP_002552144.1"
                     /db_xref="GeneID:8291089"
                     /db_xref="GOA:C5DD45"
                     /db_xref="InterPro:IPR017946"
                     /translation="MKYLSYTITFVKNTHRSCQRINKSASFGMIGSLAIGFVLMIVSF
                     WAGTYVNVRGNPVMLDFSDGASSTRGDSNAHNNLGLTGANLLHFFKNRMSDTKDLTDA
                     RGVQVSRFYDEVVRYLTAENAGASTAEGTCFPEGSIVSKLTRNVNVVPKVHSHNDYWR
                     DLPLFEALCHGIPSVEADVWLVDNDTQLAVGHNEAFLDHAHRTLHSLYTGPLLTMLNE
                     VNCNLGDKDHKYGVFYSSPETTLNLYIDFKSPDSTQTYALLMDLYLKPLIDMGYLTYF
                     DMDEEKVVWNPVTVILTGDYPTDPTVLDGQEQKGYYNTTQRFVFLDAPMHKLDEHYSG
                     ISVVASASLQQLLGNCKDLSQEADRSLLRQGSLPTESVTCVAKQVQKAQSLGLKTRIW
                     GAPTWPESSKQKLWSQQIFDIGIDFLNTDDLEEVTHL"
     gene            <667368..>668792
                     /locus_tag="KLTH0B08228g"
                     /db_xref="GeneID:8290985"
     mRNA            <667368..>668792
                     /locus_tag="KLTH0B08228g"
                     /product="KLTH0B08228p"
                     /transcript_id="XM_002552099.1"
                     /db_xref="GeneID:8290985"
     CDS             667368..668792
                     /locus_tag="KLTH0B08228g"
                     /note="similar to uniprot|Q07729 Saccharomyces cerevisiae
                     YDL238C GUD1 Guanine deaminase a catabolic enzyme of the
                     guanine salvage pathway producing xanthine and ammonia
                     from guanine activity is low in exponentially- growing
                     cultures but expression is increased in post- diauxic and
                     stationary-phase cultures"
                     /codon_start=1
                     /product="KLTH0B08228p"
                     /protein_id="XP_002552145.1"
                     /db_xref="GeneID:8290985"
                     /db_xref="GOA:C5DD46"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR014311"
                     /db_xref="UniProtKB/TrEMBL:C5DD46"
                     /translation="MILKLTVYHGNFVDTPSLGDVRIRPQTTIGVGTDGKILFIKEKS
                     QDPLRDALDFDQTLQPSEVAVVKISGSQDGSFFFPGFVDTHVHASQYPNAGIFGSSTL
                     LDWLQTYTFPLEASLKDADTARAVYNRVLDRTLANGTTTASYYTTIDAASSNLMARIC
                     AEKGQRAFIGKVCMDQNSPDYYVELFKECKHSTRQVVDYIKKELKDEKIQPVLTPRFA
                     PSCSRELMSWLGQLAHEEDLNVQTHLSENLAELELVAELFPECENYSQVYDNHHLLTK
                     KTLLAHCVHLSDKEIELLKLRGCGVSHCPISNSSLASGECRVRLLLDNGINVGLGTDL
                     SGGYSSSILAVARQALLVSRHLAMKETDAKKQEHVNLSVEDVLFLASLGGAQALSLGS
                     VVGSFEVNKQFDAQLINLDPVSSNVDVFEWQRTSWNDSPKEGENQKLARNLLAKWLFT
                     GDDRNTARVWVAGRLVHSYPASAT"
     gene            complement(<668789..>669409)
                     /locus_tag="KLTH0B08250g"
                     /db_xref="GeneID:8290986"
     mRNA            complement(<668789..>669409)
                     /locus_tag="KLTH0B08250g"
                     /product="KLTH0B08250p"
                     /transcript_id="XM_002552100.1"
                     /db_xref="GeneID:8290986"
     CDS             complement(668789..669409)
                     /locus_tag="KLTH0B08250g"
                     /note="highly similar to uniprot|P53538 Saccharomyces
                     cerevisiae YNL222W SSU72 Transcription/RNA-processing
                     factor that associates with TFIIB and
                     cleavage/polyadenylation factor Pta1p exhibits intrinsic
                     phosphatase activity affects start site selection in vivo
                     Nuclear zinc-finger motif containing protein."
                     /codon_start=1
                     /product="KLTH0B08250p"
                     /protein_id="XP_002552146.1"
                     /db_xref="GeneID:8290986"
                     /db_xref="GOA:C5DD47"
                     /db_xref="InterPro:IPR006811"
                     /db_xref="UniProtKB/TrEMBL:C5DD47"
                     /translation="MSNEPTKSLKFCTVCASNNNRSMESHRVLREAGYDVSSYGTGSA
                     VRLPGLSEDKPNVYAFGTPYNDIYNDLRSQSVERYRSNGLLEMLDRNRKLKKAPEKWQ
                     EGFKVFDFVFTCEERCFDAVCEDLMNRGGQLNKIVHVININIRDDNENAKIGSKAILK
                     LADMLSQETVRCEKTGEPLEDCIISLLAQWQEMYPQLPLLYSPAYY"
     gene            complement(<669610..>671061)
                     /locus_tag="KLTH0B08272g"
                     /db_xref="GeneID:8290987"
     mRNA            complement(<669610..>671061)
                     /locus_tag="KLTH0B08272g"
                     /product="KLTH0B08272p"
                     /transcript_id="XM_002552101.1"
                     /db_xref="GeneID:8290987"
     CDS             complement(669610..671061)
                     /locus_tag="KLTH0B08272g"
                     /note="similar to uniprot|P53867 Saccharomyces cerevisiae
                     YNL223W ATG4 Cysteine protease required for autophagy
                     cleaves Atg8p to a form required for autophagosome and Cvt
                     vesicle generation mediates attachment of autophagosomes
                     to microtubules through interactions with Tub1p and Tub2p"
                     /codon_start=1
                     /product="KLTH0B08272p"
                     /protein_id="XP_002552147.1"
                     /db_xref="GeneID:8290987"
                     /db_xref="GOA:C5DD48"
                     /db_xref="InterPro:IPR005078"
                     /db_xref="UniProtKB/TrEMBL:C5DD48"
                     /translation="MFKFAKCQCFNHNTLFRQQEYSRATAMEFLQKVSQQLFEPENAD
                     QDNELVVLGRRYEANGSNERKPDEGEAVSTGVFSQLFHRERGWNPEFLLEVHSLLHFT
                     YRTKFEPIPKDPNGPSPMNFGTLFRDNPLNSFESAINHPDCFCSDIGWGCMIRTGQAL
                     LGNALARLRSPPEEKQLIGWFEDRSSAPFSLHNFVREGNALSRKPPGEWFGPSATSRS
                     IQSLVHAFPQCGLNHCIISTDSGDVYEEDVGPILEREPQATILLLLGVKLGLNNVNSR
                     YWPDVKHILGSSFSVGIAGGRPSSSLYFFGYQGDYLFYLDPHTSQLDLASCATDNEKY
                     ESVHSARFNKVHFSELDPSMLIGVLIQGLDDWDAWKSYIDRSQILHVLPHRPRDYFMD
                     EPDDSASENDGIPGSRDSQDSQGPAIDGDYVDVAPMVQHAGSCRDDEFQDVKCKNQKI
                     LVVGDHDSTTADTEIERVLVEHETVPLIASTRP"
     gene            <671104..>673350
                     /locus_tag="KLTH0B08294g"
                     /db_xref="GeneID:8290988"
     mRNA            <671104..>673350
                     /locus_tag="KLTH0B08294g"
                     /product="KLTH0B08294p"
                     /transcript_id="XM_002552102.1"
                     /db_xref="GeneID:8290988"
     CDS             671104..673350
                     /locus_tag="KLTH0B08294g"
                     /note="similar to uniprot|P53866 Saccharomyces cerevisiae
                     YNL224C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B08294p"
                     /protein_id="XP_002552148.1"
                     /db_xref="GeneID:8290988"
                     /db_xref="GOA:C5DD49"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:C5DD49"
                     /translation="MAKRHSHYKARGTGRGSRGRNSGGKPKGAAKKSHKRVNNANHTP
                     VGGGDLSNIDMMDDYYFGHNYRGDSMRMGGFRPGRQQEDDTRDGQRNLPLRKRPVEFI
                     KAKDVFDPSHDLILRLREANKKRQQQCSEESLGTQPSDSSELTTNTRDVSGTGSSKSV
                     EEDKTPGQGAEKLKNVGATRTISVEKLPDEELYFVDDEPSAPVEPIPVHIESEPTRRF
                     NEQQTKATEFEPVLTIGKTLLNLNEDNDGTVSVQLPKWKSHPFQPRESEESELSSEEA
                     VEVEWESEDESEDVPVVELESDFDDRSDFGSEYEVDDGAELASNSNSTRSRPSPLLSN
                     DIKSLSIEDSDRQIPGAVQNTLKEQTDAGPEFGFLEEDFAVNISEVNVTNIRIGAYDN
                     SYFLRSYRYFGDYEPRWVDQDDLVEFITELGLPDHRIDAYLQFVMSSIVPQKNEEDAL
                     EDRIAKEAALIASESESDSCSEQSLAAGFSSDEELGEDLDDLVAYTTKYETVRNQTFD
                     TKSLETTGRGLKKKLLFTEQMDLDQGIQDVLQDKFSTRKAKKASKKLAKQDYISEQNS
                     NSEDLFLKYPFGFHVQNFKDEFELFLQRNKPSMAFPPLDPHGNRTLMKFAEAYFIKGK
                     KAGKGGKTHVIVEKVKKTKWSFPNYNYINQLMAQRPVFMRIDVRKPREDRIPSEKFSG
                     KGKFQVKEGGIVGEDAPEIGTDNIGRRMLEKLGWSRGQGLGAHGNEGISEPIFAKIKK
                     NKSGLRHA"
     gene            <673602..>676454
                     /locus_tag="KLTH0B08316g"
                     /db_xref="GeneID:8290989"
     mRNA            <673602..>676454
                     /locus_tag="KLTH0B08316g"
                     /product="KLTH0B08316p"
                     /transcript_id="XM_002552103.1"
                     /db_xref="GeneID:8290989"
     CDS             673602..676454
                     /locus_tag="KLTH0B08316g"
                     /note="some similarities with uniprot|P25386 Saccharomyces
                     cerevisiae YDL058W USO1 involved intracellular protein
                     transport coiled-coil protein necessary for protein
                     transport from ER to Golgi Integrin analogue gene"
                     /codon_start=1
                     /product="KLTH0B08316p"
                     /protein_id="XP_002552149.1"
                     /db_xref="GeneID:8290989"
                     /db_xref="InterPro:IPR021750"
                     /db_xref="UniProtKB/TrEMBL:C5DD50"
                     /translation="MLGLGSGHIYSMANQSTVSNMSKDEKYDYEDEVSDENEDSGISL
                     TKVRAEQGFSLRSFIDQINAKTKALAIARELDAQRGVTHQDATMSAGSIDSATSASTE
                     TQRTQEISSHPTATVRRIPSGARASTAEPNLGSSTPMKEVSRSDNTHNQTINDLLVQS
                     TPINSSKSAPTSRNTQPRDLLKEKFMESHKAQNERSATGNADELQFENVRLREELEFY
                     KKAHDSQEENIQVLQETLQKQDQTAQALREKLQELQDQVEESAQALKVAQDDRRSEFE
                     GHQRVAEELAKCKGQIRLKEDEIVTVTENADKACQDLRTDNAGLHKKAIEIQSALTES
                     ELYVQQLKSKVDLMKKHNDDLSQTVHDKIEELNECNTRIDELYKENIAQENSLRSRVK
                     EYDSELSSLRNRNEELQKKLELQDHEFISKSSSYEARISSLKSANEDLEKGIELERTK
                     SSKEAHVLGDTVVTLRQQLADAEKENEKILVRFNMLEKQHLEAENLRDGLEETNQELK
                     SVVTRLEKISSDQLQTIGRLEEEVERKSKKEANSLSSVRKHSKQLEEKVRHLQDVIVA
                     KNSELEMQKQELNQFESYLKSVSLFQIQAGDLIVEQYRLNKYATQMDAAFKERNPDIL
                     GFFTQDQLQTTENSAVRLEALDNELHKLEESIKDEWTVKVQQLEEKLKNQELKESTIA
                     KQLAGNNIRIEELNSMVGTLSAEKRDLLHEKEKSMEMQQRLNDQVNSLKGELVDGEHK
                     AFISLSNRIESLGEERLDLQQNLQALESKIKSTETLLNEANALLNQERSEHATSQDEA
                     AQLRKDLARLKGKASRKITFQMASQSRPHLSRKTYDSLMVDAVNDMDMVELQNIIKNI
                     ILLLEIPLAKITKKMPLVGIYLRYEKNICLHFANKIHYLMFRETIDIKRYTNVAYGQY
                     LDHHDICHLDHPLESCLDNLYKEVSARLSLSPLTNG"
     STS             673648..674749
                     /locus_tag="KLTH0B08316g"
                     /standard_name="ha2448"
                     /db_xref="UniSTS:515550"
     gene            <676591..>678363
                     /locus_tag="KLTH0B08338g"
                     /db_xref="GeneID:8290990"
     mRNA            <676591..>678363
                     /locus_tag="KLTH0B08338g"
                     /product="KLTH0B08338p"
                     /transcript_id="XM_002552104.1"
                     /db_xref="GeneID:8290990"
     CDS             676591..678363
                     /locus_tag="KLTH0B08338g"
                     /note="similar to uniprot|P53863 Saccharomyces cerevisiae
                     YNL227C JJJ1 Protein that may function as a cochaperone as
                     suggested by the presence of a DnaJ-like domain"
                     /codon_start=1
                     /product="KLTH0B08338p"
                     /protein_id="XP_002552150.1"
                     /db_xref="GeneID:8290990"
                     /db_xref="GOA:C5DD51"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR007087"
                     /db_xref="InterPro:IPR015880"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="InterPro:IPR022755"
                     /db_xref="UniProtKB/TrEMBL:C5DD51"
                     /translation="MKTCYYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEAT
                     TVFATIRSAYEVLADPQERAWYDSHKQQILSDDFGAENGDDYDEYEVDAAVSGVTTDD
                     LLKFFNTGLYSRVDDTPAGFYQIAGKVFAKLASEEVRFGRMQGLPKFAKYQDDFFEAD
                     MGTQGYRKAFEKYSTQETLLFPPFGDSSAGFQYLRAFYRDWSSFNTVKTFSWKDEYMY
                     SRNYDRRTKREIKKRNEKLRQQARSEYNKTVKRFVVFIKKFDKRMKEGAAKFEQEKRK
                     KLQEDLRKQIEKDRLANSRDVGDPFKLQSWQTVDDLDWDEMEAYFDESKTADDAPEGS
                     EDEVLVYECFICNKTFKSPNQLENHNNTKSHKKMLRQIQREMHKDNMVLGLDAVSDVD
                     EFNSADEEFGSNAEDLQKMDELDMINAELERIQKELEEISDKGDDSLSPSDSEVPESA
                     TVGSKEGKSTLPDDQIDEEKHSFTVDDEVDSDFEISDGTKSPSASKQEEDVDELSKLL
                     ASLQGGAGEDTESDSWDNNKKPKKKQKGKNKATSSVQPSPPPTYQCGTCSDQFTTRNT
                     LFKHIKKSNHAAPVKATKAKKSKR"
     gene            <678693..>679772
                     /locus_tag="KLTH0B08360g"
                     /db_xref="GeneID:8290991"
     mRNA            <678693..>679772
                     /locus_tag="KLTH0B08360g"
                     /product="KLTH0B08360p"
                     /transcript_id="XM_002552105.1"
                     /db_xref="GeneID:8290991"
     CDS             678693..679772
                     /locus_tag="KLTH0B08360g"
                     /note="similar to uniprot|P23202 Saccharomyces cerevisiae
                     YNL229C URE2 Nitrogen catabolite repression regulator that
                     acts by inhibition of GLN3 transcription in good nitrogen
                     source altered form of Ure2p creates [URE3] prion"
                     /codon_start=1
                     /product="KLTH0B08360p"
                     /protein_id="XP_002552151.1"
                     /db_xref="GeneID:8290991"
                     /db_xref="GOA:C5DD52"
                     /db_xref="InterPro:IPR004045"
                     /db_xref="InterPro:IPR004046"
                     /db_xref="InterPro:IPR010987"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR017298"
                     /db_xref="UniProtKB/TrEMBL:C5DD52"
                     /translation="MVGEKQTSVGGSVSAAVSNLSSALRQVNLGNSNTTTDQSNINID
                     FHNRMNRQQLMGEAQRNNLNAQQAEELLRQQEAHQQQQLQQAQQQQQQQQQYVGPAQI
                     DSSRISKFFQNQPEEGYTIFSHRSAPNGFKVSIVLSELNLQYNTIFLDFNIGEHRAPD
                     FVAINPNARVPALIDHSMDNLAIWESGAIILHLVNRYYRETGEPLLWSENMGEQAHIT
                     AWLFFQTSGHAPMIGQALHFRYFHSQKIQSAVDRYTDEVRRVYGVVEMALAERREALI
                     MELDTENAAAYSAGTTPLSRSRFFDYPVWLVGDKITVADLSFVPWNNVVDRIGINIKL
                     EFPEVYKWTKHMMRRPAVIKALRGE"
     gene            <680750..>681883
                     /locus_tag="KLTH0B08382g"
                     /db_xref="GeneID:8290992"
     mRNA            <680750..>681883
                     /locus_tag="KLTH0B08382g"
                     /product="KLTH0B08382p"
                     /transcript_id="XM_002552106.1"
                     /db_xref="GeneID:8290992"
     CDS             680750..681883
                     /locus_tag="KLTH0B08382g"
                     /note="some similarities with uniprot|P53861 Saccharomyces
                     cerevisiae YNL230C ELA1 Elongin A F-box protein that forms
                     a heterodimer with Elc1p and participates in transcription
                     elongation"
                     /codon_start=1
                     /product="KLTH0B08382p"
                     /protein_id="XP_002552152.1"
                     /db_xref="GeneID:8290992"
                     /db_xref="GOA:C5DD53"
                     /db_xref="InterPro:IPR010684"
                     /db_xref="UniProtKB/TrEMBL:C5DD53"
                     /translation="MPISENEEEFTMEHKQTKIKSLSSLCEISLMRNHLMLQNVANVP
                     YRLVRNVLLKLKMEHLCKLEESNVLLIFEDEEAWVELLKKDFPMHVHDTYHRKRDEIV
                     AFYADFVEKHDPPKLRDEELMRGFLRFAVRKEPATHKYKVPSRMLYFKYQEDMLRKQE
                     LSTQRLRMRMQEMQQEKEKKQIVPLDDPVYCERRTKAAARAGAGERSGLFAKSYKEHQ
                     KRQLHFKSGGYDAKSRPVKRLAFGGQVGRPAPSPAAPAPCAAPAPPVAAPAPLPATMQ
                     DTSQPKRSTPAVAPSARRKPTPEQNLFLKRRRPLPKPKTPPTPRAEPSVKRKPTVVKV
                     NSTKIHRKNTKTSIFAAPSPQQQVLSQHSNTSSAYIFDQPRQG"
     gene            <682222..>683262
                     /locus_tag="KLTH0B08404g"
                     /db_xref="GeneID:8290993"
     mRNA            <682222..>683262
                     /locus_tag="KLTH0B08404g"
                     /product="KLTH0B08404p"
                     /transcript_id="XM_002552107.1"
                     /db_xref="GeneID:8290993"
     CDS             682222..683262
                     /locus_tag="KLTH0B08404g"
                     /note="highly similar to uniprot|P53860 Saccharomyces
                     cerevisiae YNL231C PDR16 Phosphatidylinositol transfer
                     protein (PITP) controlled by the multiple drug resistance
                     regulator Pdr1p localizes to lipid particles and
                     microsomes controls levels of various lipids may regulate
                     lipid synthesis homologous to Pdr17p"
                     /codon_start=1
                     /product="KLTH0B08404p"
                     /protein_id="XP_002552153.1"
                     /db_xref="GeneID:8290993"
                     /db_xref="InterPro:IPR001251"
                     /db_xref="InterPro:IPR011074"
                     /db_xref="UniProtKB/TrEMBL:C5DD54"
                     /translation="MFRRNKDKAKESTVDPSKLIKIETPIEKPPASVKPPAEKELDEG
                     QTKKYQEVLKHFSDPELRISTSEKEKDAELQPLSDLEKAWLTRECFKRYLRATKWDVK
                     ECIERIALSLAWRRQFGINNFGEENGDRLTSDAVAVEEETGKQVVLGFENDARPILYL
                     KPGRQNTKTSHRQVQHLVFMLERVIDFMPEGQDSLALLIDFKDHSDVPKVSGNSKIPP
                     IGVGKEVLHILQTHYPERLGKALLTNIPWLAWTFLKMIHPFIDPLTREKLVFDEPFPK
                     YVPEDQLDKLYGGYLDFTYKHDVYWPKLKEIAAKNRSHYLSRFEKFGSKVGLSESDLR
                     GNHEELLHPVEA"
     gene            complement(<683397..>684242)
                     /locus_tag="KLTH0B08426g"
                     /db_xref="GeneID:8290994"
     mRNA            complement(<683397..>684242)
                     /locus_tag="KLTH0B08426g"
                     /product="KLTH0B08426p"
                     /transcript_id="XM_002552108.1"
                     /db_xref="GeneID:8290994"
     CDS             complement(683397..684242)
                     /locus_tag="KLTH0B08426g"
                     /note="similar to uniprot|P53859 Saccharomyces cerevisiae
                     YNL232W CSL4 Subunit of the exosome which is an essential
                     complex present in both nucleus and cytoplasm that
                     mediates RNA processing and degradation"
                     /codon_start=1
                     /product="KLTH0B08426p"
                     /protein_id="XP_002552154.1"
                     /db_xref="GeneID:8290994"
                     /db_xref="GOA:C5DD55"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR019495"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="UniProtKB/TrEMBL:C5DD55"
                     /translation="MVYYAQSTHSAYPGQLICPVYELEKGTDSQQVIRYIAGAGVAEQ
                     DYELNGQKIIALAATVVGEVKFDEELKEMVPSGEVAESNENEEEETVSTEEERHFIVS
                     VTDKRQDGQAVTADFANNLPREGDIVLARVTRISQQRANVEILAVENKTTPVDSGVGS
                     NGAGIVAAGGGSGGATFSVSQASSDLGETFRGLISSRDVRATDRDKVKIIDSFRPGDI
                     VRAQVISLGDGSNYHLSTARNDLGVVFAKACNGAGGMMYAIDWKTMVAPSTGFTEARK
                     CAKPF"
     gene            complement(<684529..>687123)
                     /locus_tag="KLTH0B08448g"
                     /db_xref="GeneID:8290995"
     mRNA            complement(<684529..>687123)
                     /locus_tag="KLTH0B08448g"
                     /product="KLTH0B08448p"
                     /transcript_id="XM_002552109.1"
                     /db_xref="GeneID:8290995"
     CDS             complement(684529..687123)
                     /locus_tag="KLTH0B08448g"
                     /note="weakly similar to uniprot|P53858 Saccharomyces
                     cerevisiae YNL233W BNI4 Targeting subunit for Glc7p
                     protein phosphatase localized to the bud neck required for
                     localization of chitin synthase III to the bud neck via
                     interaction with the chitin synthase III regulatory
                     subunit Skt5p"
                     /codon_start=1
                     /product="KLTH0B08448p"
                     /protein_id="XP_002552155.1"
                     /db_xref="GeneID:8290995"
                     /db_xref="UniProtKB/TrEMBL:C5DD56"
                     /translation="MNQSLEEANNDGESYLNDTFYSSTSTDNLEHARTFRNSVLMQDM
                     SGEKPYNPEQEQIPSDPSDTQGKQYLKSNTNDANDRETETKTLTVTASPSLSALAGIL
                     NEKAIQAEKKMRSSMILDNSIQESIPEEEHSVHNSPVLIDIDGTSDGSYRLKFPPQMA
                     HLQNEIEQPDFLTTPRLDPPTPRVEPADSDLPNGGQQEKPQEQVSNVSSEREIETQNS
                     NSPKATAERADNSRPLPRKQASLRSFSGMSVGSFASNEQPLKESSSGKKRKSIFSFLK
                     KKPRKNSSLLSQDNSSSATLPTSATFSVSKSYHENDLPASTRLTKNSPSNGSIFSTFR
                     KNKASKKEAAAAADRTLHVPKQRATSGDSNSSNTGGASQQKRGVQTRKPTPLDFEHVS
                     QKAPSTQHNSPILTEPSTELQNTPQLVVKSPVPSENKVPDDVGESLLKADSGGVLFPK
                     SLSAHEVESIVSLERSRSVKSAKRNSLNSHRVSLTDNMSAKINNDGMFITEPSAPKLS
                     TPDLTKSPTSSILRNGTFDTLESSTQRGSYAEPNNLGISSAGLRAQDRDFSFTSIEQK
                     LNDITLDSESEDELAVNTKKASTSAGENFDTELMSDIMEFANIIDFGKDLDLNLDLSQ
                     EDINYKSLNPSDVKQSEKLPRDEMSADSFNFNSVAQVPLSSSGDRQSFSQHSYRSSIE
                     RNDTTNTDRTSFRRHSTLLSPPLNEDTRTEQMRNILSADDDDDEFEGEDFNELEEKLE
                     SQTIGSPTWQPPLDNRNRPISISFKGLRANQLNSSSNLSALRLSPSDYTVSNSHDLMS
                     ERKSVSFSSSIVLFSTYTEDEYDRHPEVATCNQLTPQLAQIIKEELNTLKAEMEVHEE
                     SRCYTHFF"
     gene            complement(<687524..>688819)
                     /locus_tag="KLTH0B08470g"
                     /db_xref="GeneID:8290996"
     mRNA            complement(<687524..>688819)
                     /locus_tag="KLTH0B08470g"
                     /product="KLTH0B08470p"
                     /transcript_id="XM_002552110.1"
                     /db_xref="GeneID:8290996"
     CDS             complement(687524..688819)
                     /locus_tag="KLTH0B08470g"
                     /note="some similarities with uniprot|P53857 Saccharomyces
                     cerevisiae YNL234W Similar to globins and has a functional
                     heme-binding domain involved in glucose signaling or
                     metabolism regulated by Rgt1p"
                     /codon_start=1
                     /product="KLTH0B08470p"
                     /protein_id="XP_002552156.1"
                     /db_xref="GeneID:8290996"
                     /db_xref="GOA:C5DD57"
                     /db_xref="InterPro:IPR000971"
                     /db_xref="InterPro:IPR009050"
                     /db_xref="InterPro:IPR012292"
                     /db_xref="UniProtKB/TrEMBL:C5DD57"
                     /translation="MEENRSFYSPLDRSQIAFIPADLESISENDPSVEPSPGLPRLSG
                     DSHIFKESFRDSYVPSVTSQSIFSEAHPPSSLSSVDELDRLSSLSSGSSCGTNMSYAA
                     RYKIVLKLTSREIKLIRESWSMMLNDELSGDNLRTFIRKIVHEIGGLPWVRASGRRTR
                     NNSQNTSLSANSSASSPGSGSPPSPKHASAIPTGNTGAFASSIFCQQFYGNLLYMAPS
                     IEAMFPSIRHQAVSFAGVLTMTVNNLDNLSALEAYLCALGKRHARILSIEPPHFELMG
                     LAFLKTIKERFGVHCTLELEETWSRLYSYLANSILQFGIDPVLKIDALKNEMIFPVLD
                     VTKGLPSTKSMFQPLQPSALNAHALATQKLRNNSRPENISPLTKPPISSKKSLPISTS
                     NRNISGSALPQQHKKEQQKPKPLGASALKRDSDKDCVIM"
     gene            <689075..>691468
                     /locus_tag="KLTH0B08492g"
                     /db_xref="GeneID:8290997"
     mRNA            <689075..>691468
                     /locus_tag="KLTH0B08492g"
                     /product="KLTH0B08492p"
                     /transcript_id="XM_002552111.1"
                     /db_xref="GeneID:8290997"
     CDS             689075..691468
                     /locus_tag="KLTH0B08492g"
                     /note="similar to uniprot|P38863 YHR172W Saccharomyces
                     cerevisiae SPC97 Component of the microtubule-nucleating
                     Tub4p (gamma-tubulin) complex"
                     /codon_start=1
                     /product="KLTH0B08492p"
                     /protein_id="XP_002552157.1"
                     /db_xref="GeneID:8290997"
                     /db_xref="GOA:C5DD58"
                     /db_xref="InterPro:IPR007259"
                     /db_xref="UniProtKB/TrEMBL:C5DD58"
                     /translation="MEVRRGVDDVCELESFPNSSFLSRLVNYQPLTHAHLKVKSYPLD
                     QIKSQRVQESLVVRDLLFVLVGLEGVYIRYNNSYEPQTGMEGDEIRGPDFKIAKSMDL
                     SLKNFAKWIVKLGKMFVVLTQFGERYSDPVYGAVLHRLCCEIRAFLVHEYMRCLVDVA
                     EEDFKTNAEFGIRELGQLLSKSCVYKMQLLYELVQDVSQEMARRALMDRDEADFQNFI
                     KDLKMEKETTDHSGLLFMTDSRISAHARGGAILQMVQDKLKANWGDQRNVEFLQGLLR
                     KISAQYCSMLEEWLTNGSLEDPYDEFMVADTARASQGQAQVAVTALNSERLWDTRYVI
                     RKDGLLEQFNEGDVAFKVLMTGKSLHLFRTCCELQDLKNLLPLGPSHGLQELPHGTQL
                     TLYVDAHYARANHLVWKLLYEGYNLPRVLQEMQHNFLMHNNPTFFRTFFCRSLVELTK
                     TRHETVQSKLRRLFEDYQKARCAERGSLVLPLMNLQLDRRSFSSTIEQFSSEAAADRG
                     NVDLLQARDFGNLRDMLLRDLELQDSSGAGGGPRADSQYSIHYLQFELLVPFPLNTVV
                     SKTCVMQYQMMQRHMLLLHYYNEILQNTWFEINKNKVWRHTGFGPDLARWIRRCRVVH
                     HRMSQFMKLLLEYTTQDVVHDGWRTLEPRVHAYDAAGFDLHQCQAQLEQFLANLVSHS
                     LLTSASLVRLLVQITDSVHKFCKFVTSLRKTLCLLDLRLYTRYEAQLRGEHYYDEAAA
                     LAKLREMQNYLAVVSDHFRQLSAAFAEGVRYYGDHGSSRFGVNPLLALAERLNDIVT"
     gene            <692293..>693606
                     /locus_tag="KLTH0B08514g"
                     /db_xref="GeneID:8290998"
     mRNA            <692293..>693606
                     /locus_tag="KLTH0B08514g"
                     /product="KLTH0B08514p"
                     /transcript_id="XM_002552112.1"
                     /db_xref="GeneID:8290998"
     CDS             692293..693606
                     /locus_tag="KLTH0B08514g"
                     /note="highly similar to uniprot|P00924 Saccharomyces
                     cerevisiae YGR254W ENO1 Enolase I and to uniprot|P00925
                     Saccharomyces cerevisiae YHR174W ENO2 Enolase II"
                     /codon_start=1
                     /product="KLTH0B08514p"
                     /protein_id="XP_002552158.1"
                     /db_xref="GeneID:8290998"
                     /db_xref="GOA:C5DD59"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="InterPro:IPR029017"
                     /db_xref="InterPro:IPR029065"
                     /db_xref="UniProtKB/TrEMBL:C5DD59"
                     /translation="MAISKVHARQVYDSRGNPTVEVELTTEKGTFRSIVPSGASTGAY
                     EAIELRDGDKSKWLGKGVLKAVDNVNSVIAPALVKANVDVKNQKAVDELLLSLDGTPN
                     KSKLGANAVLGVSMAAAKAAAAEKNVPLYKHLADLSNSKQDSYVLPVPFLNVLNGGSH
                     AGGALALQEFMIAPTGAESFSEAMRMGSEVYHNLKSLTKKRYGPSAGNVGDEGGVAPN
                     IQTAEEALDLIVDAIKAAGYEGKISIGLDSASSEFYKDGLYDLDFKNPDSDKSKWLTG
                     KQMAEMYASLVSKYPIVSIEDPFAEDDWEAWSHYYKTAGIQIVADDLTVTNPLRIKTA
                     IEKKAADALLLKVNQIGSLSESIEAAQDSFAAGWGVMVSHRSGETEDTFIADLVVGLR
                     TGQIKTGAPARSERLAKLNQLLRIEEELGSKAVFAGKKFHNGQNL"
     gene            <693870..>694322
                     /locus_tag="KLTH0B08536g"
                     /db_xref="GeneID:8290999"
     mRNA            <693870..>694322
                     /locus_tag="KLTH0B08536g"
                     /product="KLTH0B08536p"
                     /transcript_id="XM_002552113.1"
                     /db_xref="GeneID:8290999"
     CDS             693870..694322
                     /locus_tag="KLTH0B08536g"
                     /note="similar to uniprot|P38865 Saccharomyces cerevisiae
                     YHR175W CTR2"
                     /codon_start=1
                     /product="KLTH0B08536p"
                     /protein_id="XP_002552159.1"
                     /db_xref="GeneID:8290999"
                     /db_xref="GOA:C5DD60"
                     /db_xref="InterPro:IPR007274"
                     /db_xref="UniProtKB/TrEMBL:C5DD60"
                     /translation="MEHSMMDHGDMGHGDMGHDDMCSMNMLFTWNYKNTCVVFKWWHI
                     RTLPHLLLSMIVVAASAYLYEYMKYYSAKSTASRAAGAANLSHTKAAKMKSASWYGAQ
                     VGFSFMLMLVFMTFNGWLMLAVVAGAAWGHYSWGHLTEGLAHNSLACH"
     gene            <694496..>695806
                     /locus_tag="KLTH0B08558g"
                     /db_xref="GeneID:8291000"
     mRNA            <694496..>695806
                     /locus_tag="KLTH0B08558g"
                     /product="KLTH0B08558p"
                     /transcript_id="XM_002552114.1"
                     /db_xref="GeneID:8291000"
     CDS             694496..695806
                     /locus_tag="KLTH0B08558g"
                     /note="similar to uniprot|P38866 Saccharomyces cerevisiae
                     YHR176W FMO1 Flavin-containing monooxygenase localized to
                     the cytoplasmic face of the ER membrane catalyzes
                     oxidation of biological thiols to maintain the ER redox
                     buffer ratio for correct folding of disulfide- bonded
                     proteins"
                     /codon_start=1
                     /product="KLTH0B08558p"
                     /protein_id="XP_002552160.1"
                     /db_xref="GeneID:8291000"
                     /db_xref="GOA:C5DD61"
                     /db_xref="InterPro:IPR000960"
                     /db_xref="InterPro:IPR020946"
                     /db_xref="UniProtKB/TrEMBL:C5DD61"
                     /translation="MTRSVEKVAIIGAGPGGLAAARVFLANSNFDIVLYERSQNVGGV
                     WYYPPNAPHKDTAMYDELETNLCKEIMQFSGFPFPETAPTFPNRTHVEDYLQAYFHTF
                     IEPNSRVDVRLGCNVERLEKINGSWHIYAKHSLQAVDYVVVANGHFDVPYIPWHLPGL
                     EQWISQDPMSILHSKGFESCKFCRGKNVLVVGNGSSGSDITNQVSTTANHVFHSVTDI
                     SKTNWEANTAVTAVTTISELDYAHERSVRLQDGSILTHIDYIIWATGYMYDLPFLRSY
                     RPLILGADCDSKPARRLYNVWEQLAFTEDPTLAFSLLCKNVVPFPLAELQAAVMVKVF
                     KGELEVPPSGGQAALSGESPSDAANSSKNYHSLITPRDIEYCRELQALLDAHDSADDP
                     FQPVRWDERMAALRYQTGAMKQERTKLLVKNAKEFREQNQPYRL"
     gene            <697066..>698970
                     /locus_tag="KLTH0B08580g"
                     /db_xref="GeneID:8291001"
     mRNA            <697066..>698970
                     /locus_tag="KLTH0B08580g"
                     /product="KLTH0B08580p"
                     /transcript_id="XM_002552115.1"
                     /db_xref="GeneID:8291001"
     CDS             697066..698970
                     /locus_tag="KLTH0B08580g"
                     /note="similar to uniprot|P38699 Saccharomyces cerevisiae
                     YHR178W STB5 binds Sin3p in two-hybrid assay Zinc finger
                     (6-Cys)"
                     /codon_start=1
                     /product="KLTH0B08580p"
                     /protein_id="XP_002552161.1"
                     /db_xref="GeneID:8291001"
                     /db_xref="GOA:C5DD62"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DD62"
                     /translation="MEDGLSTEINDNGKRYESYSCSRCRKLKKRCSKESPVCVSCAKA
                     GETCTYPGRAPRRTKRELEMVRRKTSTSLQPGNKRSRSSESASRYETADEEYDSNDPG
                     RTYGLAESDAERESVNSSEPASILSMLTGINDASPPPQVHAQGVLEHELHKPDSIPIK
                     ASSIQIETVTAVFKGGRTTPMVEPNGSFKHIERPLYDRFIAAYFKHNHRSYPLLNKIE
                     FLNKVSTIRDFKEMDEKYDSTFIFELYMVMAIGCTTLQRAGILSKNEEHLSEHFAYIA
                     MKKFCTVMHQQNVNTITCLLLLGIYSFFEPQGVSSWTISGVIMRLTIGLGLHRALTAR
                     KMKSMTVVEVEMRYRAFWSFYSFERLVSTSLGRISAIDDDDISVPLPRALYAEEAEDI
                     EVTIMMISLRKMGGTIYKKVHSVGAGKQKLSSDEKQCIIDDLRHQLDTLYEREREKIR
                     VANSASFPSKASSCISFHTSDIWLAMRYAQLQIMLYRPSALIPKPPMESLSILGDFCL
                     QALKHTYTLYKKKLQPLNWITLFRTLTICNTMLYCLCQWSIDLIESKIEIQQCVEILQ
                     HFGEKWVFAAKCADVFQTISTAILDISLSNGQVPNMDKLTRELFGASNEYQDILDDNN
                     VDISWVDRLV"
     gene            699089..699160
                     /locus_tag="KLTH0B08602r"
                     /db_xref="GeneID:8291002"
     tRNA            699089..699160
                     /locus_tag="KLTH0B08602r"
                     /product="tRNA-Thr"
                     /note="tRNA-Thr (TGT) cove score=84.23"
                     /db_xref="GeneID:8291002"
     gene            <699412..>700092
                     /locus_tag="KLTH0B08624g"
                     /db_xref="GeneID:8291003"
     mRNA            <699412..>700092
                     /locus_tag="KLTH0B08624g"
                     /product="KLTH0B08624p"
                     /transcript_id="XM_002552116.1"
                     /db_xref="GeneID:8291003"
     CDS             699412..700092
                     /locus_tag="KLTH0B08624g"
                     /note="highly similar to uniprot|P38869 Saccharomyces
                     cerevisiae YHR181W SVP26 Component of Sed5p vesicles"
                     /codon_start=1
                     /product="KLTH0B08624p"
                     /protein_id="XP_002552162.1"
                     /db_xref="GeneID:8291003"
                     /db_xref="InterPro:IPR007277"
                     /db_xref="UniProtKB/TrEMBL:C5DD63"
                     /translation="MILQALSYAGTVLGFLFLTLSIASGLYYISELVEEHSEPTKRFL
                     TRAIYGIIILYVFLLILDSFPFKLSVFSIVSYLVYLQNLKHFPFISLKSPTLLASCVL
                     VALNHYFWFKHFNDTEVPPQFRYDPNYIPRRRASFTEVASFFGICVWFVPFALFVSLS
                     AGDNVLPTTTAGLAKKSDSADANSPRFRKKATGLVRVVIDSIRAYFYSAARVFGYDID
                     PNRGRLVV"
     gene            <700331..>702544
                     /locus_tag="KLTH0B08646g"
                     /db_xref="GeneID:8291004"
     mRNA            <700331..>702544
                     /locus_tag="KLTH0B08646g"
                     /product="KLTH0B08646p"
                     /transcript_id="XM_002552117.1"
                     /db_xref="GeneID:8291004"
     CDS             700331..702544
                     /locus_tag="KLTH0B08646g"
                     /note="weakly similar to uniprot|P38870 Saccharomyces
                     cerevisiae YHR182W Protein of unknown function green
                     fluorescent protein (GFP)-fusion protein localizes to the
                     cell periphery and cytoplasm"
                     /codon_start=1
                     /product="KLTH0B08646p"
                     /protein_id="XP_002552163.1"
                     /db_xref="GeneID:8291004"
                     /db_xref="GOA:C5DD64"
                     /db_xref="InterPro:IPR008936"
                     /db_xref="UniProtKB/TrEMBL:C5DD64"
                     /translation="MTTEASRATFWSEDYTSGIAVLLGNIDNDVSELQEFIEDVETFD
                     NKTVSPAIKSLDSLVRSIPSDTDESLCNKLKQQRKGLLAEILEKLQIANRSNLETACL
                     SQLQALLFEFEEYQQESKELIEKNYGLYSKHLSLAKRARVDVTTRAQRIREASQKPLL
                     RSEETPLSSEEERDYANESSIQFPLTLDAKLSFSSEESFFGFCNKLKKLTKTSKRLIY
                     IPGVSNEYFSSSALFESLKRIEPRMDASLYNLERLGQTLINNEIISPYNGILGAKVSF
                     ARDGYYVWGENSSPVIRPAEEKPLRRADVFNGLFKKIGRSSGSSEQIETTEELGLRQR
                     ELVDREDHFFQECQNLDYWRTQLELELQKCMNQYHKMLRHKIQILNKASLQFSSLLKE
                     ALSTQSSLTPVGADQEIRRIYRANYGIVGHYVPQPGVVFAKHNQLGELTGVAMFHADL
                     QEFPTNELGVAIILHILLEYLWGCDALEVLQAWQLPLDLRRVSRLRRECIVEFKETDG
                     SHSASLANILASKPRPLADVVGLLQSWLLELPDSLIPMICYEEISRTQSIEGMSMAPA
                     EHLVNLAAVCDHFRWLVQRCGGEKVRTAFDSRTDFPLYHVFARTRTRNPQEAPVVSGV
                     VHEILCKDESAERLREMAKNSNARTDARAEARADLQAGSSKHSSPPSTSRLATPAVFV
                     PRPLKAAHSDASSSRPSSKRISGLDLAVVGQSDSESETEPKESKEPSTLAAGVAD"
     gene            <703013..>704491
                     /locus_tag="KLTH0B08668g"
                     /db_xref="GeneID:8291005"
     mRNA            <703013..>704491
                     /locus_tag="KLTH0B08668g"
                     /product="KLTH0B08668p"
                     /transcript_id="XM_002552118.1"
                     /db_xref="GeneID:8291005"
     CDS             703013..704491
                     /locus_tag="KLTH0B08668g"
                     /note="highly similar to uniprot|P53319 Saccharomyces
                     cerevisiae YGR256W GND2 and to uniprot|P38720
                     Saccharomyces cerevisiae YHR183W GND1 6-phosphogluconate
                     dehydrogenase(decarboxylating)"
                     /codon_start=1
                     /product="KLTH0B08668p"
                     /protein_id="XP_002552164.1"
                     /db_xref="GeneID:8291005"
                     /db_xref="GOA:C5DD65"
                     /db_xref="InterPro:IPR006113"
                     /db_xref="InterPro:IPR006114"
                     /db_xref="InterPro:IPR006115"
                     /db_xref="InterPro:IPR006184"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR012284"
                     /db_xref="InterPro:IPR013328"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="UniProtKB/TrEMBL:C5DD65"
                     /translation="MAQPKGDMGLIGLAVMGQNLILNAADHGYTVVAFNRTVSKVDHF
                     MENEAKGKSIIGAHSIQELVDNLKRPRRIVLLVKAGAAVDAFIEQLLPYLEKGDIIID
                     GGNSHYPDTNRRYEELKGKGIYFVGSGVSGGEEGARYGPSLMPGGAEEAWPHIKEIFQ
                     AISAKSDGEPCCDWVGPAGAGHYVKMVHNGIEYGDMQLITEAYDIMKRVGGFSDKEIG
                     DVFAKWNTGVLDSFLVEITRDILRYDDKDGTPLVEKIMDSAGQKGTGKWTAINALDLG
                     MPVTLIGEAVFARCLSSLKSERIRAASILPGPEVSKDAIKDKQQFVDDLEQALYASKI
                     ISYAQGFMLIREAGKTYNWKLNNPAIALMWRGGCIIRSVFLAEITKAYRENPELENLL
                     FNKFFTDAITKAQSGWRKTIALASTQGIPTPAFSTALSFYDGYRSERLPANLLQAQRD
                     YFGAHTFRVLPECASEDLPEGQDIHVNWTGRGGNISASTYQA"
     gene            <704855..>706639
                     /locus_tag="KLTH0B08690g"
                     /db_xref="GeneID:8291006"
     mRNA            <704855..>706639
                     /locus_tag="KLTH0B08690g"
                     /product="KLTH0B08690p"
                     /transcript_id="XM_002552119.1"
                     /db_xref="GeneID:8291006"
     CDS             704855..706639
                     /locus_tag="KLTH0B08690g"
                     /note="weakly similar to uniprot|P38871 Saccharomyces
                     cerevisiae YHR184W SSP1 Protein involved in the control of
                     meiotic nuclear division and spore formation"
                     /codon_start=1
                     /product="KLTH0B08690p"
                     /protein_id="XP_002552165.1"
                     /db_xref="GeneID:8291006"
                     /db_xref="UniProtKB/TrEMBL:C5DD66"
                     /translation="MSDYYREQEQIYSKPPYLEDSSVMHSNYEMPNNERAYSRGRGFL
                     ADSHSFFDRVKSKLSMFRGYDSQEYLADQDSAAERQSQLWNAIKRKPIQLIVEDSMEK
                     SQVAEPQQFDQAPESANTFLTDNQNDNYVRSTASPKRKDLASGVPLSGSPFASGGISD
                     FIGLERDAILSKNSTSWEKVTAKSPLRSATTLGTIQKRLLQISSKKNEVSKGYQKLLK
                     ELNEWWQETIEAEENMSLISDLQQMFHEDLVFEQRLSDKLKEVSKALEFTKMREEEML
                     QERKELQHTIKKYGQMRAKKGNHSEEAHFLKEKVITKQNSLSVITGHYQQSLSTTARE
                     LFVNASVEYFEAASDIKDTSKTFFQNSVEYLRTVRADNIEQHIEDLRRKRADKHWSKL
                     NAQERDDPNRLVEIMSGMYNGQDSLMRCVERRGHMKAPEKSPANCKENQPRFDSQPDL
                     KLEFKTGLDESLSVFPSESAQKKDLKQTSTRSSELTEGYSKTNANGFSFDSHRTLRCE
                     GLAGKGPSLKTRLPYPETNETIRAPNLKLNFDNNNIRLKNLSPNAATNSEDGTLIKFP
                     PHGENVSRFAYEPEQDLDRNKWAESPRT"
     gene            complement(<706712..>707746)
                     /locus_tag="KLTH0B08712g"
                     /db_xref="GeneID:8291007"
     mRNA            complement(<706712..>707746)
                     /locus_tag="KLTH0B08712g"
                     /product="KLTH0B08712p"
                     /transcript_id="XM_002552120.1"
                     /db_xref="GeneID:8291007"
     CDS             complement(706712..707746)
                     /locus_tag="KLTH0B08712g"
                     /note="similar to uniprot|P53320 Saccharomyces cerevisiae
                     YGR257C MTM1 Mitochondrial protein of the mitochondrial
                     carrier family involved in activating mitochondrial Sod2p
                     probably by facilitating insertion of an essential
                     manganese cofactor"
                     /codon_start=1
                     /product="KLTH0B08712p"
                     /protein_id="XP_002552166.1"
                     /db_xref="GeneID:8291007"
                     /db_xref="GOA:C5DD67"
                     /db_xref="InterPro:IPR018108"
                     /db_xref="InterPro:IPR023395"
                     /db_xref="UniProtKB/TrEMBL:C5DD67"
                     /translation="MSNEKKEGIGLKERLLSAVAGSLLTSLILTPMDVVRIRLQQQKM
                     LPSCDCDANGKLSLKTTAPKGVFWQDACFADVHCQTSSVNYNSTWDAFTKIARIEGAR
                     SLWRGLSITLVMAVPANMVYFIGYESLRDNSFLQNKYSRLNPLLCGAIARVLAATTVA
                     PLELFRTRLQSIPRSSPNSTAAMMVKDLIKESRYEISRVGYKALFRGLEITLWRDVPF
                     SSIYWGCYEFYKSNISIKSERSIVNSSNTNWNHFVNSFVGGSFGGAVAAILTHPFDVG
                     KTRMQISFLNNTPGKSPSKNMFKYLNQIRKSEGLGALYTGLVPRVIKIAPSCAIMIST
                     YEVCKRLFST"
     gene            complement(<707994..>708773)
                     /locus_tag="KLTH0B08734g"
                     /db_xref="GeneID:8291008"
     mRNA            complement(<707994..>708773)
                     /locus_tag="KLTH0B08734g"
                     /product="KLTH0B08734p"
                     /transcript_id="XM_002552121.1"
                     /db_xref="GeneID:8291008"
     CDS             complement(707994..708773)
                     /locus_tag="KLTH0B08734g"
                     /note="weakly similar to uniprot|P38872 Saccharomyces
                     cerevisiae YHR185C PFS1 Sporulation protein required for
                     prospore membrane formation at selected spindle poles
                     ensures functionality of all four spindle pole bodies of a
                     cell during meiosis II not required for meiotic
                     recombination or meiotic chromosome segregation"
                     /codon_start=1
                     /product="KLTH0B08734p"
                     /protein_id="XP_002552167.1"
                     /db_xref="GeneID:8291008"
                     /db_xref="UniProtKB/TrEMBL:C5DD68"
                     /translation="MKAQKSHQQSSRVLAANGSIANIERTGHFPSAKPVCERSPKRRE
                     SFKVTKSKRLEPGELYSPHADASDKTTGFMSSPVGNIPDSSAVRRVGYANRAYAPGDS
                     PFAQYALMNYCNSNSHLNTSIYANPNISSLTGVDHVEQDVNNIFDDFEHFSFQTFPSY
                     FNPREASNMPHQEKVNKWIESVPTFNVSGELWESECYSVNTDLDWEEKEFDRGLVCHE
                     SLPFSLATADEILHLQAKRLDTLVRRNYELTPEVPLTPRAF"
     gene            complement(<708976..>712047)
                     /locus_tag="KLTH0B08756g"
                     /db_xref="GeneID:8291009"
     mRNA            complement(<708976..>712047)
                     /locus_tag="KLTH0B08756g"
                     /product="KLTH0B08756p"
                     /transcript_id="XM_002552122.1"
                     /db_xref="GeneID:8291009"
     CDS             complement(708976..712047)
                     /locus_tag="KLTH0B08756g"
                     /note="similar to uniprot|P07276 Saccharomyces cerevisiae
                     YGR258C RAD2 Single-stranded DNA endonuclease cleaves
                     single-stranded DNA during nucleotide excision repair to
                     excise damaged DNA subunit of Nucleotide Excision Repair
                     Factor 3 (NEF3) homolog of human XPG protein"
                     /codon_start=1
                     /product="KLTH0B08756p"
                     /protein_id="XP_002552168.1"
                     /db_xref="GeneID:8291009"
                     /db_xref="GOA:C5DD69"
                     /db_xref="InterPro:IPR001044"
                     /db_xref="InterPro:IPR006085"
                     /db_xref="InterPro:IPR006086"
                     /db_xref="InterPro:IPR008918"
                     /db_xref="InterPro:IPR019974"
                     /db_xref="InterPro:IPR020045"
                     /db_xref="InterPro:IPR029060"
                     /db_xref="UniProtKB/TrEMBL:C5DD69"
                     /translation="MGVHALWDIVGPTAKPVRLESLSNKRLAVDASIWIYQFLKAVRD
                     KEGNAMRYSHVVGFFRRICKLLYFGIKPVFVFDGGAPALKRRTIQQRKERRQGRRDNA
                     VSTAKKLLALQMQNGDRTKNKENASRSTSQTHVHRQDDEYDLPKIPGFKYEEGDARIN
                     ADDFKTIMENIDELDGVDLDAVNPASREFEELPKSTQYMILSALRLKSRLRMGYSKEQ
                     LEEIFPDSMEFSKFQIDMVKRRNFFTQKLMSATNTHDGGASKSDTEPYKRVAGQRGKE
                     YQLIRTENGWALSLTGNDGSEISKAIVVDEPQRKMEGESRTRSEPQGEDDEDEDIDWE
                     DVDVEKKKSEKELDYSIKASMLSVKANTVRSGGGQSFLDRRTTETRDKGPQSKFVYVS
                     NEPELIDDEDEDEDDFSELTKEIQLMEDVKNGRGKRIEEIQTDNSIPQRQEQQKAESK
                     KPSSSAPFSYENEPASVKDRIEVADNSDEVGEQEMITEDEVREKSQQNSRFGEFIAPS
                     YPQNKASHDGHPKVSSSQAENKKSSNSEQNLQFVLDKINNLEQMQDQRVEIAPANENP
                     EGHNSDVIHAHSRAPEHDERPVQETPAWFRSAPDFNPHLGTSFLTSTTEKEPEQTDDE
                     QLGLLTGSKAAELLYERDVLNKENEANGDQSSAEEDVIEIAPPESLSADKPSEGGEEE
                     EIDSAGTQGKAHVPVVDYDFSEDEEDALVHQLREEEQDYNAFKTSLNPSSVNATFVDE
                     ELHDQHLRDKRDSDEVTAAMVAEVQDLLTRFGIPFMTAPMEAEAQCAELLMLGLVDGI
                     ITDDSDIFLFGGDKVYKNMFQEKNYVEYYYSDLMKKELGLDREKFIELAQLLGSDYTT
                     GVKSVGPVSAMEILAEFGNLHNFRNWYSDGQFNKKKQEEEPTFEKRLRKKLVTSEVIL
                     DTEFPSDLVKEAYLRPEVDHDATRFTWGVPDLDRLRSFFQSTIGWPQEKTDEVMIPLI
                     REVNNRKKTGIQNTLTNFFPSEYIKASKDIKLGKRIKNASGKLKMKKQRTE"
     gene            complement(712345..712417)
                     /locus_tag="KLTH0B08778r"
                     /db_xref="GeneID:8291010"
     tRNA            complement(712345..712417)
                     /locus_tag="KLTH0B08778r"
                     /product="tRNA-Val"
                     /note="tRNA-Val (CAC) cove score=75.70"
                     /db_xref="GeneID:8291010"
     gene            complement(<712793..>717340)
                     /locus_tag="KLTH0B08800g"
                     /db_xref="GeneID:8291011"
     mRNA            complement(<712793..>717340)
                     /locus_tag="KLTH0B08800g"
                     /product="KLTH0B08800p"
                     /transcript_id="XM_002552123.1"
                     /db_xref="GeneID:8291011"
     CDS             complement(712793..717340)
                     /locus_tag="KLTH0B08800g"
                     /note="some similarities with uniprot|P38873 Saccharomyces
                     cerevisiae YHR186C KOG1 Subunit of TORC1 a
                     rapamycin-sensitive complex involved in growth control
                     that contains Tor1p or Tor2p Lst8p and Tco89p contains
                     four HEAT repeats and seven WD-40 repeats may act as a
                     scaffold protein to couple TOR and its effectors"
                     /codon_start=1
                     /product="KLTH0B08800p"
                     /protein_id="XP_002552169.1"
                     /db_xref="GeneID:8291011"
                     /db_xref="GOA:C5DD70"
                     /db_xref="InterPro:IPR001680"
                     /db_xref="InterPro:IPR004083"
                     /db_xref="InterPro:IPR015943"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR017986"
                     /db_xref="InterPro:IPR019775"
                     /db_xref="InterPro:IPR029347"
                     /db_xref="UniProtKB/TrEMBL:C5DD70"
                     /translation="MPTTYGPQPLRKLNTETRHGFGDQYSSEQYLENLENDFMFYFDD
                     KRHRTNGNPTSPEVKAKDESHYYQPIPDWKIVKERQKTVSAALLLCLNLGVDPPDVAK
                     THPCARLESWVDPLNFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFC
                     NSLRRASKDERILFHYNGHGVPQPTASGEMWVFNRGYTQYIPVSLYDLQTWLGAPCIY
                     VYDCNSAGNIVANFQTFVQKRIKDDQDGNHDPAAPSPTQAYTECIQLASCRANELLPM
                     KPELPADLFTCCLTCPIKISVEIFLMQSPLRESKYSVLFQDYDSRTHRSGEQSSSAKP
                     NVTIPGKLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMVAALFRNFLL
                     AKRIMPWFNCHPVSDPELPDSIADHPMWKSWDLAIDEVLTKLVDDLQNVPLASADLEL
                     QPSLQEQQVSDTSIDDPLHSKAAAGTLSTMSLANHQAGSLSQVSQHLSQQQLLQHQHQ
                     QQQLQQQQQQQQFTGFFEQNLTAFELWLKYGSNTRHPPEQLPIVLQVLLSQVHRVRAL
                     VLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELRPILVFIWARIMSIDYKNTQA
                     ELIKEKGYLYFVKILVPELGMHPQPGSAPQLQRTISGGGLTMNASTSIGTQRYQFYQN
                     FQNANNPGVAMANNTTDEQKAMAMFVLSSFLRDFSLGQKYCSSLELLGKICYYVETSD
                     VPLLRQWCIVLMGQLYLKNPFNKYLCMTCGFLDKIYTSMKDPIPEIRCAALLAFSMFI
                     SEKNDAEMALQMQQEMQQQAQQLQVQLQTLQGGQMQRQQAQAERQLQQLQASLSQMRT
                     MDSRKLKQDEIKMTIEALGLVNDGSPLVRKELIISLSRIVHRYINFFFVIAFNELCDE
                     ISQLESTGDSAALESKQSIAHGSIFNTVWKSLLILAEDPYLENKTLAQQVVDYVFTKL
                     NVHSQLNEVVLLMELYLVKHTSCNATGHGATTVSILPTAKRPLSLSANKREATSNSET
                     PKSGIFKRSISLNGLLKALGWEQDQEDSSQETPSNRSFGRLQGNNLLTVPYGVSPSAT
                     TPRYKKPKGPIDMPLKSSFLDYSREYFQEPQMKKQEADEPGSVEYTSRLWRRNRNESI
                     IQRTQAQKRLALYGDWSNKIGTLDNKTQPKLLKFSQFENYIACSDDRDNISIFDWVDK
                     SKLSTFSNGNPFGTKITDMSYLNEDDVPLLLAGSSDGIVKIYKNFQDLEELELVSSWR
                     GLTDLLLTPRSTGLLTEWQQSRGSLLVTGDAKIIRVWDALTETIEVDIPAKSSSLITS
                     ITSDQLSGHMFVTGFSDGSLRAYDRRVDPRDSMVRLWRSGDGKSNFGINNIHLQRGGY
                     RELVSGTENGLVELWDLRYQNSIGKFKDEGDKSSSMTTMTSMKVHEHAPVIATGTKSL
                     KIWTTSGDLLSSFKNNTPAHAGGVAGTLATGISASRISSSFISTMAFHPHEMILAAAN
                     SHNSSINIYECYEGKTDYLYY"
     gene            <717544..>718431
                     /locus_tag="KLTH0B08822g"
                     /db_xref="GeneID:8291012"
     mRNA            <717544..>718431
                     /locus_tag="KLTH0B08822g"
                     /product="KLTH0B08822p"
                     /transcript_id="XM_002552124.1"
                     /db_xref="GeneID:8291012"
     CDS             717544..718431
                     /locus_tag="KLTH0B08822g"
                     /note="similar to uniprot|P38874 Saccharomyces cerevisiae
                     YHR187W IKI1 Subunit of the Elp4p-Iki1p-Elp6p- subcomplex
                     of RNA polymerase II elongator complex which is a histone
                     acetyltransferase iki1 mutations confer resistance to the
                     K. lactis toxin zymocin"
                     /codon_start=1
                     /product="KLTH0B08822p"
                     /protein_id="XP_002552170.1"
                     /db_xref="GeneID:8291012"
                     /db_xref="GOA:C5DD71"
                     /db_xref="InterPro:IPR019519"
                     /db_xref="UniProtKB/TrEMBL:C5DD71"
                     /translation="MASSSHNPAVLLKRVLSLRESSPFILCVDCIERSASSIVEEVSR
                     EVGDSATIIYVSYETNNKPRYATHFVEGTGSEARLLDTIKSYLPSKPSPRKHLVIIDT
                     LNLIPNNKLSQFISSMVSPSVVLLGIYHKQQPEVRPSSMENYPSSLQLLQFMATSILD
                     CQPITEDAAAEEMLDSKIQKLVIPRGLNSPVFKLVLTNRRKSGRALTYSFQFDSRNHT
                     YNVLQEQAENENTEDDKEVFEGLTTFNLNISNRQKAARENVALPFLEAQSFNAGGAIV
                     YEYEKDDDYDEEDPYEDPF"
     gene            complement(<718586..>720562)
                     /locus_tag="KLTH0B08844g"
                     /db_xref="GeneID:8291013"
     mRNA            complement(<718586..>720562)
                     /locus_tag="KLTH0B08844g"
                     /product="KLTH0B08844p"
                     /transcript_id="XM_002552125.1"
                     /db_xref="GeneID:8291013"
     CDS             complement(718586..720562)
                     /locus_tag="KLTH0B08844g"
                     /note="similar to uniprot|P38875 Saccharomyces cerevisiae
                     YHR188C GPI16 Transmembrane protein subunit of the
                     glycosylphosphatidylinositol transamidase complex that
                     adds GPIs to newly synthesized proteins human PIG-Tp
                     homolog"
                     /codon_start=1
                     /product="KLTH0B08844p"
                     /protein_id="XP_002552171.1"
                     /db_xref="GeneID:8291013"
                     /db_xref="GOA:C5DD72"
                     /db_xref="InterPro:IPR007245"
                     /db_xref="UniProtKB/TrEMBL:C5DD72"
                     /translation="MRALLVLFWAFLVAKAQEVRSSIDEELLIPNETESAGSADETCI
                     AEDSSFGLDSGNSTSNDKEDPVEEELLNEALQKPVFFEKQDAIKYPFAEQLTLKPLPR
                     NYMVASFQFQMASNNLSVGQSETDFDAYRHYTVFPKAISPILEYTNTRQLHLRFTHGL
                     WDSESWGQLPHKGSKSGGNGVELWAVIEADSKEIAFRHWVSLANSLSGLFCSSINFID
                     SERTTYPVSSFQPQGDGGLPVFNATNGLFLIRAALANEPICTENLTPFLKLLPTRGKS
                     GISSLLDGHKVFDSNWHSMSLDVETTCDGNDCKYHMEELIEIVFNVPNTLARAEKPIP
                     KPVKESDLKCDESKPHDNFECFPLPQSKEIKFRLSELFGKQIVGSSLISESPSQICAD
                     VSDNWKAYIDVDNMLFATDNNCFSVKENKLHDLYLESDDTTQVTPPESVPLYVSRSLT
                     GYGQDSGGLRTVFKNPGNESVNAIYFEALPWYMRIYLSSLKIESADGLEIEDVVRGTY
                     YLPAIDRERPTHLEYNLTIPANTTIALSYQFDKALLKYAEYPPDANHGFEIESAVVTV
                     LEPVRYEMRTATLLLSLSTPDFSMPYNVIILTSTVMGLAFGTLFNLMVKRLVPLEEAD
                     RQASLRPGLKGKVARMLKAFSLKRKKVDEVKKRQ"
     gene            <720807..>723716
                     /locus_tag="KLTH0B08866g"
                     /db_xref="GeneID:8291014"
     mRNA            <720807..>723716
                     /locus_tag="KLTH0B08866g"
                     /product="KLTH0B08866p"
                     /transcript_id="XM_002552126.1"
                     /db_xref="GeneID:8291014"
     CDS             720807..723716
                     /locus_tag="KLTH0B08866g"
                     /note="similar to uniprot|P49955 Saccharomyces cerevisiae
                     YMR288W HSH155 U2-snRNP associated splicing factor that
                     forms extensive associations with the branch site-3'
                     splice site-3' exon region upon prespliceosome formation;
                     similarity to the mammalian U2 snRNP-associated splicing
                     factor SAP155"
                     /codon_start=1
                     /product="KLTH0B08866p"
                     /protein_id="XP_002552172.1"
                     /db_xref="GeneID:8291014"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DD73"
                     /translation="MKDLESVENMDSNQKHCLTAAYTMPQELKTELEVHGKDDALTER
                     MRAKAASARESDYQRKRYDLQLKEGAGNGQENDKKRHLEVDITSEPRQGAVVKRSRWD
                     VVEAYQMPESSREEIQNLSKELITEVPGVRDLQFFKPSDKNHFGELLSDKKELSEEEE
                     KDRQFLRLLLRIKNGRPQTRKSAMRALRDRASEFGAPRIFNRVLPILMDRSLEDQERH
                     LMIKVVDRILYQLQDLVKPYTHRILVVIAPTLIDEDIVTREVGREIISRLAHSVGFAT
                     IIMNVRADIDNQDEYVRNITSRVLAVVAKALSVSNMIPFLKAVCNSRKSWRARHTGVR
                     TIQRIGILMGIGVLPYLQSLIECISDKLNDEHLPVRIATAQSIASLAQSSYPYGIDAF
                     NYVLEPLWRGIRTHRGKALASFLRALGFIIPLMDAEYAGYYTQEVMRIVKREFHSPDE
                     EMKKAVLLVLQKCCGTEGVSRLQLKEEIVPDFFRNFWTRRTALDRQISKLVVYTTTIL
                     SEKVGCAFPVGYLLNPLRDESEPLRTMAARAVNQIVKSQGTQDIDQRLETRMIDALLI
                     AFQEQTNEDNIVLRGFGTVINSLDTRMKPYLAPIVSTVLQRLRHKSPIIRQHSADLCA
                     MLASAVKHCGEEAMLNKLNIIMYESLGEVYPEVLGSMIGAMCEIVSCADFSRMQPPAN
                     QILPNLTPILRNRHRKVQHNSILLIGKIADKGPDSVPPKEWMRICFELLEMLKSPSKS
                     IQRSANSTFGSIAKTIGPQDVLVALLNNLKVQERQLRVCTAVAIGIVAETCGPITVLP
                     ALMNEYKTPETNVQNGVLKAMSFMFEYIGGIAKDYIYTTVPLLQDALTDRDLVHRQTA
                     AAVTRHLALNCMGKGYEDAFLHLLNLLMPNVFETSPHVITRIVEGLEALRNALGPGVA
                     LNYVWAGLFHPAKGVRKSFWGLYNNAYIQHLDSIVPFYPQVESGPFTVEELNEIL"
     gene            complement(<723793..>726174)
                     /locus_tag="KLTH0B08888g"
                     /db_xref="GeneID:8291015"
     mRNA            complement(<723793..>726174)
                     /locus_tag="KLTH0B08888g"
                     /product="KLTH0B08888p"
                     /transcript_id="XM_002552127.1"
                     /db_xref="GeneID:8291015"
     CDS             complement(723793..726174)
                     /locus_tag="KLTH0B08888g"
                     /note="similar to uniprot|P46682 Saccharomyces cerevisiae
                     YGR261C APL6 beta3-like subunit of the yeast AP- 3 complex
                     which functions in transport of alkaline phosphatase to
                     the vacuole via the alternate pathway suppressor of loss
                     of casein kinase 1 function putative beta adaptin
                     component of the membrane-associate clathrin assembly
                     complex"
                     /codon_start=1
                     /product="KLTH0B08888p"
                     /protein_id="XP_002552173.1"
                     /db_xref="GeneID:8291015"
                     /db_xref="GOA:C5DD74"
                     /db_xref="InterPro:IPR002553"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="InterPro:IPR026739"
                     /db_xref="InterPro:IPR026740"
                     /db_xref="UniProtKB/TrEMBL:C5DD74"
                     /translation="MVDSISRITSALESARELTLEAAAVAASRLGESSYHRYSQSITP
                     EGLRSLLNSRNSREVRDGMKRVASLMACDDPTINLESYFADVVKNVSSDDVKVKRLVA
                     IYMLRYAEKDPGLALLAVNSIQRSLSDPDPEVRSLALKAISDIRIPSLYPIVLHSVKK
                     AITDVAAEVRCAVGFALLKLYREQREELTDDILPLLQDLLADSDPEVVSSAIILMKEA
                     FPDHLELLHGHFRRYCGLLPQLCEWSQLYLIELSVKYCKHFIPRPILMDSSDAARAVP
                     LSDDFADIPFAIYDVSFHPDLSMFLDSLQKLLHSQNAAVVVAISKAYFELSPSLTFKN
                     SKATDALVRLIGGPSIADGRALIFQCILVYCAVDPSTFSRFLNKFFLLPSDDTNTAVA
                     KLKILSTLVDLNNVKRVVSEIKYYIINDQRPAVIQEALNSLAGCGQLSRSLSLHITKW
                     LLTRMVDSISSASLDSFVSVLRSLIQENPAEHLHTMLNLSQVLRTENYLSGTAKAGIV
                     WLFGEFSSINFTICPDVLRILIPNFSREPKEVRLQIVLLAAKLLSWEVDNSKNSSTEV
                     GAFDIDNSRTAQMARSVFYLAKFDDDFDIRDRSRLFCSLFDNERYEIASLLLQAPKPS
                     SIAPMALNMSSSANASSFASLGLDPGMEDYLSFSSWTFDGDADESSALRVPAQTKDYS
                     RMKTSFSSSTFFGGKNSDDFGGTSPVSETSDDVHTQSSRGFTSSAGRKYKLQSLDEFF
                     SDIPARGQRRRRVLVEEESSDEEETSQEDSESDDTSISSSSESEAESNIEVNT"
     gene            complement(726326..726398)
                     /locus_tag="KLTH0B08910r"
                     /db_xref="GeneID:8291016"
     tRNA            complement(726326..726398)
                     /locus_tag="KLTH0B08910r"
                     /product="tRNA-Lys"
                     /note="tRNA-Lys (CTT) cove score=77.79"
                     /db_xref="GeneID:8291016"
     gene            <726546..>727685
                     /locus_tag="KLTH0B08932g"
                     /db_xref="GeneID:8291017"
     mRNA            <726546..>727685
                     /locus_tag="KLTH0B08932g"
                     /product="KLTH0B08932p"
                     /transcript_id="XM_002552128.1"
                     /db_xref="GeneID:8291017"
     CDS             726546..727685
                     /locus_tag="KLTH0B08932g"
                     /note="similar to uniprot|Q03266 Saccharomyces cerevisiae
                     YMR289W ABZ2 4-amino-4-deoxychorismate lyase catalyzes the
                     third step in para-aminobenzoic acid biosynthesis"
                     /codon_start=1
                     /product="KLTH0B08932p"
                     /protein_id="XP_002552174.1"
                     /db_xref="GeneID:8291017"
                     /db_xref="GOA:C5DD75"
                     /db_xref="InterPro:IPR001544"
                     /db_xref="UniProtKB/TrEMBL:C5DD75"
                     /translation="MEGADGNGLTAMQQQISEIVQHGVIDPNFKFSDADFEILSTLRY
                     DPGFTHTNGGGSSGTAEDELDPRLSAADVREALGESPLSDSGEYSIDTIAQMLGEMQK
                     DTLPLSPPPEAEEELETSEYGLKKIFYNRFLLLGEQFKRLNLALSFFKWNFSIPFELL
                     LEKLIQALPCPLELATDLSSRMQALLSVKKCYKMRVLVSSSGRMRVEAHELPQNWGNF
                     ATASQYFVNTVLRGFLPQQDEVWDVFVDTQAIVASPFTTFKTTRRGHYNAARERMTEL
                     SERVHNPARKSEILVYNSAFELMEGSISNAALLLNGNETSNSLYQTPFLTSGCLCGVM
                     RYYLLKKNLITEGNIDVRHLNVGDQVLLFNGVMGCVRGVIRNSLE"
     gene            complement(<727687..>728484)
                     /locus_tag="KLTH0B08954g"
                     /db_xref="GeneID:8291018"
     mRNA            complement(<727687..>728484)
                     /locus_tag="KLTH0B08954g"
                     /product="KLTH0B08954p"
                     /transcript_id="XM_002552129.1"
                     /db_xref="GeneID:8291018"
     CDS             complement(727687..728484)
                     /locus_tag="KLTH0B08954g"
                     /note="similar to uniprot|P53323 Saccharomyces cerevisiae
                     YGR262C BUD32 Protein involved in bud-site selection
                     diploid mutants display a random budding pattern instead
                     of the wild-type bipolar pattern"
                     /codon_start=1
                     /product="KLTH0B08954p"
                     /protein_id="XP_002552175.1"
                     /db_xref="GeneID:8291018"
                     /db_xref="GOA:C5DD76"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010440"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR022495"
                     /db_xref="UniProtKB/TrEMBL:C5DD76"
                     /translation="MSKEVIEQVVTYLTPNVPIVPISQGAEAFVFTTNVHPYNASACK
                     TAGDIPVKYIIKYRPPKKYRHPSIDKTLTKHRTLSESRILAKLSQVPGLHVPKLIACD
                     VYNGCIWIEFIGEDLPESHGFSNLKNFLWMYKTDPYNIAVEKVLFKVGEQIGLLHWND
                     YCHGDLTTSNLVLHQENGDWSPYLIDFGLGSASTLVEDKGVDLYVLERAIISTHSKFA
                     DKYNEWILMGFKSVYENEGKKGQQKLKDVIKRFEEVRLRGRKRSMLG"
     gene            complement(<729231..>731486)
                     /locus_tag="KLTH0B08976g"
                     /db_xref="GeneID:8291019"
     mRNA            complement(<729231..>731486)
                     /locus_tag="KLTH0B08976g"
                     /product="KLTH0B08976p"
                     /transcript_id="XM_002552130.1"
                     /db_xref="GeneID:8291019"
     CDS             complement(729231..731486)
                     /locus_tag="KLTH0B08976g"
                     /note="highly similar to uniprot|P00958 Saccharomyces
                     cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms a
                     complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p
                     which increases the catalytic efficiency of both tRNA
                     synthetases also has a role in nuclear export of tRNAs"
                     /codon_start=1
                     /product="KLTH0B08976p"
                     /protein_id="XP_002552176.1"
                     /db_xref="GeneID:8291019"
                     /db_xref="GOA:C5DD77"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR009080"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR014758"
                     /db_xref="InterPro:IPR015413"
                     /db_xref="InterPro:IPR018285"
                     /db_xref="InterPro:IPR023458"
                     /db_xref="InterPro:IPR029038"
                     /db_xref="UniProtKB/TrEMBL:C5DD77"
                     /translation="MAFNLSFDRSKDHSYALQLANNIKLALAQELAGKEIKISVNDES
                     VKPELTVASTDFRLFNTNAILRYVLNDFEGLESSETHFAVSSLEAMLYHPSAPQEHVK
                     ENVSKALENYLQELREPFCATNLITFANAYALSPESLESKFANLPASLSKALSAAKSY
                     TPRLSSSFKRTGAVKINSNFAVKKQDAEILPIEGERNILITSALPYVNNVPHLGNIVG
                     SVLSADIYARYCKARNYNTLFVCGTDEYGTATETKAIEEGCTPRELCDKYHKIHSDVY
                     KWFQIGFDYFGRTTTEKQTEIAQDIFNKLNNNGYLEEHSMKQLYCEEHKAYLADRYVE
                     GECPKCHYEDARGDQCDKCGGLLDPFELINPRCKLDNSKPIPRNSDHIFISLDKLEPR
                     IKEWVEKSSREGGWSKNSRTITQSWLKEGLQPRCITRDLVWGTPVPLEKYKDKVLYVW
                     FDATIGYVSITANYTDGWKKWWKDPENVQLYQFMGKDNVPFHSVIFPGSQLGTNENWT
                     MLHHLSTTEYLQYEGGKFSKSRGVGVFGNNAKDTGVSPSVWRYYLASVRPESSDSHFS
                     WSDFVARNNSELLANLGNFVNRLVKFVNAKYNGVVPEYDQKQLADFVKLEKDINSILS
                     SYVSEMEQSHERRGLEIAMSLSARGNLFLQENKLDNSLFSEFPAKSDAVVGVGLNIVY
                     SVASVIYPFMPEAAETIYKMLNAPAKKIDDKFYLCIEGGHNINKAEYLFKRIDEKEIE
                     NWRSKYGGQQK"
     gene            complement(<731722..>733200)
                     /locus_tag="KLTH0B08998g"
                     /db_xref="GeneID:8291020"
     mRNA            complement(<731722..>733200)
                     /locus_tag="KLTH0B08998g"
                     /product="KLTH0B08998p"
                     /transcript_id="XM_002552131.1"
                     /db_xref="GeneID:8291020"
     CDS             complement(731722..733200)
                     /locus_tag="KLTH0B08998g"
                     /note="highly similar to uniprot|Q03532 Saccharomyces
                     cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
                     localizes to both the nuclear periphery and nucleolus
                     highly enriched in nuclear pore complex fractions"
                     /codon_start=1
                     /product="KLTH0B08998p"
                     /protein_id="XP_002552177.1"
                     /db_xref="GeneID:8291020"
                     /db_xref="GOA:C5DD78"
                     /db_xref="InterPro:IPR000629"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR014014"
                     /db_xref="InterPro:IPR025313"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DD78"
                     /translation="MGEVEEKAHSKKRSADAVEASENDGYKEKFAELNLSPPTMKAID
                     KMGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIEMLHSLKFKPRNGTG
                     VIVITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEADKLAKGVNLLIATPGR
                     LLDHLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILPSEERQTMLFSATQT
                     TKVEDLARISLRPGPLFINVDSEKQTSTADGLEQGYVVCDSDKRFLLLFSFLKRNQKK
                     KIIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCTDV
                     AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGSKGKGKSLMFLTPNELGFLRYLK
                     AAKVPLNEYEFPSNKIANVQSQLEKLIKSNYHLHQIAKDGYRSYLQAYSSHSLKTVYQ
                     IDKLDLAKVAKSYGFPIPPKVNITIGASGKTPPSKKRKPSRN"
     gene            <734001..>736115
                     /locus_tag="KLTH0B09020g"
                     /db_xref="GeneID:8291021"
     mRNA            <734001..>736115
                     /locus_tag="KLTH0B09020g"
                     /product="KLTH0B09020p"
                     /transcript_id="XM_002552132.1"
                     /db_xref="GeneID:8291021"
     CDS             734001..736115
                     /locus_tag="KLTH0B09020g"
                     /note="similar to uniprot|P53326 YGR266W Saccharomyces
                     cerevisiae probably contains a single transmembrane span"
                     /codon_start=1
                     /product="KLTH0B09020p"
                     /protein_id="XP_002552178.1"
                     /db_xref="GeneID:8291021"
                     /db_xref="InterPro:IPR018946"
                     /db_xref="UniProtKB/TrEMBL:C5DD79"
                     /translation="MQEFYDPWDTQALYQDKVQGCDTCTDKCAVPERGIVCGPILRLV
                     GVDYERNLYRGSLLLVCRDIAAPQVSFVAGPSDSGIGAGAAGSSASASASQSHSYFPR
                     VLFFEEQGLQFYRYTIEFEMQDYEQLIKYAIDTEIKPHYRFFVPAKTANFNTISYSCN
                     GFSLSVDTTKFKGSMWFDILNKHAKTHYHVMLGGGDQIYSDGVKIFCDKFNDWLTEKN
                     PSVKARAKLTPELRADLDKFYLKEYIEWYGYGYWKGSTPKSKTTQACFPIAMASIPSI
                     NIWDDHDIIDGFGSYSHSFMKNEVFSGVGKAAYKYYMLFQHHVSIHEREAYLENPSWL
                     LGHKESDYIGERSHSVFTRIGPTWGMLGLDCRTERKIKQIVSWDTYALVFKRLEEEVA
                     KGKMDHLMVMLGVPIAYPRLVWLEWLFSSKFLAPLKYLSKKGLIARSLVNEFNGDVEL
                     LDDLNDHWCARHHKKERNFLVSKLQDFGAKHGVRITILSGDVHLTTIGRFRSKLHSHH
                     ITSSKDSEVERVLDEPENDVRLMFNVISSAVVNTPPPTAMSGLLQKRSGIHHFDRETD
                     EDVVPLFKKDVDGTNRKFFSFMNRRNWSDLLPVQNVLQNEYLRNLYQVSEGDKCVPGI
                     ISDSGLEKRTSDNSPEEKQDVLYPVTSQGFIATIHAEKDALSVESKSVGYAVVVPELK
                     RANISLSHKGIKHLDATNPSEA"
     gene            <736520..>738112
                     /locus_tag="KLTH0B09042g"
                     /db_xref="GeneID:8291022"
     mRNA            <736520..>738112
                     /locus_tag="KLTH0B09042g"
                     /product="KLTH0B09042p"
                     /transcript_id="XM_002552133.1"
                     /db_xref="GeneID:8291022"
     CDS             736520..738112
                     /locus_tag="KLTH0B09042g"
                     /note="similar to uniprot|Q03533 Saccharomyces cerevisiae
                     YMR291W Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B09042p"
                     /protein_id="XP_002552179.1"
                     /db_xref="GeneID:8291022"
                     /db_xref="GOA:C5DD80"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017441"
                     /db_xref="InterPro:IPR020675"
                     /db_xref="InterPro:IPR020679"
                     /db_xref="UniProtKB/TrEMBL:C5DD80"
                     /translation="MSTASVADASWPQGSVSPNAGDVSRCKYVIKDSQLGDGYFSVVK
                     ECMNVYTRDRFAMKLVSKKTVEGKLWLIQREVKLLKAVSAKIRELEQSEAACKDTFEG
                     HHHVLQLFDYFETNQNIVLVTQLCSHGDLYEKIIEAGSLDVTRQVKSYTACLLSAINF
                     LHENGVVHRDLKAENVLFRCRVTELSEYSRRGSHYDHHAHDLILADFGLATNLNGNED
                     ELRECVGTISYIAPEVVRCYGISRLAPSEAKAIPAYGAAIDIWALGVLAYFMMTGYMP
                     FDCETDAETKKCISEGDYYVDEELKSDKSLDSKHFWNFVHLCFTINASDRPTSQDLKK
                     HPFVQQFFSTDNQAEPFGDRIALVKSTSSSSLHNLGTPSRSSSSSSLAALGRSESGSN
                     LISIDSRDLKLDRVRETLKKTLSMTSIAPARNNFVDPATQNKKNSTFKLEPMPPSNSL
                     MNGCFSLTPESKSNFTTSPSVSRTHSSTEMGRIMSTGESNGTSLTRQSSGLGNEVTED
                     ECSKAAGTTQRSSRKSGAQFDF"
     gene            complement(<738472..>739206)
                     /locus_tag="KLTH0B09064g"
                     /db_xref="GeneID:8291023"
     mRNA            complement(<738472..>739206)
                     /locus_tag="KLTH0B09064g"
                     /product="KLTH0B09064p"
                     /transcript_id="XM_002552134.1"
                     /db_xref="GeneID:8291023"
     CDS             complement(738472..739206)
                     /locus_tag="KLTH0B09064g"
                     /note="highly similar to uniprot|P51601 YGR267C
                     Saccharomyces cerevisiae FOL2 GTP-cyclohydrolase I"
                     /codon_start=1
                     /product="KLTH0B09064p"
                     /protein_id="XP_002552180.1"
                     /db_xref="GeneID:8291023"
                     /db_xref="GOA:C5DD81"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="InterPro:IPR018234"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="UniProtKB/TrEMBL:C5DD81"
                     /translation="MENKHLAGLIERQDTPLRTRPASPYTLNPPVEADGLSWPSLGSR
                     VRSEESPEETQQRTDRIAEAVKVILSELGEDVSREGLLETPQRYAKAMMYFTKGYQHN
                     IINDVIKNAVFEEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKKVLGLSKLA
                     RLAEMYARRLQVQERLTKQIAMALSEILKPRGVAVVIEAAHMCMVSRGVQKTGSSTMT
                     SCMLGCFREAHKTREEFLNLLNRRSI"
     gene            complement(<740501..>741178)
                     /locus_tag="KLTH0B09086g"
                     /db_xref="GeneID:8291024"
     mRNA            complement(<740501..>741178)
                     /locus_tag="KLTH0B09086g"
                     /product="KLTH0B09086p"
                     /transcript_id="XM_002552135.1"
                     /db_xref="GeneID:8291024"
     CDS             complement(740501..741178)
                     /locus_tag="KLTH0B09086g"
                     /note="weakly similar to uniprot|P40325 YGR268C
                     Saccharomyces cerevisiae HUA1 uncharacterized ORF"
                     /codon_start=1
                     /product="KLTH0B09086p"
                     /protein_id="XP_002552181.1"
                     /db_xref="GeneID:8291024"
                     /db_xref="UniProtKB/TrEMBL:C5DD82"
                     /translation="MVHNEDPPPPSYDEAIKESALPFGPEERPPAMPARPSTYTHRPP
                     ARPPRPVSSAGPSGPSAYGASSPGPSAASSSSFQSYGGSSYTAPAASQSTRPSLPWTY
                     PRGYYCTKCGNTGYKIKNGHSCKRCWRKFAHSSPSQNVQVTYGGYAPSYALYGGAPTF
                     GTVPMAMGVSPASPAPASGGAPLVLRPGDPRIGGVTCGECRGSGRVRFLLDKEICPLC
                     HGVGRVL"
     gene            <741971..>742474
                     /locus_tag="KLTH0B09108g"
                     /db_xref="GeneID:8291025"
     mRNA            join(<741971..741992,742080..>742474)
                     /locus_tag="KLTH0B09108g"
                     /product="KLTH0B09108p"
                     /transcript_id="XM_002552136.1"
                     /db_xref="GeneID:8291025"
     CDS             join(741971..741992,742080..742474)
                     /locus_tag="KLTH0B09108g"
                     /note="similar to uniprot|Q03554 YMR292w Saccharomyces
                     cerevisiae GOT1 evolutionarily conserved non-essential
                     protein present in early Golgi cisternae that may be
                     involved in ER-Golgi transport at a step after vesicle
                     tethering to Golgi membranes"
                     /codon_start=1
                     /product="KLTH0B09108p"
                     /protein_id="XP_002552182.1"
                     /db_xref="GeneID:8291025"
                     /db_xref="GOA:C5DD83"
                     /db_xref="InterPro:IPR007305"
                     /db_xref="UniProtKB/TrEMBL:C5DD83"
                     /translation="MWLTESQKFGVAFTFGGCLFFLFGVLTFFDRALLALGNILFLVG
                     VLLIIGPQKTYTFFTRPSKRRGSFFFCLGILMILLKWTFMGFIVESLGIVGLFGDFFA
                     VIVQFLRSLPLIGPVLSHPAVAPYVDKIAGVRVLPV"
     gene            <742805..>746806
                     /locus_tag="KLTH0B09130g"
                     /db_xref="GeneID:8291026"
     mRNA            <742805..>746806
                     /locus_tag="KLTH0B09130g"
                     /product="KLTH0B09130p"
                     /transcript_id="XM_002552137.1"
                     /db_xref="GeneID:8291026"
     CDS             742805..746806
                     /locus_tag="KLTH0B09130g"
                     /note="similar to uniprot|P40340 Saccharomyces cerevisiae
                     YGR270W YTA7 Protein of unknown function member of
                     CDC48/PAS1/SEC18 family of ATPases potentially
                     phosphorylated by Cdc28p"
                     /codon_start=1
                     /product="KLTH0B09130p"
                     /protein_id="XP_002552183.1"
                     /db_xref="GeneID:8291026"
                     /db_xref="GOA:C5DD84"
                     /db_xref="InterPro:IPR001487"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR003960"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DD84"
                     /translation="MTRPLRPRHHEPLKNELDESSRGIKDENGIIHTTTRSLRKVNYA
                     DVENNYDFIDEVVDEDDEDEAAAPAGSRRRGHAIKSDSEEFEPAEKTEDEPEPPIEDH
                     TAQEVSGPETRNSKSRGGPDEDGDESFHEEDAEDEDEDALAGSEDEYLSEESIRRSRR
                     RADRNFVVSDEDDEDEDTIGASKRTRRGYRTTTTIDTDEDDPPSRRNFRSSTIQARQG
                     RRSEISPPRKLRRRARSAYGSEERQSRSDRLSLADELRELRDDSPVREKRSLRERTKP
                     VNYTLPPPIGDTAMDETAKLGNANGILPYPSPKARRGLHAGQSFGPLRRLFPTGGPFG
                     GNDVTAIFGTNTNYYDNAGQGTANNKLLLDSDSSEDEILPLGAVSTKPNESTHKKKKP
                     EIADLDPLGVDMNIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHG
                     PPGTGKTLMARALAASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQP
                     SIIFFDEIDGLAPVRSSKQEQIHASIVSTMLALMDGMDNRGQVIVIGATNRPDAVDPA
                     LRRPGRFDREFFFPLPDLSARSKILEIHTKKWDPPLPKPFIDRLASLTKGYGGADLRA
                     LCTEAALISIQRKVPQIYQSEMKLSINLASVNVKARDFMMALEKIVPSSARSAGNSAQ
                     PIPETVEALLDSQFEEIKKKLKSIIPSDSKFQRNGASTIKHYLEYEVEDSDEESDGFS
                     KAEFLRNMEKARVCKPRLIVTGSRGNGQQYVGAAILHYLEDFNMQMLDVGTLASDSTR
                     SFETAIVQIFTEARRRQPSVLYIPNSEIWLQAVPENAILMLASLLRSLRSDEKVLLLA
                     VANGLSKSDILEGSLSHLEFEKFIHKIRKPSSSQRAKYFLSLKQILKTKPSSFEQGKK
                     RTKPLPQLPVVESSKKSEGLDKNGNPLSEEAKLIQTLKSFQNHDMKLKNTLKLKLSGL
                     MDLFKNRYKRFRKPPIDDALLIHLFETNAALQGNPDYQPAYIKENNMILECATGRRFF
                     NMDLDIVEERLWNGFYSEPRQFLKDIELIYKDAHTSGDRERIIKASEMFVNAQMGIEE
                     ISAPDFVMECRDSRQRELTRQKLNLEKQAKLKSQELSEELQVRANEVDISENDLSSSS
                     EKFERNSLNGSHALQVGVGSGGQLQCQAQKNPQEELQVEDATNDEQGNNTERQLPNDD
                     INPLQIGNNEYKKDDAEAAEIEGAIDGKHAESETPRNSSPENSKSSEQSSLSEEALIE
                     EGGPQVAEFILDDNKLNDLLSLLEHRSEGFTVQKLEELYAFALNIIWEDRLLWDRTTT
                     LHKLLTHIENWGN"
     gene            complement(<746833..>748230)
                     /locus_tag="KLTH0B09152g"
                     /db_xref="GeneID:8291027"
     mRNA            complement(<746833..>748230)
                     /locus_tag="KLTH0B09152g"
                     /product="KLTH0B09152p"
                     /transcript_id="XM_002552138.1"
                     /db_xref="GeneID:8291027"
     CDS             complement(746833..748230)
                     /locus_tag="KLTH0B09152g"
                     /note="similar to uniprot|Q03557 Saccharomyces cerevisiae
                     YMR293C Uncharacterized ORF"
                     /codon_start=1
                     /product="KLTH0B09152p"
                     /protein_id="XP_002552184.1"
                     /db_xref="GeneID:8291027"
                     /db_xref="GOA:C5DD85"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR004412"
                     /db_xref="InterPro:IPR020556"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:C5DD85"
                     /translation="MSFKSAISRLEKLPLIQKQYNAFTHLNPNCKELLIKDVSSSPKK
                     SLTNLLYGIKDNIATSDMPTSCGSKVLHNYQSPFDATIVELLESAGAISVGKTNLDEF
                     GMGSGGLFSHFGPTKNPLFPFQDTVVGGSSSGSAAAVAADAVDFSIGTDTGGSVRLPA
                     AYTSLFGFKPSYGRISRFGVIAYAQSMDTVGIFSKNVSIIKSVFDVLDKHDKKDPTSL
                     SENLRGKLRQLSSPQSSYKIGIPQELLQDNMPLELQDGFLLALEKLEANGHEIYGVSI
                     PQMVNSLPIYYTLAPAEAASNLARFDGLRYGYRDDVADSRDDTLFAPTRSAFGDEVKS
                     RIVLGNYNLCSESFNNHYIKAQRLRVDLINEFDNTFTHPNILTGFPGNQNGVDFLISF
                     SSINLPPAMSDYDSDCTSNPTNSYVNDVFTTPMSLAGLPAINVPVMASNPIGIQLVGQ
                     YGDDSRLLDLAAELL"
     gene            <748355..>749449
                     /locus_tag="KLTH0B09174g"
                     /db_xref="GeneID:8291028"
     mRNA            <748355..>749449
                     /locus_tag="KLTH0B09174g"
                     /product="KLTH0B09174p"
                     /transcript_id="XM_002552139.1"
                     /db_xref="GeneID:8291028"
     CDS             748355..749449
                     /locus_tag="KLTH0B09174g"
                     /note="weakly similar to uniprot|P36224 Saccharomyces
                     cerevisiae YMR294W JNM1 Component of the yeast dynactin
                     complex consisting of Nip100p Jnm1p and Arp1p required for
                     proper nuclear migration and spindle partitioning during
                     mitotic anaphase B"
                     /codon_start=1
                     /product="KLTH0B09174p"
                     /protein_id="XP_002552185.1"
                     /db_xref="GeneID:8291028"
                     /db_xref="GOA:C5DD86"
                     /db_xref="InterPro:IPR028133"
                     /db_xref="UniProtKB/TrEMBL:C5DD86"
                     /translation="MALDIIEWDEEAAVGGIPNDSFKDGKEVFETSDIEETESETSVP
                     ALMNDDINAIKDDYDRSRELFENQVLENIGSDFSGRTDRLQSAHMVSGSCLETRAQKL
                     ARIRRELQEIELSEESGEANSTELVSLRQLLDQLDSKAKSESQNIKQLLCESDKVREQ
                     VELPKINLELGLARRLAELENKVSKLESVLGLSGYSSQKTITTTMDELYRQIKLLRNN
                     DKLLNEFRSKLESISANYEKTLIARKASRNSSLQKQISSDLISSETKVSELYESFSIL
                     RRYKDVVPHITTRMKTLNSLHMEIGDCVSTVKTVDSSVKWMTDQNEKWQKMLIDMDEK
                     LESVEKKAEANKQEVTKWLTNVESRLQEMS"
     gene            <749587..>755451
                     /locus_tag="KLTH0B09196g"
                     /db_xref="GeneID:8291029"
     mRNA            <749587..>755451
                     /locus_tag="KLTH0B09196g"
                     /product="KLTH0B09196p"
                     /transcript_id="XM_002552140.1"
                     /db_xref="GeneID:8291029"
     CDS             749587..755451
                     /locus_tag="KLTH0B09196g"
                     /note="highly similar to uniprot|P53327 Saccharomyces
                     cerevisiae YGR271W SLH1 SKI2-like helicase"
                     /codon_start=1
                     /product="KLTH0B09196p"
                     /protein_id="XP_002552186.1"
                     /db_xref="GeneID:8291029"
                     /db_xref="GOA:C5DD87"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004179"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DD87"
                     /translation="MSTQYSIDSVRSYMDAMSTMVSAAQNFKLGENIAVAPEIDNEIE
                     KSKDESYVQLTTLSQDRNEWDDIFDSFGELSRANVTNAIESAIAEDSSSVTNELKSYM
                     KGINSSEMDEETLLETLLLLLQSENQDSLQSELLDLLGDENIEFISFLVQNREELISI
                     PPEEIKIALKFENSDGDFLTHREIRKQYLKNAKDAKNTELNPLQKQAEYPHVFRKSEV
                     GSSFALSFTGQKFALPVGTTRSSFATREEIIIPAAEAGLRNSMRFKNIVIKDLDVFCT
                     SVFTYETLNAIQSLVYPVAYETNENMLICAPTGAGKTDIALLTILNTVKQFSEVDQKG
                     NIDIEYDSFKVVYVAPLKALAAEIVEKFSKRLAVFDMKVRELTGDMQLTKAEILETQV
                     IVTTPEKWDVVTRKANGDNDLVSKIKLLIIDEVHLLHEDRGSVIETLVARTLRQVERS
                     QSMIRILGLSATLPNFIDVADFLGVNRQIGMFYFDQSFRPKPLEQQLLGCRGKAGSKQ
                     ARENIDNTAYEKMVDMIQRGAQVMVFVHSRKETVRSARNFISIATSHHEIDLFTEASS
                     IREFYQKEMTKNKDKDVKELFQSGFGVHHAGMSRSDRNLTERMFKDGAINVLICTATL
                     AWGVNLPADVVIIKGTQVYDSKKGGFTDLGISDVIQIFGRAGRPGFGSSNGTGILCTS
                     SDRLDDYVSLITQQHPIESKLATKLVDNLNAEISLGSVTNVEEGIQWLGYTYLYVRMR
                     KNPFSYGINWDEIRDDPQLYERRKNMIISAARRLHTLQMIVFDEVSLHFIPKDLGRIS
                     SDFYLLNESVEIFNQLCNPSATEADVLSMISMSSEFDNMKFREEEATELSRLMDNAAQ
                     CQIGGEVESAQGKTNILLQSYISRTRIFDSALSSDSNYVAQNSIRICRALFLVGVNRR
                     WGNFAKVMLDVCKSIEKRLWAFDHPLCQFELPEPVIRQLRDKNPSMESLLDLESEELG
                     DLVHNRKVGHKLYSILSRFPRLEISADIFPITTNVMRIHVALTPAFIWDMRIHGNAQF
                     FWLFVEESDKSQILHVEKLILNKRQMSNPHEMDFMIPLSDPLPPQVVVKVVSDIWIGS
                     ESTQVISFQHLIRPHNETLQTKLQRLRPLPTSAMKNPLLEQIYPFRYFNPMQTMIFHT
                     LYNTNESVFVGSPTGSGKTVVAELAMWHAFKEYPGSKIVYIAPMKALVRERVTDWRKR
                     VTPVTGDKVIELTGDSLPDPRDVKDATIIITTPEKFDGISRNWQTRKFVQEVSLIIMD
                     EIHLLASDRGPILEMIVSRMNYVASQTKRPVRLLGMSTAVSNAYDMGGWLGVKDNGLY
                     NFSSSVRPVPLKMYIDGFPDNLAFCPLMKTMNKPAFMAIKQHSPDKPVLIFVASRRQT
                     RLTALDLIHLCGMESNPRRFLNIDDEGELQYYLSQVSDETLKLSLQFGIGLHHAGLVE
                     KDRYISHELFQKNKIQVLVATSTLAWGVNLPAHLVIIKGTQFFDAKIEGYRDMDLTDI
                     LQMMGRAGRPAFDTSGTAIVYTKQAKKMFYKHFLNIGFPVESSLHKVLDDHLGAEIAS
                     GSIANKQEAMDFLSWTFLFRRAHHNPTYYGIMEDTSAAGINKHLSNLIDDTLKNLEES
                     SCVALRGNEIEALPFLSISSYYYISHKTIRQLLKHIKNTASFQEVLKWLSLAFEFNEL
                     PVRNGEIIMNVEMSAQSRYSVESTFVGEDELPMWDPHVKAFLLLQAYFSRVDLPIADY
                     HQDTISVLDQALRILQAYADVAGELGYYSTVLTIIKAMQCVKQGCWYEDDPVSLLPGV
                     GLKRITDCEFSETGFPLEKSHSMNLDKIGRLKFKQLEQVARKLNVEKEKIKDFIGECQ
                     KLPVLDNIRVEPQSDPNELVITAVHANPRHNRNFEVYCERFPKTQKELWFVIGYQGEE
                     LMMVKRFQPRRKNNGVAISGEFVVAEELHGQTLRFTIINDALDIKYDFEHTLAR"
     gene            complement(<755504..>756172)
                     /locus_tag="KLTH0B09218g"
                     /db_xref="GeneID:8291030"
     mRNA            complement(<755504..>756172)
                     /locus_tag="KLTH0B09218g"
                     /product="KLTH0B09218p"
                     /transcript_id="XM_002552141.1"
                     /db_xref="GeneID:8291030"
     CDS             complement(755504..756172)
                     /locus_tag="KLTH0B09218g"
                     /note="similar to uniprot|P53328 YGR272C Saccharomyces
                     cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B09218p"
                     /protein_id="XP_002552187.1"
                     /db_xref="GeneID:8291030"
                     /db_xref="InterPro:IPR019310"
                     /db_xref="UniProtKB/TrEMBL:C5DD88"
                     /translation="MDRKQRRRTNKSAGAPIQLARVLGSGSNKIKRKIRDIERLLQKK
                     KDVLPDTVLIEKERALEALRLELHNAEQRVKIQNNAKKYHMVRFFERKKALRRYTKSV
                     KEGDADAVRERSIDLCYVVNFPKTEKYIALYPSEESESRDTDDKKGVAKTEARRAQFR
                     DLVAAKMDAGTLPVPLKDILKGKKLDRDDTGVQLETGESRASKEASISESEKEDEDED
                     DFFE"
     gene            complement(<756449..>757042)
                     /locus_tag="KLTH0B09240g"
                     /db_xref="GeneID:8291031"
     mRNA            complement(<756449..>757042)
                     /locus_tag="KLTH0B09240g"
                     /product="KLTH0B09240p"
                     /transcript_id="XM_002552142.1"
                     /db_xref="GeneID:8291031"
     CDS             complement(756449..757042)
                     /locus_tag="KLTH0B09240g"
                     /note="similar to uniprot|Q03559 YMR295C Saccharomyces
                     cerevisiae Protein of unknown function"
                     /codon_start=1
                     /product="KLTH0B09240p"
                     /protein_id="XP_002552188.1"
                     /db_xref="GeneID:8291031"
                     /db_xref="InterPro:IPR018809"
                     /db_xref="UniProtKB/TrEMBL:C5DD89"
                     /translation="MGLFRKSSNASTGAGHLHAPDTKLTKEDREHFKLRASSVHDPVL
                     EAVQEAQPFEQAADVSQDDPNRKSYYSGDGPDHLTRDVFGQPIQQPDISNPMRARDER
                     PLDTIRGFEYSISGDPSWGQRLETHQYGFRVRPDFPQFGNSGDAMAASGPGGMPSSQF
                     MMQEQAIYSAPAPGSALNPSKKKKKRGLFGRKKDTAE"
     gene            <758773..>761235
                     /locus_tag="KLTH0B09262g"
                     /db_xref="GeneID:8291032"
     mRNA            <758773..>761235
                     /locus_tag="KLTH0B09262g"
                     /product="KLTH0B09262p"
                     /transcript_id="XM_002552143.1"
                     /db_xref="GeneID:8291032"
     CDS             758773..761235
                     /locus_tag="KLTH0B09262g"
                     /note="weakly similar to uniprot|P39961 Saccharomyces
                     cerevisiae YER184C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B09262p"
                     /protein_id="XP_002552189.1"
                     /db_xref="GeneID:8291032"
                     /db_xref="GOA:C5DD90"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DD90"
                     /translation="MKVSKDTKKPAERAARACLNCRRRKVKCSGQSPCANCRNYNCAC
                     TYAVSEAQPQQEHCFNHPRDVTRMIGRMEKSLESLDELLHNNSESCAVLSEMSAKIEH
                     LKSLLDTGINAKWVTAYRGEKSLEYEITYRNHSLFRRYQPSISNLKSASGTTYELYSP
                     IMSLSVKGVSSVMHKLLSYADNEAARETFYLFLKSFDAANTFYLTSAAFWSMPLSTNL
                     NQFSSAPARGTTPLRLLVSQIPAELWPSPEAREKVDLTNATQACCELVRVLEKHYRIN
                     GDLPFGDGNLHSFVQFVGMDQLITTACAELLTRSTLSEFLSIEYADALLSFLECKTAL
                     ETSDRLCKIAAIAVRMLIDLGLDRWEYYVSVDEHTANRRRKLWWRAYWWDRLLSCYSG
                     RAPKVNDAHVTCLFPREVMALGIDDSMDHTTILENIPKSGTDLEAVMLAAYLAAGRHT
                     SYMFTNVLHARRFTHYKLHSDVGVAASDLIEELNVEVDGILRFQARLDAQIGPYREAL
                     TAHPIYQPVLPHLACVSLCLLLAVENLIRRVREAVATARPLPAAKSLARCRNQTLDSA
                     RALLVDVAHCKTLRQFLADKLASTVAFLVAVDHFIHGEPNAVDPALLALICSFAHQLT
                     RFSVTHKSEGDEGAHTELRYPSSILLVLARICLQIHNARHSPSGADTLSSALAEVLPA
                     ITVPEVRATVAELLTVTSRIWRPVLSCKDVSAYHGAILRHLDSGDPAVAETARSAGSS
                     FTRTDSVDQHADANRGGSAMGTAAAADVDDGPTDRGHVYQSTAFDAQLLELEALLDFS
                     RLPDLASVLCDYAGNSEAPADL"
     gene            <761694..>762773
                     /locus_tag="KLTH0B09284g"
                     /db_xref="GeneID:8291033"
     mRNA            <761694..>762773
                     /locus_tag="KLTH0B09284g"
                     /product="KLTH0B09284p"
                     /transcript_id="XM_002552144.1"
                     /db_xref="GeneID:8291033"
     CDS             761694..762773
                     /locus_tag="KLTH0B09284g"
                     /note="similar to uniprot|P40100 Saccharomyces cerevisiae
                     YER185W Hypothetical ORF and to YGR213C uniprot|P53047
                     Saccharomyces cerevisiae YGR213C RTA1 involved in
                     7-aminocholesterol resistance"
                     /codon_start=1
                     /product="KLTH0B09284p"
                     /protein_id="XP_002552190.1"
                     /db_xref="GeneID:8291033"
                     /db_xref="GOA:C5DD91"
                     /db_xref="InterPro:IPR007568"
                     /db_xref="UniProtKB/TrEMBL:C5DD91"
                     /translation="MSATVKEKVMFAATVSLKPSSYTAANGTIVHYLQRPYYTYTPTV
                     GGAAVFAVLFGISLVVLSVQLWQYSKQRTSMERQIMADGSVSRDQTEDVESHDDGGLG
                     LAAPAAVQPCSNARLIGKFVPLMVGIAVEIGGYAARIASRNDLYSIGPYVAQAVMLLV
                     APALMAATIYMNFGRLLTLLRATQLSIVPARFNTTIFVMGDILSFVLQGAGGGILGAS
                     DNHQLGSNIVIGGLAIQVFVFGFFVATEVRFLMCARRMSPVAYRISRHWKVLNINLFV
                     SSLLILARSIVRLVEFAQGFNGYIMEHEWFIYVFDAVPMFLVVVSFIVFFNNGNLFRV
                     EFECTSMISDSRKYSMDTMTGCIDK"
     gene            complement(<762842..>764500)
                     /locus_tag="KLTH0B09306g"
                     /db_xref="GeneID:8291034"
     mRNA            complement(<762842..>764500)
                     /locus_tag="KLTH0B09306g"
                     /product="KLTH0B09306p"
                     /transcript_id="XM_002552145.1"
                     /db_xref="GeneID:8291034"
     CDS             complement(762842..764500)
                     /locus_tag="KLTH0B09306g"
                     /note="similar to uniprot|P25045 YMR296C Saccharomyces
                     cerevisiae LCB1 Component of serine palmitoyltransferase
                     responsible along with Lcb2p for the first committed step
                     in sphingolipid synthesis"
                     /codon_start=1
                     /product="KLTH0B09306p"
                     /protein_id="XP_002552191.1"
                     /db_xref="GeneID:8291034"
                     /db_xref="GOA:C5DD92"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="UniProtKB/TrEMBL:C5DD92"
                     /translation="MRQPPEVLPSSIPVPEAVLRSSSYVWYYCQRAAHAIPGMRYVVS
                     YVRKSHQDDPYRTLFELFLIIYGIIYFFRKPRKQGEQAAPKLSEREVEALLDEWEPEP
                     IAQQNIKLEWRAKSTPVLMGNSSAPTRVNLTRDEGRESYSDVLNCASTSFLQISSDPE
                     FVKAAKDTIHQYGVGACGPAGFYGNQDVHSELEYNLARFFGTERAVLYGQDFCIAASV
                     IPAFTKRGDVIVADDRVNVALQNALQLSRSTVYYYNHNDMEALEELLEQLQERELNEK
                     LPSLPRKFIVTEGLFQNLGDIPDLPRLVELKRKYKYRLLVDETFSLGVLGANGRGIAE
                     YYNMKRDASVDITIGSLAVALGSSGGFVLGDNVMSMHQRIGSHAYTFSAALPAFAVTT
                     ASRVLDHLEHDNSAVQKLRSLSQLMHQLFIDDSELSPYIEVTSSKESSILHFRLTDEY
                     RSRVFHTTEESLFQELSAMHAKNLSEKYIEGCEREEKLLQRIVDMALKEHKVLLTRNT
                     FVLKHETLPVTPSLKLCCSAKMTEDELRSACESVKSAVLACTSE"
     gene            <765494..>767071
                     /locus_tag="KLTH0B09328g"
                     /db_xref="GeneID:8291035"
     mRNA            <765494..>767071
                     /locus_tag="KLTH0B09328g"
                     /product="KLTH0B09328p"
                     /transcript_id="XM_002552146.1"
                     /db_xref="GeneID:8291035"
     CDS             765494..767071
                     /locus_tag="KLTH0B09328g"
                     /note="similar to uniprot|P00729 Saccharomyces cerevisiae
                     YMR297W PRC1 Vacuolar carboxypeptidase Y (proteinase C)
                     involved in protein degradation in the vacuole and
                     required for full protein degradation during sporulation"
                     /codon_start=1
                     /product="KLTH0B09328p"
                     /protein_id="XP_002552192.1"
                     /db_xref="GeneID:8291035"
                     /db_xref="GOA:C5DD93"
                     /db_xref="InterPro:IPR001563"
                     /db_xref="InterPro:IPR008442"
                     /db_xref="InterPro:IPR018202"
                     /db_xref="InterPro:IPR029058"
                     /db_xref="UniProtKB/TrEMBL:C5DD93"
                     /translation="MKTSTLLAGALAASAQAASVQNVFQANTLLDKAIDALGLSSEDV
                     LDSLPKSLKSVWGEMGMLFPKETSQLEFVTKPKFKTNRRPDSQWDFVVQENPSHKLRV
                     NKIKDPQVLGVDPGVKQYTGYLDVEEEDKHFFYWFFESRNDPKNDPVILWLNGGPGCS
                     SLTGQFFELGPSHIGPEIKPIYNPYSWNSNASVIFLDQPVNVGYSYSGSSGVSNTVAA
                     GKDVYAFLQLFFKQFPEYASGQDFHIAGESYAGHYIPVFASEILSHPEEERSFNLTSV
                     LIGNGLTDELTQYQYYEPMACGEGGEPSVLEPEECEGMLDTLPRCLSLIEACYDSQSV
                     WTCVPASIYCNNAQMGPYQKTGKNVYDIRKECEGELCYAEMSYMDEYLNLDVVKEAVG
                     AEVDKFESCNFDINRNFLFAGDWMKPYHKAVTDLLNQGLPVLIYAGDKDFICNWLGNQ
                     AWSNVLPWKYGDEFQDAPVKDWISSTTGDTAGKVKNYEHFTFLRVYGGGHMVPYDQPE
                     NSLAMVNDWIQGRYSFE"
     gene            <767386..>767808
                     /locus_tag="KLTH0B09350g"
                     /db_xref="GeneID:8291036"
     mRNA            <767386..>767808
                     /locus_tag="KLTH0B09350g"
                     /product="KLTH0B09350p"
                     /transcript_id="XM_002552147.1"
                     /db_xref="GeneID:8291036"
     CDS             767386..767808
                     /locus_tag="KLTH0B09350g"
                     /note="similar to uniprot|Q03579 Saccharomyces cerevisiae
                     YMR298W Protein required for cell viability"
                     /codon_start=1
                     /product="KLTH0B09350p"
                     /protein_id="XP_002552193.1"
                     /db_xref="GeneID:8291036"
                     /db_xref="UniProtKB/TrEMBL:C5DD94"
                     /translation="MAQRTPQIYKLFQYVCAGLALIAAVEYFKYSTRINYEWFHCTLV
                     EEPWEQGSSLSRLYAVGGPSCDKRGELKTIMKKITRGFDLQKEGISFCIKEDLEVPSV
                     HYPIHDKKGAPGYVAYASYDSDSRDIREVCEDAPVLHI"
     gene            complement(<767865..>770873)
                     /locus_tag="KLTH0B09372g"
                     /db_xref="GeneID:8291037"
     mRNA            complement(<767865..>770873)
                     /locus_tag="KLTH0B09372g"
                     /product="KLTH0B09372p"
                     /transcript_id="XM_002552148.1"
                     /db_xref="GeneID:8291037"
     CDS             complement(767865..770873)
                     /locus_tag="KLTH0B09372g"
                     /note="similar to uniprot|P46677 YGR274C Saccharomyces
                     cerevisiae TAF1 TFIID subunit (145 kDa) involved in RNA
                     polymerase II transcription initiation"
                     /codon_start=1
                     /product="KLTH0B09372p"
                     /protein_id="XP_002552194.1"
                     /db_xref="GeneID:8291037"
                     /db_xref="GOA:C5DD95"
                     /db_xref="InterPro:IPR001878"
                     /db_xref="InterPro:IPR022591"
                     /db_xref="UniProtKB/TrEMBL:C5DD95"
                     /translation="MSSRKQTKKQLPGKGDLTNEDDAYDAVFSGEFGSMEIGNYIGPS
                     EGQTEHLPDAIDFEDEDELAEEELPEETQPSMRNMTQEDDDYLNMMSNGAILGEQADG
                     YSDRNNTLFMGVDGHEATFPEEHHPFGEFADENQIALEEQRKLLEKERVAREEKELLN
                     YYFPKFQKGKVLSLMSIVPKQISKYQWQRDLYLTNRHIKPMLPLKLRVEVQPDSRRLF
                     KSKSKSWQFMSELYKKKKPGLVTVPLEDMFADGKQSTQRRKMDGSIPSELMMIADEWD
                     YKKIIGDSDDEQESQSGKSTRSVAVSSETPTIQQDWNWDEENLVEGKVDQIKVCLDMN
                     DERLLFVKDKHQEHQESKAKPALLPFNEKSLLQKFNISNDDKYKILKENYQTKIRSTI
                     SNLSIEHSQPAFRLQSPFFKVVPPKGYIRHFHRPHFGGQVRPGTNIVFSKVKTRKRKR
                     DKGKDVRELFARSPDLTLGDSAPIFLMEYSEESPVALSKFGMGNKLINYYRKTDEKDL
                     SRPKLPVGETHVLGVQDKSPFWNFGFVEPGNVVPTLYNNMIRAPVFKHEVSGTDFLLI
                     KSTGNGMGNRFYLRNINHLFTVGQTFPVVEVPGPNSRRVTSMGKNRLRMIVYRILNKS
                     AEHRLLVKQVARHFPDQNDMQNRQRLKEFMKYQRDGDDHGFWKLKESEILPDNENVKK
                     MITPEDVSLTESMYQGQQFQEDNEFFNCDEKLIKLEENLIPWAATKNFLNATQMRAMV
                     QIHGAGDPTGCGEGFSFLKTSMKGGFTRSGDDSGQPQISGGHSYNVAQQQKAYEEEIS
                     KTWYTQAKSLRITNPFEEMEDPDVVNKTNKKVKSHRDDNKVLRIIRKKRDENGIIQRQ
                     TIIIKDPRVIQGYLRAYKKKREEAEANLGLEELMNDNIDLVSGGNTEEKQLKQKKLLE
                     EQLAKLQKSQERRQARKLAKEKTKDGKVTKARNTNRRCATCGMVGHIRTNKTCPMYNG
                     GTGAAIANPPTPGPAPGSENSVENAENAEA"
     gene            <771104..>771655
                     /locus_tag="KLTH0B09394g"
                     /db_xref="GeneID:8291038"
     mRNA            <771104..>771655
                     /locus_tag="KLTH0B09394g"
                     /product="KLTH0B09394p"
                     /transcript_id="XM_002552149.1"
                     /db_xref="GeneID:8291038"
     CDS             771104..771655
                     /locus_tag="KLTH0B09394g"
                     /note="weakly similar to uniprot|P53330 Saccharomyces
                     cerevisiae YGR275W RTT102 Regulator of Ty1 Transposition
                     regulator of Ty1 transposition"
                     /codon_start=1
                     /product="KLTH0B09394p"
                     /protein_id="XP_002552195.1"
                     /db_xref="GeneID:8291038"
                     /db_xref="InterPro:IPR018304"
                     /db_xref="UniProtKB/TrEMBL:C5DD96"
                     /translation="MEASALISRANNASTHTFSNSNPKYWKFDWYTPVKPKQAQSNEK
                     SSGENDSEEKFSFKYKTWLPSEKPAWKQLEAEVEEIIDLEQYDRTKQPKTLQPGSAPV
                     VNGQAAADGLTADDIRGAVGGQETMIGFSASDATTKNDTKPAQANHEGPDGRVDPTAS
                     LDANGEQKPESEKKDADGDLDLQ"
     gene            complement(<771758..>773746)
                     /locus_tag="KLTH0B09416g"
                     /db_xref="GeneID:8291039"
     mRNA            complement(<771758..>773746)
                     /locus_tag="KLTH0B09416g"
                     /product="KLTH0B09416p"
                     /transcript_id="XM_002552150.1"
                     /db_xref="GeneID:8291039"
     CDS             complement(771758..773746)
                     /locus_tag="KLTH0B09416g"
                     /note="similar to uniprot|P53331 Saccharomyces cerevisiae
                     YGR276C RNH70 3' exoribonuclease required for 5S and
                     tRNA-Arg3 maturation"
                     /codon_start=1
                     /product="KLTH0B09416p"
                     /protein_id="XP_002552196.1"
                     /db_xref="GeneID:8291039"
                     /db_xref="GOA:C5DD97"
                     /db_xref="InterPro:IPR006055"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="InterPro:IPR013520"
                     /db_xref="UniProtKB/TrEMBL:C5DD97"
                     /translation="MGFNLSKSQEANAAGESPIKDGHIQNGQAGARKIGSKTQDGKDE
                     TSFRSSVARLSICEDENTKAKILDKLQRKDSDDIIVNEKNSGDQKAGSKRRRRRSSGV
                     AGPSLGNLKKTLEEQHSSSSLNIPKRKKKSSQPASLSISQKALQKRVSIKDLRDLVLY
                     IFQDSNNAPGWIQVGNRASMNKMIVLFAPGLQADDFEKNKKHAWGDQTENPRATSLIS
                     LDDDELLDTIQRVPISAPGSKSTLYSAYNSFINVGLSKKEKEEKKQALNQKAITLNDL
                     VLRPDQLLENEYPVHEETPGLSEQEKQILSKTHAECDAAWKSTKSFEHGGSHTFALDC
                     EMCMSKDGLVLTRVSLVDFDCNLVYDSLVKPDVPIVDYLTRYSGITEEKLENVTVTLE
                     DVQNQLLKLVSADDILIGHSLQSDLNVLKLRHPKIIDTAVIFEHKAGPPFRPALKYLA
                     SEYLSQTIQNSEGLGHDSFEDARACMELTKLKIVNGLAFGVGVNTENLFQRLARAGVR
                     SLCLNDYAPKYTELTSSRNASEVNLRCANDEEIFDNIRSSLKEYDLFVGRLRELEFAR
                     EYAESPKGVTKEDFTAARERFVQRLKGLYHASPPSTVILVCSGTGDTRDWANIMRELN
                     KLNKDEKFEERKKRESEIQAAVYKARDAIGLLMTKKAE"
     gene            complement(<774127..>775104)
                     /locus_tag="KLTH0B09438g"
                     /db_xref="GeneID:8291040"
     mRNA            complement(<774127..>775104)
                     /locus_tag="KLTH0B09438g"
                     /product="KLTH0B09438p"
                     /transcript_id="XM_002552151.1"
                     /db_xref="GeneID:8291040"
     CDS             complement(774127..775104)
                     /locus_tag="KLTH0B09438g"
                     /note="weakly similar to uniprot|Q04949 Saccharomyces
                     cerevisiae YMR299C DYN3 Dynein light intermediate chain
                     (LIC) localizes with dynein null mutant is defective in
                     nuclear migration"
                     /codon_start=1
                     /product="KLTH0B09438p"
                     /protein_id="XP_002552197.1"
                     /db_xref="GeneID:8291040"
                     /db_xref="UniProtKB/TrEMBL:C5DD98"
                     /translation="MATNLWNNLLETNADLSAGSKTETAVVISAESQGVLQDFLVRVL
                     EVPDANASLSSIGYYCKDYGLDSGRPNDTVLHIYTLGWPVTPMNLDLLSIFVKPGARS
                     IKWVFLLDWLDGNKKLWLRSLQEGFELVNKKLQRDPCEIDDSSIVCMQSQCCKNLEVA
                     TAAWSSLKMEFINQALRSVAFLKHASLLALETYTSKKDIIEIGKVATGQNTSKAPEYI
                     QLNKLFIPKNSDSEGKIKTMGEKFPVHMVLEESFISGQFERLIPGEPNSEPITDPGSP
                     RKVVQLEEVDIQKELTEAYNLQKASLLENKTTSPASQIEPLNNSDLAGP"
     gene            complement(<775299..>776831)
                     /locus_tag="KLTH0B09460g"
                     /db_xref="GeneID:8291041"
     mRNA            complement(<775299..>776831)
                     /locus_tag="KLTH0B09460g"
                     /product="KLTH0B09460p"
                     /transcript_id="XM_002552152.1"
                     /db_xref="GeneID:8291041"
     CDS             complement(775299..776831)
                     /locus_tag="KLTH0B09460g"
                     /note="highly similar to uniprot|P04046 YMR300C
                     Saccharomyces cerevisiae ADE4 Phosphoribosylpyrophosphate
                     amidotransferase"
                     /codon_start=1
                     /product="KLTH0B09460p"
                     /protein_id="XP_002552198.1"
                     /db_xref="GeneID:8291041"
                     /db_xref="GOA:C5DD99"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005854"
                     /db_xref="InterPro:IPR017932"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="InterPro:IPR029057"
                     /db_xref="UniProtKB/TrEMBL:C5DD99"
                     /translation="MCGVLGIALGDQTSAVAPELFDGCLFLQHRGQDAAGIATCGQRG
                     RLYQCKGNGMARDVFTQQRMANLVGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGILL
                     GHNGNLVNTLSLRRYMDEDVHRHINTDSDSELLLNILAAELEKHNKYRVNNDDIFHAL
                     EGVYRLCRGGYACVGMLAGYAMIGFRDPNGIRPLLFGERTRPDGTKDYMLASESVVLK
                     AHNFNNFRDLAPGEAVIVPKDCGNTAPEFKQVVPINSYRPDLFEYVYFARPDSVLDGI
                     SVYHTRLAMGVKLAESIRKEIDPNDIDVVVSVPDTARTCALQCANTLQIPYREGFVKN
                     RYVGRTFIMPNQKERVSSVRRKLNAMDSEFKGKRVLVVDDSIVRGTTSKEIISMAKEA
                     GASKVYFASAAPAIRYNHIYGIDLADTKQLVAFDKSTEEVSQELGCDRVFYQSLEDLV
                     DCCKTDKISKFEVGVFTGNYVTGVEDGYLQELEKVRALNAAKQNFAKADSDIGLYNSA
                     DF"
     gene            complement(<777282..>779366)
                     /locus_tag="KLTH0B09482g"
                     /db_xref="GeneID:8291042"
     mRNA            complement(<777282..>779366)
                     /locus_tag="KLTH0B09482g"
                     /product="KLTH0B09482p"
                     /transcript_id="XM_002552153.1"
                     /db_xref="GeneID:8291042"
     CDS             complement(777282..779366)
                     /locus_tag="KLTH0B09482g"
                     /note="similar to uniprot|P40416 Saccharomyces cerevisiae
                     YMR301C ATM1 Mitochondrial inner membrane transporter
                     exports mitochondrially synthesized precursors of
                     iron-sulfur (Fe/S) clusters to the cytosol member of the
                     ATP-binding cassette (ABC) transporter family"
                     /codon_start=1
                     /product="KLTH0B09482p"
                     /protein_id="XP_002552199.1"
                     /db_xref="GeneID:8291042"
                     /db_xref="GOA:C5DDA0"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDA0"
                     /translation="MRPVDSIKLGGLVFRSLKPLPVRTSLCSRAFSLSPTARVSSTIP
                     TINSLRLYSTKNSPKIQENTVKSSPAPAKPKANEASKTPTIGELKILKDLFKYIWPNG
                     DNKVKARVLIALSLLVGSKVLNVQVPFFFKQIVDSMNIEWADPTAVLPIAVTAMILSY
                     GAARFGSVLFGELRNAIFASVAQSAITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMD
                     RGTKGISYVLSAMVFHIIPITVEIGAVCGILTYQFGASFAAMTFTTMLLYSIFTFKTT
                     AWRTEFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQYRDSQIKV
                     AQSLAFLNAGQNFIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLG
                     SVYRELKQSLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSKIVFENVSFGYDPDRMI
                     LKNSSFTMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLR
                     RAIGVVPQDTPLFNDSIWENVRFGKISASDEEIRLAVEKAQLESLVDQLPKGRDTIVG
                     ERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKT
                     SVYIAHRLRTIADADKIIVIQQGQVKEEGKHAELLAKPGSLYAELWNVQENLDVLNEE
                     LQREETQEKGDK"
     gene            complement(<779619..>780320)
                     /locus_tag="KLTH0B09504g"
                     /db_xref="GeneID:8291043"
     mRNA            complement(<779619..>780320)
                     /locus_tag="KLTH0B09504g"
                     /product="KLTH0B09504p"
                     /transcript_id="XM_002552154.1"
                     /db_xref="GeneID:8291043"
     CDS             complement(779619..780320)
                     /locus_tag="KLTH0B09504g"
                     /note="highly similar to uniprot|P40302 Saccharomyces
                     cerevisiae YMR314W PRE5 20S proteasome alpha-type subunit"
                     /codon_start=1
                     /product="KLTH0B09504p"
                     /protein_id="XP_002552200.1"
                     /db_xref="GeneID:8291043"
                     /db_xref="GOA:C5DDA1"
                     /db_xref="InterPro:IPR000426"
                     /db_xref="InterPro:IPR001353"
                     /db_xref="InterPro:IPR023332"
                     /db_xref="InterPro:IPR029055"
                     /db_xref="UniProtKB/TrEMBL:C5DDA1"
                     /translation="MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFA
                     VLVALKRNADELSSYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRK
                     LSLEKAGNLLSDKAQKNTQSYGGRPYGVGLLLAGYDNSGPHLLEFQPSGNTLELYGSA
                     IGARSQGAKTYLERTLQDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVVGQD
                     KPFTILDDEAVSPYL"
     gene            <780915..>782657
                     /locus_tag="KLTH0B09526g"
                     /db_xref="GeneID:8291044"
     mRNA            <780915..>782657
                     /locus_tag="KLTH0B09526g"
                     /product="KLTH0B09526p"
                     /transcript_id="XM_002552155.1"
                     /db_xref="GeneID:8291044"
     CDS             780915..782657
                     /locus_tag="KLTH0B09526g"
                     /note="similar to uniprot|P40308 YMR313C Saccharomyces
                     cerevisiae TGL3 Triacylglycerol lipase of the lipid
                     particle"
                     /codon_start=1
                     /product="KLTH0B09526p"
                     /protein_id="XP_002552201.1"
                     /db_xref="GeneID:8291044"
                     /db_xref="GOA:C5DDA2"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="InterPro:IPR016035"
                     /db_xref="InterPro:IPR021771"
                     /db_xref="UniProtKB/TrEMBL:C5DDA2"
                     /translation="MFKLYILSFFYLFLNHIPPFVWALGHVVSDIFQFWMRRLMNYLR
                     PRSRNLYHGAISDLEQCDNFSDWYQKAAIVDEITGADLWRRNFYSQRYDVNSVLEQYA
                     VLDEALDENDAHTIVHRFSTTGPSMLRNFAGIVDKRLFTKSLIGTKLLIEQYLDKVLE
                     CLQFLCQTPGVARTSFFQRCKLSLGTTAFILQGGSLFGLFHLGVIRGLLEQKLLPNII
                     SGSSMGACIGSLCSVLTNEELSVLLSGDNLLNAIKSDLDLLKQCGYGNIDQDLNLGSL
                     LQNVVHRGYSKDVFLFINFVNKVIIKDLTFEEAFQRTGKILNIIVHPTDQNRCPSLLN
                     YVTTPNVLIACAIDCSLGSEVVSSGTKLMCKNLKNEIVDYIPDTGSSRLVFLTPQNAS
                     ETGLIESPYTRLTELFNVNNFIVSLARPYLAPLVMNDLKHEIKTSKYYYYKHYPTTDM
                     SNFTPLQLSNMNEVEPLGFKFRYHLERKLKHIVTMELRHRVEVMDNLGILSHWIKRLA
                     IDEKTPRSATEITIVPNLKSLSLSRVIEGQLDNIPYWIKCGEQSCWPVLALIKTRCAV
                     EFGLDEIIKSKKNT"
     gene            complement(<782708..>783535)
                     /locus_tag="KLTH0B09548g"
                     /db_xref="GeneID:8291045"
     mRNA            complement(<782708..>783535)
                     /locus_tag="KLTH0B09548g"
                     /product="KLTH0B09548p"
                     /transcript_id="XM_002552156.1"
                     /db_xref="GeneID:8291045"
     CDS             complement(782708..783535)
                     /locus_tag="KLTH0B09548g"
                     /note="similar to uniprot|Q04868 Saccharomyces cerevisiae
                     YMR312W ELP6 Elongator protein part of the HAP subcomplex
                     of Elongator which is a six-subunit component of the RNA
                     polymerase II holoenzyme required for Elongator structural
                     integrity and histone acetyltransferase activity"
                     /codon_start=1
                     /product="KLTH0B09548p"
                     /protein_id="XP_002552202.1"
                     /db_xref="GeneID:8291045"
                     /db_xref="UniProtKB/TrEMBL:C5DDA3"
                     /translation="MSMAQKQDLVIFSDHSVLSRELFSKDLHHVLFVTHKLGTSPSWL
                     INALVETQVLGFPATLNESHAAAVNRASNRKITDSKCATVASFIHNRGFFTSALKKLK
                     VDAECYNIIDYMTDFVLKNYGKPASKVLSSLLEELSNESATSELLILEQPELLVHLLN
                     ITSDQLHLELINPLIKKFPLLVVVSYTEAYENVPSDSNEKLSSDMIEQIRFCNSCFFK
                     SAAVLGLKPLATGHASDVSGTLTITRGGASLSHLAVHVVENEYLFLTQKDTTKLFYR"
     gene            <783747..>785033
                     /locus_tag="KLTH0B09570g"
                     /db_xref="GeneID:8291046"
     mRNA            <783747..>785033
                     /locus_tag="KLTH0B09570g"
                     /product="KLTH0B09570p"
                     /transcript_id="XM_002552157.1"
                     /db_xref="GeneID:8291046"
     CDS             783747..785033
                     /locus_tag="KLTH0B09570g"
                     /note="highly similar to uniprot|P32527 Saccharomyces
                     cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
                     chaperone contains a DnaJ domain together with Ssz1p acts
                     as a chaperone for nascent polypeptide chains"
                     /codon_start=1
                     /product="KLTH0B09570p"
                     /protein_id="XP_002552203.1"
                     /db_xref="GeneID:8291046"
                     /db_xref="InterPro:IPR001623"
                     /db_xref="InterPro:IPR018253"
                     /db_xref="UniProtKB/TrEMBL:C5DDA4"
                     /translation="MISLPPLTSDINVNVNTSASKAASVRRPVEPVGRFFMHHAQRTL
                     RNHTWSEFEKIQASQNVQRVDESVDPDEELLDDELADESLLEHDPRDWKTADLYAAMG
                     LSKLRHKATDAQVIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYETLTDPTKRK
                     QYDSCDYNADVEPPKKGSKYDFFEAWGPVFEAESRFSKKQPVVLLGGPDASKADVEKF
                     YNFWHRFDSWRTFEFADEEVPDDSSNRDHKRYIERKNKAARDKKKTADNARLAKLVER
                     ASNEDPRIKQFKEAEKKEKEKKKWEREAGARAEAEAKAKAEAEAKAKAEAEAAAAAGA
                     KVDKKKAKEAAKAAKKKNKRAVRNAPKDADYFGDAEKAAAIDEQTGLIVDSVDDEQLV
                     QLAEKVKADAKAGLAEFAKVLSDSGKLPASLLSYFL"
     gene            <785306..>786223
                     /locus_tag="KLTH0B09592g"
                     /db_xref="GeneID:8291047"
     mRNA            <785306..>786223
                     /locus_tag="KLTH0B09592g"
                     /product="KLTH0B09592p"
                     /transcript_id="XM_002552158.1"
                     /db_xref="GeneID:8291047"
     CDS             785306..786223
                     /locus_tag="KLTH0B09592g"
                     /note="similar to uniprot|P53337 Saccharomyces cerevisiae
                     YGR284C ERV29 Protein localized to COPII-coated vesicles
                     involved in vesicle formation and incorporation of
                     specific secretory cargo"
                     /codon_start=1
                     /product="KLTH0B09592p"
                     /protein_id="XP_002552204.1"
                     /db_xref="GeneID:8291047"
                     /db_xref="GOA:C5DDA5"
                     /db_xref="InterPro:IPR002995"
                     /db_xref="UniProtKB/TrEMBL:C5DDA5"
                     /translation="MSFRGNSGFSGIPTTHQGYKQNPYTASAAGKSSSLKKTVMDELD
                     KLSNKVDDLTDHPVVQKLKPYTPAISRFFIVATFYEDSFRIISQWSDQVFFLWNYRHL
                     PYFFVVLFLLAVVLSMTVGATMLILRKRTIVATGVLCACIVLQGLVYGLYGGSFVLRN
                     VSVIGGLLIAFSDSIVQSKTTFGMLPELHNKDGKTKGFLLLMGRLLLVVLFVTFTFTK
                     NWLTVLLVIIGTICISVGFKTKLASILLGLILAFYNITVNNYWFYDSGKRDLLKYEYF
                     QNLSIIGGLLLVVSTGAGELSIDEKKKIY"
     gene            <786773..>787390
                     /locus_tag="KLTH0B09614g"
                     /db_xref="GeneID:8291048"
     mRNA            <786773..>787390
                     /locus_tag="KLTH0B09614g"
                     /product="KLTH0B09614p"
                     /transcript_id="XM_002552159.1"
                     /db_xref="GeneID:8291048"
     CDS             786773..787390
                     /locus_tag="KLTH0B09614g"
                     /note="similar to uniprot|P41818 Saccharomyces cerevisiae
                     YMR311C GLC8 Regulatory subunit of protein phosphatase 1
                     (Glc7p) involved in glycogen metabolism and chromosome
                     segregation proposed to regulate Glc7p activity via
                     conformational alteration ortholog of the mammalian
                     protein phosphatase inhibitor 2"
                     /codon_start=1
                     /product="KLTH0B09614p"
                     /protein_id="XP_002552205.1"
                     /db_xref="GeneID:8291048"
                     /db_xref="GOA:C5DDA6"
                     /db_xref="InterPro:IPR007062"
                     /db_xref="UniProtKB/TrEMBL:C5DDA6"
                     /translation="MVGILKNPLPDRNGESEEPESISEFRKQVYKNTQLNAKLTSKAQ
                     NNGKSTSKANAASPKRPVVPRDTLSLKHQHDTLSQAEEEKLKWNQQNLAENDIAKLEY
                     KDINIDEPKTPYQGAVDPTGEYYRDDDDELESLSLGEPVVEMPQSDSDNSSSSGPSDA
                     EPSAEESAEAKHRRFEELRKKHYNVKEALKAQRQNLDDEELEDED"
     gene            <787602..>788771
                     /locus_tag="KLTH0B09636g"
                     /db_xref="GeneID:8291049"
     mRNA            <787602..>788771
                     /locus_tag="KLTH0B09636g"
                     /product="KLTH0B09636p"
                     /transcript_id="XM_002552160.1"
                     /db_xref="GeneID:8291049"
     CDS             787602..788771
                     /locus_tag="KLTH0B09636g"
                     /note="similar to uniprot|Q04867 Saccharomyces cerevisiae
                     YMR310C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B09636p"
                     /protein_id="XP_002552206.1"
                     /db_xref="GeneID:8291049"
                     /db_xref="InterPro:IPR003750"
                     /db_xref="InterPro:IPR029026"
                     /db_xref="InterPro:IPR029028"
                     /db_xref="UniProtKB/TrEMBL:C5DDA7"
                     /translation="MAPKREGGVVGKGHNETAKKSKLSKPAKYTENNKKAANFTTKAP
                     KKKLKKTIKICSKTINYSLCIPVSVIDNCKNLEQATHVVYQIAKSAVLFNVGEIVVLD
                     LGRAEDVPKESRHRFQMSPVLLVASLLQYFVTPPYLVKSVFKKEYQECFKVAAKLPRI
                     TALPFMRHLHEDNGRYREGLAVRMQRPAQGARPAKKKAYDQTKYVNVGKDSALELRGQ
                     LVPANVRVTVDLIDCKVVSPAEAYGDFVGAQASYGFHVRVAKTFADIFTQSPAPNGYT
                     QTVWVNSGDFYFDPTTKKSLKLETKIPRIGKILKPTPEEVASGEAENPAHLLVVLGKW
                     DHLKKSFARSREMFAGCEGAHQFFDGQLELPGSAPEANIGIHDSCMIAMTMLASL"
     gene            <789016..>789939
                     /locus_tag="KLTH0B09658g"
                     /db_xref="GeneID:8291050"
     mRNA            <789016..>789939
                     /locus_tag="KLTH0B09658g"
                     /product="KLTH0B09658p"
                     /transcript_id="XM_002552161.1"
                     /db_xref="GeneID:8291050"
     CDS             789016..789939
                     /locus_tag="KLTH0B09658g"
                     /note="highly similar to uniprot|P15703 Saccharomyces
                     cerevisiae YGR282C BGL2 Endo-beta-1 3-glucanase major
                     protein of the cell wall involved in cell wall
                     maintenance"
                     /codon_start=1
                     /product="KLTH0B09658p"
                     /protein_id="XP_002552207.1"
                     /db_xref="GeneID:8291050"
                     /db_xref="GOA:C5DDA8"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DDA8"
                     /translation="MKFSTIASLAAVGVSYASAVGDLGFNLGVKNNDGTCKSTEDYAK
                     DLDILKGYTSTVKVYAASDCNTLQNLGPAAESAGFSVFVGVWPNDDAHFSAEKQALQS
                     YLPNIKTSTVKGILVGSEALYREDLTASELASKISEVKSLVADIKDSDGNSYSGTLVG
                     TVDSWNVLVDGGNADVIKASDMVMANAFSYWQGQTMDNASYSFFDDIMQAMQTIQTVK
                     GTDIPFWVGETGWPTDGTNFESSYPGTDNAAQFWQEGICAIRAWGVNVLVFEAFDEDW
                     KPNTSGTSDVEKHWGVWTSGDELKYSLDCKF"
     gene            <790481..>792934
                     /locus_tag="KLTH0B09680g"
                     /db_xref="GeneID:8291051"
     mRNA            <790481..>792934
                     /locus_tag="KLTH0B09680g"
                     /product="KLTH0B09680p"
                     /transcript_id="XM_002552162.1"
                     /db_xref="GeneID:8291051"
     CDS             790481..792934
                     /locus_tag="KLTH0B09680g"
                     /note="similar to uniprot|P32497 Saccharomyces cerevisiae
                     YMR309C NIP1 Subunit of the eukaryotic translation
                     initiation factor 3 (eIF3) involved in the assembly of
                     preinitiation complex and start codon selection"
                     /codon_start=1
                     /product="KLTH0B09680p"
                     /protein_id="XP_002552208.1"
                     /db_xref="GeneID:8291051"
                     /db_xref="GOA:C5DDA9"
                     /db_xref="InterPro:IPR000717"
                     /db_xref="InterPro:IPR008905"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR027516"
                     /db_xref="UniProtKB/TrEMBL:C5DDA9"
                     /translation="MSRFFANSYDYESGSSSSEEDLLSTSEEELMSSSSSEEEQANDS
                     FFDESESESDVDSDGSGDRPYGPDWFKKPEFRKGGSTGANKFLKNADYSNSEDSDDEG
                     RKVVKSAKDKLLDEMRGVYDKIEDAEMTQDWITILAELDNMTRLSTRAQQQNYGVPNI
                     FVKVLAQVEDAVAATSLQDINNKAVARAYNTTKQRVRKVARDYEQALSSFRENPEAHA
                     DDEAVQDNNSVSTFALAGKKTADLSSMATASSESDFFTALRIVIDSRGKKGTDFQAQI
                     KTLEELLDIAKSPYETILAYLNLIPIRFDSSATLSYQPIDQWKASQQDIAKLFDTLED
                     SIDAYHVSELAPHNDFIEEEPQPNEQGIKQVLGSVYSFVERLDEEFNKSLLNTDPHSS
                     DFLDRLKDEQGVYNLILRSQLYLEATSSDSELERRLARVLTRRFDHIYFKSVKLVEVS
                     ESKAWKSLREGAKSKVTPLDGEVDESYTFGLIDTLHKMLSTQKDGAQRRRAGLYQIYF
                     YALNNQFEKAKHMLLSSHIQSSINNADAPLQILFNRTVVQLGLAAFKLCLIDDCHQIL
                     NEVSTSTHLRDILGQQSLQRVAANNATNPGGASNEQLCLPFHQHINLDLIDVVFMTCS
                     LLIEVPHMAAFFSGIKVKRIPYSQKSIRRALEHYDKSSFQGPPETLRDHVLYAAKSMQ
                     RGDWDKSVEYLKKVPTWSLLPNTAEVLTNLAHRVQVEALRTYIFTYKRFYSKLSLLKL
                     SQLFGLSQETVVEVVSAIISQYDIKGRLDEESKFLVFEKGYEITKLEEVAVKLAKETK
                     YVSERLNEKKYVGSSRKQE"
     gene            complement(<796023..>800483)
                     /locus_tag="KLTH0B09724g"
                     /db_xref="GeneID:8291053"
     mRNA            complement(<796023..>800483)
                     /locus_tag="KLTH0B09724g"
                     /product="KLTH0B09724p"
                     /transcript_id="XM_002552163.1"
                     /db_xref="GeneID:8291053"
     CDS             complement(796023..800483)
                     /locus_tag="KLTH0B09724g"
                     /note="similar to uniprot|P53049 Saccharomyces cerevisiae
                     YGR281W YOR1 Plasma membrane transporter of the
                     ATP-binding cassette (ABC) family mediates export of many
                     different organic anions including oligomycin"
                     /codon_start=1
                     /product="KLTH0B09724p"
                     /protein_id="XP_002552209.1"
                     /db_xref="GeneID:8291053"
                     /db_xref="GOA:C5DDB0"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDB0"
                     /translation="MISSTSTSSDSGSEKDHVISIHAHNAPQARKLAAETGAGAGDTA
                     GVGAAIDAGVAAEAADASSVASSTVDQNRPETFLNSDDLERVTDSEIYPQKRLFSLLH
                     TRKIPQIPLPEERKTYPLYHTNPIYYAFFWWVFPIIRIGYKRTLQPNDLWAMDNRISI
                     EAIYATFTKYMDHYTEIARQNYAQEHPEASPEDVRENTTLSKHALFKALLRTFKLQYF
                     FALIAMSLSNATSAFIPMVTKRLIRFVEEKALVPGLKVNAGVGYAIGASIMMLLNAIL
                     LNHSFHLAQLTGVQVKSILIKAILNKSFKLSGYSKHKFPNGKITSVMSTDLSRLELAI
                     MFQPLLGAFFVAVIICIVQLIVNLGPVALVGVGIFAAAMVGSAYAFKRMINVRKTTNQ
                     FTDARVTLMREIMNSMKMIKFYAWEDAYEKNVNDVRTLEIRQTRIMQFTRNFVTALAV
                     CLPSLASMVTFLVMYKVNNNGRNPADIFSSLSLFQVLSIQMFFLPMALGTGVDGSIAL
                     NRVQEILEAGEEDQDIEKTCLPMDDEKHALKLVNASFQWENFEVEEAKDVAKAKQAED
                     DKKNRKDKKHNAHEVKTNDSDSTADSKKAPNVTFKGFDNLNIQITKGELVIVTGSVGT
                     GKSSLLYALSGFMKKTGGDIYKDGTMLLCGYPWIQNATVRDNILFGSPYNEARYNEII
                     RVCSLQADLELLPAGDRTEIGERGITLSGGQKARINLARAVYKKKDIYLFDDVLSAVD
                     ARVGKHIMDECLMGKLEGSTRVLATHQLSLIARASKVIYIDLDGSVDVGSVEELKKRK
                     PGFVNLMQYSNHSESEKKPGEVEEEKRQEAGAGAQPVRPEIDSRQSELEASELKKQVS
                     KRSQLQDEQKGVAPDGRLTSKEERAVNSISYKVYQQYITAGVGKKGFLMLPIYLMLLA
                     VSTFSLLFSSVWLSFWTENKFKHKKTPFYMGMYTFFVFFNYFVTTSQFSLICYIGLSA
                     AKRLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVRLFVFQLSNIV
                     GVIVMCIIYLPWFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLG
                     GMDTIRAYRGERRFLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIAMAFALIVTLLC
                     VTRQFHISAASVGVLLTYVLQLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAA
                     YRRPEMSPPAEWPTDGRIEFDHVSLAYRPGLPLVLKDVTLHVAAGEKIGICGRTGAGK
                     STIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPF
                     HERTDDELWHALVRGGAIPAESLATVRAQTHENAGSLSNMHKFHLQQEVEEDGTNFSL
                     GERQLLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAFSNCTILCIAHRLNT
                     ILDYDRILVLDQGRVCEFDTPAALYARGGVFTEMCDRSGITRDDFNTRHH"
     gene            complement(<801412..>803589)
                     /locus_tag="KLTH0B09746g"
                     /db_xref="GeneID:8291054"
     mRNA            complement(<801412..>803589)
                     /locus_tag="KLTH0B09746g"
                     /product="KLTH0B09746p"
                     /transcript_id="XM_002552164.1"
                     /db_xref="GeneID:8291054"
     CDS             complement(801412..803589)
                     /locus_tag="KLTH0B09746g"
                     /note="some similarities with uniprot|Q12180 Saccharomyces
                     cerevisiae YOL089C HAL9 Putative transcription factor
                     containing a zinc finger overexpression increases salt
                     tolerance through increased expression of the ENA1 (Na /Li
                     extrusion pump) gene while gene disruption decreases both
                     salt tolerance and ENA1 expression"
                     /codon_start=1
                     /product="KLTH0B09746p"
                     /protein_id="XP_002552210.1"
                     /db_xref="GeneID:8291054"
                     /db_xref="GOA:C5DDB1"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DDB1"
                     /translation="MSNVMEKSPSLGTKANKANEFKRILEKIESLEKEVVGLAEQLRS
                     NSLSASLQEKRRKRRARSSGKAWASKRRPTSISLQRVSSLDLLANVVLQVNSRGKPQG
                     SKSEADESSGALKYAENFSLKEVPNFAYFGDFGVFSSYAILTPKGLEWIRSKSINCEE
                     EIGYLGNWYSQFLQSKKSESLFPLPIALQPRPELAVLEALIQVFEKSRLHAMSFAFLD
                     GIQALFKELLEGEAKSLKASKHIVLNVALALVCHFQQHSSKTPIEGMSSEVMETMQNL
                     EALVEMEDNFISNALFYYHQVSIMPEGILTLQAMLALLAYTDFTGALHASYIMVTLAI
                     RLAQDLGLHAEITYEGLDIAEDEKRRKMWGLCRYFDLKLSMILGRPPVVANYDTTTSF
                     PNCGTYLGLLAEVCAGTSANPPTCELSFAKKLLHLVVKETGFDLYGGFHIFRLVRVAS
                     RVYSQLYAPSTAINLKKHLASAQALLTEMESFRLSLPDGVRPLSPVKKAVIADLFKVS
                     NLPPTMTQVLIYSIHFLFYMNLMFIQKALFKTQVYLKENGEYSETPFYESVRTARHAL
                     SLVAETFEPDMNGYFKPFQWTISMAFFEVFVYTLSKQDDPQEFEHDVRLMAHVQCDFF
                     TRYDSIDAVVGPCTQAHRQNALPSPNLQNNFKHMINVLRKTFSARFGRNVQLTPAQHD
                     CLQYSASDIATTPDREMNSPSMNPFSGVDNMEFFGLDANMFGL"
     gene            <805761..>809039
                     /locus_tag="KLTH0B09768g"
                     /db_xref="GeneID:8291055"
     mRNA            <805761..>809039
                     /locus_tag="KLTH0B09768g"
                     /product="KLTH0B09768p"
                     /transcript_id="XM_002552165.1"
                     /db_xref="GeneID:8291055"
     CDS             805761..809039
                     /locus_tag="KLTH0B09768g"
                     /note="similar to uniprot|P32337 Saccharomyces cerevisiae
                     YMR308C PSE1 Karyopherin/importin that interacts with the
                     nuclear pore complex acts as the nuclear import receptor
                     for specific proteins including Pdr1p Yap1p Ste12p and
                     Aft1p"
                     /codon_start=1
                     /product="KLTH0B09768p"
                     /protein_id="XP_002552211.1"
                     /db_xref="GeneID:8291055"
                     /db_xref="InterPro:IPR011989"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DDB2"
                     /translation="MSALPDEVNTTLVNVLHGFSSPDNGIRAAAEETLNKDWITPDNI
                     EVLLIFLSEQAAYSPEPTLAALSAVLFRKLALRAPPSSKTVIIAKNITHISESALNQI
                     RETLLKGFVTERQGGIRHKLSDAIAECAQEDLPEWPALLQGLFEAIKNPDANFRESSF
                     RIFTSVPHLINAVDINSVLPIFEAGFTDSDDNVKVAAVTAFVGYFKQLPKQHWAKLGI
                     LLPSLLNSLPNFLDGGKDDALASVFESLIELVELAPKLFKNMFDQMIQFTDIVIKNKD
                     LETSARTTALELLTAFSESAPQMCKSTPSYAQSLIMNTLLMMTEVSIDDDQASDWHDS
                     DDTEEDDEEVTYDHARQALDRVSLKLGGKYLAPPLFQYLQQMVSSSEWRERFGALMAL
                     SSAAEGCRDVLIGEIPKILDMIVPLINDPHPRVQYGCCNALGQISTDFAPLIQRTSHE
                     RILPPLISKLTPQSVDRVQTHAAAALVNFSEHATQTILEPYLDDLLTNLLTLLQSTKF
                     YVQEQALTTIAFIAEAAEKKFIKYYDTLMPLLINVLKTDTGNANRLLKGKCIECSTLI
                     ALAVGKEKFLTQSQELIELFIAYQNQGIDDDDPMKSYLEHGWSRICRILREDFVPLLP
                     VVIPPLLETAKATQDVSLIEEEDAANFQQYSDWDVVQIQGKHIAIHTSILDDKVSAME
                     LLQVYTTILKNFFAVYVPEIMKEIAVPSIDFYLHDGVRATGAGLIPVLLSALVSATGV
                     QNSDVLQLWHLASTKLLNGIISEPMPEITQIYHTALVDGLAIMGENSLSDEQLLQYTK
                     GLSANLSDIYERVKQRRNQEDEYNEDVDDDFEDYTDEDLLDDINKSLAAVFKSTGGRY
                     LNQFQTLWPLVVTYLRDGEVILTLFALCAIGDMIETAGPATEVYKDSFINEVKEYLVS
                     PEASIRQAAAYVIGVCAQHSRDVYAQECSQSLDTLVRVISIPDAKSEENVTSTENASA
                     AIAKILHSYGPNVPNFDNYVSNWLKTFPIVQDEEAAAFNYRFLAHLIDSNSPAVHNSA
                     AIPHILDSVVQALHHKSLVGKNASAVVESTKKLLGTLPQSEAMNLFQRYPSDVVQEVQ
                     HWFA"
     gene            <809351..>810328
                     /locus_tag="KLTH0B09790g"
                     /db_xref="GeneID:8291056"
     mRNA            <809351..>810328
                     /locus_tag="KLTH0B09790g"
                     /product="KLTH0B09790p"
                     /transcript_id="XM_002552166.1"
                     /db_xref="GeneID:8291056"
     CDS             809351..810328
                     /locus_tag="KLTH0B09790g"
                     /note="some similarities with uniprot|P53335 Saccharomyces
                     cerevisiae YGR280C PXR1 Protein with a role in maturation
                     of rRNAs and small nucleolar RNAs required for cell
                     viability"
                     /codon_start=1
                     /product="KLTH0B09790p"
                     /protein_id="XP_002552212.1"
                     /db_xref="GeneID:8291056"
                     /db_xref="GOA:C5DDB3"
                     /db_xref="InterPro:IPR000467"
                     /db_xref="UniProtKB/TrEMBL:C5DDB3"
                     /translation="MGLAATKNKQKLGLDPRNTAWSNDTSRFGHKHLEKMGWRPGSGL
                     GMMPNATTTHVKVSIKDDNLGLGAKLRKKDKADEFDSGECAGLDAFQRLLGRLNGKED
                     SVSNELDIQKKQNIINGKWGIHFVKGDVLASTWDAKTKTLKLYSNESTKRKLDSEDEE
                     YPSSRESKRSKKSKESRKSDKKKDVSEEDKETVKKGDKSRKDKDKKLKKDGDTKDKKE
                     KRVKKEKKDKKDKKDKHKMKKTEDKKQKHKKSEKDRDEKHKNKKDKKREYKSSKSNKV
                     SRESMLKPRDPQENAIASRLSVRSKWIKQKRAAVMDAQALNEIFMVTTQ"
     gene            complement(<810486..>812117)
                     /locus_tag="KLTH0B09812g"
                     /db_xref="GeneID:8291057"
     mRNA            complement(<810486..>812117)
                     /locus_tag="KLTH0B09812g"
                     /product="KLTH0B09812p"
                     /transcript_id="XM_002552167.1"
                     /db_xref="GeneID:8291057"
     CDS             complement(810486..812117)
                     /locus_tag="KLTH0B09812g"
                     /note="similar to uniprot|P22146 Saccharomyces cerevisiae
                     YMR307W GAS1 Beta-1.3-glucanosyltransferase required for
                     cell wall assembly localizes to the cell surface via a
                     glycosylphosphatidylinositol (GPI) anchor"
                     /codon_start=1
                     /product="KLTH0B09812p"
                     /protein_id="XP_002552213.1"
                     /db_xref="GeneID:8291057"
                     /db_xref="GOA:C5DDB4"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DDB4"
                     /translation="MRFATSSLLLSLLSVLQLALADGNDTTPAIEVKGNKFFFSNNGS
                     QFYMKGVAYQADTANSTAGDEDTIVDPLADYETCSRDLPYLLGVHTNVVRVYALNTSL
                     DHSKCMNAFADAGIYVIADLSEPSESINRDSPAWTLDLYERYTSVVDAVANYSNVLGF
                     FAGNEVTNNKSNTNASPFVKAAIRDTKKYMKDKGYRNIPVGYSSNDDEETRVSMADYF
                     ACGDDDVKADFYGINMYEWCGSSTFQSSGYEDRTKEFSNLSIPAFFSEYGCNESPPRK
                     FQEVEALYGDDMTDVWSGGIVYMYFEEANKYGLVSTSGNTVKTLDDYNNLKKEIASVS
                     PSSVNKNSYTPSTTSLKCPATGTNWNASTELPPTPDKDVCDCLKSSLSCVLADDVESK
                     DYGDLFSYLCDKIGCDEITADGSAGNYGEYSFCDADIKLSFLLDKYYQKNGKNKSDCS
                     FSGSASLASSTSQASSCQAKLSSATASAKSTGSSNSNSSGSSASSSNSSSSASSSSNS
                     KKSGGIQVKPASPAGLWLVAIMVASASVGLGSIVF"
     gene            complement(<812816..>814456)
                     /locus_tag="KLTH0B09834g"
                     /db_xref="GeneID:8291058"
     mRNA            complement(<812816..>814456)
                     /locus_tag="KLTH0B09834g"
                     /product="KLTH0B09834p"
                     /transcript_id="XM_002552168.1"
                     /db_xref="GeneID:8291058"
     CDS             complement(812816..814456)
                     /locus_tag="KLTH0B09834g"
                     /note="similar to uniprot|P22146 Saccharomyces cerevisiae
                     YMR307W GAS1 Beta-1.3-glucanosyltransferase required for
                     cell wall assembly localizes to the cell surface via a
                     glycosylphosphatidylinositol (GPI) anchor"
                     /codon_start=1
                     /product="KLTH0B09834p"
                     /protein_id="XP_002552214.1"
                     /db_xref="GeneID:8291058"
                     /db_xref="GOA:C5DDB5"
                     /db_xref="InterPro:IPR004886"
                     /db_xref="InterPro:IPR012946"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DDB5"
                     /translation="MLFRKITALSVASLLTSRVVADDLPAIEVKGNKFFFSNNGSQFY
                     MKGIAYQQDTANTTSGESFNDPLADYETCSRDIPYMQAVDTNTIRVYALNNSLDHTKC
                     MQALNDAGIYVIADLSQPSQSINRDDPAWDLELYKRYTDVIDAMHNYTNILGFFAGNE
                     VTNNKSNTAASAFVKAAIRDCKKYIKDKGYRDIPVGYSTNDDEETRVSMADYFACGDE
                     DVRADFYGINMYEWCGSSTFQSSGYEDRTKEFSNLTIPIFFSEYGCIESRPRKFQEVG
                     TLYSDDMTDVWSGGIVYMYFEEANNYGLVSVSGDKVSTLSDYSYYSEEIKSVSPTSVN
                     SKTYTVSNATLSCPATNSNWKAATSLPPTPNQQVCECMSGSLSCVVADDVDEDDYQDL
                     FDYVCGVISCDGITASGSNGTYGSYSFCDAKSKLSFVLNKYYESNGSSKSACSFSGSA
                     SLQTASTASTCSSILSQIGSQGTGSATGLSSATGVSSISTGSNSGSKSGSSSSSSSSS
                     SSDKKNAASTNSPKSVAQILLTAFVAIGATAGVGFVIA"
     gene            complement(<815242..>820530)
                     /locus_tag="KLTH0B09856g"
                     /db_xref="GeneID:8291059"
     mRNA            complement(<815242..>820530)
                     /locus_tag="KLTH0B09856g"
                     /product="KLTH0B09856p"
                     /transcript_id="XM_002552169.1"
                     /db_xref="GeneID:8291059"
     CDS             complement(815242..820530)
                     /locus_tag="KLTH0B09856g"
                     /note="similar to uniprot|Q04952 Saccharomyces cerevisiae
                     YMR306W FKS3 Protein of unknown function has similarity to
                     1,3-beta-D-glucan synthase catalytic subunits Fks1p and
                     Gsc2p"
                     /codon_start=1
                     /product="KLTH0B09856p"
                     /protein_id="XP_002552215.1"
                     /db_xref="GeneID:8291059"
                     /db_xref="GOA:C5DDB6"
                     /db_xref="InterPro:IPR003440"
                     /db_xref="InterPro:IPR026899"
                     /db_xref="UniProtKB/TrEMBL:C5DDB6"
                     /translation="MEDEQFSAWYHDGEAPVTRTELRDIFDDLARKFGFQQSSKENMQ
                     QHMLAQLDSRARRSSARTALTSLHASYIGGDEANFKKWYFAAQLDLDEEIGFQNLKLH
                     GKARKRNLKHAKERGVSIEEQIRLWKEQEEEFANSHPKLPFTQTQPKINESFATADYK
                     WKLRMRDLEPGQMARQLALYFLCWGEANQIRFTPECLCFIFKCALDHDVSEADVCQAS
                     KPEFSYLDDIITPLYRFLRSQVYHVDETNGKMTRLEKDHKDIIGYDDVNQLFWYPEGI
                     ERLVLESGERLIDKPSHERYLSLKDVLWSKAFYKTYKETRTWMHCATNFNRIWIIHLS
                     TFWFFTSFNAPTLYTKDYVQLLNNPPTRQARLSAVALGGTLTCIIQIVATLFEWSFVP
                     RKWPGGQHLTRRMIALLVCLAINFAPSVYVFGFFDLDVHSTYAYTASIIQLIIAIVTT
                     FFFAIRPLGGLFESYLFKGRKKRRYTSSQTFTAQFPKLMGRSRWFSWGLWFFVFLGKF
                     IESYFFLTLSLRDPIRVLSIMDMSRCNGDSLLGSHLCRLQPKITLIIMILTDLVLFFL
                     DTYLWYIICNCIFSIILSFSLGTSILTPWKNIYSRLPKRIHSKILATSEMDVKYKPKI
                     LVSQIWNAMIISMYREHLLSIEHVQRLLYQQVDSANMNKRTLKSPTFFVAQDDSTFKS
                     MDFFPENSEAERRISFFAQSLSTPISEPIPVECMPTFTVLIPHYSEKILLSLKEIIKE
                     ESTKSRITLLEYLKYLYPTEWECFVRDTKLIAVENCSINNDQGESESEVLKEGLLGVS
                     KEYDDRSKFFQAKIEDLPYHCMGFTNSDPEYTLRTRIWASLRFQTLYRTVSGFMNYSK
                     AIKLLYRIENPTIIQKYGADFELLEEELDRLSREKFRMVVAMQRLKKFDRHEREAAEF
                     LLKAYPDMCISYLEEVPQENGEAIFYSCLIDGHCDFEDTTGERKPQFKIRLSGNPILG
                     DGKSDNQNHSLIFYRGEYIQVIDANQDNYLEECLKIRSILGEFEELDLDQSMPYIPGV
                     DSGGDAPIAIVGAREYIFSENIGVLGDIAAGKEQTFGTLFARTLAEIGGKLHYGHPDF
                     LNGIFMTTRGGISKAQKGLHLNEDIYAGMTAVCRGGRIKHSDYYQCGKGRDLGFGSIM
                     NFTTKIGAGMGEQLLSREYYYLGTQLPIDRFLSFFYAHAGFHLNNLFITMSVQIFFIL
                     LINLGSLNHEVIRCEYNKDLPITDLERPIGCYNILPVLHWVNIFVLSIFIVFFIAFAP
                     LLIQELLEKGAWKAFSRLIHHLFSLAPLFEVFVCQIYARSLLTNVTFGGAKYISTGRG
                     FAITRLDFPELYSKFANTSIYAGSKIFLMLLFATVSMWQPALLWFWITVVSMCLAPFL
                     FNPHQFAFTDFFVDYRNFIHWLSRGNSKYERKSWIEHVRSSRAVFTGYKRKIVGDISE
                     ESASETRRAQISDVFAAEVIIPLLTAGLSFTAYTFINAQTGVPSATATSAVIRLGIVT
                     FLPIFVNFIVLFVCFQLSFFAAPLLSLCCKKVGATIAAIVHGFAVVIYLITFEVMWCL
                     EGWSFTRALTLLIACISIQNFVFKVITIFFLTREYRNNKSQLAWWSGKWFTTGIGWIA
                     VLQPSRELFVKTIECSLFAGDFILGHLILFVQLPLVFTPFVNYWHSMMLFWMKPKSLI
                     SNKLAYTKKQKLRRRRIVQKYLPIHCLILFLFIGLLVAPFYTAKNLPLGPDTFKNSFL
                     DGLIQPKSQDNNDTGTRAPSYILTTTPPMPVFRTVR"
     gene            <821778..>822995
                     /locus_tag="KLTH0B09878g"
                     /db_xref="GeneID:8291060"
     mRNA            <821778..>822995
                     /locus_tag="KLTH0B09878g"
                     /product="KLTH0B09878p"
                     /transcript_id="XM_002552170.1"
                     /db_xref="GeneID:8291060"
     CDS             821778..822995
                     /locus_tag="KLTH0B09878g"
                     /note="some similarities with uniprot|P53334 Saccharomyces
                     cerevisiae YGR279C"
                     /codon_start=1
                     /product="KLTH0B09878p"
                     /protein_id="XP_002552216.1"
                     /db_xref="GeneID:8291060"
                     /db_xref="GOA:C5DDB7"
                     /db_xref="InterPro:IPR000490"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="UniProtKB/TrEMBL:C5DDB7"
                     /translation="MRFSQVLSSASMIGASLASPLGHEHAEHKRAVAYVTNVQTTTVY
                     GTAPQQIGGASTTVSLDASNTLAQQAATQTSSLSEVSRGVAAVPSEATSTVSESSSSS
                     SAASSTSVASNSAAASSSASASSSASASSSASSSSSQASSTASSSVGSGGAKGITYSP
                     YSDSGSCKSSSQIASELSQLSGFDIIRLYGVDCDQVSAVLQGKSSNQKLFLGVYYVNA
                     IEDGVNAIKDAINSYGSWDDVYAVSIGNELVNGGEATVSQVGSYVEEGRTHLTAAGYN
                     GPVVSVDTFIAVINNPGLCDHSDFMAVNAHAYFDYNTAAEDSGTWVMEQIERVWGACQ
                     GNKNVLITESGWPSVGQTLGKAVASKENQKSAISSIKSVCGNSVILFTAFNDYWKADG
                     AYGCEKYWGIFSD"
     gene            complement(<823250..>825040)
                     /locus_tag="KLTH0B09900g"
                     /db_xref="GeneID:8291061"
     mRNA            complement(<823250..>825040)
                     /locus_tag="KLTH0B09900g"
                     /product="KLTH0B09900p"
                     /transcript_id="XM_002552171.1"
                     /db_xref="GeneID:8291061"
     CDS             complement(823250..825040)
                     /locus_tag="KLTH0B09900g"
                     /note="similar to uniprot|P53333 Saccharomyces cerevisiae
                     YGR278W CWC22 Essential protein component of a complex
                     containing Cef1p has similarity to S. pombe Cwf22p
                     putative spliceosomal component based on computational
                     analysis of large-scale protein-protein interaction data"
                     /codon_start=1
                     /product="KLTH0B09900p"
                     /protein_id="XP_002552217.1"
                     /db_xref="GeneID:8291061"
                     /db_xref="GOA:C5DDB8"
                     /db_xref="InterPro:IPR003890"
                     /db_xref="InterPro:IPR003891"
                     /db_xref="InterPro:IPR016021"
                     /db_xref="InterPro:IPR016024"
                     /db_xref="UniProtKB/TrEMBL:C5DDB8"
                     /translation="MSQEDQDVVILQKESWDHLKSYIKQCFRSLTRSSVVEEYRKLFA
                     VNILWGERLVVSSVLQKQSAGDSSEILAALTSLLNAHIPQLGELLIEETTSRFLNAFK
                     THNSKGCYAMAALIAELFNYEVLHEILILQILHLLMEGVNVDSACLAMFVLSKCGRQL
                     MLVAKTAHDLAFESLRKFFQENKVERAVYRRFEDLFDLRKRNYPQLSKRIHLPDHETV
                     THTFLLDLESSTPSSDESLEEFRYDRNFMEKESEIETLRSKLFALEGTDATPDEQRPA
                     EDKTQSRELEMKKKIYLTLKGSLSGDEAAHKILKYKFPDSEKKAVVDILVTACSQETT
                     YSKFYGIVAERLCSSHKSWKAAFGQSFHDNYSAVDEFQANQVRNMGKFWGHILASDYL
                     GFEVFESVHMNANETSSAGRVYLKFLFQELVLDLSIDTLQARLDEPYIQPFLVNLFPK
                     DDAEKSRFSINYFTAIGLGRLTEGMRQALADMEKKVVALQDTEAESGSSLFSRRGSSS
                     SPKTKAYIQGERASSETDNSHSLERSYRRPQDEEFSQTRYSESLTRSRTSVRRRSRTP
                     TRRRSRTPTRRRSRTPARRRSRSPNTRFGP"
     gene            <825139..>825996
                     /locus_tag="KLTH0B09922g"
                     /db_xref="GeneID:8291062"
     mRNA            <825139..>825996
                     /locus_tag="KLTH0B09922g"
                     /product="KLTH0B09922p"
                     /transcript_id="XM_002552172.1"
                     /db_xref="GeneID:8291062"
     CDS             825139..825996
                     /locus_tag="KLTH0B09922g"
                     /note="similar to uniprot|P53332 Saccharomyces cerevisiae
                     YGR277C Homolog to human PPAT"
                     /codon_start=1
                     /product="KLTH0B09922p"
                     /protein_id="XP_002552218.1"
                     /db_xref="GeneID:8291062"
                     /db_xref="GOA:C5DDB9"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="UniProtKB/TrEMBL:C5DDB9"
                     /translation="MPAVAITLSSYKETDQNLLDGVLEDILPLLVKEGSSLDIIIVEK
                     IHSVDYLDYVLGKLYSGTRETLLAEDLYDTPINVLFNQDLSSYVDKKWDLLITDKNEV
                     VQLPHKELRKVRLLKEVNEHERQDSSKDDPLYMVSALGGTFDHLHDGHKILLSAAAFL
                     TVSRLIIGVTDQELLQKKQFREQLEPYETRSGNVRSFLSRIKPSLKVEIVALRDVCGP
                     TGAVPEIESLIVSRETVSGGQIVNNARRSKGLKELKVHVVNVLGGKEEDGWKEKISST
                     ELRRRCSLK"
     gene            complement(<826050..>829619)
                     /locus_tag="KLTH0B09944g"
                     /db_xref="GeneID:8291063"
     mRNA            complement(<826050..>829619)
                     /locus_tag="KLTH0B09944g"
                     /product="KLTH0B09944p"
                     /transcript_id="XM_002552173.1"
                     /db_xref="GeneID:8291063"
     CDS             complement(826050..829619)
                     /locus_tag="KLTH0B09944g"
                     /note="similar to uniprot|P50101 Saccharomyces cerevisiae
                     YMR304W UBP15 Ubiquitin-specific protease that may play a
                     role in ubiquitin precursor processing"
                     /codon_start=1
                     /product="KLTH0B09944p"
                     /protein_id="XP_002552219.1"
                     /db_xref="GeneID:8291063"
                     /db_xref="GOA:C5DDC0"
                     /db_xref="InterPro:IPR001394"
                     /db_xref="InterPro:IPR002083"
                     /db_xref="InterPro:IPR008974"
                     /db_xref="InterPro:IPR018200"
                     /db_xref="InterPro:IPR024729"
                     /db_xref="InterPro:IPR028889"
                     /db_xref="InterPro:IPR029346"
                     /db_xref="UniProtKB/TrEMBL:C5DDC0"
                     /translation="MSEKPAFQENVGELIDLGKGISDVLPELESQETECEGAFTWHIG
                     NWSQLKQDKHVSPRFRIGEYEWDVLLFPQGNHNSGISMYLEPHPEEKFNEEKQCLEPT
                     DPDWHVCAQFAIGISKPGEDTKCQLFNVSHHRFSATDTDWGFANYIELESLKRRTSSK
                     NSGFLSNGRLNVSVFVRILKDPTGVLWHNFMNYDSKKLTGFIGLKNQGATCYLNSLLQ
                     SYFFTKLFRKIVYKIPSENESPNDSVLLALQRSFYLLQKSNETLDTLELTRSFGWDTG
                     DAFTQHDVQELNRILMDRLETRMKGTEVEGALNELFVGKMKSYIRCINVDYESSRVED
                     FWDIQLNVKNLKGVQESFDNYVEVEIMDGENQYAAQDYGLQDAKKGVVFESFPSVLHL
                     QLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCVYNLHGVLVHSGE
                     ISVGHYYAMIKPDVGDQWFRFDDDKVWRVTKEQAFDENFGHEPLPDDKLRSLTREQYQ
                     NYLIARQTSAYMLVYIREDMEKNVLEDVSDTDVPQHIVTSIEKELKEREQKRKELEEM
                     HLYTKVNIHSMSNFVNYQGFDLSPNERSKLYSSELHDESEYASSLKILKTTKLRDVKS
                     EISSKLNLPRTHRVNYWIMSYRKNYTLRLDSILAPELDSLSLEQVIHKMGISRATAID
                     FFVEEPYLELAFLNELLKANIIPPSRLTSESVLKIRKAAYEENFPESSKYLSSPEEDS
                     PKVLVFLKVFDTEVRRLEGFAHTLVNRTDKVSKLVELAGHFCSVNTTEFFYEEFQPDT
                     IEPIEREMQFVASELVDGDILSFSTTQSRQNLSSQPPSLLEYYDYLRYRIKISLTRTV
                     NAEEEYVATDESNNDGPLELWISAKASYQELAQKISQRTGISAHFIRTFAIYGNGRFA
                     LKWDCKISDFLVKNYTRDSIPPFEYEVLSIPLKEFEHLRSIKFYWLSDSYVHYQLYEF
                     RIANSCTIGEFMDKLQQRLHFDDEQKSKILIWTNCDFKFQGILSEENVFEELSESFLF
                     FGRILPEELALVKQLEASSPENIDSMDETEEEDLSIVTKSANPTEGKLVIVIQYFKDL
                     DNRHGISFLFNLLPNENCLQTWDRLHAKFGLGHKEFSKIKLGITVSSEAGLTFKSFQN
                     FTDQELSEIILFDVLNNLDYICMDHPDRTRTQTYHDRPMVIKN"
     gene            <831234..>833657
                     /locus_tag="KLTH0B09966g"
                     /db_xref="GeneID:8291064"
     mRNA            <831234..>833657
                     /locus_tag="KLTH0B09966g"
                     /product="KLTH0B09966p"
                     /transcript_id="XM_002552174.1"
                     /db_xref="GeneID:8291064"
     CDS             831234..833657
                     /locus_tag="KLTH0B09966g"
                     /note="similar to uniprot|P32843 Saccharomyces cerevisiae
                     YMR302C PRP12 Integral inner mitochondrial membrane
                     protein with similarity to exonucleases"
                     /codon_start=1
                     /product="KLTH0B09966p"
                     /protein_id="XP_002552220.1"
                     /db_xref="GeneID:8291064"
                     /db_xref="GOA:C5DDC1"
                     /db_xref="InterPro:IPR000504"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="InterPro:IPR018850"
                     /db_xref="UniProtKB/TrEMBL:C5DDC1"
                     /translation="MLALLSRSLRPVRYGRVKPNILLPLKRQVSTEIQEKDEQAGEST
                     TATDTGVIHKTEEETLIYFDNVYPRATSLWSPTQWYNILLTNQSRDAVRSKIMEFASP
                     PRNPIHGLELRSTIPVKRDGGVFATFLVPRDYSKAQVNSIIQQNTAKESSKSILSFVT
                     RAAAFPVKGSPWIEDLRRLPSTVIKIKFEGQPLTEEEIYSLFRRYGTILDIYPSKKGD
                     TVATLRYRSYRGAICAKNCVSGMEVHNSTIHVQYQRLADEHMIRDFFVNHQRIAIPLM
                     IALLSIVAVLVFDPIREFSVRQKITHRFAFSRENYLIKELFKLTSFTVSSFKSLIGSE
                     NVETNKKQLWEERIEKVSDLKMWLEENNNTFVIVRGPRGSGKHDLVIQHTLHDRPNVL
                     YLDCDKLIKSRTDSKFLMNAAAEIGYFPIFPWINSFTNVVDLAVQGLTGQKTGLSESK
                     ETQFRNMLTTALMAIRQVALKGYHPIVGRGDDAITMKEEDYLQQHPEKKPVIVIDRFN
                     DKAEMNGFAYKELSDWAAMLVQMNIAHVIFLTETVSPNQLLADSLPNQVFKTLILSDA
                     SKESARSYVLASLDHTEPLDDDQEKSKPIILSDDIKRELDESLEPLGGRMLDLQAFVR
                     RVKSGENPKEALDKMVEQALEQITQIFLAENVDQVKSAQAWELIEMLSKEPVVEFKNV
                     VFRPLFKSAPEAGLLELEKNGLITVSRDRGVLKDIRPAKPLYRAAFGYLLNDSELFTV
                     LETGYLLRIINFETKRIQKWEEELKSLGKVSEHRMFKSRLLYLAAKIDASSDSINKCE
                     DKIKALARS"
     gene            complement(833923..834025)
                     /locus_tag="KLTH0B09988r"
                     /db_xref="GeneID:8291065"
     tRNA            complement(join(833923..833966,833989..834025))
                     /locus_tag="KLTH0B09988r"
                     /product="tRNA-Leu"
                     /note="tRNA-Leu (CAG) cove"
                     /db_xref="GeneID:8291065"
     repeat_region   complement(834084..834345)
                     /rpt_type=long_terminal_repeat
     gene            <835039..>838875
                     /locus_tag="KLTH0B10032g"
                     /db_xref="GeneID:8291067"
     mRNA            <835039..>838875
                     /locus_tag="KLTH0B10032g"
                     /product="KLTH0B10032p"
                     /transcript_id="XM_002552175.1"
                     /db_xref="GeneID:8291067"
     CDS             835039..838875
                     /locus_tag="KLTH0B10032g"
                     /note="highly similar to uniprot|P28273 YKL215C
                     Saccharomyces cerevisiae Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B10032p"
                     /protein_id="XP_002552221.1"
                     /db_xref="GeneID:8291067"
                     /db_xref="GOA:C5DDC2"
                     /db_xref="InterPro:IPR002821"
                     /db_xref="InterPro:IPR003692"
                     /db_xref="InterPro:IPR008040"
                     /db_xref="UniProtKB/TrEMBL:C5DDC2"
                     /translation="MSKIRIAIDRGGTFTDCIGNPGTGKPQDDVVIKLLSVDPKNYPD
                     APLEGIRRLLEIFQKKKISRGVPLDLSDVESLRMGTTLATNCALERNGERCVFVTTKG
                     FKDCLLIGDQTRPRIFELAIKRPDPLYDVVIEVDERVTLEDFSEDPENVKSQPSANEG
                     VIVGKSGEIVRVLRKPDISTLRTALEAAFAQGIRSVGIALLHSYTFPEHEELVAALAS
                     EIGFTHVSLSSQVSPMIKYLPRANSAIADAYLTPVIQKYLSGMQAGLINTDNTNIQFM
                     QSDGGLVEGSKFSGLKSILSGPAGGVVGYSATCYDPVTKIPLVGFDMGGTSTDVSRYG
                     DGKLDHVFETTTAGIVIQSPQLDINTVAAGGSSRLFWENGLFRVGPESATADPGPAAY
                     RKGGPLTITDANLLLGRLVPEFFPKIFGPNEDESLDMDITKKKFEELAETINRDLGTR
                     FSTDQVAYGFIKVANESMARPIRSLTEAKGHVISSHQMVTFGGAGGQHAVAVAESLGI
                     DTVIAHRYSSILSAYGMFLADVVEETQEPCSLVLENTSTCIKVEERFEAMTGKATDSL
                     LKQGFSEKDLSFEKYLNLRYEGTETSLMVLKDKSSWKFSQDFAKAHKREFGFIFSDRN
                     IIVDDIRIRAVAKSPVRSQTSIEEELARSLISEIDVEKEVAFYKDVFFDDRRMKTPVF
                     QIDNMPVGSRIKGPCILADGTQTNIIPCNATATILSSHIVIKITSRSQESDTKLENRV
                     DPVLLSIFSHRFMDIAEQMGNQLRKTSVSTNVKERLDFSCALFDPEGNLVANAPHVPV
                     HLGSMSTCISAQAKLWKNKLKPGDVLVTNHPEMGGTHLPDITVITPAFSETSGKIIFY
                     VASRAHHADIGGILPGSVPPNSKELYEEGAAIYSELLVKEGRFDEELVIKLLVDDPAQ
                     YPGCSGSRKISDNMSDLKAQIAANNKGVQLIAKLMTDFGFDVIVKYMLAIQENASFTV
                     KQVLKRMTEHFGATEFAGEDYMDDGTVIKLRVTLDTKKEEYVFDFEGTSPQVYGNLNA
                     PEAITNSAILYCLRCLVNEEIPLNQGCLKPITVKIPKGSILSPTKGVAVVGGNVLTSQ
                     RVTDVVLKTFKVMADSQGDCNNFTFGTGGKDSNGKVSSGFGYYETICGGHGAGGDSWR
                     GPGWNGAHAVHTNMTNTRMTDVEIFERRYPVILREFSIRAGSGGKGKFAGGNGVVRDI
                     LFRKAVQASILSERRVVPPHGFDGGEDGERGLNLWIRGSSGAVINIGAKNTISAQPGD
                     RVIIMTPGGGGWGLPE"
     gene            complement(<839166..>840677)
                     /locus_tag="KLTH0B10054g"
                     /db_xref="GeneID:8291068"
     mRNA            complement(<839166..>840677)
                     /locus_tag="KLTH0B10054g"
                     /product="KLTH0B10054p"
                     /transcript_id="XM_002552176.1"
                     /db_xref="GeneID:8291068"
     CDS             complement(839166..840677)
                     /locus_tag="KLTH0B10054g"
                     /note="weakly similar to uniprot|P53322 Saccharomyces
                     cerevisiae YGR260W TNA1 High affinity nicotinic acid
                     plasma membrane permease"
                     /codon_start=1
                     /product="KLTH0B10054p"
                     /protein_id="XP_002552222.1"
                     /db_xref="GeneID:8291068"
                     /db_xref="GOA:C5DDC3"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DDC3"
                     /translation="MAIGLVKTVQMETTHSVATKDPIKVSIHDDAELSEELAEHVIEE
                     EYYIDPQDESALTRKLDTRLLPMLAFMYFLSALDRSNIGNAYTSGMKEDLRLTSHQYS
                     NAVSVFYSTYLAAELPAVWLLKIAKPRYYMSILVFCWSVITLSSGFVKSYHSLLATRI
                     LLGTFEGGFFPAMTLLITMMYKPKEQAKRIAFFFGSSALSGAFGGLIATGLASVNNAG
                     GLEGWRWLYIIEGLISVCASFWLFFGLPDNLDKMKFLNERELSLMQIREKQRIQYMGA
                     DPAFSWGQVWLAFKDFKTYFAFVIQFCQDIILYGFSTFLTAILKLGLGYSSREAQYMS
                     VPVYILAAIVFMVSAYVSDRLQVRGPVFFCYNILGATGYIILLAVDNNAVKYFACYLI
                     TFSLYTGTGLNITWLTNNVAPHYKRATALGLNQTLGNLSGAIVGQVYTKSPYVFGNSF
                     SLGCIVLSNILTAVQIAWLVKLNKDKAAILAGTKKDTKKERIGDEALDFKYCL"
     gene            <841024..>843090
                     /locus_tag="KLTH0B10076g"
                     /db_xref="GeneID:8291069"
     mRNA            <841024..>843090
                     /locus_tag="KLTH0B10076g"
                     /product="KLTH0B10076p"
                     /transcript_id="XM_002552177.1"
                     /db_xref="GeneID:8291069"
     CDS             841024..843090
                     /locus_tag="KLTH0B10076g"
                     /note="some similarities with uniprot|P25502 Saccharomyces
                     cerevisiae YKL015W PUT3 Positive regulator of PUT (proline
                     utilization) genes zinc-finger transcription factor of the
                     Zn(2)-Cys(6) binuclear cluster domain type"
                     /codon_start=1
                     /product="KLTH0B10076p"
                     /protein_id="XP_002552223.1"
                     /db_xref="GeneID:8291069"
                     /db_xref="GOA:C5DDC4"
                     /db_xref="InterPro:IPR001138"
                     /db_xref="InterPro:IPR007219"
                     /db_xref="UniProtKB/TrEMBL:C5DDC4"
                     /translation="MPRKKMMKACIKCKQRKKKCSGQLPCDYCVKIEQPGGCEYRTRT
                     KSKVVKVTERYISSLKNKIRALEAELAKASEGPDSEGCLEDGATSAEVNPLIEPEFRL
                     TPDLDSPKQESLTIGSVEHCVQASQHSKQFLGMSSCVQYLAKLKQSLVNSCGSSTEHF
                     VATDGGWPPNDLDINRSFVENVATKELPDLRKAKELIEIAHEIIGADYMFLETGYFED
                     TAQHLICKNPPPLQSEAIIEYTTELLRLVAHLALGSLFDKENAESRSLGLKYHRTTLL
                     LYSELVKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTMFTLGLHKRTK
                     TIVENRVFWLCFIYDRLLAVRFGFPLMIDERNINIPLLTEVDDNLTAVSLDIYHFVSQ
                     VRLAKITTQIITKIYTRNPYSFLHNCHAVLKQLKNWFESLPAELKFDYNDIKTATTRS
                     TFNLHINYNYSIIIATRPVLLYVFNSILTENRTKEKIYEARQLELISVLLESCVQAAE
                     IQSRILAKLYYDGKLANRSFLDCHYIFSATTVLILTGYCSMLSGESIAFSGDIEGLFD
                     FIQHNLKILQGLSEYNLAAKNFNKQLTELIDMMSSDEVVKALATGRSQNDPTSVDFQQ
                     AVASPRPMSRILRKRGNNPPKDFEEIGYVDLSQLVNNMDAEFRSGSTTDLFLDEDFMN
                     YASGSL"
     gene            complement(<843319..>844122)
                     /locus_tag="KLTH0B10098g"
                     /db_xref="GeneID:8291070"
     mRNA            complement(<843319..>844122)
                     /locus_tag="KLTH0B10098g"
                     /product="KLTH0B10098p"
                     /transcript_id="XM_002552178.1"
                     /db_xref="GeneID:8291070"
     CDS             complement(843319..844122)
                     /locus_tag="KLTH0B10098g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B10098p"
                     /protein_id="XP_002552224.1"
                     /db_xref="GeneID:8291070"
                     /db_xref="InterPro:IPR009906"
                     /db_xref="UniProtKB/TrEMBL:C5DDC5"
                     /translation="MSNPESFRELCRKEIHTGPTSGVLPGYIQANLLILPKCVAESFE
                     DLCTRNPVACPILSKTEGGPQFLRNHASLIKQGTFDIRTDFPRYNVYSRGKLVQQKNN
                     CVNEWSSDHVGFLIGCSFTFEHALEKAGLVPKNVLYNKNVSMFRTTKFLDSAGIFHQC
                     PYVVSMRPYKLTEVEIVREITRKFKKTHGEPLDWGYDGAKRLGIEDLQKPDYGDPIDI
                     GEQEIPMFWACGVTPQLAVTTVGDRIEGSVIGHTPGHMLILDATDVDWC"
     gene            complement(<847376..>849082)
                     /locus_tag="KLTH0B10142g"
                     /db_xref="GeneID:8291072"
     mRNA            complement(<847376..>849082)
                     /locus_tag="KLTH0B10142g"
                     /product="KLTH0B10142p"
                     /transcript_id="XM_002552179.1"
                     /db_xref="GeneID:8291072"
     CDS             complement(847376..849082)
                     /locus_tag="KLTH0B10142g"
                     /note="similar to uniprot|P36172 Saccharomyces cerevisiae
                     YKR105C Hypothetical ORF"
                     /codon_start=1
                     /product="KLTH0B10142p"
                     /protein_id="XP_002552225.1"
                     /db_xref="GeneID:8291072"
                     /db_xref="GOA:C5DDC6"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DDC6"
                     /translation="MSDIETGIHSDRDRKISGESDDLSLKHKRCITLDRPKINKVKLF
                     LSLFSLGLSMFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARL
                     SAVLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQL
                     VDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAIAIFVFF
                     YNPEGVNLLEKFGNTFKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAGWLLFLLA
                     LTFGGQTHAWNSGIVISFIIIGVLLIAISLVYDFKVFEQIKTQDSFRPLLSWEIMSNR
                     SILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFSIASGI
                     LTKKTGHIKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQIGVLILPGVALGFVLPSALI
                     ACHVQLDKGNPSYGADLLETTSVNALLKSLGTTLGSILSTMVFSTSMNNKMKHGGLSL
                     EEYDRLDGIASYRMDHFDGPRSEMGYILSDSIKNAFWMALGSSAIAFLCSIFVSKRKI
                     AM"
     gene            complement(<852039..>852989)
                     /locus_tag="KLTH0B10164g"
                     /db_xref="GeneID:8291073"
     mRNA            complement(<852039..>852989)
                     /locus_tag="KLTH0B10164g"
                     /product="KLTH0B10164p"
                     /transcript_id="XM_002552180.1"
                     /db_xref="GeneID:8291073"
     CDS             complement(852039..852989)
                     /locus_tag="KLTH0B10164g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B10164p"
                     /protein_id="XP_002552226.1"
                     /db_xref="GeneID:8291073"
                     /db_xref="InterPro:IPR009078"
                     /db_xref="UniProtKB/TrEMBL:C5DDC7"
                     /translation="MMFAAFSPSKIAMYRFFVFGLSFLAIAASFPLYKRADLDVDILQ
                     FALTLERLENKFYKEALSMWSVDDFVDANFTEDFYTQLKYIAHDEEAHLLFLEQVIKA
                     AGAEPVQACTYNLPLDSPVSFVQSIAAFEGVGVSAYLGAASLISSKKYLTAAGSILST
                     EAIHQAAARNAIGEIPMANPFATPLSANAIYSIASKFIKSCPANNTKLPFKAYPELLV
                     TQGLPTAMNSSITFASNGTLPNSTQIYVTFVSGLDVIPVVGSRNGSSIRATVPEDVSG
                     QSYVFLTTGNSSNLTDSNILYGPAIIEVTPSSPTFNVSIF"
     gene            <855907..>857637
                     /locus_tag="KLTH0B10186g"
                     /db_xref="GeneID:8291074"
     mRNA            <855907..>857637
                     /locus_tag="KLTH0B10186g"
                     /product="KLTH0B10186p"
                     /transcript_id="XM_002552181.1"
                     /db_xref="GeneID:8291074"
     CDS             855907..857637
                     /locus_tag="KLTH0B10186g"
                     /note="highly similar to uniprot|P38361 Saccharomyces
                     cerevisiae YBR296C PHO89 Na+/Pi cotransporter active in
                     early growth phase"
                     /codon_start=1
                     /product="KLTH0B10186p"
                     /protein_id="XP_002552227.1"
                     /db_xref="GeneID:8291074"
                     /db_xref="GOA:C5DDC8"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="UniProtKB/TrEMBL:C5DDC8"
                     /translation="MTLHQFDYIFAIAMLFAFLDAFNIGANDVANSFASAISSKSLKY
                     WQAMILAGLCEFLGAVLAGSRVSKTIKNDIIDASTFNNDPAVLMLTMTCALVGSSCWL
                     TIATSIGLPVSNTHSIVGGTIGAGIAASGAGGVVWGWDGVAQIIASWFIAPVLAGLIA
                     AIIFTISRICVLEVKTLEKSIKNALLLVGLLVFATFSILTMLIVWKGSPNLHLDNLSE
                     TETALSIVLTGAIASVVYFIFFYPFYRRKLLHQDWTLKLADILRGPVFYFKPLDEIPP
                     MPENHQLTIDYYEGRRFPQETAVGVSDEENKMPNVSTKSINDNDDNLQRTGSVETKTE
                     PENKMSTRQYWWSLLKQGPKQWPKLLWLVVSHGWTQDVVSAQVNDKDMLSGNLVDMFK
                     RSKYYDNRVEYIYSVLQAITAATMSFAHGANDVANATGPLAVVYEIWKTNATAAKSDV
                     PVWVLAYGGAALVLGCWTYGYNIIKNLGNKIILQSPSRGFSIELAAAITTVMATQLAI
                     PTSTTQIAVGGIVAVGLCNKDVKSVNWKMVAWCYSGWFLTLPIAGLIAGILNGIILNA
                     PHFGGVYEMT"
     gene            <861584..>862198
                     /locus_tag="KLTH0B10230g"
                     /db_xref="GeneID:8291076"
     mRNA            <861584..>862198
                     /locus_tag="KLTH0B10230g"
                     /product="KLTH0B10230p"
                     /transcript_id="XM_002552182.1"
                     /db_xref="GeneID:8291076"
     CDS             861584..862198
                     /locus_tag="KLTH0B10230g"
                     /note="some similarities with uniprot|P36034 Saccharomyces
                     cerevisiae YKL219W COS9 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="KLTH0B10230p"
                     /protein_id="XP_002552228.1"
                     /db_xref="GeneID:8291076"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DDC9"
                     /translation="MKGERAEEHLIQTPHVDDQNLRLPRDTFPNRFLYEISRHRTFVI
                     AVSSELILYAFSIYRGLTSKDRDIGFLIALFMIVLGSTGIILTGIITICLLNDCGTDP
                     SNTLHFMKEIVAVGLQMEMREWDIIAARMNRVFYLNNSWATPYFFYDGEACHSFFKNY
                     YLKHYSRGEKTSGTNTYGLEEFQPFVDQAVEAYKKSETRMCSPF"
     gene            <863070..>863741
                     /locus_tag="KLTH0B10252g"
                     /db_xref="GeneID:8291077"
     mRNA            <863070..>863741
                     /locus_tag="KLTH0B10252g"
                     /product="KLTH0B10252p"
                     /transcript_id="XM_002552183.1"
                     /db_xref="GeneID:8291077"
     CDS             863070..863741
                     /locus_tag="KLTH0B10252g"
                     /note="some similarities with uniprot|P36034 Saccharomyces
                     cerevisiae YKL219W COS9 Protein of unknown function member
                     of a family of conserved often subtelomerically-encoded
                     proteins"
                     /codon_start=1
                     /product="KLTH0B10252p"
                     /protein_id="XP_002552229.1"
                     /db_xref="GeneID:8291077"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DDD0"
                     /translation="MMREERVEEYSLHASQEDDQSLTLPRDIYPNKFLYQISRHRAPL
                     FATSLELVLCTLLIRYFMKKNDSSARFEAVSSVVSFGLPLGLSLFSGMVHLVHNCGKA
                     PVNRVRFMEEIIAVEPGTETRKWDSIAARLNAIFYSNNSLATPHFFYDGNACYFYFRL
                     HYVRPLFEKKESSYAFREFPDEFKALIHQAMEAYKKGLDKDWQRLLNTGSSLGIRAST
                     SEKMT"
     gene            <865279..>865761
                     /locus_tag="KLTH0B10274g"
                     /db_xref="GeneID:8291078"
     mRNA            <865279..>865761
                     /locus_tag="KLTH0B10274g"
                     /product="KLTH0B10274p"
                     /transcript_id="XM_002552184.1"
                     /db_xref="GeneID:8291078"
     CDS             865279..865761
                     /locus_tag="KLTH0B10274g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B10274p"
                     /protein_id="XP_002552230.1"
                     /db_xref="GeneID:8291078"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DDD1"
                     /translation="MARKFISGDDLAAIRIFIVSLGMAGTAITGAIIEGRVESVILMP
                     SNKVQFMKEIAILGPGLEMKKGGVVAAKMNPVLHKSSLLATPYYFYDGESCYSCFRNE
                     YLHPYLRRKNTNDTQAYIVDEFKPFVDQVLKSYEESLNKDLQHMLEEEISVESQHIKL
                     "
     gene            <867082..>867360
                     /locus_tag="KLTH0B10296g"
                     /db_xref="GeneID:8291079"
     mRNA            <867082..>867360
                     /locus_tag="KLTH0B10296g"
                     /product="KLTH0B10296p"
                     /transcript_id="XM_002552185.1"
                     /db_xref="GeneID:8291079"
     CDS             867082..867360
                     /locus_tag="KLTH0B10296g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B10296p"
                     /protein_id="XP_002552231.1"
                     /db_xref="GeneID:8291079"
                     /db_xref="InterPro:IPR001142"
                     /db_xref="UniProtKB/TrEMBL:C5DDD2"
                     /translation="MVKPGIDMRKWDFIAAKMNANLYQNNSLISPYYYYNGEACYCFF
                     KAKYLLPHLERKGANSTGEMPLYDLEPFYGQILDAYEERTKKEWQHIL"
     gene            <869187..>873833
                     /locus_tag="KLTH0B10318g"
                     /db_xref="GeneID:8291080"
     mRNA            <869187..>873833
                     /locus_tag="KLTH0B10318g"
                     /product="KLTH0B10318p"
                     /transcript_id="XM_002552186.1"
                     /db_xref="GeneID:8291080"
     CDS             869187..873833
                     /locus_tag="KLTH0B10318g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B10318p"
                     /protein_id="XP_002552232.1"
                     /db_xref="GeneID:8291080"
                     /db_xref="GOA:C5DDD3"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDD3"
                     /translation="MEKISDRFAAIDGFLVKKDKSGLRRIVNTISTTFKPNKQEARCI
                     EKLQLRNLALYFDCKDDLLPHDCPLLFKTVSSKRKLFYHTEDGIKVVKSGKTSSRDMR
                     RAIEHAVIEIPLSGSQKKYLVDCQDGIDQRLWREGRAMAPLQNSNNSHITRTLACDTL
                     LFTPQDYALLRSFALEKVLYEAESISIFEHCHRKALQNLEEKGQGDLLEEKITGKQFH
                     LLLQKNTVRAYGRIMSSLYFILVNFHRLSLSTRVADPAINRALLLDSIGCSYNVESKA
                     SHLQEIMCIMLKNTDHASLLQLLARMLPFNLEGYVDKNQTLGYYETEEICERLVAMRT
                     WVKYVALSAKTGDEEVIFLENDPASTWGVLSSYYREIARESKKLDLATLRFISRDIVC
                     VSGKTFGRCYIRDFYSGLEQRFDALWMQLNKYYSVRSIQAVEELLFYDESMSLSEGKS
                     CPYFSFENVFPMDVRRSLLPRGRKALTEAEQRVVLDTIEEMTRAVMWITWLAAGTPYA
                     FAELQDLAYAGERRNVYVDEDFRRIKLATCYNQNGDILYLVKWLDSHTSSYLAFLILV
                     ISKIQLELLNEMRSIFDHPRHNEMRHSAANIRSSKYTTPMKKTCKALLSEFLFVDASQ
                     AKLVSEKRFQEVCKEYPKRTAPLERLNFPQLRQGMTALVQRKLEGHRSQAGAAHPSTS
                     AYLADHWPKMGTGMYGLDSLLLESLQGPTAYMTQRELSEQWNLSMDLGVNTEDEPQST
                     GNTLKGGLQRAGLVPDDLFLAGRMLYGEQFAFRNTDQTFACISAYMSDEKVIAVQAPT
                     GFGKTLVFQLPLICYAMKKLQTVSFVFVPDAALVAATTHRLRSKSCLRVGSVEFLIHK
                     GLVGDDPFQDVYVGTFSDAIDHRLIELMKHWKEQFPETQLGLLVFDEFQNLPDVESYC
                     KTPLHLPKDIDIEQFQRLILTTATGSQGSSEKALRELGLKGRLEIQPVWGDSEGDTCF
                     VTAPIRFRNYIREPALAHVYKHAILMEGDGTGQVMVLLRRLFEKDSKAKVAIVLGQEA
                     NTGSLFNRVAKEFTSVCVGKELDKTEKAMKMQSFLLDKNVQVLMGPKLAVEGIDVAEL
                     RMVILLDYQPSVGEYIQCAGRVRNSGVSIALWRKAPQRGNNDLSSIDYSRCFTSQICE
                     FYELPQQVHAGCCKHFDSVSEETRDIFEYVAIELEPADTQQKRKHTDGSPHSSKRLCS
                     PHNPEVPGSRPTTNLELQATDKSQQLTKAERLEISCRGCRDIFEYFEFSDDRRRDLLM
                     EGLDERYFGNISIFNVNSELECRWCLEPKRGCCCWPESPACEDMSLKKLAMQALAFLG
                     CFLTPKGYTEEVAFCENYGVATWMMLLETRIKKEVFTRYYTAYKDYHDLVRRRMEYFY
                     GYEGDRYIDDYNEMWRMLQKKELIVYFSTRKIQECPMGGCCADCVKIAVEDDDPPWCR
                     DYPISKGYLQAQMESTDEDAYLCSENMAMRLRGSPPVLGFHYKLMQFVLFHNKDFRDA
                     IWERFPQLPQVGMFTHWLRLMKTEWIFDGVPVPLYAVVGAIFYRQNPYYLHDAL"
     gene            <874656..>875879
                     /locus_tag="KLTH0B10340g"
                     /db_xref="GeneID:8291081"
     mRNA            <874656..>875879
                     /locus_tag="KLTH0B10340g"
                     /product="KLTH0B10340p"
                     /transcript_id="XM_002552187.1"
                     /db_xref="GeneID:8291081"
     CDS             874656..875879
                     /locus_tag="KLTH0B10340g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B10340p"
                     /protein_id="XP_002552233.1"
                     /db_xref="GeneID:8291081"
                     /db_xref="GOA:C5DDD4"
                     /db_xref="InterPro:IPR009486"
                     /db_xref="UniProtKB/TrEMBL:C5DDD4"
                     /translation="MSIVWVGAIRKNAQQDIMLKKLCLGLLALATTTLCESISRDVTT
                     TTVIAAVSSSSSSLTVATPGTPVSPKVLLIANEFEFGYLDAYNFTTQYTGVLFDQTFA
                     CTEDGAICKLECGQELVSASQITALMMIPGVDLKKTYVIITGTGGVNPKYGTAGGAAI
                     STFGIQWEWGSMFLGDDLPANFSGQYFASYAQLSPDKYPVTVGSEVYKLNEALVDRFY
                     ATGSKVTYEDVSETSQGLRATYEYDAAKQDPFLARCDTVSAQVYWHGNVAGENVEYYS
                     NVITNGQARPCNTNEDDQGRLLALFLGAVHHMVDFGRVSMIKAFSNFDRPPPQLSAYQ
                     SRFYVGEGATEPGLRNAWKSIIVIVDDVLENWDSVFDAGIKPNTYMGDIKGTLGGVCD
                     FNSTASAAKGSVQGS"
     gene            876403..876512
                     /locus_tag="KLTH0B10362r"
                     /db_xref="GeneID:8291082"
     tRNA            join(876403..876438,876477..876512)
                     /locus_tag="KLTH0B10362r"
                     /product="tRNA-Pro"
                     /note="tRNA-Pro (TGG) cove"
                     /db_xref="GeneID:8291082"
     gene            complement(<877070..>878725)
                     /locus_tag="KLTH0B10384g"
                     /db_xref="GeneID:8291083"
     mRNA            complement(<877070..>878725)
                     /locus_tag="KLTH0B10384g"
                     /product="KLTH0B10384p"
                     /transcript_id="XM_002552188.1"
                     /db_xref="GeneID:8291083"
     CDS             complement(877070..878725)
                     /locus_tag="KLTH0B10384g"
                     /note="similar to uniprot|P15365 Saccharomyces cerevisiae
                     YJR152W DAL5 Allantoin permease ureidosuccinate permease
                     expression is constitutive but sensitive to nitrogen
                     catabolite repression"
                     /codon_start=1
                     /product="KLTH0B10384p"
                     /protein_id="XP_002552234.1"
                     /db_xref="GeneID:8291083"
                     /db_xref="GOA:C5DDD5"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DDD5"
                     /translation="MHILIKLKIPTLAAISKNCINWTFVFHFYPQQSSPSSFPLTRFH
                     TTMSSTKQEGEVVTSVLSSEQAAELYDVKSRDLAMEKADEAAQLEVDPSSNRRLVWKI
                     DLILLTVISLVSAFQYMDKSSSNYASVMGIKTDLKMVGNQYSWVGTSFYLGFLVFEAP
                     CSWTLQRLPLSKITSAYIIAWGLLLCLTSLVKSYPTFILTRTLLGVLESSITPAMVLF
                     MSQWYKKDEQFFRTSILIACNAVGGLVGASVSYRLYERQLAGTLSMDAWRILFIIVGL
                     ITIVTGLMVLFIIPDTPSQAWWLNKTEKLLAIQRIRSNKQGFGNRHFKKEQVYEALVD
                     PRLYLYFFLQVAVAIPNGGFSNFSALMIAGLGYGKGKALLMGMPTSAVSIIGMILFGY
                     LSTIRNRRLDIAFAGLALNLISGCLMAFAKPLHAQLAGYYIFGISPIPYTCILSMVAS
                     NSAGHSKKVFMGAISMIGYCTGNLIGPQTFRESQAPHYQGAKTAIVACYCIAFLILAA
                     IYIVNVRENKRRDALDERLPADMLNSEFADLTDFQNPEFRYAI"
     repeat_region   879953..880369
                     /rpt_type=long_terminal_repeat
     gene            <881360..>885136
                     /locus_tag="KLTH0B10428g"
                     /db_xref="GeneID:8291085"
     mRNA            <881360..>885136
                     /locus_tag="KLTH0B10428g"
                     /product="KLTH0B10428p"
                     /transcript_id="XM_002552189.1"
                     /db_xref="GeneID:8291085"
     CDS             881360..885136
                     /locus_tag="KLTH0B10428g"
                     /note="no similarity"
                     /codon_start=1
                     /product="KLTH0B10428p"
                     /protein_id="XP_002552235.1"
                     /db_xref="GeneID:8291085"
                     /db_xref="GOA:C5DDD6"
                     /db_xref="InterPro:IPR001650"
                     /db_xref="InterPro:IPR011545"
                     /db_xref="InterPro:IPR014001"
                     /db_xref="InterPro:IPR027417"
                     /db_xref="UniProtKB/TrEMBL:C5DDD6"
                     /translation="MEKISDRFAAIHGFLIKTDRDGTKRITCPNISSLKPTKKEVQRI
                     LELKLQNLAVYLGMKEDLIYVDCPLLFETVTSEQRYFYSTEDGMKAVRSGRTNSANTR
                     RSIEYRVLPITLPNKTRKYLCQTGKKLPEMPLEHEIATLHQESEAKTATVPQASEDLD
                     VFHTLHCDKLVFTNRDRRLFRSFAMDRTLYEVESVAILKHCHREAISKTTKTNSFGEP
                     LVTKYKLETLEIHGKHAGVLLFLIANLHQLSLGQQVERPTVDSELLLDRIGELHNTEA
                     KAAHLQQLLYIVLKEERYMDLANLFTRLLLFRLSAHFDIRKDLEVEEMETVRERMSAT
                     GVWIKCVIISEKSEDQLNIFQEESHNIWSKFTTLYHKVAKESDQTMTMNINRVPPDCI
                     RVYGKTFGREYIKSFYSDMQYEFDQQWSKLDRVLTMTPVESTGKMLLENYRIPWAGHG
                     YRANFSLKDMFPQWIHDQVSPSMRQPLTQLDKREVLGAIDKMTVALMWMIWLAAGVPY
                     TFSELQVLACGGDQQNIYVDSERRCVQIITRSFKKGNLKEDFKWLDKRTSYYLVYYVT
                     VLRKTQISVLGENYEAFEPPKEGEVDLEGIWEHIEGKCNMSKKEASALIMDQYLFLDA
                     KLGQLMSRRRFLKPSEEHPNYVASPERLSFKQLKFGRMGLLRQYLASSLNDSKPVKTA
                     RIDLAMCRFAASSARDYMDELGDSEDVDDPDAMGDLEVLEESMWQCEQSERFMTRTWH
                     EEIAKQWIRWVGLDEEEEIHHPLTYSVGEIVLQKEALCPDDLVHAGRELYGKSFTFRN
                     SDQYLACVNAYLSNKKIIAVQAPPGLGKTLVFQLPLMCYTMRKLSLVSFVFVPFVGLL
                     AGTMCRLEASGNLRVGSVEKLLNETRCKENSLLDVYVGTFNDAAAEDFIKMINFWSLL
                     YPEKKLGLLAFDEFQNLYDEKSHSEVSFPSLKRVQFGRFRRIILTSATCEQGSAQGAL
                     QELGFRGREGTNFTWERSQAGRSVDVPIFLRNYVQEPAVMHVYKHALRMRGNGVGQVK
                     QFLRSLFAYDPDAKAALVVGENVATTELFTEVSQEFSAAYVHSDLTTEEKLKRVQSFI
                     KDKSLQLLIGTKQVVEGLDIEGLRMVILLDYYPRVAEYIQCVGRVRGSGTCIALWQDP
                     PPQVENDQPRVDYDKCFTSQICKYYELPQRVHAGCCGSFESVTEEAKSLFHRVVLEEE
                     VNDVCSQKTTRDEDSEQGRERKIARTDVIASADDSNEVSGVNKRPQDDTAITKA"
     gene            complement(<885429..>887291)
                     /locus_tag="KLTH0B10450g"
                     /db_xref="GeneID:8291086"
     mRNA            complement(<885429..>887291)
                     /locus_tag="KLTH0B10450g"
                     /product="KLTH0B10450p"
                     /transcript_id="XM_002552190.1"
                     /db_xref="GeneID:8291086"
     CDS             complement(885429..887291)
                     /locus_tag="KLTH0B10450g"
                     /note="similar to uniprot|P38724 Saccharomyces cerevisiae
                     YHL047C ARN2 Transporter member of the ARN family of
                     transporters that specifically recognize siderophore-iron
                     chelates responsible for uptake of iron bound to the
                     siderophore triacetylfusarinine C"
                     /codon_start=1
                     /product="KLTH0B10450p"
                     /protein_id="XP_002552236.1"
                     /db_xref="GeneID:8291086"
                     /db_xref="GOA:C5DDD7"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="UniProtKB/TrEMBL:C5DDD7"
                     /translation="MPEYQQGGPSLGSESTPNENYGKANVVQTEKEFSHDSKNEPELG
                     DKLQITKRIVIRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMND
                     YQTHSLLSTVSVISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDV
                     QRYAAGSIFYYIGLVGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHV
                     ANPEKNWSWGIAMWAFIFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLV
                     QTLKQLFWKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLVPFF
                     IYWESKLALVPLAPFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLS
                     ATRITSLYSFVAAVFSPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGK
                     GVIGAMVVWGITSCFFNYPINISMQTVTSHENMATVTAFGLTIFRIGGAVGAAVSGAI
                     WTQSLYPRLLKALGDPTLALEAYNMPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVG
                     LIFVAPMFLLTFFLRDPPLTEDYGQKLEDDEYVKHDDPITDWIAERFSSFKKHE"
     gene            <888176..>889927
                     /locus_tag="KLTH0B10472g"
                     /db_xref="GeneID:8291087"
     mRNA            <888176..>889927
                     /locus_tag="KLTH0B10472g"
                     /product="KLTH0B10472p"
                     /transcript_id="XM_002552191.1"
                     /db_xref="GeneID:8291087"
     CDS             888176..889927
                     /locus_tag="KLTH0B10472g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B10472p"
                     /protein_id="XP_002552237.1"
                     /db_xref="GeneID:8291087"
                     /db_xref="GOA:C5DDD8"
                     /db_xref="InterPro:IPR000120"
                     /db_xref="InterPro:IPR023631"
                     /db_xref="UniProtKB/TrEMBL:C5DDD8"
                     /translation="MKIQSVCVLFLVLCLVEPSSLNQSRRKYASKSQTLFQTANTTTH
                     LSSQIESDGLLLINSRSNVSLGYATIDQLQDYLSNGSLSSQDLVRYYLQRFQQLNPHV
                     KGILQLNPDALKIAKERDEERTQGLVRGPLHGIPFLVKDNYATKDKMETTCGSWSLLG
                     SVVPRDAFVVAKLRDAGAVLLGHTTLSEWADMRSSCYSEGYSARGGQARCPFDLSVSP
                     GGSSSGSAVAVAADMVTFSLGTETDGSIIDPAMKNGIVGFKPTVGLTSRAGVVPESEH
                     QDSTGPMARTVRDAVYAFQYMWGVDERDVYTLNQTGHVPQDGDYVKFLSDKESLKGAR
                     FGIPWQKLWTLAEENEISRLAEVIKMIESAGATIYNNTNFKNLDVVSSSGWDWNMGPA
                     NESEFTVVKVDFFNNIESYLSELENSDMRSLKDIVEYNNRNYETEGGTENTHHAFQSG
                     QDSFMESLSWGGVQNETYWQAVEFVQKTSRGEGIDYALNYTDPETGENFNLDGLLVPS
                     GLPITHQQAAKAGYPMITLPVASKESNGRPFGLGIIQSAWEEPKLIKYGSAIEDLLNY
                     QLKPWSNDNLDKNISTT"
     gene            complement(<890670..>892271)
                     /locus_tag="KLTH0B10494g"
                     /db_xref="GeneID:8291088"
     mRNA            complement(<890670..>892271)
                     /locus_tag="KLTH0B10494g"
                     /product="KLTH0B10494p"
                     /transcript_id="XM_002552192.1"
                     /db_xref="GeneID:8291088"
     CDS             complement(890670..892271)
                     /locus_tag="KLTH0B10494g"
                     /note="conserved hypothetical protein"
                     /codon_start=1
                     /product="KLTH0B10494p"
                     /protein_id="XP_002552238.1"
                     /db_xref="GeneID:8291088"
                     /db_xref="UniProtKB/TrEMBL:C5DDD9"
                     /translation="MKLKCFCTISLAASFVAADWQFKSRPDLSPPILNIAIPANQNTS
                     PGYLFAAPFSGYADNKNHGPRQAAPYIFTDKGELVWSGFSYFSIWATNFQKGRLNGED
                     ILFSFEGSHNPDYGHGHGHVTILDSHYQTIKELRAGRHKIIDKHEFHIIDEKTGLVQI
                     YQPVPRDLTLYAKSEEQQWIVDAIFQEIDIESGEVLFEWRSLDWISPDESILPINEGQ
                     AGSGFNSSDAWDYFHINSVDKNEEGDYLLSARDAAALYKINGTSGEVIWKLGGLPELS
                     SDFKIDFQFSFQHHARFISRNGSKEVISFYDNSAHGTENKDGKTVSYAETSSGKVIEV
                     DNKEFTAHLLREFLPPDGLLSKSQGSTQVLSDGHVIVNWGSKGAVTEYNSKDEAVFHA
                     YFDSDLLGENVENYRAFKFNWIGEPDEDISLYSEISADGEASIYVSWNGDTKTQKWRF
                     FELDEEGEKQIIGATTRKGFETAFKTNKIKLSNKVLVEALGERGEVLGVSDPTLSQKE
                     IIPAGGKKVSTKNSFSNYFEWRMWQ"
CONTIG      join(CU928166.1:1..893706)
//
DBGET integrated database retrieval system